F487375
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 980 | 340 | 1960 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0281896|Ga0496102_0281896_454_1302 |
| Length | 282 |
| Sequence | MGDRRDPTIQSVDRAARILKALAAGSPRLGVSELAERLGLAKTTVHGLLRTLERQDLVEQDSETGKYRLGPEMLQLGNAFLDHHELRGRSLVWADTLAERVGEAVRVGVLYGRRVLVVHHVFRPDDSVQILEVGASVPWHASALGKVHAASLPSDRRRTLVSGPLQRLTGRTIVDPHALALALEEVAAAGFATEAHEAVIGEGEXXXXVFDHRGHPVGAIGVVGPVERLLPAGPTPELIVALTDTAKRLSWEMGARRGRAGTIGHSIPRPGPRAAPRAGVGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 164 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 165 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 166 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 167 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 168 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 199 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 200 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 201 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 202 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 203 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 204 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 205 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 206 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 207 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 208 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 209 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 210 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 333 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 334 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 338 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 339 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 340 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.57 |
| Metatranscriptomes | 1.12 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 5.51 |
| Rhizosphere | 92.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0281896 | 3300048905 | Unclassified | 1566 |
| 2 | Ga0070683_100060765 | 3300005329 | Bacteria | 3512 |
| 3 | Ga0070670_100102969 | 3300005331 | Bacteria | 2459 |
| 4 | Ga0070680_100129875 | 3300005336 | Bacteria | 2107 |
| 5 | Ga0070682_100159670 | 3300005337 | Bacteria | 1556 |
| 6 | Ga0070682_100203147 | 3300005337 | Bacteria | 1399 |
| 7 | Ga0068868_100028993 | 3300005338 | Bacteria | 4237 |
| 8 | Ga0068868_100042560 | 3300005338 | Bacteria | 3546 |
| 9 | Ga0070660_100257304 | 3300005339 | Bacteria | 1425 |
| 10 | Ga0070689_100121780 | 3300005340 | Bacteria | 2084 |
| 11 | Ga0070689_100546938 | 3300005340 | Bacteria | 997 |
| 12 | Ga0070691_10084472 | 3300005341 | Unclassified | 1558 |
| 13 | Ga0070661_100215459 | 3300005344 | Bacteria | 1471 |
| 14 | Ga0070669_100235960 | 3300005353 | Bacteria | 1451 |
| 15 | Ga0070703_10000005 | 3300005406 | Bacteria | 127348 |
| 16 | Ga0070703_10011257 | 3300005406 | Bacteria | 2525 |
| 17 | Ga0070709_10000936 | 3300005434 | Bacteria | 16205 |
| 18 | Ga0070709_10010332 | 3300005434 | Bacteria | 5165 |
| 19 | Ga0070709_10017721 | 3300005434 | Bacteria | 4090 |
| 20 | Ga0070709_10037240 | 3300005434 | Bacteria | 2969 |
| 21 | Ga0070714_100008560 | 3300005435 | Bacteria | 8000 |
| 22 | Ga0070714_100015228 | 3300005435 | Bacteria | 6186 |
| 23 | Ga0070714_100075357 | 3300005435 | Bacteria | 2927 |
| 24 | Ga0070714_100146227 | 3300005435 | Bacteria | 2126 |
| 25 | Ga0070714_100217442 | 3300005435 | Bacteria | 1754 |
| 26 | Ga0070714_100524625 | 3300005435 | Bacteria | 1132 |
| 27 | Ga0070714_100878267 | 3300005435 | Unclassified | 870 |
| 28 | Ga0070713_100002341 | 3300005436 | Bacteria | 12368 |
| 29 | Ga0070713_100020797 | 3300005436 | Bacteria | 5038 |
| 30 | Ga0070713_100030612 | 3300005436 | Bacteria | 4276 |
| 31 | Ga0070713_100101020 | 3300005436 | Bacteria | 2498 |
| 32 | Ga0070713_100120831 | 3300005436 | Bacteria | 2297 |
| 33 | Ga0070713_100132283 | 3300005436 | Bacteria | 2201 |
| 34 | Ga0070713_100153967 | 3300005436 | Bacteria | 2047 |
| 35 | Ga0070713_100249147 | 3300005436 | Bacteria | 1620 |
| 36 | Ga0070713_100327440 | 3300005436 | Bacteria | 1416 |
| 37 | Ga0070713_100477227 | 3300005436 | Bacteria | 1174 |
| 38 | Ga0070710_10003344 | 3300005437 | Bacteria | 7603 |
| 39 | Ga0070710_10003544 | 3300005437 | Bacteria | 7396 |
| 40 | Ga0070710_10016273 | 3300005437 | Bacteria | 3781 |
| 41 | Ga0070710_10063649 | 3300005437 | Bacteria | 2108 |
| 42 | Ga0070701_10050836 | 3300005438 | Bacteria | 2148 |
| 43 | Ga0070711_100001972 | 3300005439 | Bacteria | 11521 |
| 44 | Ga0070711_100019864 | 3300005439 | Bacteria | 4320 |
| 45 | Ga0070711_100022459 | 3300005439 | Bacteria | 4090 |
| 46 | Ga0070711_100022794 | 3300005439 | Bacteria | 4063 |
| 47 | Ga0070711_100048894 | 3300005439 | Bacteria | 2894 |
| 48 | Ga0070711_100389002 | 3300005439 | Unclassified | 1129 |
| 49 | Ga0070711_100591675 | 3300005439 | Bacteria | 925 |
| 50 | Ga0070705_100008189 | 3300005440 | Bacteria | 5170 |
| 51 | Ga0070705_100029213 | 3300005440 | Bacteria | 3029 |
| 52 | Ga0070705_100140657 | 3300005440 | Bacteria | 1588 |
| 53 | Ga0070694_100038314 | 3300005444 | Bacteria | 3185 |
| 54 | Ga0070694_100334090 | 3300005444 | Bacteria | 1170 |
| 55 | Ga0070708_100000074 | 3300005445 | Bacteria | 63932 |
| 56 | Ga0070708_100001238 | 3300005445 | Bacteria | 19640 |
| 57 | Ga0070708_100001603 | 3300005445 | Bacteria | 17338 |
| 58 | Ga0070708_100118040 | 3300005445 | Bacteria | 2444 |
| 59 | Ga0070708_100153843 | 3300005445 | Bacteria | 2140 |
| 60 | Ga0070708_100181477 | 3300005445 | Bacteria | 1967 |
| 61 | Ga0070708_100675851 | 3300005445 | Bacteria | 972 |
| 62 | Ga0070663_100024890 | 3300005455 | Bacteria | 4035 |
| 63 | Ga0070663_100075280 | 3300005455 | Bacteria | 2467 |
| 64 | Ga0070663_100091646 | 3300005455 | Bacteria | 2252 |
| 65 | Ga0070678_100020458 | 3300005456 | Bacteria | 4343 |
| 66 | Ga0070678_100620959 | 3300005456 | Bacteria | 967 |
| 67 | Ga0070662_100125049 | 3300005457 | Bacteria | 1976 |
| 68 | Ga0070681_10015186 | 3300005458 | Bacteria | 7660 |
| 69 | Ga0070681_10268021 | 3300005458 | Bacteria | 1619 |
| 70 | Ga0070681_10408939 | 3300005458 | Bacteria | 1269 |
| 71 | Ga0070681_10457813 | 3300005458 | Bacteria | 1188 |
| 72 | Ga0068867_100175967 | 3300005459 | Unclassified | 1698 |
| 73 | Ga0070706_100001907 | 3300005467 | Bacteria | 21528 |
| 74 | Ga0070706_100006141 | 3300005467 | Bacteria | 11366 |
| 75 | Ga0070706_100007464 | 3300005467 | Bacteria | 10252 |
| 76 | Ga0070706_100021579 | 3300005467 | Bacteria | 5929 |
| 77 | Ga0070706_100027442 | 3300005467 | Bacteria | 5240 |
| 78 | Ga0070706_100031066 | 3300005467 | Bacteria | 4925 |
| 79 | Ga0070706_100070908 | 3300005467 | Bacteria | 3223 |
| 80 | Ga0070706_100073130 | 3300005467 | Bacteria | 3172 |
| 81 | Ga0070706_100078530 | 3300005467 | Bacteria | 3056 |
| 82 | Ga0070706_100152939 | 3300005467 | Bacteria | 2154 |
| 83 | Ga0070706_100200826 | 3300005467 | Bacteria | 1862 |
| 84 | Ga0070706_100589054 | 3300005467 | Bacteria | 1034 |
| 85 | Ga0070707_100000637 | 3300005468 | Bacteria | 35026 |
| 86 | Ga0070707_100002195 | 3300005468 | Bacteria | 18652 |
| 87 | Ga0070707_100004568 | 3300005468 | Bacteria | 12960 |
| 88 | Ga0070707_100005640 | 3300005468 | Bacteria | 11693 |
| 89 | Ga0070707_100009909 | 3300005468 | Bacteria | 8870 |
| 90 | Ga0070707_100024185 | 3300005468 | Bacteria | 5750 |
| 91 | Ga0070707_100031092 | 3300005468 | Bacteria | 5083 |
| 92 | Ga0070707_100042754 | 3300005468 | Bacteria | 4338 |
| 93 | Ga0070707_100057084 | 3300005468 | Bacteria | 3746 |
| 94 | Ga0070707_100057133 | 3300005468 | Bacteria | 3744 |
| 95 | Ga0070707_100084603 | 3300005468 | Bacteria | 3065 |
| 96 | Ga0070707_100113629 | 3300005468 | Bacteria | 2627 |
| 97 | Ga0070707_100158398 | 3300005468 | Bacteria | 2205 |
| 98 | Ga0070707_100255719 | 3300005468 | Bacteria | 1704 |
| 99 | Ga0070707_100389879 | 3300005468 | Bacteria | 1353 |
| 100 | Ga0070698_100000082 | 3300005471 | Bacteria | 73573 |
| 101 | Ga0070698_100002067 | 3300005471 | Bacteria | 22298 |
| 102 | Ga0070698_100006327 | 3300005471 | Bacteria | 12858 |
| 103 | Ga0070698_100009295 | 3300005471 | Bacteria | 10547 |
| 104 | Ga0070698_100010143 | 3300005471 | Bacteria | 10064 |
| 105 | Ga0070698_100011159 | 3300005471 | Bacteria | 9545 |
| 106 | Ga0070698_100013845 | 3300005471 | Bacteria | 8531 |
| 107 | Ga0070698_100019349 | 3300005471 | Bacteria | 7152 |
| 108 | Ga0070698_100025985 | 3300005471 | Bacteria | 6100 |
| 109 | Ga0070698_100039922 | 3300005471 | Bacteria | 4826 |
| 110 | Ga0070698_100091562 | 3300005471 | Bacteria | 3023 |
| 111 | Ga0070698_100092469 | 3300005471 | Bacteria | 3005 |
| 112 | Ga0070698_100097124 | 3300005471 | Bacteria | 2922 |
| 113 | Ga0070698_100119956 | 3300005471 | Bacteria | 2590 |
| 114 | Ga0070698_100406277 | 3300005471 | Bacteria | 1295 |
| 115 | Ga0070699_100001106 | 3300005518 | Bacteria | 25074 |
| 116 | Ga0070699_100010091 | 3300005518 | Bacteria | 8177 |
| 117 | Ga0070699_100024128 | 3300005518 | Bacteria | 5241 |
| 118 | Ga0070699_100044724 | 3300005518 | Bacteria | 3833 |
| 119 | Ga0070699_100106047 | 3300005518 | Bacteria | 2465 |
| 120 | Ga0070699_100163958 | 3300005518 | Bacteria | 1968 |
| 121 | Ga0070679_100100227 | 3300005530 | Bacteria | 2883 |
| 122 | Ga0070679_100182357 | 3300005530 | Bacteria | 2071 |
| 123 | Ga0070684_100034153 | 3300005535 | Bacteria | 4347 |
| 124 | Ga0070684_100079692 | 3300005535 | Bacteria | 2895 |
| 125 | Ga0070684_100154071 | 3300005535 | Bacteria | 2083 |
| 126 | Ga0070684_100226699 | 3300005535 | Bacteria | 1705 |
| 127 | Ga0070684_100282126 | 3300005535 | Bacteria | 1522 |
| 128 | Ga0070697_100128414 | 3300005536 | Bacteria | 2124 |
| 129 | Ga0070697_100139624 | 3300005536 | Bacteria | 2037 |
| 130 | Ga0070697_100343954 | 3300005536 | Bacteria | 1287 |
| 131 | Ga0070686_100102933 | 3300005544 | Bacteria | 1932 |
| 132 | Ga0070695_100036735 | 3300005545 | Bacteria | 3084 |
| 133 | Ga0070695_100053815 | 3300005545 | Bacteria | 2589 |
| 134 | Ga0070696_100014341 | 3300005546 | Bacteria | 5315 |
| 135 | Ga0070696_100026882 | 3300005546 | Bacteria | 3917 |
| 136 | Ga0070696_100170887 | 3300005546 | Bacteria | 1607 |
| 137 | Ga0070696_100272658 | 3300005546 | Bacteria | 1287 |
| 138 | Ga0070693_100059353 | 3300005547 | Bacteria | 2217 |
| 139 | Ga0070665_100037887 | 3300005548 | Bacteria | 4846 |
| 140 | Ga0070665_100060734 | 3300005548 | Bacteria | 3789 |
| 141 | Ga0070665_100103077 | 3300005548 | Bacteria | 2857 |
| 142 | Ga0068855_100015019 | 3300005563 | Bacteria | 9326 |
| 143 | Ga0068855_100057398 | 3300005563 | Bacteria | 4563 |
| 144 | Ga0068855_100638293 | 3300005563 | Bacteria | 1145 |
| 145 | Ga0070664_100101554 | 3300005564 | Bacteria | 2501 |
| 146 | Ga0068857_100367418 | 3300005577 | Bacteria | 1334 |
| 147 | Ga0068854_100245493 | 3300005578 | Bacteria | 1428 |
| 148 | Ga0068856_100042997 | 3300005614 | Bacteria | 4445 |
| 149 | Ga0068856_100288919 | 3300005614 | Bacteria | 1656 |
| 150 | Ga0068856_100389414 | 3300005614 | Unclassified | 1413 |
| 151 | Ga0068856_100782337 | 3300005614 | Bacteria | 974 |
| 152 | Ga0070702_100040027 | 3300005615 | Bacteria | 2619 |
| 153 | Ga0070702_100097035 | 3300005615 | Bacteria | 1800 |
| 154 | Ga0068852_100012576 | 3300005616 | Bacteria | 6430 |
| 155 | Ga0068852_100037902 | 3300005616 | Bacteria | 4047 |
| 156 | Ga0068852_100279856 | 3300005616 | Bacteria | 1608 |
| 157 | Ga0068864_100151195 | 3300005618 | Bacteria | 2103 |
| 158 | Ga0068866_10013129 | 3300005718 | Bacteria | 3625 |
| 159 | Ga0068861_100084029 | 3300005719 | Bacteria | 2498 |
| 160 | Ga0068863_100015496 | 3300005841 | Bacteria | 7328 |
| 161 | Ga0068858_100013504 | 3300005842 | Bacteria | 7705 |
| 162 | Ga0068858_100338018 | 3300005842 | Bacteria | 1441 |
| 163 | Ga0068858_100389930 | 3300005842 | Bacteria | 1337 |
| 164 | Ga0068860_100303023 | 3300005843 | Bacteria | 1566 |
| 165 | Ga0068860_100483283 | 3300005843 | Unclassified | 1235 |
| 166 | Ga0081455_10008399 | 3300005937 | Bacteria | 10740 |
| 167 | Ga0081538_10002838 | 3300005981 | Bacteria | 16566 |
| 168 | Ga0081538_10003979 | 3300005981 | Bacteria | 13764 |
| 169 | Ga0081538_10004688 | 3300005981 | Bacteria | 12525 |
| 170 | Ga0081538_10075464 | 3300005981 | Bacteria | 1829 |
| 171 | Ga0081540_1001407 | 3300005983 | Bacteria | 20817 |
| 172 | Ga0081539_10005520 | 3300005985 | Bacteria | 12837 |
| 173 | Ga0081539_10019810 | 3300005985 | Bacteria | 4584 |
| 174 | Ga0081539_10044537 | 3300005985 | Bacteria | 2561 |
| 175 | Ga0070717_10006347 | 3300006028 | Bacteria | 8694 |
| 176 | Ga0070717_10006576 | 3300006028 | Bacteria | 8563 |
| 177 | Ga0070717_10017441 | 3300006028 | Bacteria | 5587 |
| 178 | Ga0070717_10019394 | 3300006028 | Bacteria | 5331 |
| 179 | Ga0070717_10033140 | 3300006028 | Bacteria | 4166 |
| 180 | Ga0070717_10060140 | 3300006028 | Bacteria | 3145 |
| 181 | Ga0070717_10091920 | 3300006028 | Bacteria | 2563 |
| 182 | Ga0070717_10634615 | 3300006028 | Bacteria | 969 |
| 183 | Ga0070715_10001082 | 3300006163 | Bacteria | 7713 |
| 184 | Ga0070715_10002235 | 3300006163 | Bacteria | 5880 |
| 185 | Ga0070715_10010780 | 3300006163 | Bacteria | 3269 |
| 186 | Ga0070715_10034807 | 3300006163 | Bacteria | 2067 |
| 187 | Ga0070716_100002738 | 3300006173 | Bacteria | 8176 |
| 188 | Ga0070716_100007339 | 3300006173 | Bacteria | 5421 |
| 189 | Ga0070716_100011043 | 3300006173 | Bacteria | 4542 |
| 190 | Ga0070712_100009206 | 3300006175 | Bacteria | 6219 |
| 191 | Ga0070712_100027795 | 3300006175 | Bacteria | 3781 |
| 192 | Ga0070712_100029667 | 3300006175 | Bacteria | 3668 |
| 193 | Ga0070712_100153508 | 3300006175 | Bacteria | 1770 |
| 194 | Ga0070712_100186918 | 3300006175 | Bacteria | 1618 |
| 195 | Ga0070712_100189940 | 3300006175 | Bacteria | 1607 |
| 196 | Ga0070712_100190787 | 3300006175 | Bacteria | 1604 |
| 197 | Ga0075427_10006620 | 3300006194 | Bacteria | 1685 |
| 198 | Ga0097621_100027570 | 3300006237 | Bacteria | 4469 |
| 199 | Ga0097621_100239204 | 3300006237 | Unclassified | 1587 |
| 200 | Ga0075428_100151851 | 3300006844 | Bacteria | 2516 |
| 201 | Ga0075428_100376443 | 3300006844 | Bacteria | 1522 |
| 202 | Ga0075430_100003287 | 3300006846 | Bacteria | 13549 |
| 203 | Ga0075431_100002693 | 3300006847 | Bacteria | 17220 |
| 204 | Ga0075431_100224388 | 3300006847 | Bacteria | 1916 |
| 205 | Ga0075433_10015709 | 3300006852 | Bacteria | 6219 |
| 206 | Ga0075433_10046642 | 3300006852 | Bacteria | 3769 |
| 207 | Ga0075433_10054586 | 3300006852 | Bacteria | 3485 |
| 208 | Ga0075433_10716931 | 3300006852 | Bacteria | 876 |
| 209 | Ga0075434_100001693 | 3300006871 | Bacteria | 18867 |
| 210 | Ga0075434_100022020 | 3300006871 | Bacteria | 6203 |
| 211 | Ga0075434_100054495 | 3300006871 | Bacteria | 3972 |
| 212 | Ga0075434_100060715 | 3300006871 | Bacteria | 3760 |
| 213 | Ga0075434_100282956 | 3300006871 | Bacteria | 1678 |
| 214 | Ga0075429_100037097 | 3300006880 | Bacteria | 4242 |
| 215 | Ga0075429_100176498 | 3300006880 | Bacteria | 1872 |
| 216 | Ga0068865_100011404 | 3300006881 | Bacteria | 5560 |
| 217 | Ga0075436_100050921 | 3300006914 | Bacteria | 2858 |
| 218 | Ga0075436_100126236 | 3300006914 | Bacteria | 1792 |
| 219 | Ga0075436_100544547 | 3300006914 | Bacteria | 852 |
| 220 | Ga0075435_100024351 | 3300007076 | Bacteria | 4696 |
| 221 | Ga0075435_100073248 | 3300007076 | Bacteria | 2800 |
| 222 | Ga0075435_100096126 | 3300007076 | Bacteria | 2451 |
| 223 | Ga0099794_10155724 | 3300007265 | Bacteria | 1161 |
| 224 | Ga0099795_10027524 | 3300007788 | Bacteria | 1924 |
| 225 | Ga0105240_10011678 | 3300009093 | Bacteria | 12205 |
| 226 | Ga0105240_10057051 | 3300009093 | Bacteria | 4882 |
| 227 | Ga0105240_10793519 | 3300009093 | Bacteria | 1026 |
| 228 | Ga0111539_10009833 | 3300009094 | Bacteria | 12070 |
| 229 | Ga0111539_10381512 | 3300009094 | Bacteria | 1641 |
| 230 | Ga0111539_10448037 | 3300009094 | Bacteria | 1503 |
| 231 | Ga0105245_10026493 | 3300009098 | Bacteria | 5103 |
| 232 | Ga0105245_10254069 | 3300009098 | Bacteria | 1709 |
| 233 | Ga0105245_10395405 | 3300009098 | Bacteria | 1380 |
| 234 | Ga0105245_10688787 | 3300009098 | Bacteria | 1054 |
| 235 | Ga0105247_10308919 | 3300009101 | Bacteria | 1099 |
| 236 | Ga0114129_10066227 | 3300009147 | Bacteria | 5039 |
| 237 | Ga0114129_10095375 | 3300009147 | Bacteria | 4120 |
| 238 | Ga0114129_10202251 | 3300009147 | Bacteria | 2689 |
| 239 | Ga0114129_10226187 | 3300009147 | Bacteria | 2521 |
| 240 | Ga0114129_10356006 | 3300009147 | Bacteria | 1938 |
| 241 | Ga0114129_10399215 | 3300009147 | Bacteria | 1812 |
| 242 | Ga0114129_10496739 | 3300009147 | Bacteria | 1594 |
| 243 | Ga0114129_10651209 | 3300009147 | Bacteria | 1360 |
| 244 | Ga0105243_10039760 | 3300009148 | Bacteria | 3669 |
| 245 | Ga0105243_10081531 | 3300009148 | Bacteria | 2642 |
| 246 | Ga0105243_10223315 | 3300009148 | Unclassified | 1666 |
| 247 | Ga0105241_10015186 | 3300009174 | Bacteria | 5640 |
| 248 | Ga0105248_10010737 | 3300009177 | Bacteria | 10110 |
| 249 | Ga0105248_10049581 | 3300009177 | Bacteria | 4710 |
| 250 | Ga0105237_10039204 | 3300009545 | Bacteria | 4782 |
| 251 | Ga0105237_10134879 | 3300009545 | Bacteria | 2463 |
| 252 | Ga0105237_10580494 | 3300009545 | Bacteria | 1128 |
| 253 | Ga0105238_10007703 | 3300009551 | Bacteria | 10765 |
| 254 | Ga0105238_10438954 | 3300009551 | Bacteria | 1302 |
| 255 | Ga0105238_10528076 | 3300009551 | Bacteria | 1183 |
| 256 | Ga0105249_10011780 | 3300009553 | Bacteria | 7687 |
| 257 | Ga0105249_10013267 | 3300009553 | Bacteria | 7272 |
| 258 | Ga0105249_10173176 | 3300009553 | Bacteria | 2094 |
| 259 | Ga0105249_10344411 | 3300009553 | Unclassified | 1508 |
| 260 | Ga0105239_10025385 | 3300010375 | Bacteria | 6524 |
| 261 | Ga0157370_10036126 | 3300013104 | Bacteria | 4797 |
| 262 | Ga0157370_10073380 | 3300013104 | Bacteria | 3228 |
| 263 | Ga0157370_10153129 | 3300013104 | Bacteria | 2145 |
| 264 | Ga0157370_10163904 | 3300013104 | Bacteria | 2068 |
| 265 | Ga0157369_10008975 | 3300013105 | Bacteria | 11452 |
| 266 | Ga0157369_10046070 | 3300013105 | Bacteria | 4740 |
| 267 | Ga0157369_10079297 | 3300013105 | Bacteria | 3517 |
| 268 | Ga0157369_10115893 | 3300013105 | Bacteria | 2845 |
| 269 | Ga0157369_10185806 | 3300013105 | Bacteria | 2186 |
| 270 | Ga0157374_10036164 | 3300013296 | Bacteria | 4522 |
| 271 | Ga0157374_10056454 | 3300013296 | Bacteria | 3666 |
| 272 | Ga0157378_10005547 | 3300013297 | Bacteria | 11048 |
| 273 | Ga0163162_10079399 | 3300013306 | Bacteria | 3348 |
| 274 | Ga0157372_10123614 | 3300013307 | Bacteria | 2975 |
| 275 | Ga0157372_10350375 | 3300013307 | Bacteria | 1720 |
| 276 | Ga0157372_10803550 | 3300013307 | Bacteria | 1093 |
| 277 | Ga0163163_10017404 | 3300014325 | Bacteria | 6703 |
| 278 | Ga0163163_10224599 | 3300014325 | Bacteria | 1927 |
| 279 | Ga0163163_10324806 | 3300014325 | Bacteria | 1592 |
| 280 | Ga0157380_10899236 | 3300014326 | Bacteria | 911 |
| 281 | Ga0157379_10017813 | 3300014968 | Bacteria | 6257 |
| 282 | Ga0157379_10202767 | 3300014968 | Bacteria | 1794 |
| 283 | Ga0157376_10126189 | 3300014969 | Bacteria | 2276 |
| 284 | Ga0206351_10697221 | 3300020077 | Bacteria | 1232 |
| 285 | Ga0206350_10034970 | 3300020080 | Bacteria | 1659 |
| 286 | Ga0206354_10010395 | 3300020081 | Bacteria | 1381 |
| 287 | Ga0206354_10248428 | 3300020081 | Bacteria | 2370 |
| 288 | Ga0206354_10358818 | 3300020081 | Bacteria | 2330 |
| 289 | Ga0206353_10982929 | 3300020082 | Bacteria | 3839 |
| 290 | Ga0206353_11739985 | 3300020082 | Bacteria | 1075 |
| 291 | Ga0206353_12011555 | 3300020082 | Bacteria | 2421 |
| 292 | Ga0213875_10000197 | 3300021388 | Bacteria | 61686 |
| 293 | Ga0213875_10000281 | 3300021388 | Bacteria | 49818 |
| 294 | Ga0213875_10000768 | 3300021388 | Bacteria | 24048 |
| 295 | Ga0213875_10134856 | 3300021388 | Bacteria | 1155 |
| 296 | Ga0213875_10146460 | 3300021388 | Bacteria | 1106 |
| 297 | Ga0224712_10001664 | 3300022467 | Bacteria | 5244 |
| 298 | Ga0224712_10095271 | 3300022467 | Bacteria | 1253 |
| 299 | Ga0224712_10245051 | 3300022467 | Bacteria | 826 |
| 300 | Ga0207426_1000875 | 3300025302 | Bacteria | 31224 |
| 301 | Ga0207653_10000002 | 3300025885 | Bacteria | 270513 |
| 302 | Ga0207692_10000435 | 3300025898 | Bacteria | 14700 |
| 303 | Ga0207692_10001293 | 3300025898 | Bacteria | 9308 |
| 304 | Ga0207692_10005264 | 3300025898 | Bacteria | 5169 |
| 305 | Ga0207692_10009511 | 3300025898 | Bacteria | 4064 |
| 306 | Ga0207685_10000488 | 3300025905 | Bacteria | 6725 |
| 307 | Ga0207685_10013342 | 3300025905 | Bacteria | 2538 |
| 308 | Ga0207685_10087334 | 3300025905 | Bacteria | 1305 |
| 309 | Ga0207699_10001146 | 3300025906 | Bacteria | 12536 |
| 310 | Ga0207699_10002053 | 3300025906 | Bacteria | 9506 |
| 311 | Ga0207699_10004947 | 3300025906 | Bacteria | 6373 |
| 312 | Ga0207699_10028323 | 3300025906 | Bacteria | 3112 |
| 313 | Ga0207699_10035947 | 3300025906 | Bacteria | 2821 |
| 314 | Ga0207699_10084494 | 3300025906 | Bacteria | 1977 |
| 315 | Ga0207684_10000123 | 3300025910 | Bacteria | 142518 |
| 316 | Ga0207684_10000339 | 3300025910 | Bacteria | 65102 |
| 317 | Ga0207684_10000574 | 3300025910 | Bacteria | 44726 |
| 318 | Ga0207684_10009068 | 3300025910 | Bacteria | 8810 |
| 319 | Ga0207684_10013508 | 3300025910 | Bacteria | 7062 |
| 320 | Ga0207684_10047001 | 3300025910 | Bacteria | 3661 |
| 321 | Ga0207684_10071717 | 3300025910 | Bacteria | 2943 |
| 322 | Ga0207684_10076794 | 3300025910 | Bacteria | 2839 |
| 323 | Ga0207684_10078735 | 3300025910 | Bacteria | 2804 |
| 324 | Ga0207684_10092948 | 3300025910 | Bacteria | 2571 |
| 325 | Ga0207684_10167903 | 3300025910 | Bacteria | 1891 |
| 326 | Ga0207684_10373769 | 3300025910 | Bacteria | 1226 |
| 327 | Ga0207684_10558274 | 3300025910 | Bacteria | 979 |
| 328 | Ga0207707_10047197 | 3300025912 | Bacteria | 3751 |
| 329 | Ga0207707_10189427 | 3300025912 | Bacteria | 1795 |
| 330 | Ga0207695_10001971 | 3300025913 | Bacteria | 31775 |
| 331 | Ga0207695_10033576 | 3300025913 | Bacteria | 5594 |
| 332 | Ga0207671_10000203 | 3300025914 | Bacteria | 90100 |
| 333 | Ga0207671_10246432 | 3300025914 | Bacteria | 1404 |
| 334 | Ga0207693_10005318 | 3300025915 | Bacteria | 10753 |
| 335 | Ga0207693_10005872 | 3300025915 | Bacteria | 10189 |
| 336 | Ga0207693_10011807 | 3300025915 | Bacteria | 7058 |
| 337 | Ga0207693_10034813 | 3300025915 | Bacteria | 3971 |
| 338 | Ga0207693_10055161 | 3300025915 | Bacteria | 3118 |
| 339 | Ga0207693_10109789 | 3300025915 | Bacteria | 2163 |
| 340 | Ga0207693_10397053 | 3300025915 | Bacteria | 1078 |
| 341 | Ga0207663_10001814 | 3300025916 | Bacteria | 10084 |
| 342 | Ga0207663_10006086 | 3300025916 | Bacteria | 6137 |
| 343 | Ga0207663_10028399 | 3300025916 | Bacteria | 3274 |
| 344 | Ga0207663_10039773 | 3300025916 | Bacteria | 2852 |
| 345 | Ga0207663_10103685 | 3300025916 | Bacteria | 1916 |
| 346 | Ga0207663_10243453 | 3300025916 | Bacteria | 1320 |
| 347 | Ga0207660_10437468 | 3300025917 | Bacteria | 1056 |
| 348 | Ga0207657_10027219 | 3300025919 | Bacteria | 5238 |
| 349 | Ga0207649_10215912 | 3300025920 | Bacteria | 1363 |
| 350 | Ga0207652_10024768 | 3300025921 | Bacteria | 4980 |
| 351 | Ga0207652_10337547 | 3300025921 | Bacteria | 1360 |
| 352 | Ga0207646_10000061 | 3300025922 | Bacteria | 151425 |
| 353 | Ga0207646_10001194 | 3300025922 | Bacteria | 32687 |
| 354 | Ga0207646_10002341 | 3300025922 | Bacteria | 22412 |
| 355 | Ga0207646_10004121 | 3300025922 | Bacteria | 15968 |
| 356 | Ga0207646_10018758 | 3300025922 | Bacteria | 6446 |
| 357 | Ga0207646_10027513 | 3300025922 | Bacteria | 5186 |
| 358 | Ga0207646_10052080 | 3300025922 | Bacteria | 3663 |
| 359 | Ga0207646_10053559 | 3300025922 | Bacteria | 3609 |
| 360 | Ga0207646_10054966 | 3300025922 | Bacteria | 3561 |
| 361 | Ga0207646_10073851 | 3300025922 | Bacteria | 3046 |
| 362 | Ga0207646_10112716 | 3300025922 | Bacteria | 2441 |
| 363 | Ga0207646_10255525 | 3300025922 | Bacteria | 1584 |
| 364 | Ga0207694_10002093 | 3300025924 | Bacteria | 16491 |
| 365 | Ga0207650_10023834 | 3300025925 | Bacteria | 4345 |
| 366 | Ga0207659_10292967 | 3300025926 | Bacteria | 1334 |
| 367 | Ga0207687_10099438 | 3300025927 | Bacteria | 2137 |
| 368 | Ga0207687_10277710 | 3300025927 | Bacteria | 1342 |
| 369 | Ga0207687_10596894 | 3300025927 | Unclassified | 930 |
| 370 | Ga0207700_10000714 | 3300025928 | Bacteria | 19206 |
| 371 | Ga0207700_10003538 | 3300025928 | Bacteria | 9095 |
| 372 | Ga0207700_10004876 | 3300025928 | Bacteria | 7971 |
| 373 | Ga0207700_10018529 | 3300025928 | Bacteria | 4681 |
| 374 | Ga0207700_10020336 | 3300025928 | Bacteria | 4506 |
| 375 | Ga0207700_10027887 | 3300025928 | Bacteria | 3960 |
| 376 | Ga0207700_10071906 | 3300025928 | Bacteria | 2665 |
| 377 | Ga0207700_10222702 | 3300025928 | Bacteria | 1600 |
| 378 | Ga0207700_10229272 | 3300025928 | Bacteria | 1578 |
| 379 | Ga0207700_10260979 | 3300025928 | Bacteria | 1483 |
| 380 | Ga0207700_10293778 | 3300025928 | Bacteria | 1401 |
| 381 | Ga0207700_10430022 | 3300025928 | Bacteria | 1161 |
| 382 | Ga0207700_10619866 | 3300025928 | Bacteria | 963 |
| 383 | Ga0207664_10000825 | 3300025929 | Bacteria | 21018 |
| 384 | Ga0207664_10004487 | 3300025929 | Bacteria | 9460 |
| 385 | Ga0207664_10010010 | 3300025929 | Bacteria | 6681 |
| 386 | Ga0207664_10012761 | 3300025929 | Bacteria | 6014 |
| 387 | Ga0207664_10014707 | 3300025929 | Bacteria | 5661 |
| 388 | Ga0207664_10022552 | 3300025929 | Bacteria | 4704 |
| 389 | Ga0207664_10023375 | 3300025929 | Bacteria | 4630 |
| 390 | Ga0207664_10164389 | 3300025929 | Bacteria | 1895 |
| 391 | Ga0207664_10251932 | 3300025929 | Bacteria | 1541 |
| 392 | Ga0207664_10316996 | 3300025929 | Bacteria | 1375 |
| 393 | Ga0207664_10722382 | 3300025929 | Unclassified | 896 |
| 394 | Ga0207690_10353826 | 3300025932 | Bacteria | 1162 |
| 395 | Ga0207706_10015126 | 3300025933 | Bacteria | 6983 |
| 396 | Ga0207706_10254699 | 3300025933 | Unclassified | 1533 |
| 397 | Ga0207670_10099670 | 3300025936 | Bacteria | 2073 |
| 398 | Ga0207670_10343074 | 3300025936 | Bacteria | 1181 |
| 399 | Ga0207704_10039306 | 3300025938 | Bacteria | 2753 |
| 400 | Ga0207704_10192111 | 3300025938 | Bacteria | 1486 |
| 401 | Ga0207665_10001557 | 3300025939 | Bacteria | 15450 |
| 402 | Ga0207665_10002854 | 3300025939 | Bacteria | 11599 |
| 403 | Ga0207665_10003130 | 3300025939 | Bacteria | 11099 |
| 404 | Ga0207665_10004964 | 3300025939 | Bacteria | 8876 |
| 405 | Ga0207665_10008897 | 3300025939 | Bacteria | 6594 |
| 406 | Ga0207665_10351336 | 3300025939 | Bacteria | 1113 |
| 407 | Ga0207711_10034042 | 3300025941 | Bacteria | 4314 |
| 408 | Ga0207711_10063783 | 3300025941 | Bacteria | 3181 |
| 409 | Ga0207711_10378600 | 3300025941 | Bacteria | 1313 |
| 410 | Ga0207661_10138672 | 3300025944 | Bacteria | 2091 |
| 411 | Ga0207661_10301634 | 3300025944 | Bacteria | 1436 |
| 412 | Ga0207661_10317803 | 3300025944 | Bacteria | 1399 |
| 413 | Ga0207661_10513090 | 3300025944 | Unclassified | 1096 |
| 414 | Ga0207661_10633727 | 3300025944 | Bacteria | 982 |
| 415 | Ga0207679_10255239 | 3300025945 | Bacteria | 1493 |
| 416 | Ga0207679_10420673 | 3300025945 | Bacteria | 1179 |
| 417 | Ga0207667_10021249 | 3300025949 | Bacteria | 7195 |
| 418 | Ga0207667_10028682 | 3300025949 | Bacteria | 6043 |
| 419 | Ga0207667_10311268 | 3300025949 | Bacteria | 1609 |
| 420 | Ga0207712_10010611 | 3300025961 | Bacteria | 5848 |
| 421 | Ga0207712_10064017 | 3300025961 | Bacteria | 2620 |
| 422 | Ga0207712_10553563 | 3300025961 | Unclassified | 990 |
| 423 | Ga0207668_10107518 | 3300025972 | Bacteria | 2086 |
| 424 | Ga0207640_10083435 | 3300025981 | Bacteria | 2191 |
| 425 | Ga0207640_10423394 | 3300025981 | Bacteria | 1090 |
| 426 | Ga0207677_10146500 | 3300026023 | Bacteria | 1815 |
| 427 | Ga0207703_10055815 | 3300026035 | Bacteria | 3214 |
| 428 | Ga0207678_10040467 | 3300026067 | Bacteria | 4043 |
| 429 | Ga0207678_10043387 | 3300026067 | Bacteria | 3892 |
| 430 | Ga0207678_10115786 | 3300026067 | Bacteria | 2287 |
| 431 | Ga0207678_10620971 | 3300026067 | Bacteria | 948 |
| 432 | Ga0207708_10033558 | 3300026075 | Bacteria | 3900 |
| 433 | Ga0207702_10096086 | 3300026078 | Bacteria | 2605 |
| 434 | Ga0207702_10131506 | 3300026078 | Bacteria | 2253 |
| 435 | Ga0207702_10208111 | 3300026078 | Bacteria | 1817 |
| 436 | Ga0207641_10022430 | 3300026088 | Bacteria | 5198 |
| 437 | Ga0207641_10458504 | 3300026088 | Bacteria | 1233 |
| 438 | Ga0207648_10064281 | 3300026089 | Bacteria | 3198 |
| 439 | Ga0207676_10036261 | 3300026095 | Bacteria | 3750 |
| 440 | Ga0207676_10313302 | 3300026095 | Bacteria | 1437 |
| 441 | Ga0207676_10338836 | 3300026095 | Unclassified | 1387 |
| 442 | Ga0207674_10024169 | 3300026116 | Bacteria | 6497 |
| 443 | Ga0207674_10067884 | 3300026116 | Bacteria | 3589 |
| 444 | Ga0207674_10179296 | 3300026116 | Bacteria | 2070 |
| 445 | Ga0207675_100009207 | 3300026118 | Bacteria | 9261 |
| 446 | Ga0207675_100064783 | 3300026118 | Bacteria | 3416 |
| 447 | Ga0207683_10039499 | 3300026121 | Bacteria | 4118 |
| 448 | Ga0207683_10174320 | 3300026121 | Bacteria | 1949 |
| 449 | Ga0207683_10664302 | 3300026121 | Bacteria | 966 |
| 450 | Ga0207698_10039132 | 3300026142 | Bacteria | 3510 |
| 451 | Ga0207698_10118085 | 3300026142 | Bacteria | 2239 |
| 452 | Ga0207698_10859235 | 3300026142 | Bacteria | 913 |
| 453 | Ga0209179_1042848 | 3300027512 | Bacteria | 956 |
| 454 | Ga0207428_10002280 | 3300027907 | Bacteria | 19250 |
| 455 | Ga0268266_10140268 | 3300028379 | Bacteria | 2169 |
| 456 | Ga0268264_10209086 | 3300028381 | Bacteria | 1790 |
| 457 | Ga0307512_10158741 | 3300030522 | Bacteria | 1331 |
| 458 | Ga0307408_100162690 | 3300031548 | Bacteria | 1774 |
| 459 | Ga0307405_10010538 | 3300031731 | Bacteria | 4798 |
| 460 | Ga0307405_10015094 | 3300031731 | Bacteria | 4173 |
| 461 | Ga0307405_10098553 | 3300031731 | Bacteria | 1954 |
| 462 | Ga0307413_10031652 | 3300031824 | Bacteria | 2988 |
| 463 | Ga0307413_10035071 | 3300031824 | Bacteria | 2874 |
| 464 | Ga0307410_10001287 | 3300031852 | Bacteria | 11173 |
| 465 | Ga0307410_10010927 | 3300031852 | Bacteria | 5168 |
| 466 | Ga0307410_10251102 | 3300031852 | Bacteria | 1375 |
| 467 | Ga0307406_10111347 | 3300031901 | Bacteria | 1885 |
| 468 | Ga0307407_10024002 | 3300031903 | Bacteria | 3190 |
| 469 | Ga0307409_100002277 | 3300031995 | Bacteria | 9943 |
| 470 | Ga0307409_100018550 | 3300031995 | Bacteria | 4682 |
| 471 | Ga0307409_100027257 | 3300031995 | Bacteria | 4046 |
| 472 | Ga0307409_100101902 | 3300031995 | Bacteria | 2384 |
| 473 | Ga0307416_100001993 | 3300032002 | Bacteria | 11456 |
| 474 | Ga0307416_100005066 | 3300032002 | Bacteria | 8036 |
| 475 | Ga0307416_100032459 | 3300032002 | Bacteria | 3945 |
| 476 | Ga0307416_100209124 | 3300032002 | Bacteria | 1859 |
| 477 | Ga0307414_10023364 | 3300032004 | Bacteria | 3921 |
| 478 | Ga0307414_10113402 | 3300032004 | Bacteria | 2069 |
| 479 | Ga0307411_10049930 | 3300032005 | Bacteria | 2722 |
| 480 | Ga0307411_10142156 | 3300032005 | Bacteria | 1771 |
| 481 | Ga0307415_100000849 | 3300032126 | Bacteria | 13973 |
| 482 | Ga0307415_100021788 | 3300032126 | Bacteria | 3946 |
| 483 | Ga0307415_100023412 | 3300032126 | Bacteria | 3832 |
| 484 | Ga0307415_100183403 | 3300032126 | Bacteria | 1644 |
| 485 | Ga0316212_1006845 | 3300033547 | Bacteria | 1650 |
| 486 | Ga0373930_0002420 | 3300034816 | Bacteria | 2883 |
| 487 | Ga0373948_0010324 | 3300034817 | Bacteria | 1628 |
| 488 | Ga0373958_0001957 | 3300034819 | Bacteria | 2831 |
| 489 | Ga0373938_0002054 | 3300034957 | Bacteria | 3232 |
| 490 | Ga0373934_0007496 | 3300035086 | Bacteria | 4053 |
| 491 | Ga0373940_0014214 | 3300035088 | Bacteria | 1938 |
| 492 | Ga0373949_0012367 | 3300035090 | Bacteria | 1888 |
| 493 | Ga0373951_0009135 | 3300035091 | Bacteria | 2233 |
| 494 | Ga0373951_0019096 | 3300035091 | Bacteria | 1561 |
| 495 | Ga0373939_0003465 | 3300035114 | Bacteria | 3702 |
| 496 | Ga0373941_0008018 | 3300035115 | Bacteria | 2608 |
| 497 | Ga0373941_0038187 | 3300035115 | Bacteria | 1469 |
| 498 | Ga0373954_0055624 | 3300035118 | Bacteria | 1862 |
| 499 | Ga0373954_0184959 | 3300035118 | Bacteria | 1022 |
| 500 | Ga0373956_0051871 | 3300035119 | Bacteria | 1844 |
| 501 | Ga0373957_0012014 | 3300035120 | Bacteria | 2905 |
| 502 | Ga0373957_0041992 | 3300035120 | Bacteria | 1724 |
| 503 | Ga0373957_0101218 | 3300035120 | Bacteria | 1154 |
| 504 | Ga0373960_0015618 | 3300035121 | Bacteria | 1941 |
| 505 | Ga0373943_0015162 | 3300035170 | Bacteria | 3499 |
| 506 | Ga0373943_0074323 | 3300035170 | Bacteria | 1728 |
| 507 | Ga0373943_0229329 | 3300035170 | Bacteria | 1037 |
| 508 | Ga0373943_0230070 | 3300035170 | Bacteria | 1035 |
| 509 | Ga0373955_0190793 | 3300035172 | Bacteria | 1218 |
| 510 | Ga0373942_0007998 | 3300035207 | Bacteria | 2458 |
| 511 | Ga0373961_0006508 | 3300035241 | Bacteria | 2805 |
| 512 | Ga0373961_0025299 | 3300035241 | Bacteria | 1612 |
| 513 | Ga0373924_0048260 | 3300035410 | Bacteria | 1758 |
| 514 | Ga0373931_0004582 | 3300035691 | Bacteria | 6324 |
| 515 | Ga0373935_0010449 | 3300035692 | Bacteria | 5568 |
| 516 | Ga0373933_0008334 | 3300035724 | Bacteria | 5660 |
| 517 | Ga0373933_0015855 | 3300035724 | Bacteria | 4206 |
| 518 | Ga0373933_0184653 | 3300035724 | Bacteria | 1331 |
| 519 | Ga0373947_0146097 | 3300035725 | Bacteria | 1520 |
| 520 | Ga0373937_0020628 | 3300036401 | Bacteria | 5908 |
| 521 | Ga0373937_0134035 | 3300036401 | Bacteria | 2315 |
| 522 | Ga0373937_0324186 | 3300036401 | Bacteria | 1457 |
| 523 | Ga0373925_0003342 | 3300037068 | Bacteria | 12459 |
| 524 | Ga0373925_0057874 | 3300037068 | Bacteria | 2905 |
| 525 | Ga0373925_0058736 | 3300037068 | Bacteria | 2884 |
| 526 | Ga0373925_0145286 | 3300037068 | Bacteria | 1859 |
| 527 | Ga0395899_0004556 | 3300037312 | Bacteria | 10793 |
| 528 | Ga0395899_0048153 | 3300037312 | Bacteria | 3173 |
| 529 | Ga0395899_0070110 | 3300037312 | Bacteria | 2566 |
| 530 | Ga0395899_0144064 | 3300037312 | Bacteria | 1693 |
| 531 | Ga0395899_0192209 | 3300037312 | Bacteria | 1428 |
| 532 | Ga0395900_0005315 | 3300037418 | Bacteria | 13496 |
| 533 | Ga0395900_0033991 | 3300037418 | Bacteria | 5248 |
| 534 | Ga0395900_0117896 | 3300037418 | Bacteria | 2724 |
| 535 | Ga0395900_0123111 | 3300037418 | Bacteria | 2660 |
| 536 | Ga0395900_0141725 | 3300037418 | Bacteria | 2461 |
| 537 | Ga0395900_0167531 | 3300037418 | Bacteria | 2238 |
| 538 | Ga0395900_0382399 | 3300037418 | Bacteria | 1375 |
| 539 | Ga0395900_0932478 | 3300037418 | Bacteria | 790 |
| 540 | Ga0395898_0002844 | 3300037466 | Bacteria | 19791 |
| 541 | Ga0395898_0012364 | 3300037466 | Bacteria | 8828 |
| 542 | Ga0395898_0131786 | 3300037466 | Bacteria | 2394 |
| 543 | Ga0395898_0275927 | 3300037466 | Bacteria | 1603 |
| 544 | Ga0395898_0758056 | 3300037466 | Bacteria | 912 |
| 545 | Ga0395905_0001967 | 3300037471 | Bacteria | 23493 |
| 546 | Ga0395905_0041976 | 3300037471 | Bacteria | 4292 |
| 547 | Ga0395905_0170315 | 3300037471 | Bacteria | 2045 |
| 548 | Ga0395905_0331729 | 3300037471 | Bacteria | 1412 |
| 549 | Ga0395905_0557070 | 3300037471 | Bacteria | 1048 |
| 550 | Ga0436364_0025330 | 3300037853 | Bacteria | 1503 |
| 551 | Ga0436364_0077046 | 3300037853 | Bacteria | 111992 |
| 552 | Ga0436364_0212006 | 3300037853 | Bacteria | 61210 |
| 553 | Ga0436364_0565857 | 3300037853 | Bacteria | 1517 |
| 554 | Ga0436364_0721645 | 3300037853 | Bacteria | 2986 |
| 555 | Ga0436364_1181445 | 3300037853 | Bacteria | 9028 |
| 556 | Ga0436364_1370870 | 3300037853 | Bacteria | 1337 |
| 557 | Ga0395901_0001069 | 3300038443 | Bacteria | 29372 |
| 558 | Ga0395901_0040772 | 3300038443 | Bacteria | 4809 |
| 559 | Ga0395901_0042265 | 3300038443 | Bacteria | 4725 |
| 560 | Ga0395901_0100283 | 3300038443 | Bacteria | 3037 |
| 561 | Ga0395901_0132266 | 3300038443 | Bacteria | 2621 |
| 562 | Ga0395901_0178470 | 3300038443 | Bacteria | 2227 |
| 563 | Ga0395901_0185908 | 3300038443 | Bacteria | 2179 |
| 564 | Ga0395901_0844552 | 3300038443 | Bacteria | 901 |
| 565 | Ga0395901_0921349 | 3300038443 | Bacteria | 854 |
| 566 | Ga0436362_0561529 | 3300039453 | Bacteria | 1439 |
| 567 | Ga0439443_004128 | 3300042003 | Bacteria | 1875 |
| 568 | Ga0439448_0011857 | 3300042005 | Bacteria | 2600 |
| 569 | Ga0439448_0084843 | 3300042005 | Bacteria | 1066 |
| 570 | Ga0439450_000457 | 3300042008 | Bacteria | 5296 |
| 571 | Ga0439450_010723 | 3300042008 | Bacteria | 1775 |
| 572 | Ga0439451_007941 | 3300042009 | Bacteria | 2154 |
| 573 | Ga0439454_008156 | 3300042011 | Bacteria | 1331 |
| 574 | Ga0439463_001832 | 3300042016 | Bacteria | 5519 |
| 575 | Ga0439463_007320 | 3300042016 | Bacteria | 2727 |
| 576 | Ga0450888_006260 | 3300042126 | Bacteria | 1290 |
| 577 | Ga0450900_007727 | 3300042136 | Bacteria | 1330 |
| 578 | Ga0450905_000683 | 3300042142 | Bacteria | 4155 |
| 579 | Ga0439435_0019844 | 3300042436 | Bacteria | 1728 |
| 580 | Ga0439444_0002788 | 3300042437 | Bacteria | 2421 |
| 581 | Ga0439464_0000611 | 3300042439 | Bacteria | 7548 |
| 582 | Ga0439464_0084967 | 3300042439 | Bacteria | 948 |
| 583 | Ga0439460_0001195 | 3300042461 | Bacteria | 6112 |
| 584 | Ga0439460_0045737 | 3300042461 | Bacteria | 1299 |
| 585 | Ga0439460_0074999 | 3300042461 | Unclassified | 1053 |
| 586 | Ga0450916_000443 | 3300042530 | Bacteria | 3562 |
| 587 | Ga0439440_0000138 | 3300042993 | Bacteria | 10454 |
| 588 | Ga0439440_0040887 | 3300042993 | Bacteria | 1129 |
| 589 | Ga0466969_0007236 | 3300044656 | Bacteria | 5906 |
| 590 | Ga0466969_0030840 | 3300044656 | Bacteria | 2730 |
| 591 | Ga0466966_0042731 | 3300044684 | Bacteria | 2907 |
| 592 | Ga0466961_0017607 | 3300044693 | Bacteria | 4590 |
| 593 | Ga0466961_0024414 | 3300044693 | Bacteria | 3890 |
| 594 | Ga0466963_0154394 | 3300044694 | Bacteria | 1595 |
| 595 | Ga0466963_0230172 | 3300044694 | Bacteria | 1299 |
| 596 | Ga0466971_0005673 | 3300044719 | Bacteria | 5425 |
| 597 | Ga0466970_0006512 | 3300044765 | Bacteria | 5837 |
| 598 | Ga0466970_0233606 | 3300044765 | Bacteria | 1028 |
| 599 | Ga0466957_0118038 | 3300044842 | Bacteria | 1689 |
| 600 | Ga0466959_0006218 | 3300045049 | Bacteria | 8253 |
| 601 | Ga0466959_0047709 | 3300045049 | Bacteria | 3150 |
| 602 | Ga0466959_0076883 | 3300045049 | Bacteria | 2410 |
| 603 | Ga0466959_0171899 | 3300045049 | Bacteria | 1520 |
| 604 | Ga0466958_0117574 | 3300045836 | Bacteria | 1662 |
| 605 | Ga0466967_0015406 | 3300045976 | Bacteria | 5991 |
| 606 | Ga0466967_0181203 | 3300045976 | Bacteria | 1987 |
| 607 | Ga0466967_0367604 | 3300045976 | Bacteria | 1395 |
| 608 | Ga0495592_0030009 | 3300046454 | Bacteria | 4113 |
| 609 | Ga0495592_0122017 | 3300046454 | Bacteria | 1832 |
| 610 | Ga0495592_0126824 | 3300046454 | Bacteria | 1789 |
| 611 | Ga0495603_0006845 | 3300046455 | Bacteria | 6840 |
| 612 | Ga0495641_0080404 | 3300046461 | Bacteria | 1460 |
| 613 | Ga0495651_0008074 | 3300046462 | Bacteria | 8071 |
| 614 | Ga0495651_0023871 | 3300046462 | Bacteria | 4755 |
| 615 | Ga0495651_0031173 | 3300046462 | Bacteria | 4159 |
| 616 | Ga0495651_0037806 | 3300046462 | Bacteria | 3758 |
| 617 | Ga0495651_0043718 | 3300046462 | Bacteria | 3474 |
| 618 | Ga0495651_0081301 | 3300046462 | Bacteria | 2446 |
| 619 | Ga0495651_0236269 | 3300046462 | Bacteria | 1256 |
| 620 | Ga0495653_0001681 | 3300046463 | Bacteria | 17410 |
| 621 | Ga0495653_0011612 | 3300046463 | Bacteria | 7190 |
| 622 | Ga0495653_0065294 | 3300046463 | Bacteria | 2739 |
| 623 | Ga0495653_0110223 | 3300046463 | Bacteria | 1979 |
| 624 | Ga0495580_0128389 | 3300046472 | Bacteria | 1759 |
| 625 | Ga0495664_0010356 | 3300046477 | Bacteria | 5231 |
| 626 | Ga0495664_0011383 | 3300046477 | Bacteria | 5014 |
| 627 | Ga0495584_0088945 | 3300046491 | Bacteria | 1557 |
| 628 | Ga0495594_0095754 | 3300046499 | Bacteria | 1667 |
| 629 | Ga0495596_0049482 | 3300046500 | Bacteria | 1648 |
| 630 | Ga0495607_0214476 | 3300046501 | Bacteria | 945 |
| 631 | Ga0495607_0217776 | 3300046501 | Unclassified | 936 |
| 632 | Ga0495608_0038199 | 3300046511 | Bacteria | 3225 |
| 633 | Ga0495608_0046096 | 3300046511 | Bacteria | 2902 |
| 634 | Ga0495608_0089639 | 3300046511 | Bacteria | 1990 |
| 635 | Ga0495608_0128943 | 3300046511 | Bacteria | 1619 |
| 636 | Ga0495616_0125470 | 3300046513 | Bacteria | 1181 |
| 637 | Ga0495618_0015050 | 3300046514 | Bacteria | 4718 |
| 638 | Ga0495618_0084435 | 3300046514 | Bacteria | 2029 |
| 639 | Ga0495628_0005291 | 3300046516 | Bacteria | 11319 |
| 640 | Ga0495628_0029092 | 3300046516 | Bacteria | 4484 |
| 641 | Ga0495628_0056532 | 3300046516 | Bacteria | 3088 |
| 642 | Ga0495628_0076877 | 3300046516 | Bacteria | 2597 |
| 643 | Ga0495628_0360253 | 3300046516 | Bacteria | 1068 |
| 644 | Ga0495630_0300543 | 3300046517 | Bacteria | 1226 |
| 645 | Ga0495637_0084402 | 3300046520 | Bacteria | 1262 |
| 646 | Ga0495644_0026909 | 3300046523 | Bacteria | 2181 |
| 647 | Ga0495644_0067683 | 3300046523 | Bacteria | 1342 |
| 648 | Ga0495652_0000731 | 3300046529 | Bacteria | 38018 |
| 649 | Ga0495652_0004416 | 3300046529 | Bacteria | 13447 |
| 650 | Ga0495652_0005702 | 3300046529 | Bacteria | 11660 |
| 651 | Ga0495652_0030389 | 3300046529 | Bacteria | 4739 |
| 652 | Ga0495652_0067853 | 3300046529 | Bacteria | 2989 |
| 653 | Ga0495665_0019512 | 3300046531 | Bacteria | 3646 |
| 654 | Ga0495640_0010835 | 3300046533 | Bacteria | 7034 |
| 655 | Ga0495640_0056712 | 3300046533 | Bacteria | 2675 |
| 656 | Ga0495640_0125088 | 3300046533 | Bacteria | 1668 |
| 657 | Ga0495586_0062901 | 3300046535 | Bacteria | 2021 |
| 658 | Ga0495586_0139911 | 3300046535 | Bacteria | 1358 |
| 659 | Ga0495587_0003110 | 3300046536 | Bacteria | 11099 |
| 660 | Ga0495587_0007004 | 3300046536 | Bacteria | 7321 |
| 661 | Ga0495587_0037051 | 3300046536 | Bacteria | 2931 |
| 662 | Ga0495609_0053328 | 3300046538 | Bacteria | 1798 |
| 663 | Ga0495645_0011691 | 3300046543 | Bacteria | 6179 |
| 664 | Ga0495645_0061719 | 3300046543 | Bacteria | 2716 |
| 665 | Ga0495645_0078745 | 3300046543 | Bacteria | 2368 |
| 666 | Ga0495645_0196281 | 3300046543 | Bacteria | 1372 |
| 667 | Ga0495622_0132949 | 3300046557 | Bacteria | 1132 |
| 668 | Ga0495667_0000230 | 3300046559 | Bacteria | 36657 |
| 669 | Ga0495667_0012947 | 3300046559 | Bacteria | 5655 |
| 670 | Ga0495667_0028768 | 3300046559 | Bacteria | 3742 |
| 671 | Ga0495667_0038181 | 3300046559 | Bacteria | 3198 |
| 672 | Ga0495667_0069636 | 3300046559 | Bacteria | 2296 |
| 673 | Ga0495667_0071785 | 3300046559 | Bacteria | 2257 |
| 674 | Ga0495656_0024362 | 3300046615 | Bacteria | 2389 |
| 675 | Ga0495656_0105436 | 3300046615 | Bacteria | 1310 |
| 676 | Ga0495656_0164777 | 3300046615 | Bacteria | 1079 |
| 677 | Ga0495634_0010984 | 3300046642 | Bacteria | 6610 |
| 678 | Ga0495611_0141861 | 3300046648 | Bacteria | 1122 |
| 679 | Ga0495635_0015411 | 3300046663 | Bacteria | 5346 |
| 680 | Ga0495635_0028333 | 3300046663 | Bacteria | 3892 |
| 681 | Ga0495635_0063918 | 3300046663 | Bacteria | 2527 |
| 682 | Ga0495635_0203332 | 3300046663 | Bacteria | 1343 |
| 683 | Ga0495659_0047392 | 3300046664 | Bacteria | 1554 |
| 684 | Ga0495659_0113245 | 3300046664 | Unclassified | 1061 |
| 685 | Ga0495588_0034182 | 3300046674 | Bacteria | 2572 |
| 686 | Ga0495657_0006566 | 3300046675 | Bacteria | 9087 |
| 687 | Ga0495657_0015874 | 3300046675 | Bacteria | 5498 |
| 688 | Ga0495657_0029078 | 3300046675 | Bacteria | 3879 |
| 689 | Ga0495657_0049466 | 3300046675 | Bacteria | 2831 |
| 690 | Ga0495657_0095821 | 3300046675 | Bacteria | 1896 |
| 691 | Ga0495657_0106551 | 3300046675 | Bacteria | 1780 |
| 692 | Ga0495599_0024054 | 3300046678 | Bacteria | 3809 |
| 693 | Ga0495599_0107418 | 3300046678 | Bacteria | 1739 |
| 694 | Ga0495623_0010932 | 3300046679 | Bacteria | 5874 |
| 695 | Ga0495623_0011007 | 3300046679 | Bacteria | 5854 |
| 696 | Ga0495623_0050003 | 3300046679 | Bacteria | 2649 |
| 697 | Ga0495623_0065624 | 3300046679 | Bacteria | 2269 |
| 698 | Ga0495646_0001297 | 3300046680 | Bacteria | 14748 |
| 699 | Ga0495646_0052943 | 3300046680 | Bacteria | 2449 |
| 700 | Ga0495647_0162727 | 3300046681 | Bacteria | 962 |
| 701 | Ga0495613_0026413 | 3300046689 | Bacteria | 4326 |
| 702 | Ga0495613_0026934 | 3300046689 | Bacteria | 4280 |
| 703 | Ga0495624_0057729 | 3300046690 | Bacteria | 2440 |
| 704 | Ga0495670_0102710 | 3300046691 | Bacteria | 1473 |
| 705 | Ga0495671_0101040 | 3300046692 | Bacteria | 1410 |
| 706 | Ga0495600_0011317 | 3300046809 | Bacteria | 5558 |
| 707 | Ga0495600_0033653 | 3300046809 | Bacteria | 3326 |
| 708 | Ga0495600_0073269 | 3300046809 | Bacteria | 2236 |
| 709 | Ga0495600_0290193 | 3300046809 | Bacteria | 1034 |
| 710 | Ga0495604_0009037 | 3300047317 | Bacteria | 7883 |
| 711 | Ga0495604_0027235 | 3300047317 | Bacteria | 4547 |
| 712 | Ga0495604_0047627 | 3300047317 | Bacteria | 3338 |
| 713 | Ga0495604_0388611 | 3300047317 | Unclassified | 921 |
| 714 | Ga0495674_0064492 | 3300047319 | Bacteria | 3184 |
| 715 | Ga0495674_0084036 | 3300047319 | Bacteria | 2728 |
| 716 | Ga0495674_0188857 | 3300047319 | Bacteria | 1713 |
| 717 | Ga0495674_0399777 | 3300047319 | Bacteria | 1109 |
| 718 | Ga0495676_0248073 | 3300047321 | Bacteria | 1216 |
| 719 | Ga0495680_0015996 | 3300047322 | Bacteria | 6453 |
| 720 | Ga0495680_0027890 | 3300047322 | Bacteria | 4633 |
| 721 | Ga0495680_0028167 | 3300047322 | Bacteria | 4608 |
| 722 | Ga0495680_0040467 | 3300047322 | Bacteria | 3714 |
| 723 | Ga0495680_0116584 | 3300047322 | Bacteria | 1975 |
| 724 | Ga0495680_0163577 | 3300047322 | Bacteria | 1614 |
| 725 | Ga0495680_0348849 | 3300047322 | Bacteria | 1031 |
| 726 | Ga0495675_0073953 | 3300047444 | Bacteria | 2148 |
| 727 | Ga0495684_0039835 | 3300047471 | Bacteria | 3602 |
| 728 | Ga0495684_0055703 | 3300047471 | Bacteria | 3015 |
| 729 | Ga0495602_0003730 | 3300048088 | Bacteria | 15821 |
| 730 | Ga0495602_0022067 | 3300048088 | Bacteria | 6239 |
| 731 | Ga0495602_0053308 | 3300048088 | Bacteria | 3583 |
| 732 | Ga0495602_0209220 | 3300048088 | Bacteria | 1482 |
| 733 | Ga0496100_0131438 | 3300048903 | Bacteria | 1764 |
| 734 | Ga0496100_0246021 | 3300048903 | Bacteria | 1321 |
| 735 | Ga0496100_0568345 | 3300048903 | Unclassified | 878 |
| 736 | Ga0496101_0009273 | 3300048904 | Bacteria | 6462 |
| 737 | Ga0496101_0054617 | 3300048904 | Bacteria | 2884 |
| 738 | Ga0496101_0066251 | 3300048904 | Bacteria | 2634 |
| 739 | Ga0496102_0038032 | 3300048905 | Bacteria | 4341 |
| 740 | Ga0496102_0168099 | 3300048905 | Unclassified | 2064 |
| 741 | Ga0496104_0013522 | 3300048907 | Bacteria | 7353 |
| 742 | Ga0496104_0027757 | 3300048907 | Bacteria | 5239 |
| 743 | Ga0496104_0046157 | 3300048907 | Bacteria | 4101 |
| 744 | Ga0496104_0074089 | 3300048907 | Bacteria | 3241 |
| 745 | Ga0496104_0104810 | 3300048907 | Bacteria | 2710 |
| 746 | Ga0496105_0011075 | 3300048908 | Bacteria | 7108 |
| 747 | Ga0496105_0051797 | 3300048908 | Bacteria | 3390 |
| 748 | Ga0496105_0105840 | 3300048908 | Bacteria | 2322 |
| 749 | Ga0496106_0009855 | 3300048909 | Bacteria | 7055 |
| 750 | Ga0496106_0034483 | 3300048909 | Bacteria | 3780 |
| 751 | Ga0496106_0136090 | 3300048909 | Unclassified | 1930 |
| 752 | Ga0496107_0083340 | 3300048910 | Bacteria | 2332 |
| 753 | Ga0496108_0024011 | 3300048911 | Bacteria | 5019 |
| 754 | Ga0496108_0027816 | 3300048911 | Bacteria | 4674 |
| 755 | Ga0496108_0073268 | 3300048911 | Bacteria | 2891 |
| 756 | Ga0496108_0111865 | 3300048911 | Bacteria | 2336 |
| 757 | Ga0496108_0272712 | 3300048911 | Bacteria | 1473 |
| 758 | Ga0496109_0023936 | 3300048912 | Bacteria | 5423 |
| 759 | Ga0496109_0031186 | 3300048912 | Bacteria | 4782 |
| 760 | Ga0496109_0063514 | 3300048912 | Bacteria | 3378 |
| 761 | Ga0496109_0077477 | 3300048912 | Bacteria | 3059 |
| 762 | Ga0496109_0126967 | 3300048912 | Bacteria | 2378 |
| 763 | Ga0496109_0198975 | 3300048912 | Bacteria | 1884 |
| 764 | Ga0496109_0623882 | 3300048912 | Bacteria | 1015 |
| 765 | Ga0496110_0081573 | 3300048913 | Bacteria | 2883 |
| 766 | Ga0496110_0094205 | 3300048913 | Bacteria | 2681 |
| 767 | Ga0496110_0103784 | 3300048913 | Bacteria | 2550 |
| 768 | Ga0496111_0017139 | 3300048914 | Bacteria | 5003 |
| 769 | Ga0496111_0062831 | 3300048914 | Bacteria | 2693 |
| 770 | Ga0496111_0076770 | 3300048914 | Bacteria | 2435 |
| 771 | Ga0496111_0083739 | 3300048914 | Bacteria | 2331 |
| 772 | Ga0496111_0132876 | 3300048914 | Bacteria | 1842 |
| 773 | Ga0496112_0006374 | 3300048915 | Bacteria | 10357 |
| 774 | Ga0496112_0169183 | 3300048915 | Bacteria | 2151 |
| 775 | Ga0496112_0176229 | 3300048915 | Bacteria | 2103 |
| 776 | Ga0496112_0182905 | 3300048915 | Bacteria | 2060 |
| 777 | Ga0496113_0011428 | 3300048916 | Bacteria | 5922 |
| 778 | Ga0496113_0013158 | 3300048916 | Bacteria | 5591 |
| 779 | Ga0496113_0045651 | 3300048916 | Bacteria | 3250 |
| 780 | Ga0496113_0186785 | 3300048916 | Bacteria | 1644 |
| 781 | Ga0496113_0343534 | 3300048916 | Unclassified | 1197 |
| 782 | Ga0496114_0016291 | 3300048917 | Bacteria | 5987 |
| 783 | Ga0496114_0207742 | 3300048917 | Unclassified | 1716 |
| 784 | Ga0496115_0002340 | 3300048918 | Bacteria | 13593 |
| 785 | Ga0496115_0326532 | 3300048918 | Bacteria | 1254 |
| 786 | Ga0496126_0047192 | 3300048929 | Bacteria | 3944 |
| 787 | Ga0496126_0166963 | 3300048929 | Bacteria | 1878 |
| 788 | Ga0501031_0004126 | 3300049568 | Bacteria | 9382 |
| 789 | Ga0501031_0008038 | 3300049568 | Bacteria | 6869 |
| 790 | Ga0501031_0021617 | 3300049568 | Bacteria | 4194 |
| 791 | Ga0501031_0100417 | 3300049568 | Bacteria | 1888 |
| 792 | Ga0501032_0023141 | 3300049569 | Bacteria | 4301 |
| 793 | Ga0501032_0052254 | 3300049569 | Bacteria | 2754 |
| 794 | Ga0501033_0006419 | 3300049570 | Bacteria | 9208 |
| 795 | Ga0501033_0041685 | 3300049570 | Bacteria | 3424 |
| 796 | Ga0501033_0074091 | 3300049570 | Bacteria | 2499 |
| 797 | Ga0501034_0021538 | 3300049571 | Bacteria | 6568 |
| 798 | Ga0501036_0000868 | 3300049572 | Bacteria | 22508 |
| 799 | Ga0501036_0018563 | 3300049572 | Bacteria | 5830 |
| 800 | Ga0501036_0033097 | 3300049572 | Bacteria | 4371 |
| 801 | Ga0501036_0048287 | 3300049572 | Bacteria | 3603 |
| 802 | Ga0501036_0051775 | 3300049572 | Bacteria | 3477 |
| 803 | Ga0501037_0007242 | 3300049573 | Bacteria | 8104 |
| 804 | Ga0501037_0031573 | 3300049573 | Bacteria | 3911 |
| 805 | Ga0501037_0075919 | 3300049573 | Bacteria | 2440 |
| 806 | Ga0501037_0182984 | 3300049573 | Bacteria | 1486 |
| 807 | Ga0501038_0015642 | 3300049574 | Bacteria | 6896 |
| 808 | Ga0501038_0016922 | 3300049574 | Bacteria | 6598 |
| 809 | Ga0501038_0018692 | 3300049574 | Bacteria | 6257 |
| 810 | Ga0501038_0023764 | 3300049574 | Bacteria | 5476 |
| 811 | Ga0501038_0051125 | 3300049574 | Bacteria | 3568 |
| 812 | Ga0501039_0001861 | 3300049575 | Bacteria | 15592 |
| 813 | Ga0501039_0017741 | 3300049575 | Bacteria | 5460 |
| 814 | Ga0501039_0018772 | 3300049575 | Bacteria | 5308 |
| 815 | Ga0501039_0027934 | 3300049575 | Bacteria | 4340 |
| 816 | Ga0501039_0064832 | 3300049575 | Bacteria | 2832 |
| 817 | Ga0501039_0120346 | 3300049575 | Bacteria | 2057 |
| 818 | Ga0501040_0000619 | 3300049576 | Bacteria | 21740 |
| 819 | Ga0501040_0006111 | 3300049576 | Bacteria | 7812 |
| 820 | Ga0501040_0027955 | 3300049576 | Bacteria | 3799 |
| 821 | Ga0501040_0028606 | 3300049576 | Bacteria | 3758 |
| 822 | Ga0501040_0063177 | 3300049576 | Bacteria | 2547 |
| 823 | Ga0501040_0152897 | 3300049576 | Bacteria | 1628 |
| 824 | Ga0501040_0324886 | 3300049576 | Bacteria | 1101 |
| 825 | Ga0501041_0009934 | 3300049577 | Bacteria | 5606 |
| 826 | Ga0501041_0015722 | 3300049577 | Bacteria | 4494 |
| 827 | Ga0501041_0019945 | 3300049577 | Bacteria | 4005 |
| 828 | Ga0501041_0044119 | 3300049577 | Bacteria | 2711 |
| 829 | Ga0501041_0090993 | 3300049577 | Bacteria | 1883 |
| 830 | Ga0501042_0000527 | 3300049578 | Bacteria | 19961 |
| 831 | Ga0501042_0003690 | 3300049578 | Bacteria | 9666 |
| 832 | Ga0501042_0012887 | 3300049578 | Bacteria | 5678 |
| 833 | Ga0501042_0014056 | 3300049578 | Bacteria | 5458 |
| 834 | Ga0501042_0020232 | 3300049578 | Bacteria | 4630 |
| 835 | Ga0501042_0042241 | 3300049578 | Bacteria | 3244 |
| 836 | Ga0501042_0063576 | 3300049578 | Bacteria | 2637 |
| 837 | Ga0501043_0024448 | 3300049579 | Bacteria | 4740 |
| 838 | Ga0501043_0082154 | 3300049579 | Bacteria | 2532 |
| 839 | Ga0501043_0117736 | 3300049579 | Bacteria | 2084 |
| 840 | Ga0501046_0004361 | 3300049580 | Bacteria | 12872 |
| 841 | Ga0501046_0016569 | 3300049580 | Bacteria | 6166 |
| 842 | Ga0501046_0039274 | 3300049580 | Bacteria | 3791 |
| 843 | Ga0501046_0055033 | 3300049580 | Bacteria | 3128 |
| 844 | Ga0501046_0164252 | 3300049580 | Bacteria | 1668 |
| 845 | Ga0501046_0289404 | 3300049580 | Bacteria | 1198 |
| 846 | Ga0501047_0066722 | 3300049581 | Bacteria | 3469 |
| 847 | Ga0501047_0077290 | 3300049581 | Bacteria | 3203 |
| 848 | Ga0501048_0002081 | 3300049582 | Bacteria | 15238 |
| 849 | Ga0501048_0005088 | 3300049582 | Bacteria | 10014 |
| 850 | Ga0501048_0018107 | 3300049582 | Bacteria | 5182 |
| 851 | Ga0501048_0026018 | 3300049582 | Bacteria | 4262 |
| 852 | Ga0501048_0053249 | 3300049582 | Bacteria | 2879 |
| 853 | Ga0501048_0060399 | 3300049582 | Bacteria | 2686 |
| 854 | Ga0501067_0207509 | 3300049583 | Bacteria | 1091 |
| 855 | Ga0501067_0268008 | 3300049583 | Bacteria | 951 |
| 856 | Ga0501068_0000603 | 3300049584 | Bacteria | 18272 |
| 857 | Ga0501068_0032489 | 3300049584 | Bacteria | 3104 |
| 858 | Ga0501068_0046981 | 3300049584 | Bacteria | 2603 |
| 859 | Ga0501068_0135083 | 3300049584 | Bacteria | 1544 |
| 860 | Ga0501069_0000228 | 3300049585 | Bacteria | 25115 |
| 861 | Ga0501070_0016833 | 3300049586 | Bacteria | 6136 |
| 862 | Ga0501070_0109830 | 3300049586 | Bacteria | 2279 |
| 863 | Ga0501071_0001890 | 3300049587 | Bacteria | 12447 |
| 864 | Ga0501071_0005701 | 3300049587 | Bacteria | 8027 |
| 865 | Ga0501071_0007010 | 3300049587 | Bacteria | 7360 |
| 866 | Ga0501071_0009056 | 3300049587 | Bacteria | 6608 |
| 867 | Ga0501071_0032918 | 3300049587 | Bacteria | 3682 |
| 868 | Ga0501072_0003544 | 3300049588 | Bacteria | 11742 |
| 869 | Ga0501072_0019574 | 3300049588 | Bacteria | 5234 |
| 870 | Ga0501072_0021349 | 3300049588 | Bacteria | 5022 |
| 871 | Ga0501072_0024736 | 3300049588 | Bacteria | 4673 |
| 872 | Ga0501072_0151183 | 3300049588 | Bacteria | 1851 |
| 873 | Ga0501072_0369699 | 3300049588 | Bacteria | 1138 |
| 874 | Ga0501073_0001635 | 3300049589 | Bacteria | 16616 |
| 875 | Ga0501073_0080222 | 3300049589 | Bacteria | 2271 |
| 876 | Ga0501073_0193559 | 3300049589 | Bacteria | 1407 |
| 877 | Ga0501074_0003309 | 3300049590 | Bacteria | 11397 |
| 878 | Ga0501074_0017125 | 3300049590 | Bacteria | 5257 |
| 879 | Ga0501074_0018704 | 3300049590 | Bacteria | 5033 |
| 880 | Ga0501074_0019408 | 3300049590 | Bacteria | 4938 |
| 881 | Ga0501074_0126060 | 3300049590 | Bacteria | 1831 |
| 882 | Ga0501075_0000224 | 3300049591 | Bacteria | 30212 |
| 883 | Ga0501075_0002582 | 3300049591 | Bacteria | 12084 |
| 884 | Ga0501075_0022840 | 3300049591 | Bacteria | 4574 |
| 885 | Ga0501075_0028323 | 3300049591 | Bacteria | 4134 |
| 886 | Ga0501075_0069950 | 3300049591 | Bacteria | 2652 |
| 887 | Ga0501075_0105506 | 3300049591 | Bacteria | 2141 |
| 888 | Ga0501076_0000544 | 3300049592 | Bacteria | 24072 |
| 889 | Ga0501076_0014133 | 3300049592 | Bacteria | 6003 |
| 890 | Ga0501076_0014229 | 3300049592 | Bacteria | 5988 |
| 891 | Ga0501076_0021406 | 3300049592 | Bacteria | 4959 |
| 892 | Ga0501076_0252599 | 3300049592 | Bacteria | 1443 |
| 893 | Ga0501077_0002174 | 3300049593 | Bacteria | 11848 |
| 894 | Ga0501077_0005502 | 3300049593 | Bacteria | 7702 |
| 895 | Ga0501077_0148021 | 3300049593 | Bacteria | 1490 |
| 896 | Ga0501077_0180999 | 3300049593 | Bacteria | 1340 |
| 897 | Ga0501079_0000269 | 3300049741 | Bacteria | 31990 |
| 898 | Ga0501079_0008835 | 3300049741 | Bacteria | 7629 |
| 899 | Ga0501079_0014148 | 3300049741 | Bacteria | 6081 |
| 900 | Ga0501079_0016461 | 3300049741 | Bacteria | 5645 |
| 901 | Ga0501079_0052197 | 3300049741 | Bacteria | 3156 |
| 902 | Ga0501079_0418211 | 3300049741 | Bacteria | 1052 |
| 903 | Ga0501080_0033224 | 3300049742 | Bacteria | 4815 |
| 904 | Ga0501080_0055307 | 3300049742 | Bacteria | 3696 |
| 905 | Ga0501080_0179308 | 3300049742 | Bacteria | 1950 |
| 906 | Ga0501081_0006116 | 3300049743 | Bacteria | 7802 |
| 907 | Ga0501081_0015908 | 3300049743 | Bacteria | 4967 |
| 908 | Ga0501081_0022842 | 3300049743 | Bacteria | 4187 |
| 909 | Ga0501081_0117170 | 3300049743 | Bacteria | 1894 |
| 910 | Ga0501083_0005179 | 3300049744 | Bacteria | 9222 |
| 911 | Ga0501083_0019519 | 3300049744 | Bacteria | 4721 |
| 912 | Ga0501083_0028477 | 3300049744 | Bacteria | 3849 |
| 913 | Ga0501083_0099647 | 3300049744 | Bacteria | 1916 |
| 914 | Ga0501035_0045429 | 3300049822 | Bacteria | 3952 |
| 915 | Ga0501035_0249737 | 3300049822 | Bacteria | 1507 |
| 916 | Ga0501044_0005842 | 3300049823 | Bacteria | 13629 |
| 917 | Ga0501044_0039522 | 3300049823 | Bacteria | 4922 |
| 918 | Ga0501044_0097613 | 3300049823 | Bacteria | 2959 |
| 919 | Ga0501045_0000261 | 3300049824 | Bacteria | 30562 |
| 920 | Ga0501045_0009032 | 3300049824 | Bacteria | 6962 |
| 921 | Ga0501045_0015095 | 3300049824 | Bacteria | 5482 |
| 922 | Ga0501045_0028504 | 3300049824 | Bacteria | 4028 |
| 923 | Ga0501045_0135190 | 3300049824 | Bacteria | 1833 |
| 924 | Ga0501045_0361747 | 3300049824 | Bacteria | 1080 |
| 925 | nmdc:mga05p37_192922_c1 | 3300050507 | Bacteria | 2472 |
| 926 | nmdc:mga05p37_223895_c1 | 3300050507 | Bacteria | 2269 |
| 927 | nmdc:mga05p37_312751_c1 | 3300050507 | Bacteria | 1861 |
| 928 | nmdc:mga05p37_68759_c2 | 3300050507 | Bacteria | 2612 |
| 929 | nmdc:mga05p37_7014_c1 | 3300050507 | Bacteria | 13281 |
| 930 | nmdc:mga09592_105203_c1 | 3300050508 | Bacteria | 2419 |
| 931 | nmdc:mga09592_12307_c1 | 3300050508 | Bacteria | 6967 |
| 932 | nmdc:mga0qj67_74070_c1 | 3300050509 | Bacteria | 2721 |
| 933 | nmdc:mga06r32_497521_c1 | 3300050510 | Unclassified | 1196 |
| 934 | nmdc:mga06r32_65967_c1 | 3300050510 | Bacteria | 3493 |
| 935 | nmdc:mga08y16_56483_c1 | 3300050511 | Bacteria | 4103 |
| 936 | nmdc:mga0n895_20018_c1 | 3300050512 | Bacteria | 6231 |
| 937 | nmdc:mga0n895_238296_c1 | 3300050512 | Bacteria | 1846 |
| 938 | nmdc:mga0n895_31992_c1 | 3300050512 | Bacteria | 5044 |
| 939 | nmdc:mga0n895_382426_c1 | 3300050512 | Bacteria | 1424 |
| 940 | nmdc:mga0n895_46907_c1 | 3300050512 | Bacteria | 4223 |
| 941 | nmdc:mga0n895_47781_c1 | 3300050512 | Bacteria | 4186 |
| 942 | nmdc:mga0n895_70162_c1 | 3300050512 | Bacteria | 3473 |
| 943 | nmdc:mga0rr50_291791_c1 | 3300050513 | Bacteria | 1363 |
| 944 | nmdc:mga0rr50_58822_c1 | 3300050513 | Bacteria | 2882 |
| 945 | nmdc:mga0rr50_73518_c1 | 3300050513 | Bacteria | 2614 |
| 946 | nmdc:mga08x19_17380_c1 | 3300050514 | Bacteria | 4400 |
| 947 | nmdc:mga08x19_43265_c1 | 3300050514 | Bacteria | 2873 |
| 948 | nmdc:mga0a205_152773_c1 | 3300050515 | Bacteria | 2207 |
| 949 | nmdc:mga0a205_16824_c1 | 3300050515 | Bacteria | 6849 |
| 950 | nmdc:mga0a205_52657_c1 | 3300050515 | Bacteria | 3928 |
| 951 | nmdc:mga0a205_73016_c1 | 3300050515 | Bacteria | 3315 |
| 952 | nmdc:mga0a205_783369_c1 | 3300050515 | Bacteria | 801 |
| 953 | nmdc:mga0a205_7938_c1 | 3300050515 | Bacteria | 9638 |
| 954 | Ga0495601_0004265 | 3300053077 | Bacteria | 8257 |
| 955 | Ga0495601_0188601 | 3300053077 | Bacteria | 1348 |
| 956 | Ga0495612_0012471 | 3300053078 | Bacteria | 3426 |
| 957 | Ga0495612_0020207 | 3300053078 | Bacteria | 2669 |
| 958 | Ga0495619_0123606 | 3300053085 | Bacteria | 1775 |
| 959 | Ga0501084_0009738 | 3300054114 | Bacteria | 7949 |
| 960 | Ga0501084_0025891 | 3300054114 | Bacteria | 4892 |
| 961 | Ga0501084_0030837 | 3300054114 | Bacteria | 4482 |
| 962 | Ga0501084_0052286 | 3300054114 | Bacteria | 3418 |
| 963 | Ga0501084_0064590 | 3300054114 | Bacteria | 3062 |
| 964 | Ga0501084_0212425 | 3300054114 | Bacteria | 1632 |
| 965 | Ga0590074_003008 | 3300059423 | Bacteria | 2783 |
| 966 | Ga0590075_025083 | 3300059424 | Bacteria | 1498 |
| 967 | Ga0590077_003153 | 3300059426 | Bacteria | 3447 |
| 968 | Ga0590077_007353 | 3300059426 | Bacteria | 2253 |
| 969 | Ga0501082_0000767 | 3300060353 | Bacteria | 28110 |
| 970 | Ga0501082_0020138 | 3300060353 | Bacteria | 5748 |
| 971 | Ga0501082_0043677 | 3300060353 | Bacteria | 3865 |
| 972 | Ga0501082_0050136 | 3300060353 | Bacteria | 3600 |
| 973 | Ga0466962_0005687 | 3300061719 | Bacteria | 5990 |
| 974 | Ga0530510_0001223 | 3300061734 | Bacteria | 17156 |
| 975 | Ga0530510_0005952 | 3300061734 | Bacteria | 8458 |
| 976 | Ga0530510_0109172 | 3300061734 | Bacteria | 2025 |
| 977 | Ga0530510_0258128 | 3300061734 | Bacteria | 1299 |
| 978 | 2891402858 | 2891395885 | Bacteria | 9251614 |
| 979 | 2891554832 | 2891554331 | Bacteria | 8812224 |
| 980 | 2997457445 | 2997451912 | Bacteria | 8492419 |
| 981 | Ga0496102_0281896 | |||
| 982 | Ga0070683_100060765 | |||
| 983 | Ga0070670_100102969 | |||
| 984 | Ga0070680_100129875 | |||
| 985 | Ga0070682_100159670 | |||
| 986 | Ga0070682_100203147 | |||
| 987 | Ga0068868_100028993 | |||
| 988 | Ga0068868_100042560 | |||
| 989 | Ga0070660_100257304 | |||
| 990 | Ga0070689_100121780 | |||
| 991 | Ga0070689_100546938 | |||
| 992 | Ga0070691_10084472 | |||
| 993 | Ga0070661_100215459 | |||
| 994 | Ga0070669_100235960 | |||
| 995 | Ga0070703_10000005 | |||
| 996 | Ga0070703_10011257 | |||
| 997 | Ga0070709_10000936 | |||
| 998 | Ga0070709_10010332 | |||
| 999 | Ga0070709_10017721 | |||
| 1000 | Ga0070709_10037240 | |||
| 1001 | Ga0070714_100008560 | |||
| 1002 | Ga0070714_100015228 | |||
| 1003 | Ga0070714_100075357 | |||
| 1004 | Ga0070714_100146227 | |||
| 1005 | Ga0070714_100217442 | |||
| 1006 | Ga0070714_100524625 | |||
| 1007 | Ga0070714_100878267 | |||
| 1008 | Ga0070713_100002341 | |||
| 1009 | Ga0070713_100020797 | |||
| 1010 | Ga0070713_100030612 | |||
| 1011 | Ga0070713_100101020 | |||
| 1012 | Ga0070713_100120831 | |||
| 1013 | Ga0070713_100132283 | |||
| 1014 | Ga0070713_100153967 | |||
| 1015 | Ga0070713_100249147 | |||
| 1016 | Ga0070713_100327440 | |||
| 1017 | Ga0070713_100477227 | |||
| 1018 | Ga0070710_10003344 | |||
| 1019 | Ga0070710_10003544 | |||
| 1020 | Ga0070710_10016273 | |||
| 1021 | Ga0070710_10063649 | |||
| 1022 | Ga0070701_10050836 | |||
| 1023 | Ga0070711_100001972 | |||
| 1024 | Ga0070711_100019864 | |||
| 1025 | Ga0070711_100022459 | |||
| 1026 | Ga0070711_100022794 | |||
| 1027 | Ga0070711_100048894 | |||
| 1028 | Ga0070711_100389002 | |||
| 1029 | Ga0070711_100591675 | |||
| 1030 | Ga0070705_100008189 | |||
| 1031 | Ga0070705_100029213 | |||
| 1032 | Ga0070705_100140657 | |||
| 1033 | Ga0070694_100038314 | |||
| 1034 | Ga0070694_100334090 | |||
| 1035 | Ga0070708_100000074 | |||
| 1036 | Ga0070708_100001238 | |||
| 1037 | Ga0070708_100001603 | |||
| 1038 | Ga0070708_100118040 | |||
| 1039 | Ga0070708_100153843 | |||
| 1040 | Ga0070708_100181477 | |||
| 1041 | Ga0070708_100675851 | |||
| 1042 | Ga0070663_100024890 | |||
| 1043 | Ga0070663_100075280 | |||
| 1044 | Ga0070663_100091646 | |||
| 1045 | Ga0070678_100020458 | |||
| 1046 | Ga0070678_100620959 | |||
| 1047 | Ga0070662_100125049 | |||
| 1048 | Ga0070681_10015186 | |||
| 1049 | Ga0070681_10268021 | |||
| 1050 | Ga0070681_10408939 | |||
| 1051 | Ga0070681_10457813 | |||
| 1052 | Ga0068867_100175967 | |||
| 1053 | Ga0070706_100001907 | |||
| 1054 | Ga0070706_100006141 | |||
| 1055 | Ga0070706_100007464 | |||
| 1056 | Ga0070706_100021579 | |||
| 1057 | Ga0070706_100027442 | |||
| 1058 | Ga0070706_100031066 | |||
| 1059 | Ga0070706_100070908 | |||
| 1060 | Ga0070706_100073130 | |||
| 1061 | Ga0070706_100078530 | |||
| 1062 | Ga0070706_100152939 | |||
| 1063 | Ga0070706_100200826 | |||
| 1064 | Ga0070706_100589054 | |||
| 1065 | Ga0070707_100000637 | |||
| 1066 | Ga0070707_100002195 | |||
| 1067 | Ga0070707_100004568 | |||
| 1068 | Ga0070707_100005640 | |||
| 1069 | Ga0070707_100009909 | |||
| 1070 | Ga0070707_100024185 | |||
| 1071 | Ga0070707_100031092 | |||
| 1072 | Ga0070707_100042754 | |||
| 1073 | Ga0070707_100057084 | |||
| 1074 | Ga0070707_100057133 | |||
| 1075 | Ga0070707_100084603 | |||
| 1076 | Ga0070707_100113629 | |||
| 1077 | Ga0070707_100158398 | |||
| 1078 | Ga0070707_100255719 | |||
| 1079 | Ga0070707_100389879 | |||
| 1080 | Ga0070698_100000082 | |||
| 1081 | Ga0070698_100002067 | |||
| 1082 | Ga0070698_100006327 | |||
| 1083 | Ga0070698_100009295 | |||
| 1084 | Ga0070698_100010143 | |||
| 1085 | Ga0070698_100011159 | |||
| 1086 | Ga0070698_100013845 | |||
| 1087 | Ga0070698_100019349 | |||
| 1088 | Ga0070698_100025985 | |||
| 1089 | Ga0070698_100039922 | |||
| 1090 | Ga0070698_100091562 | |||
| 1091 | Ga0070698_100092469 | |||
| 1092 | Ga0070698_100097124 | |||
| 1093 | Ga0070698_100119956 | |||
| 1094 | Ga0070698_100406277 | |||
| 1095 | Ga0070699_100001106 | |||
| 1096 | Ga0070699_100010091 | |||
| 1097 | Ga0070699_100024128 | |||
| 1098 | Ga0070699_100044724 | |||
| 1099 | Ga0070699_100106047 | |||
| 1100 | Ga0070699_100163958 | |||
| 1101 | Ga0070679_100100227 | |||
| 1102 | Ga0070679_100182357 | |||
| 1103 | Ga0070684_100034153 | |||
| 1104 | Ga0070684_100079692 | |||
| 1105 | Ga0070684_100154071 | |||
| 1106 | Ga0070684_100226699 | |||
| 1107 | Ga0070684_100282126 | |||
| 1108 | Ga0070697_100128414 | |||
| 1109 | Ga0070697_100139624 | |||
| 1110 | Ga0070697_100343954 | |||
| 1111 | Ga0070686_100102933 | |||
| 1112 | Ga0070695_100036735 | |||
| 1113 | Ga0070695_100053815 | |||
| 1114 | Ga0070696_100014341 | |||
| 1115 | Ga0070696_100026882 | |||
| 1116 | Ga0070696_100170887 | |||
| 1117 | Ga0070696_100272658 | |||
| 1118 | Ga0070693_100059353 | |||
| 1119 | Ga0070665_100037887 | |||
| 1120 | Ga0070665_100060734 | |||
| 1121 | Ga0070665_100103077 | |||
| 1122 | Ga0068855_100015019 | |||
| 1123 | Ga0068855_100057398 | |||
| 1124 | Ga0068855_100638293 | |||
| 1125 | Ga0070664_100101554 | |||
| 1126 | Ga0068857_100367418 | |||
| 1127 | Ga0068854_100245493 | |||
| 1128 | Ga0068856_100042997 | |||
| 1129 | Ga0068856_100288919 | |||
| 1130 | Ga0068856_100389414 | |||
| 1131 | Ga0068856_100782337 | |||
| 1132 | Ga0070702_100040027 | |||
| 1133 | Ga0070702_100097035 | |||
| 1134 | Ga0068852_100012576 | |||
| 1135 | Ga0068852_100037902 | |||
| 1136 | Ga0068852_100279856 | |||
| 1137 | Ga0068864_100151195 | |||
| 1138 | Ga0068866_10013129 | |||
| 1139 | Ga0068861_100084029 | |||
| 1140 | Ga0068863_100015496 | |||
| 1141 | Ga0068858_100013504 | |||
| 1142 | Ga0068858_100338018 | |||
| 1143 | Ga0068858_100389930 | |||
| 1144 | Ga0068860_100303023 | |||
| 1145 | Ga0068860_100483283 | |||
| 1146 | Ga0081455_10008399 | |||
| 1147 | Ga0081538_10002838 | |||
| 1148 | Ga0081538_10003979 | |||
| 1149 | Ga0081538_10004688 | |||
| 1150 | Ga0081538_10075464 | |||
| 1151 | Ga0081540_1001407 | |||
| 1152 | Ga0081539_10005520 | |||
| 1153 | Ga0081539_10019810 | |||
| 1154 | Ga0081539_10044537 | |||
| 1155 | Ga0070717_10006347 | |||
| 1156 | Ga0070717_10006576 | |||
| 1157 | Ga0070717_10017441 | |||
| 1158 | Ga0070717_10019394 | |||
| 1159 | Ga0070717_10033140 | |||
| 1160 | Ga0070717_10060140 | |||
| 1161 | Ga0070717_10091920 | |||
| 1162 | Ga0070717_10634615 | |||
| 1163 | Ga0070715_10001082 | |||
| 1164 | Ga0070715_10002235 | |||
| 1165 | Ga0070715_10010780 | |||
| 1166 | Ga0070715_10034807 | |||
| 1167 | Ga0070716_100002738 | |||
| 1168 | Ga0070716_100007339 | |||
| 1169 | Ga0070716_100011043 | |||
| 1170 | Ga0070712_100009206 | |||
| 1171 | Ga0070712_100027795 | |||
| 1172 | Ga0070712_100029667 | |||
| 1173 | Ga0070712_100153508 | |||
| 1174 | Ga0070712_100186918 | |||
| 1175 | Ga0070712_100189940 | |||
| 1176 | Ga0070712_100190787 | |||
| 1177 | Ga0075427_10006620 | |||
| 1178 | Ga0097621_100027570 | |||
| 1179 | Ga0097621_100239204 | |||
| 1180 | Ga0075428_100151851 | |||
| 1181 | Ga0075428_100376443 | |||
| 1182 | Ga0075430_100003287 | |||
| 1183 | Ga0075431_100002693 | |||
| 1184 | Ga0075431_100224388 | |||
| 1185 | Ga0075433_10015709 | |||
| 1186 | Ga0075433_10046642 | |||
| 1187 | Ga0075433_10054586 | |||
| 1188 | Ga0075433_10716931 | |||
| 1189 | Ga0075434_100001693 | |||
| 1190 | Ga0075434_100022020 | |||
| 1191 | Ga0075434_100054495 | |||
| 1192 | Ga0075434_100060715 | |||
| 1193 | Ga0075434_100282956 | |||
| 1194 | Ga0075429_100037097 | |||
| 1195 | Ga0075429_100176498 | |||
| 1196 | Ga0068865_100011404 | |||
| 1197 | Ga0075436_100050921 | |||
| 1198 | Ga0075436_100126236 | |||
| 1199 | Ga0075436_100544547 | |||
| 1200 | Ga0075435_100024351 | |||
| 1201 | Ga0075435_100073248 | |||
| 1202 | Ga0075435_100096126 | |||
| 1203 | Ga0099794_10155724 | |||
| 1204 | Ga0099795_10027524 | |||
| 1205 | Ga0105240_10011678 | |||
| 1206 | Ga0105240_10057051 | |||
| 1207 | Ga0105240_10793519 | |||
| 1208 | Ga0111539_10009833 | |||
| 1209 | Ga0111539_10381512 | |||
| 1210 | Ga0111539_10448037 | |||
| 1211 | Ga0105245_10026493 | |||
| 1212 | Ga0105245_10254069 | |||
| 1213 | Ga0105245_10395405 | |||
| 1214 | Ga0105245_10688787 | |||
| 1215 | Ga0105247_10308919 | |||
| 1216 | Ga0114129_10066227 | |||
| 1217 | Ga0114129_10095375 | |||
| 1218 | Ga0114129_10202251 | |||
| 1219 | Ga0114129_10226187 | |||
| 1220 | Ga0114129_10356006 | |||
| 1221 | Ga0114129_10399215 | |||
| 1222 | Ga0114129_10496739 | |||
| 1223 | Ga0114129_10651209 | |||
| 1224 | Ga0105243_10039760 | |||
| 1225 | Ga0105243_10081531 | |||
| 1226 | Ga0105243_10223315 | |||
| 1227 | Ga0105241_10015186 | |||
| 1228 | Ga0105248_10010737 | |||
| 1229 | Ga0105248_10049581 | |||
| 1230 | Ga0105237_10039204 | |||
| 1231 | Ga0105237_10134879 | |||
| 1232 | Ga0105237_10580494 | |||
| 1233 | Ga0105238_10007703 | |||
| 1234 | Ga0105238_10438954 | |||
| 1235 | Ga0105238_10528076 | |||
| 1236 | Ga0105249_10011780 | |||
| 1237 | Ga0105249_10013267 | |||
| 1238 | Ga0105249_10173176 | |||
| 1239 | Ga0105249_10344411 | |||
| 1240 | Ga0105239_10025385 | |||
| 1241 | Ga0157370_10036126 | |||
| 1242 | Ga0157370_10073380 | |||
| 1243 | Ga0157370_10153129 | |||
| 1244 | Ga0157370_10163904 | |||
| 1245 | Ga0157369_10008975 | |||
| 1246 | Ga0157369_10046070 | |||
| 1247 | Ga0157369_10079297 | |||
| 1248 | Ga0157369_10115893 | |||
| 1249 | Ga0157369_10185806 | |||
| 1250 | Ga0157374_10036164 | |||
| 1251 | Ga0157374_10056454 | |||
| 1252 | Ga0157378_10005547 | |||
| 1253 | Ga0163162_10079399 | |||
| 1254 | Ga0157372_10123614 | |||
| 1255 | Ga0157372_10350375 | |||
| 1256 | Ga0157372_10803550 | |||
| 1257 | Ga0163163_10017404 | |||
| 1258 | Ga0163163_10224599 | |||
| 1259 | Ga0163163_10324806 | |||
| 1260 | Ga0157380_10899236 | |||
| 1261 | Ga0157379_10017813 | |||
| 1262 | Ga0157379_10202767 | |||
| 1263 | Ga0157376_10126189 | |||
| 1264 | Ga0206351_10697221 | |||
| 1265 | Ga0206350_10034970 | |||
| 1266 | Ga0206354_10010395 | |||
| 1267 | Ga0206354_10248428 | |||
| 1268 | Ga0206354_10358818 | |||
| 1269 | Ga0206353_10982929 | |||
| 1270 | Ga0206353_11739985 | |||
| 1271 | Ga0206353_12011555 | |||
| 1272 | Ga0213875_10000197 | |||
| 1273 | Ga0213875_10000281 | |||
| 1274 | Ga0213875_10000768 | |||
| 1275 | Ga0213875_10134856 | |||
| 1276 | Ga0213875_10146460 | |||
| 1277 | Ga0224712_10001664 | |||
| 1278 | Ga0224712_10095271 | |||
| 1279 | Ga0224712_10245051 | |||
| 1280 | Ga0207426_1000875 | |||
| 1281 | Ga0207653_10000002 | |||
| 1282 | Ga0207692_10000435 | |||
| 1283 | Ga0207692_10001293 | |||
| 1284 | Ga0207692_10005264 | |||
| 1285 | Ga0207692_10009511 | |||
| 1286 | Ga0207685_10000488 | |||
| 1287 | Ga0207685_10013342 | |||
| 1288 | Ga0207685_10087334 | |||
| 1289 | Ga0207699_10001146 | |||
| 1290 | Ga0207699_10002053 | |||
| 1291 | Ga0207699_10004947 | |||
| 1292 | Ga0207699_10028323 | |||
| 1293 | Ga0207699_10035947 | |||
| 1294 | Ga0207699_10084494 | |||
| 1295 | Ga0207684_10000123 | |||
| 1296 | Ga0207684_10000339 | |||
| 1297 | Ga0207684_10000574 | |||
| 1298 | Ga0207684_10009068 | |||
| 1299 | Ga0207684_10013508 | |||
| 1300 | Ga0207684_10047001 | |||
| 1301 | Ga0207684_10071717 | |||
| 1302 | Ga0207684_10076794 | |||
| 1303 | Ga0207684_10078735 | |||
| 1304 | Ga0207684_10092948 | |||
| 1305 | Ga0207684_10167903 | |||
| 1306 | Ga0207684_10373769 | |||
| 1307 | Ga0207684_10558274 | |||
| 1308 | Ga0207707_10047197 | |||
| 1309 | Ga0207707_10189427 | |||
| 1310 | Ga0207695_10001971 | |||
| 1311 | Ga0207695_10033576 | |||
| 1312 | Ga0207671_10000203 | |||
| 1313 | Ga0207671_10246432 | |||
| 1314 | Ga0207693_10005318 | |||
| 1315 | Ga0207693_10005872 | |||
| 1316 | Ga0207693_10011807 | |||
| 1317 | Ga0207693_10034813 | |||
| 1318 | Ga0207693_10055161 | |||
| 1319 | Ga0207693_10109789 | |||
| 1320 | Ga0207693_10397053 | |||
| 1321 | Ga0207663_10001814 | |||
| 1322 | Ga0207663_10006086 | |||
| 1323 | Ga0207663_10028399 | |||
| 1324 | Ga0207663_10039773 | |||
| 1325 | Ga0207663_10103685 | |||
| 1326 | Ga0207663_10243453 | |||
| 1327 | Ga0207660_10437468 | |||
| 1328 | Ga0207657_10027219 | |||
| 1329 | Ga0207649_10215912 | |||
| 1330 | Ga0207652_10024768 | |||
| 1331 | Ga0207652_10337547 | |||
| 1332 | Ga0207646_10000061 | |||
| 1333 | Ga0207646_10001194 | |||
| 1334 | Ga0207646_10002341 | |||
| 1335 | Ga0207646_10004121 | |||
| 1336 | Ga0207646_10018758 | |||
| 1337 | Ga0207646_10027513 | |||
| 1338 | Ga0207646_10052080 | |||
| 1339 | Ga0207646_10053559 | |||
| 1340 | Ga0207646_10054966 | |||
| 1341 | Ga0207646_10073851 | |||
| 1342 | Ga0207646_10112716 | |||
| 1343 | Ga0207646_10255525 | |||
| 1344 | Ga0207694_10002093 | |||
| 1345 | Ga0207650_10023834 | |||
| 1346 | Ga0207659_10292967 | |||
| 1347 | Ga0207687_10099438 | |||
| 1348 | Ga0207687_10277710 | |||
| 1349 | Ga0207687_10596894 | |||
| 1350 | Ga0207700_10000714 | |||
| 1351 | Ga0207700_10003538 | |||
| 1352 | Ga0207700_10004876 | |||
| 1353 | Ga0207700_10018529 | |||
| 1354 | Ga0207700_10020336 | |||
| 1355 | Ga0207700_10027887 | |||
| 1356 | Ga0207700_10071906 | |||
| 1357 | Ga0207700_10222702 | |||
| 1358 | Ga0207700_10229272 | |||
| 1359 | Ga0207700_10260979 | |||
| 1360 | Ga0207700_10293778 | |||
| 1361 | Ga0207700_10430022 | |||
| 1362 | Ga0207700_10619866 | |||
| 1363 | Ga0207664_10000825 | |||
| 1364 | Ga0207664_10004487 | |||
| 1365 | Ga0207664_10010010 | |||
| 1366 | Ga0207664_10012761 | |||
| 1367 | Ga0207664_10014707 | |||
| 1368 | Ga0207664_10022552 | |||
| 1369 | Ga0207664_10023375 | |||
| 1370 | Ga0207664_10164389 | |||
| 1371 | Ga0207664_10251932 | |||
| 1372 | Ga0207664_10316996 | |||
| 1373 | Ga0207664_10722382 | |||
| 1374 | Ga0207690_10353826 | |||
| 1375 | Ga0207706_10015126 | |||
| 1376 | Ga0207706_10254699 | |||
| 1377 | Ga0207670_10099670 | |||
| 1378 | Ga0207670_10343074 | |||
| 1379 | Ga0207704_10039306 | |||
| 1380 | Ga0207704_10192111 | |||
| 1381 | Ga0207665_10001557 | |||
| 1382 | Ga0207665_10002854 | |||
| 1383 | Ga0207665_10003130 | |||
| 1384 | Ga0207665_10004964 | |||
| 1385 | Ga0207665_10008897 | |||
| 1386 | Ga0207665_10351336 | |||
| 1387 | Ga0207711_10034042 | |||
| 1388 | Ga0207711_10063783 | |||
| 1389 | Ga0207711_10378600 | |||
| 1390 | Ga0207661_10138672 | |||
| 1391 | Ga0207661_10301634 | |||
| 1392 | Ga0207661_10317803 | |||
| 1393 | Ga0207661_10513090 | |||
| 1394 | Ga0207661_10633727 | |||
| 1395 | Ga0207679_10255239 | |||
| 1396 | Ga0207679_10420673 | |||
| 1397 | Ga0207667_10021249 | |||
| 1398 | Ga0207667_10028682 | |||
| 1399 | Ga0207667_10311268 | |||
| 1400 | Ga0207712_10010611 | |||
| 1401 | Ga0207712_10064017 | |||
| 1402 | Ga0207712_10553563 | |||
| 1403 | Ga0207668_10107518 | |||
| 1404 | Ga0207640_10083435 | |||
| 1405 | Ga0207640_10423394 | |||
| 1406 | Ga0207677_10146500 | |||
| 1407 | Ga0207703_10055815 | |||
| 1408 | Ga0207678_10040467 | |||
| 1409 | Ga0207678_10043387 | |||
| 1410 | Ga0207678_10115786 | |||
| 1411 | Ga0207678_10620971 | |||
| 1412 | Ga0207708_10033558 | |||
| 1413 | Ga0207702_10096086 | |||
| 1414 | Ga0207702_10131506 | |||
| 1415 | Ga0207702_10208111 | |||
| 1416 | Ga0207641_10022430 | |||
| 1417 | Ga0207641_10458504 | |||
| 1418 | Ga0207648_10064281 | |||
| 1419 | Ga0207676_10036261 | |||
| 1420 | Ga0207676_10313302 | |||
| 1421 | Ga0207676_10338836 | |||
| 1422 | Ga0207674_10024169 | |||
| 1423 | Ga0207674_10067884 | |||
| 1424 | Ga0207674_10179296 | |||
| 1425 | Ga0207675_100009207 | |||
| 1426 | Ga0207675_100064783 | |||
| 1427 | Ga0207683_10039499 | |||
| 1428 | Ga0207683_10174320 | |||
| 1429 | Ga0207683_10664302 | |||
| 1430 | Ga0207698_10039132 | |||
| 1431 | Ga0207698_10118085 | |||
| 1432 | Ga0207698_10859235 | |||
| 1433 | Ga0209179_1042848 | |||
| 1434 | Ga0207428_10002280 | |||
| 1435 | Ga0268266_10140268 | |||
| 1436 | Ga0268264_10209086 | |||
| 1437 | Ga0307512_10158741 | |||
| 1438 | Ga0307408_100162690 | |||
| 1439 | Ga0307405_10010538 | |||
| 1440 | Ga0307405_10015094 | |||
| 1441 | Ga0307405_10098553 | |||
| 1442 | Ga0307413_10031652 | |||
| 1443 | Ga0307413_10035071 | |||
| 1444 | Ga0307410_10001287 | |||
| 1445 | Ga0307410_10010927 | |||
| 1446 | Ga0307410_10251102 | |||
| 1447 | Ga0307406_10111347 | |||
| 1448 | Ga0307407_10024002 | |||
| 1449 | Ga0307409_100002277 | |||
| 1450 | Ga0307409_100018550 | |||
| 1451 | Ga0307409_100027257 | |||
| 1452 | Ga0307409_100101902 | |||
| 1453 | Ga0307416_100001993 | |||
| 1454 | Ga0307416_100005066 | |||
| 1455 | Ga0307416_100032459 | |||
| 1456 | Ga0307416_100209124 | |||
| 1457 | Ga0307414_10023364 | |||
| 1458 | Ga0307414_10113402 | |||
| 1459 | Ga0307411_10049930 | |||
| 1460 | Ga0307411_10142156 | |||
| 1461 | Ga0307415_100000849 | |||
| 1462 | Ga0307415_100021788 | |||
| 1463 | Ga0307415_100023412 | |||
| 1464 | Ga0307415_100183403 | |||
| 1465 | Ga0316212_1006845 | |||
| 1466 | Ga0373930_0002420 | |||
| 1467 | Ga0373948_0010324 | |||
| 1468 | Ga0373958_0001957 | |||
| 1469 | Ga0373938_0002054 | |||
| 1470 | Ga0373934_0007496 | |||
| 1471 | Ga0373940_0014214 | |||
| 1472 | Ga0373949_0012367 | |||
| 1473 | Ga0373951_0009135 | |||
| 1474 | Ga0373951_0019096 | |||
| 1475 | Ga0373939_0003465 | |||
| 1476 | Ga0373941_0008018 | |||
| 1477 | Ga0373941_0038187 | |||
| 1478 | Ga0373954_0055624 | |||
| 1479 | Ga0373954_0184959 | |||
| 1480 | Ga0373956_0051871 | |||
| 1481 | Ga0373957_0012014 | |||
| 1482 | Ga0373957_0041992 | |||
| 1483 | Ga0373957_0101218 | |||
| 1484 | Ga0373960_0015618 | |||
| 1485 | Ga0373943_0015162 | |||
| 1486 | Ga0373943_0074323 | |||
| 1487 | Ga0373943_0229329 | |||
| 1488 | Ga0373943_0230070 | |||
| 1489 | Ga0373955_0190793 | |||
| 1490 | Ga0373942_0007998 | |||
| 1491 | Ga0373961_0006508 | |||
| 1492 | Ga0373961_0025299 | |||
| 1493 | Ga0373924_0048260 | |||
| 1494 | Ga0373931_0004582 | |||
| 1495 | Ga0373935_0010449 | |||
| 1496 | Ga0373933_0008334 | |||
| 1497 | Ga0373933_0015855 | |||
| 1498 | Ga0373933_0184653 | |||
| 1499 | Ga0373947_0146097 | |||
| 1500 | Ga0373937_0020628 | |||
| 1501 | Ga0373937_0134035 | |||
| 1502 | Ga0373937_0324186 | |||
| 1503 | Ga0373925_0003342 | |||
| 1504 | Ga0373925_0057874 | |||
| 1505 | Ga0373925_0058736 | |||
| 1506 | Ga0373925_0145286 | |||
| 1507 | Ga0395899_0004556 | |||
| 1508 | Ga0395899_0048153 | |||
| 1509 | Ga0395899_0070110 | |||
| 1510 | Ga0395899_0144064 | |||
| 1511 | Ga0395899_0192209 | |||
| 1512 | Ga0395900_0005315 | |||
| 1513 | Ga0395900_0033991 | |||
| 1514 | Ga0395900_0117896 | |||
| 1515 | Ga0395900_0123111 | |||
| 1516 | Ga0395900_0141725 | |||
| 1517 | Ga0395900_0167531 | |||
| 1518 | Ga0395900_0382399 | |||
| 1519 | Ga0395900_0932478 | |||
| 1520 | Ga0395898_0002844 | |||
| 1521 | Ga0395898_0012364 | |||
| 1522 | Ga0395898_0131786 | |||
| 1523 | Ga0395898_0275927 | |||
| 1524 | Ga0395898_0758056 | |||
| 1525 | Ga0395905_0001967 | |||
| 1526 | Ga0395905_0041976 | |||
| 1527 | Ga0395905_0170315 | |||
| 1528 | Ga0395905_0331729 | |||
| 1529 | Ga0395905_0557070 | |||
| 1530 | Ga0436364_0025330 | |||
| 1531 | Ga0436364_0077046 | |||
| 1532 | Ga0436364_0212006 | |||
| 1533 | Ga0436364_0565857 | |||
| 1534 | Ga0436364_0721645 | |||
| 1535 | Ga0436364_1181445 | |||
| 1536 | Ga0436364_1370870 | |||
| 1537 | Ga0395901_0001069 | |||
| 1538 | Ga0395901_0040772 | |||
| 1539 | Ga0395901_0042265 | |||
| 1540 | Ga0395901_0100283 | |||
| 1541 | Ga0395901_0132266 | |||
| 1542 | Ga0395901_0178470 | |||
| 1543 | Ga0395901_0185908 | |||
| 1544 | Ga0395901_0844552 | |||
| 1545 | Ga0395901_0921349 | |||
| 1546 | Ga0436362_0561529 | |||
| 1547 | Ga0439443_004128 | |||
| 1548 | Ga0439448_0011857 | |||
| 1549 | Ga0439448_0084843 | |||
| 1550 | Ga0439450_000457 | |||
| 1551 | Ga0439450_010723 | |||
| 1552 | Ga0439451_007941 | |||
| 1553 | Ga0439454_008156 | |||
| 1554 | Ga0439463_001832 | |||
| 1555 | Ga0439463_007320 | |||
| 1556 | Ga0450888_006260 | |||
| 1557 | Ga0450900_007727 | |||
| 1558 | Ga0450905_000683 | |||
| 1559 | Ga0439435_0019844 | |||
| 1560 | Ga0439444_0002788 | |||
| 1561 | Ga0439464_0000611 | |||
| 1562 | Ga0439464_0084967 | |||
| 1563 | Ga0439460_0001195 | |||
| 1564 | Ga0439460_0045737 | |||
| 1565 | Ga0439460_0074999 | |||
| 1566 | Ga0450916_000443 | |||
| 1567 | Ga0439440_0000138 | |||
| 1568 | Ga0439440_0040887 | |||
| 1569 | Ga0466969_0007236 | |||
| 1570 | Ga0466969_0030840 | |||
| 1571 | Ga0466966_0042731 | |||
| 1572 | Ga0466961_0017607 | |||
| 1573 | Ga0466961_0024414 | |||
| 1574 | Ga0466963_0154394 | |||
| 1575 | Ga0466963_0230172 | |||
| 1576 | Ga0466971_0005673 | |||
| 1577 | Ga0466970_0006512 | |||
| 1578 | Ga0466970_0233606 | |||
| 1579 | Ga0466957_0118038 | |||
| 1580 | Ga0466959_0006218 | |||
| 1581 | Ga0466959_0047709 | |||
| 1582 | Ga0466959_0076883 | |||
| 1583 | Ga0466959_0171899 | |||
| 1584 | Ga0466958_0117574 | |||
| 1585 | Ga0466967_0015406 | |||
| 1586 | Ga0466967_0181203 | |||
| 1587 | Ga0466967_0367604 | |||
| 1588 | Ga0495592_0030009 | |||
| 1589 | Ga0495592_0122017 | |||
| 1590 | Ga0495592_0126824 | |||
| 1591 | Ga0495603_0006845 | |||
| 1592 | Ga0495641_0080404 | |||
| 1593 | Ga0495651_0008074 | |||
| 1594 | Ga0495651_0023871 | |||
| 1595 | Ga0495651_0031173 | |||
| 1596 | Ga0495651_0037806 | |||
| 1597 | Ga0495651_0043718 | |||
| 1598 | Ga0495651_0081301 | |||
| 1599 | Ga0495651_0236269 | |||
| 1600 | Ga0495653_0001681 | |||
| 1601 | Ga0495653_0011612 | |||
| 1602 | Ga0495653_0065294 | |||
| 1603 | Ga0495653_0110223 | |||
| 1604 | Ga0495580_0128389 | |||
| 1605 | Ga0495664_0010356 | |||
| 1606 | Ga0495664_0011383 | |||
| 1607 | Ga0495584_0088945 | |||
| 1608 | Ga0495594_0095754 | |||
| 1609 | Ga0495596_0049482 | |||
| 1610 | Ga0495607_0214476 | |||
| 1611 | Ga0495607_0217776 | |||
| 1612 | Ga0495608_0038199 | |||
| 1613 | Ga0495608_0046096 | |||
| 1614 | Ga0495608_0089639 | |||
| 1615 | Ga0495608_0128943 | |||
| 1616 | Ga0495616_0125470 | |||
| 1617 | Ga0495618_0015050 | |||
| 1618 | Ga0495618_0084435 | |||
| 1619 | Ga0495628_0005291 | |||
| 1620 | Ga0495628_0029092 | |||
| 1621 | Ga0495628_0056532 | |||
| 1622 | Ga0495628_0076877 | |||
| 1623 | Ga0495628_0360253 | |||
| 1624 | Ga0495630_0300543 | |||
| 1625 | Ga0495637_0084402 | |||
| 1626 | Ga0495644_0026909 | |||
| 1627 | Ga0495644_0067683 | |||
| 1628 | Ga0495652_0000731 | |||
| 1629 | Ga0495652_0004416 | |||
| 1630 | Ga0495652_0005702 | |||
| 1631 | Ga0495652_0030389 | |||
| 1632 | Ga0495652_0067853 | |||
| 1633 | Ga0495665_0019512 | |||
| 1634 | Ga0495640_0010835 | |||
| 1635 | Ga0495640_0056712 | |||
| 1636 | Ga0495640_0125088 | |||
| 1637 | Ga0495586_0062901 | |||
| 1638 | Ga0495586_0139911 | |||
| 1639 | Ga0495587_0003110 | |||
| 1640 | Ga0495587_0007004 | |||
| 1641 | Ga0495587_0037051 | |||
| 1642 | Ga0495609_0053328 | |||
| 1643 | Ga0495645_0011691 | |||
| 1644 | Ga0495645_0061719 | |||
| 1645 | Ga0495645_0078745 | |||
| 1646 | Ga0495645_0196281 | |||
| 1647 | Ga0495622_0132949 | |||
| 1648 | Ga0495667_0000230 | |||
| 1649 | Ga0495667_0012947 | |||
| 1650 | Ga0495667_0028768 | |||
| 1651 | Ga0495667_0038181 | |||
| 1652 | Ga0495667_0069636 | |||
| 1653 | Ga0495667_0071785 | |||
| 1654 | Ga0495656_0024362 | |||
| 1655 | Ga0495656_0105436 | |||
| 1656 | Ga0495656_0164777 | |||
| 1657 | Ga0495634_0010984 | |||
| 1658 | Ga0495611_0141861 | |||
| 1659 | Ga0495635_0015411 | |||
| 1660 | Ga0495635_0028333 | |||
| 1661 | Ga0495635_0063918 | |||
| 1662 | Ga0495635_0203332 | |||
| 1663 | Ga0495659_0047392 | |||
| 1664 | Ga0495659_0113245 | |||
| 1665 | Ga0495588_0034182 | |||
| 1666 | Ga0495657_0006566 | |||
| 1667 | Ga0495657_0015874 | |||
| 1668 | Ga0495657_0029078 | |||
| 1669 | Ga0495657_0049466 | |||
| 1670 | Ga0495657_0095821 | |||
| 1671 | Ga0495657_0106551 | |||
| 1672 | Ga0495599_0024054 | |||
| 1673 | Ga0495599_0107418 | |||
| 1674 | Ga0495623_0010932 | |||
| 1675 | Ga0495623_0011007 | |||
| 1676 | Ga0495623_0050003 | |||
| 1677 | Ga0495623_0065624 | |||
| 1678 | Ga0495646_0001297 | |||
| 1679 | Ga0495646_0052943 | |||
| 1680 | Ga0495647_0162727 | |||
| 1681 | Ga0495613_0026413 | |||
| 1682 | Ga0495613_0026934 | |||
| 1683 | Ga0495624_0057729 | |||
| 1684 | Ga0495670_0102710 | |||
| 1685 | Ga0495671_0101040 | |||
| 1686 | Ga0495600_0011317 | |||
| 1687 | Ga0495600_0033653 | |||
| 1688 | Ga0495600_0073269 | |||
| 1689 | Ga0495600_0290193 | |||
| 1690 | Ga0495604_0009037 | |||
| 1691 | Ga0495604_0027235 | |||
| 1692 | Ga0495604_0047627 | |||
| 1693 | Ga0495604_0388611 | |||
| 1694 | Ga0495674_0064492 | |||
| 1695 | Ga0495674_0084036 | |||
| 1696 | Ga0495674_0188857 | |||
| 1697 | Ga0495674_0399777 | |||
| 1698 | Ga0495676_0248073 | |||
| 1699 | Ga0495680_0015996 | |||
| 1700 | Ga0495680_0027890 | |||
| 1701 | Ga0495680_0028167 | |||
| 1702 | Ga0495680_0040467 | |||
| 1703 | Ga0495680_0116584 | |||
| 1704 | Ga0495680_0163577 | |||
| 1705 | Ga0495680_0348849 | |||
| 1706 | Ga0495675_0073953 | |||
| 1707 | Ga0495684_0039835 | |||
| 1708 | Ga0495684_0055703 | |||
| 1709 | Ga0495602_0003730 | |||
| 1710 | Ga0495602_0022067 | |||
| 1711 | Ga0495602_0053308 | |||
| 1712 | Ga0495602_0209220 | |||
| 1713 | Ga0496100_0131438 | |||
| 1714 | Ga0496100_0246021 | |||
| 1715 | Ga0496100_0568345 | |||
| 1716 | Ga0496101_0009273 | |||
| 1717 | Ga0496101_0054617 | |||
| 1718 | Ga0496101_0066251 | |||
| 1719 | Ga0496102_0038032 | |||
| 1720 | Ga0496102_0168099 | |||
| 1721 | Ga0496104_0013522 | |||
| 1722 | Ga0496104_0027757 | |||
| 1723 | Ga0496104_0046157 | |||
| 1724 | Ga0496104_0074089 | |||
| 1725 | Ga0496104_0104810 | |||
| 1726 | Ga0496105_0011075 | |||
| 1727 | Ga0496105_0051797 | |||
| 1728 | Ga0496105_0105840 | |||
| 1729 | Ga0496106_0009855 | |||
| 1730 | Ga0496106_0034483 | |||
| 1731 | Ga0496106_0136090 | |||
| 1732 | Ga0496107_0083340 | |||
| 1733 | Ga0496108_0024011 | |||
| 1734 | Ga0496108_0027816 | |||
| 1735 | Ga0496108_0073268 | |||
| 1736 | Ga0496108_0111865 | |||
| 1737 | Ga0496108_0272712 | |||
| 1738 | Ga0496109_0023936 | |||
| 1739 | Ga0496109_0031186 | |||
| 1740 | Ga0496109_0063514 | |||
| 1741 | Ga0496109_0077477 | |||
| 1742 | Ga0496109_0126967 | |||
| 1743 | Ga0496109_0198975 | |||
| 1744 | Ga0496109_0623882 | |||
| 1745 | Ga0496110_0081573 | |||
| 1746 | Ga0496110_0094205 | |||
| 1747 | Ga0496110_0103784 | |||
| 1748 | Ga0496111_0017139 | |||
| 1749 | Ga0496111_0062831 | |||
| 1750 | Ga0496111_0076770 | |||
| 1751 | Ga0496111_0083739 | |||
| 1752 | Ga0496111_0132876 | |||
| 1753 | Ga0496112_0006374 | |||
| 1754 | Ga0496112_0169183 | |||
| 1755 | Ga0496112_0176229 | |||
| 1756 | Ga0496112_0182905 | |||
| 1757 | Ga0496113_0011428 | |||
| 1758 | Ga0496113_0013158 | |||
| 1759 | Ga0496113_0045651 | |||
| 1760 | Ga0496113_0186785 | |||
| 1761 | Ga0496113_0343534 | |||
| 1762 | Ga0496114_0016291 | |||
| 1763 | Ga0496114_0207742 | |||
| 1764 | Ga0496115_0002340 | |||
| 1765 | Ga0496115_0326532 | |||
| 1766 | Ga0496126_0047192 | |||
| 1767 | Ga0496126_0166963 | |||
| 1768 | Ga0501031_0004126 | |||
| 1769 | Ga0501031_0008038 | |||
| 1770 | Ga0501031_0021617 | |||
| 1771 | Ga0501031_0100417 | |||
| 1772 | Ga0501032_0023141 | |||
| 1773 | Ga0501032_0052254 | |||
| 1774 | Ga0501033_0006419 | |||
| 1775 | Ga0501033_0041685 | |||
| 1776 | Ga0501033_0074091 | |||
| 1777 | Ga0501034_0021538 | |||
| 1778 | Ga0501036_0000868 | |||
| 1779 | Ga0501036_0018563 | |||
| 1780 | Ga0501036_0033097 | |||
| 1781 | Ga0501036_0048287 | |||
| 1782 | Ga0501036_0051775 | |||
| 1783 | Ga0501037_0007242 | |||
| 1784 | Ga0501037_0031573 | |||
| 1785 | Ga0501037_0075919 | |||
| 1786 | Ga0501037_0182984 | |||
| 1787 | Ga0501038_0015642 | |||
| 1788 | Ga0501038_0016922 | |||
| 1789 | Ga0501038_0018692 | |||
| 1790 | Ga0501038_0023764 | |||
| 1791 | Ga0501038_0051125 | |||
| 1792 | Ga0501039_0001861 | |||
| 1793 | Ga0501039_0017741 | |||
| 1794 | Ga0501039_0018772 | |||
| 1795 | Ga0501039_0027934 | |||
| 1796 | Ga0501039_0064832 | |||
| 1797 | Ga0501039_0120346 | |||
| 1798 | Ga0501040_0000619 | |||
| 1799 | Ga0501040_0006111 | |||
| 1800 | Ga0501040_0027955 | |||
| 1801 | Ga0501040_0028606 | |||
| 1802 | Ga0501040_0063177 | |||
| 1803 | Ga0501040_0152897 | |||
| 1804 | Ga0501040_0324886 | |||
| 1805 | Ga0501041_0009934 | |||
| 1806 | Ga0501041_0015722 | |||
| 1807 | Ga0501041_0019945 | |||
| 1808 | Ga0501041_0044119 | |||
| 1809 | Ga0501041_0090993 | |||
| 1810 | Ga0501042_0000527 | |||
| 1811 | Ga0501042_0003690 | |||
| 1812 | Ga0501042_0012887 | |||
| 1813 | Ga0501042_0014056 | |||
| 1814 | Ga0501042_0020232 | |||
| 1815 | Ga0501042_0042241 | |||
| 1816 | Ga0501042_0063576 | |||
| 1817 | Ga0501043_0024448 | |||
| 1818 | Ga0501043_0082154 | |||
| 1819 | Ga0501043_0117736 | |||
| 1820 | Ga0501046_0004361 | |||
| 1821 | Ga0501046_0016569 | |||
| 1822 | Ga0501046_0039274 | |||
| 1823 | Ga0501046_0055033 | |||
| 1824 | Ga0501046_0164252 | |||
| 1825 | Ga0501046_0289404 | |||
| 1826 | Ga0501047_0066722 | |||
| 1827 | Ga0501047_0077290 | |||
| 1828 | Ga0501048_0002081 | |||
| 1829 | Ga0501048_0005088 | |||
| 1830 | Ga0501048_0018107 | |||
| 1831 | Ga0501048_0026018 | |||
| 1832 | Ga0501048_0053249 | |||
| 1833 | Ga0501048_0060399 | |||
| 1834 | Ga0501067_0207509 | |||
| 1835 | Ga0501067_0268008 | |||
| 1836 | Ga0501068_0000603 | |||
| 1837 | Ga0501068_0032489 | |||
| 1838 | Ga0501068_0046981 | |||
| 1839 | Ga0501068_0135083 | |||
| 1840 | Ga0501069_0000228 | |||
| 1841 | Ga0501070_0016833 | |||
| 1842 | Ga0501070_0109830 | |||
| 1843 | Ga0501071_0001890 | |||
| 1844 | Ga0501071_0005701 | |||
| 1845 | Ga0501071_0007010 | |||
| 1846 | Ga0501071_0009056 | |||
| 1847 | Ga0501071_0032918 | |||
| 1848 | Ga0501072_0003544 | |||
| 1849 | Ga0501072_0019574 | |||
| 1850 | Ga0501072_0021349 | |||
| 1851 | Ga0501072_0024736 | |||
| 1852 | Ga0501072_0151183 | |||
| 1853 | Ga0501072_0369699 | |||
| 1854 | Ga0501073_0001635 | |||
| 1855 | Ga0501073_0080222 | |||
| 1856 | Ga0501073_0193559 | |||
| 1857 | Ga0501074_0003309 | |||
| 1858 | Ga0501074_0017125 | |||
| 1859 | Ga0501074_0018704 | |||
| 1860 | Ga0501074_0019408 | |||
| 1861 | Ga0501074_0126060 | |||
| 1862 | Ga0501075_0000224 | |||
| 1863 | Ga0501075_0002582 | |||
| 1864 | Ga0501075_0022840 | |||
| 1865 | Ga0501075_0028323 | |||
| 1866 | Ga0501075_0069950 | |||
| 1867 | Ga0501075_0105506 | |||
| 1868 | Ga0501076_0000544 | |||
| 1869 | Ga0501076_0014133 | |||
| 1870 | Ga0501076_0014229 | |||
| 1871 | Ga0501076_0021406 | |||
| 1872 | Ga0501076_0252599 | |||
| 1873 | Ga0501077_0002174 | |||
| 1874 | Ga0501077_0005502 | |||
| 1875 | Ga0501077_0148021 | |||
| 1876 | Ga0501077_0180999 | |||
| 1877 | Ga0501079_0000269 | |||
| 1878 | Ga0501079_0008835 | |||
| 1879 | Ga0501079_0014148 | |||
| 1880 | Ga0501079_0016461 | |||
| 1881 | Ga0501079_0052197 | |||
| 1882 | Ga0501079_0418211 | |||
| 1883 | Ga0501080_0033224 | |||
| 1884 | Ga0501080_0055307 | |||
| 1885 | Ga0501080_0179308 | |||
| 1886 | Ga0501081_0006116 | |||
| 1887 | Ga0501081_0015908 | |||
| 1888 | Ga0501081_0022842 | |||
| 1889 | Ga0501081_0117170 | |||
| 1890 | Ga0501083_0005179 | |||
| 1891 | Ga0501083_0019519 | |||
| 1892 | Ga0501083_0028477 | |||
| 1893 | Ga0501083_0099647 | |||
| 1894 | Ga0501035_0045429 | |||
| 1895 | Ga0501035_0249737 | |||
| 1896 | Ga0501044_0005842 | |||
| 1897 | Ga0501044_0039522 | |||
| 1898 | Ga0501044_0097613 | |||
| 1899 | Ga0501045_0000261 | |||
| 1900 | Ga0501045_0009032 | |||
| 1901 | Ga0501045_0015095 | |||
| 1902 | Ga0501045_0028504 | |||
| 1903 | Ga0501045_0135190 | |||
| 1904 | Ga0501045_0361747 | |||
| 1905 | nmdc:mga05p37_192922_c1 | |||
| 1906 | nmdc:mga05p37_223895_c1 | |||
| 1907 | nmdc:mga05p37_312751_c1 | |||
| 1908 | nmdc:mga05p37_68759_c2 | |||
| 1909 | nmdc:mga05p37_7014_c1 | |||
| 1910 | nmdc:mga09592_105203_c1 | |||
| 1911 | nmdc:mga09592_12307_c1 | |||
| 1912 | nmdc:mga0qj67_74070_c1 | |||
| 1913 | nmdc:mga06r32_497521_c1 | |||
| 1914 | nmdc:mga06r32_65967_c1 | |||
| 1915 | nmdc:mga08y16_56483_c1 | |||
| 1916 | nmdc:mga0n895_20018_c1 | |||
| 1917 | nmdc:mga0n895_238296_c1 | |||
| 1918 | nmdc:mga0n895_31992_c1 | |||
| 1919 | nmdc:mga0n895_382426_c1 | |||
| 1920 | nmdc:mga0n895_46907_c1 | |||
| 1921 | nmdc:mga0n895_47781_c1 | |||
| 1922 | nmdc:mga0n895_70162_c1 | |||
| 1923 | nmdc:mga0rr50_291791_c1 | |||
| 1924 | nmdc:mga0rr50_58822_c1 | |||
| 1925 | nmdc:mga0rr50_73518_c1 | |||
| 1926 | nmdc:mga08x19_17380_c1 | |||
| 1927 | nmdc:mga08x19_43265_c1 | |||
| 1928 | nmdc:mga0a205_152773_c1 | |||
| 1929 | nmdc:mga0a205_16824_c1 | |||
| 1930 | nmdc:mga0a205_52657_c1 | |||
| 1931 | nmdc:mga0a205_73016_c1 | |||
| 1932 | nmdc:mga0a205_783369_c1 | |||
| 1933 | nmdc:mga0a205_7938_c1 | |||
| 1934 | Ga0495601_0004265 | |||
| 1935 | Ga0495601_0188601 | |||
| 1936 | Ga0495612_0012471 | |||
| 1937 | Ga0495612_0020207 | |||
| 1938 | Ga0495619_0123606 | |||
| 1939 | Ga0501084_0009738 | |||
| 1940 | Ga0501084_0025891 | |||
| 1941 | Ga0501084_0030837 | |||
| 1942 | Ga0501084_0052286 | |||
| 1943 | Ga0501084_0064590 | |||
| 1944 | Ga0501084_0212425 | |||
| 1945 | Ga0590074_003008 | |||
| 1946 | Ga0590075_025083 | |||
| 1947 | Ga0590077_003153 | |||
| 1948 | Ga0590077_007353 | |||
| 1949 | Ga0501082_0000767 | |||
| 1950 | Ga0501082_0020138 | |||
| 1951 | Ga0501082_0043677 | |||
| 1952 | Ga0501082_0050136 | |||
| 1953 | Ga0466962_0005687 | |||
| 1954 | Ga0530510_0001223 | |||
| 1955 | Ga0530510_0005952 | |||
| 1956 | Ga0530510_0109172 | |||
| 1957 | Ga0530510_0258128 | |||
| 1958 | 2891402858 | |||
| 1959 | 2891554832 | |||
| 1960 | 2997457445 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wcg-assembly1.cif.gz_B | the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna | 0.9701 | 5 | 62 |
| 4wcg-assembly1.cif.gz_A | the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna | 0.9596 | 5 | 62 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9493 | 8 | 62 |
| 7wqu-assembly1.cif.gz_B | feoc from klebsiella pneumoniae | 0.9385 | 8 | 63 |
| 7c0i-assembly1.cif.gz_A | crystal structure of chimeric mutant of e3l in complex with z-dna | 0.9278 | 8 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5tjjB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9816 | 1 | 70 | 1.10.10.10 |
| af_P77569_1_73_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9809 | 1 | 62 | 1.10.10.10 |
| af_P0ACN4_17_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9749 | 3 | 73 | 1.10.10.10 |
| 4wcgB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.97 | 5 | 62 | 1.10.10.10 |
| af_P16528_22_97_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9665 | 1 | 74 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A8EZV7-F1-model_v4 | IclR family transcriptional regulator | 0.9303 | 1 | 221 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A6V8KQV5-F1-model_v4 | IclR-ED domain-containing protein | 0.9234 | 126 | 221 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-X1EUD4-F1-model_v4 | IclR-ED domain-containing protein | 0.9226 | 83 | 218 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A2V9QTZ5-F1-model_v4 | IclR-ED domain-containing protein | 0.9117 | 83 | 216 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A117I9M0-F1-model_v4 | Transcriptional regulator | 0.9043 | 1 | 225 |
GO:0003677
GO:0003700 GO:0045892 |