F487375

General Info

Members Datasets Scaffolds Average Seq Length
980 340 1960 258

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0281896|Ga0496102_0281896_454_1302
Length 282
Sequence MGDRRDPTIQSVDRAARILKALAAGSPRLGVSELAERLGLAKTTVHGLLRTLERQDLVEQDSETGKYRLGPEMLQLGNAFLDHHELRGRSLVWADTLAERVGEAVRVGVLYGRRVLVVHHVFRPDDSVQILEVGASVPWHASALGKVHAASLPSDRRRTLVSGPLQRLTGRTIVDPHALALALEEVAAAGFATEAHEAVIGEGEXXXXVFDHRGHPVGAIGVVGPVERLLPAGPTPELIVALTDTAKRLSWEMGARRGRAGTIGHSIPRPGPRAAPRAGVGG

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
167 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
199 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
200 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
201 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
202 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
203 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
204 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
210 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
339 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
340 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 1.12
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 5.51
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0281896 3300048905 Unclassified 1566
2 Ga0070683_100060765 3300005329 Bacteria 3512
3 Ga0070670_100102969 3300005331 Bacteria 2459
4 Ga0070680_100129875 3300005336 Bacteria 2107
5 Ga0070682_100159670 3300005337 Bacteria 1556
6 Ga0070682_100203147 3300005337 Bacteria 1399
7 Ga0068868_100028993 3300005338 Bacteria 4237
8 Ga0068868_100042560 3300005338 Bacteria 3546
9 Ga0070660_100257304 3300005339 Bacteria 1425
10 Ga0070689_100121780 3300005340 Bacteria 2084
11 Ga0070689_100546938 3300005340 Bacteria 997
12 Ga0070691_10084472 3300005341 Unclassified 1558
13 Ga0070661_100215459 3300005344 Bacteria 1471
14 Ga0070669_100235960 3300005353 Bacteria 1451
15 Ga0070703_10000005 3300005406 Bacteria 127348
16 Ga0070703_10011257 3300005406 Bacteria 2525
17 Ga0070709_10000936 3300005434 Bacteria 16205
18 Ga0070709_10010332 3300005434 Bacteria 5165
19 Ga0070709_10017721 3300005434 Bacteria 4090
20 Ga0070709_10037240 3300005434 Bacteria 2969
21 Ga0070714_100008560 3300005435 Bacteria 8000
22 Ga0070714_100015228 3300005435 Bacteria 6186
23 Ga0070714_100075357 3300005435 Bacteria 2927
24 Ga0070714_100146227 3300005435 Bacteria 2126
25 Ga0070714_100217442 3300005435 Bacteria 1754
26 Ga0070714_100524625 3300005435 Bacteria 1132
27 Ga0070714_100878267 3300005435 Unclassified 870
28 Ga0070713_100002341 3300005436 Bacteria 12368
29 Ga0070713_100020797 3300005436 Bacteria 5038
30 Ga0070713_100030612 3300005436 Bacteria 4276
31 Ga0070713_100101020 3300005436 Bacteria 2498
32 Ga0070713_100120831 3300005436 Bacteria 2297
33 Ga0070713_100132283 3300005436 Bacteria 2201
34 Ga0070713_100153967 3300005436 Bacteria 2047
35 Ga0070713_100249147 3300005436 Bacteria 1620
36 Ga0070713_100327440 3300005436 Bacteria 1416
37 Ga0070713_100477227 3300005436 Bacteria 1174
38 Ga0070710_10003344 3300005437 Bacteria 7603
39 Ga0070710_10003544 3300005437 Bacteria 7396
40 Ga0070710_10016273 3300005437 Bacteria 3781
41 Ga0070710_10063649 3300005437 Bacteria 2108
42 Ga0070701_10050836 3300005438 Bacteria 2148
43 Ga0070711_100001972 3300005439 Bacteria 11521
44 Ga0070711_100019864 3300005439 Bacteria 4320
45 Ga0070711_100022459 3300005439 Bacteria 4090
46 Ga0070711_100022794 3300005439 Bacteria 4063
47 Ga0070711_100048894 3300005439 Bacteria 2894
48 Ga0070711_100389002 3300005439 Unclassified 1129
49 Ga0070711_100591675 3300005439 Bacteria 925
50 Ga0070705_100008189 3300005440 Bacteria 5170
51 Ga0070705_100029213 3300005440 Bacteria 3029
52 Ga0070705_100140657 3300005440 Bacteria 1588
53 Ga0070694_100038314 3300005444 Bacteria 3185
54 Ga0070694_100334090 3300005444 Bacteria 1170
55 Ga0070708_100000074 3300005445 Bacteria 63932
56 Ga0070708_100001238 3300005445 Bacteria 19640
57 Ga0070708_100001603 3300005445 Bacteria 17338
58 Ga0070708_100118040 3300005445 Bacteria 2444
59 Ga0070708_100153843 3300005445 Bacteria 2140
60 Ga0070708_100181477 3300005445 Bacteria 1967
61 Ga0070708_100675851 3300005445 Bacteria 972
62 Ga0070663_100024890 3300005455 Bacteria 4035
63 Ga0070663_100075280 3300005455 Bacteria 2467
64 Ga0070663_100091646 3300005455 Bacteria 2252
65 Ga0070678_100020458 3300005456 Bacteria 4343
66 Ga0070678_100620959 3300005456 Bacteria 967
67 Ga0070662_100125049 3300005457 Bacteria 1976
68 Ga0070681_10015186 3300005458 Bacteria 7660
69 Ga0070681_10268021 3300005458 Bacteria 1619
70 Ga0070681_10408939 3300005458 Bacteria 1269
71 Ga0070681_10457813 3300005458 Bacteria 1188
72 Ga0068867_100175967 3300005459 Unclassified 1698
73 Ga0070706_100001907 3300005467 Bacteria 21528
74 Ga0070706_100006141 3300005467 Bacteria 11366
75 Ga0070706_100007464 3300005467 Bacteria 10252
76 Ga0070706_100021579 3300005467 Bacteria 5929
77 Ga0070706_100027442 3300005467 Bacteria 5240
78 Ga0070706_100031066 3300005467 Bacteria 4925
79 Ga0070706_100070908 3300005467 Bacteria 3223
80 Ga0070706_100073130 3300005467 Bacteria 3172
81 Ga0070706_100078530 3300005467 Bacteria 3056
82 Ga0070706_100152939 3300005467 Bacteria 2154
83 Ga0070706_100200826 3300005467 Bacteria 1862
84 Ga0070706_100589054 3300005467 Bacteria 1034
85 Ga0070707_100000637 3300005468 Bacteria 35026
86 Ga0070707_100002195 3300005468 Bacteria 18652
87 Ga0070707_100004568 3300005468 Bacteria 12960
88 Ga0070707_100005640 3300005468 Bacteria 11693
89 Ga0070707_100009909 3300005468 Bacteria 8870
90 Ga0070707_100024185 3300005468 Bacteria 5750
91 Ga0070707_100031092 3300005468 Bacteria 5083
92 Ga0070707_100042754 3300005468 Bacteria 4338
93 Ga0070707_100057084 3300005468 Bacteria 3746
94 Ga0070707_100057133 3300005468 Bacteria 3744
95 Ga0070707_100084603 3300005468 Bacteria 3065
96 Ga0070707_100113629 3300005468 Bacteria 2627
97 Ga0070707_100158398 3300005468 Bacteria 2205
98 Ga0070707_100255719 3300005468 Bacteria 1704
99 Ga0070707_100389879 3300005468 Bacteria 1353
100 Ga0070698_100000082 3300005471 Bacteria 73573
101 Ga0070698_100002067 3300005471 Bacteria 22298
102 Ga0070698_100006327 3300005471 Bacteria 12858
103 Ga0070698_100009295 3300005471 Bacteria 10547
104 Ga0070698_100010143 3300005471 Bacteria 10064
105 Ga0070698_100011159 3300005471 Bacteria 9545
106 Ga0070698_100013845 3300005471 Bacteria 8531
107 Ga0070698_100019349 3300005471 Bacteria 7152
108 Ga0070698_100025985 3300005471 Bacteria 6100
109 Ga0070698_100039922 3300005471 Bacteria 4826
110 Ga0070698_100091562 3300005471 Bacteria 3023
111 Ga0070698_100092469 3300005471 Bacteria 3005
112 Ga0070698_100097124 3300005471 Bacteria 2922
113 Ga0070698_100119956 3300005471 Bacteria 2590
114 Ga0070698_100406277 3300005471 Bacteria 1295
115 Ga0070699_100001106 3300005518 Bacteria 25074
116 Ga0070699_100010091 3300005518 Bacteria 8177
117 Ga0070699_100024128 3300005518 Bacteria 5241
118 Ga0070699_100044724 3300005518 Bacteria 3833
119 Ga0070699_100106047 3300005518 Bacteria 2465
120 Ga0070699_100163958 3300005518 Bacteria 1968
121 Ga0070679_100100227 3300005530 Bacteria 2883
122 Ga0070679_100182357 3300005530 Bacteria 2071
123 Ga0070684_100034153 3300005535 Bacteria 4347
124 Ga0070684_100079692 3300005535 Bacteria 2895
125 Ga0070684_100154071 3300005535 Bacteria 2083
126 Ga0070684_100226699 3300005535 Bacteria 1705
127 Ga0070684_100282126 3300005535 Bacteria 1522
128 Ga0070697_100128414 3300005536 Bacteria 2124
129 Ga0070697_100139624 3300005536 Bacteria 2037
130 Ga0070697_100343954 3300005536 Bacteria 1287
131 Ga0070686_100102933 3300005544 Bacteria 1932
132 Ga0070695_100036735 3300005545 Bacteria 3084
133 Ga0070695_100053815 3300005545 Bacteria 2589
134 Ga0070696_100014341 3300005546 Bacteria 5315
135 Ga0070696_100026882 3300005546 Bacteria 3917
136 Ga0070696_100170887 3300005546 Bacteria 1607
137 Ga0070696_100272658 3300005546 Bacteria 1287
138 Ga0070693_100059353 3300005547 Bacteria 2217
139 Ga0070665_100037887 3300005548 Bacteria 4846
140 Ga0070665_100060734 3300005548 Bacteria 3789
141 Ga0070665_100103077 3300005548 Bacteria 2857
142 Ga0068855_100015019 3300005563 Bacteria 9326
143 Ga0068855_100057398 3300005563 Bacteria 4563
144 Ga0068855_100638293 3300005563 Bacteria 1145
145 Ga0070664_100101554 3300005564 Bacteria 2501
146 Ga0068857_100367418 3300005577 Bacteria 1334
147 Ga0068854_100245493 3300005578 Bacteria 1428
148 Ga0068856_100042997 3300005614 Bacteria 4445
149 Ga0068856_100288919 3300005614 Bacteria 1656
150 Ga0068856_100389414 3300005614 Unclassified 1413
151 Ga0068856_100782337 3300005614 Bacteria 974
152 Ga0070702_100040027 3300005615 Bacteria 2619
153 Ga0070702_100097035 3300005615 Bacteria 1800
154 Ga0068852_100012576 3300005616 Bacteria 6430
155 Ga0068852_100037902 3300005616 Bacteria 4047
156 Ga0068852_100279856 3300005616 Bacteria 1608
157 Ga0068864_100151195 3300005618 Bacteria 2103
158 Ga0068866_10013129 3300005718 Bacteria 3625
159 Ga0068861_100084029 3300005719 Bacteria 2498
160 Ga0068863_100015496 3300005841 Bacteria 7328
161 Ga0068858_100013504 3300005842 Bacteria 7705
162 Ga0068858_100338018 3300005842 Bacteria 1441
163 Ga0068858_100389930 3300005842 Bacteria 1337
164 Ga0068860_100303023 3300005843 Bacteria 1566
165 Ga0068860_100483283 3300005843 Unclassified 1235
166 Ga0081455_10008399 3300005937 Bacteria 10740
167 Ga0081538_10002838 3300005981 Bacteria 16566
168 Ga0081538_10003979 3300005981 Bacteria 13764
169 Ga0081538_10004688 3300005981 Bacteria 12525
170 Ga0081538_10075464 3300005981 Bacteria 1829
171 Ga0081540_1001407 3300005983 Bacteria 20817
172 Ga0081539_10005520 3300005985 Bacteria 12837
173 Ga0081539_10019810 3300005985 Bacteria 4584
174 Ga0081539_10044537 3300005985 Bacteria 2561
175 Ga0070717_10006347 3300006028 Bacteria 8694
176 Ga0070717_10006576 3300006028 Bacteria 8563
177 Ga0070717_10017441 3300006028 Bacteria 5587
178 Ga0070717_10019394 3300006028 Bacteria 5331
179 Ga0070717_10033140 3300006028 Bacteria 4166
180 Ga0070717_10060140 3300006028 Bacteria 3145
181 Ga0070717_10091920 3300006028 Bacteria 2563
182 Ga0070717_10634615 3300006028 Bacteria 969
183 Ga0070715_10001082 3300006163 Bacteria 7713
184 Ga0070715_10002235 3300006163 Bacteria 5880
185 Ga0070715_10010780 3300006163 Bacteria 3269
186 Ga0070715_10034807 3300006163 Bacteria 2067
187 Ga0070716_100002738 3300006173 Bacteria 8176
188 Ga0070716_100007339 3300006173 Bacteria 5421
189 Ga0070716_100011043 3300006173 Bacteria 4542
190 Ga0070712_100009206 3300006175 Bacteria 6219
191 Ga0070712_100027795 3300006175 Bacteria 3781
192 Ga0070712_100029667 3300006175 Bacteria 3668
193 Ga0070712_100153508 3300006175 Bacteria 1770
194 Ga0070712_100186918 3300006175 Bacteria 1618
195 Ga0070712_100189940 3300006175 Bacteria 1607
196 Ga0070712_100190787 3300006175 Bacteria 1604
197 Ga0075427_10006620 3300006194 Bacteria 1685
198 Ga0097621_100027570 3300006237 Bacteria 4469
199 Ga0097621_100239204 3300006237 Unclassified 1587
200 Ga0075428_100151851 3300006844 Bacteria 2516
201 Ga0075428_100376443 3300006844 Bacteria 1522
202 Ga0075430_100003287 3300006846 Bacteria 13549
203 Ga0075431_100002693 3300006847 Bacteria 17220
204 Ga0075431_100224388 3300006847 Bacteria 1916
205 Ga0075433_10015709 3300006852 Bacteria 6219
206 Ga0075433_10046642 3300006852 Bacteria 3769
207 Ga0075433_10054586 3300006852 Bacteria 3485
208 Ga0075433_10716931 3300006852 Bacteria 876
209 Ga0075434_100001693 3300006871 Bacteria 18867
210 Ga0075434_100022020 3300006871 Bacteria 6203
211 Ga0075434_100054495 3300006871 Bacteria 3972
212 Ga0075434_100060715 3300006871 Bacteria 3760
213 Ga0075434_100282956 3300006871 Bacteria 1678
214 Ga0075429_100037097 3300006880 Bacteria 4242
215 Ga0075429_100176498 3300006880 Bacteria 1872
216 Ga0068865_100011404 3300006881 Bacteria 5560
217 Ga0075436_100050921 3300006914 Bacteria 2858
218 Ga0075436_100126236 3300006914 Bacteria 1792
219 Ga0075436_100544547 3300006914 Bacteria 852
220 Ga0075435_100024351 3300007076 Bacteria 4696
221 Ga0075435_100073248 3300007076 Bacteria 2800
222 Ga0075435_100096126 3300007076 Bacteria 2451
223 Ga0099794_10155724 3300007265 Bacteria 1161
224 Ga0099795_10027524 3300007788 Bacteria 1924
225 Ga0105240_10011678 3300009093 Bacteria 12205
226 Ga0105240_10057051 3300009093 Bacteria 4882
227 Ga0105240_10793519 3300009093 Bacteria 1026
228 Ga0111539_10009833 3300009094 Bacteria 12070
229 Ga0111539_10381512 3300009094 Bacteria 1641
230 Ga0111539_10448037 3300009094 Bacteria 1503
231 Ga0105245_10026493 3300009098 Bacteria 5103
232 Ga0105245_10254069 3300009098 Bacteria 1709
233 Ga0105245_10395405 3300009098 Bacteria 1380
234 Ga0105245_10688787 3300009098 Bacteria 1054
235 Ga0105247_10308919 3300009101 Bacteria 1099
236 Ga0114129_10066227 3300009147 Bacteria 5039
237 Ga0114129_10095375 3300009147 Bacteria 4120
238 Ga0114129_10202251 3300009147 Bacteria 2689
239 Ga0114129_10226187 3300009147 Bacteria 2521
240 Ga0114129_10356006 3300009147 Bacteria 1938
241 Ga0114129_10399215 3300009147 Bacteria 1812
242 Ga0114129_10496739 3300009147 Bacteria 1594
243 Ga0114129_10651209 3300009147 Bacteria 1360
244 Ga0105243_10039760 3300009148 Bacteria 3669
245 Ga0105243_10081531 3300009148 Bacteria 2642
246 Ga0105243_10223315 3300009148 Unclassified 1666
247 Ga0105241_10015186 3300009174 Bacteria 5640
248 Ga0105248_10010737 3300009177 Bacteria 10110
249 Ga0105248_10049581 3300009177 Bacteria 4710
250 Ga0105237_10039204 3300009545 Bacteria 4782
251 Ga0105237_10134879 3300009545 Bacteria 2463
252 Ga0105237_10580494 3300009545 Bacteria 1128
253 Ga0105238_10007703 3300009551 Bacteria 10765
254 Ga0105238_10438954 3300009551 Bacteria 1302
255 Ga0105238_10528076 3300009551 Bacteria 1183
256 Ga0105249_10011780 3300009553 Bacteria 7687
257 Ga0105249_10013267 3300009553 Bacteria 7272
258 Ga0105249_10173176 3300009553 Bacteria 2094
259 Ga0105249_10344411 3300009553 Unclassified 1508
260 Ga0105239_10025385 3300010375 Bacteria 6524
261 Ga0157370_10036126 3300013104 Bacteria 4797
262 Ga0157370_10073380 3300013104 Bacteria 3228
263 Ga0157370_10153129 3300013104 Bacteria 2145
264 Ga0157370_10163904 3300013104 Bacteria 2068
265 Ga0157369_10008975 3300013105 Bacteria 11452
266 Ga0157369_10046070 3300013105 Bacteria 4740
267 Ga0157369_10079297 3300013105 Bacteria 3517
268 Ga0157369_10115893 3300013105 Bacteria 2845
269 Ga0157369_10185806 3300013105 Bacteria 2186
270 Ga0157374_10036164 3300013296 Bacteria 4522
271 Ga0157374_10056454 3300013296 Bacteria 3666
272 Ga0157378_10005547 3300013297 Bacteria 11048
273 Ga0163162_10079399 3300013306 Bacteria 3348
274 Ga0157372_10123614 3300013307 Bacteria 2975
275 Ga0157372_10350375 3300013307 Bacteria 1720
276 Ga0157372_10803550 3300013307 Bacteria 1093
277 Ga0163163_10017404 3300014325 Bacteria 6703
278 Ga0163163_10224599 3300014325 Bacteria 1927
279 Ga0163163_10324806 3300014325 Bacteria 1592
280 Ga0157380_10899236 3300014326 Bacteria 911
281 Ga0157379_10017813 3300014968 Bacteria 6257
282 Ga0157379_10202767 3300014968 Bacteria 1794
283 Ga0157376_10126189 3300014969 Bacteria 2276
284 Ga0206351_10697221 3300020077 Bacteria 1232
285 Ga0206350_10034970 3300020080 Bacteria 1659
286 Ga0206354_10010395 3300020081 Bacteria 1381
287 Ga0206354_10248428 3300020081 Bacteria 2370
288 Ga0206354_10358818 3300020081 Bacteria 2330
289 Ga0206353_10982929 3300020082 Bacteria 3839
290 Ga0206353_11739985 3300020082 Bacteria 1075
291 Ga0206353_12011555 3300020082 Bacteria 2421
292 Ga0213875_10000197 3300021388 Bacteria 61686
293 Ga0213875_10000281 3300021388 Bacteria 49818
294 Ga0213875_10000768 3300021388 Bacteria 24048
295 Ga0213875_10134856 3300021388 Bacteria 1155
296 Ga0213875_10146460 3300021388 Bacteria 1106
297 Ga0224712_10001664 3300022467 Bacteria 5244
298 Ga0224712_10095271 3300022467 Bacteria 1253
299 Ga0224712_10245051 3300022467 Bacteria 826
300 Ga0207426_1000875 3300025302 Bacteria 31224
301 Ga0207653_10000002 3300025885 Bacteria 270513
302 Ga0207692_10000435 3300025898 Bacteria 14700
303 Ga0207692_10001293 3300025898 Bacteria 9308
304 Ga0207692_10005264 3300025898 Bacteria 5169
305 Ga0207692_10009511 3300025898 Bacteria 4064
306 Ga0207685_10000488 3300025905 Bacteria 6725
307 Ga0207685_10013342 3300025905 Bacteria 2538
308 Ga0207685_10087334 3300025905 Bacteria 1305
309 Ga0207699_10001146 3300025906 Bacteria 12536
310 Ga0207699_10002053 3300025906 Bacteria 9506
311 Ga0207699_10004947 3300025906 Bacteria 6373
312 Ga0207699_10028323 3300025906 Bacteria 3112
313 Ga0207699_10035947 3300025906 Bacteria 2821
314 Ga0207699_10084494 3300025906 Bacteria 1977
315 Ga0207684_10000123 3300025910 Bacteria 142518
316 Ga0207684_10000339 3300025910 Bacteria 65102
317 Ga0207684_10000574 3300025910 Bacteria 44726
318 Ga0207684_10009068 3300025910 Bacteria 8810
319 Ga0207684_10013508 3300025910 Bacteria 7062
320 Ga0207684_10047001 3300025910 Bacteria 3661
321 Ga0207684_10071717 3300025910 Bacteria 2943
322 Ga0207684_10076794 3300025910 Bacteria 2839
323 Ga0207684_10078735 3300025910 Bacteria 2804
324 Ga0207684_10092948 3300025910 Bacteria 2571
325 Ga0207684_10167903 3300025910 Bacteria 1891
326 Ga0207684_10373769 3300025910 Bacteria 1226
327 Ga0207684_10558274 3300025910 Bacteria 979
328 Ga0207707_10047197 3300025912 Bacteria 3751
329 Ga0207707_10189427 3300025912 Bacteria 1795
330 Ga0207695_10001971 3300025913 Bacteria 31775
331 Ga0207695_10033576 3300025913 Bacteria 5594
332 Ga0207671_10000203 3300025914 Bacteria 90100
333 Ga0207671_10246432 3300025914 Bacteria 1404
334 Ga0207693_10005318 3300025915 Bacteria 10753
335 Ga0207693_10005872 3300025915 Bacteria 10189
336 Ga0207693_10011807 3300025915 Bacteria 7058
337 Ga0207693_10034813 3300025915 Bacteria 3971
338 Ga0207693_10055161 3300025915 Bacteria 3118
339 Ga0207693_10109789 3300025915 Bacteria 2163
340 Ga0207693_10397053 3300025915 Bacteria 1078
341 Ga0207663_10001814 3300025916 Bacteria 10084
342 Ga0207663_10006086 3300025916 Bacteria 6137
343 Ga0207663_10028399 3300025916 Bacteria 3274
344 Ga0207663_10039773 3300025916 Bacteria 2852
345 Ga0207663_10103685 3300025916 Bacteria 1916
346 Ga0207663_10243453 3300025916 Bacteria 1320
347 Ga0207660_10437468 3300025917 Bacteria 1056
348 Ga0207657_10027219 3300025919 Bacteria 5238
349 Ga0207649_10215912 3300025920 Bacteria 1363
350 Ga0207652_10024768 3300025921 Bacteria 4980
351 Ga0207652_10337547 3300025921 Bacteria 1360
352 Ga0207646_10000061 3300025922 Bacteria 151425
353 Ga0207646_10001194 3300025922 Bacteria 32687
354 Ga0207646_10002341 3300025922 Bacteria 22412
355 Ga0207646_10004121 3300025922 Bacteria 15968
356 Ga0207646_10018758 3300025922 Bacteria 6446
357 Ga0207646_10027513 3300025922 Bacteria 5186
358 Ga0207646_10052080 3300025922 Bacteria 3663
359 Ga0207646_10053559 3300025922 Bacteria 3609
360 Ga0207646_10054966 3300025922 Bacteria 3561
361 Ga0207646_10073851 3300025922 Bacteria 3046
362 Ga0207646_10112716 3300025922 Bacteria 2441
363 Ga0207646_10255525 3300025922 Bacteria 1584
364 Ga0207694_10002093 3300025924 Bacteria 16491
365 Ga0207650_10023834 3300025925 Bacteria 4345
366 Ga0207659_10292967 3300025926 Bacteria 1334
367 Ga0207687_10099438 3300025927 Bacteria 2137
368 Ga0207687_10277710 3300025927 Bacteria 1342
369 Ga0207687_10596894 3300025927 Unclassified 930
370 Ga0207700_10000714 3300025928 Bacteria 19206
371 Ga0207700_10003538 3300025928 Bacteria 9095
372 Ga0207700_10004876 3300025928 Bacteria 7971
373 Ga0207700_10018529 3300025928 Bacteria 4681
374 Ga0207700_10020336 3300025928 Bacteria 4506
375 Ga0207700_10027887 3300025928 Bacteria 3960
376 Ga0207700_10071906 3300025928 Bacteria 2665
377 Ga0207700_10222702 3300025928 Bacteria 1600
378 Ga0207700_10229272 3300025928 Bacteria 1578
379 Ga0207700_10260979 3300025928 Bacteria 1483
380 Ga0207700_10293778 3300025928 Bacteria 1401
381 Ga0207700_10430022 3300025928 Bacteria 1161
382 Ga0207700_10619866 3300025928 Bacteria 963
383 Ga0207664_10000825 3300025929 Bacteria 21018
384 Ga0207664_10004487 3300025929 Bacteria 9460
385 Ga0207664_10010010 3300025929 Bacteria 6681
386 Ga0207664_10012761 3300025929 Bacteria 6014
387 Ga0207664_10014707 3300025929 Bacteria 5661
388 Ga0207664_10022552 3300025929 Bacteria 4704
389 Ga0207664_10023375 3300025929 Bacteria 4630
390 Ga0207664_10164389 3300025929 Bacteria 1895
391 Ga0207664_10251932 3300025929 Bacteria 1541
392 Ga0207664_10316996 3300025929 Bacteria 1375
393 Ga0207664_10722382 3300025929 Unclassified 896
394 Ga0207690_10353826 3300025932 Bacteria 1162
395 Ga0207706_10015126 3300025933 Bacteria 6983
396 Ga0207706_10254699 3300025933 Unclassified 1533
397 Ga0207670_10099670 3300025936 Bacteria 2073
398 Ga0207670_10343074 3300025936 Bacteria 1181
399 Ga0207704_10039306 3300025938 Bacteria 2753
400 Ga0207704_10192111 3300025938 Bacteria 1486
401 Ga0207665_10001557 3300025939 Bacteria 15450
402 Ga0207665_10002854 3300025939 Bacteria 11599
403 Ga0207665_10003130 3300025939 Bacteria 11099
404 Ga0207665_10004964 3300025939 Bacteria 8876
405 Ga0207665_10008897 3300025939 Bacteria 6594
406 Ga0207665_10351336 3300025939 Bacteria 1113
407 Ga0207711_10034042 3300025941 Bacteria 4314
408 Ga0207711_10063783 3300025941 Bacteria 3181
409 Ga0207711_10378600 3300025941 Bacteria 1313
410 Ga0207661_10138672 3300025944 Bacteria 2091
411 Ga0207661_10301634 3300025944 Bacteria 1436
412 Ga0207661_10317803 3300025944 Bacteria 1399
413 Ga0207661_10513090 3300025944 Unclassified 1096
414 Ga0207661_10633727 3300025944 Bacteria 982
415 Ga0207679_10255239 3300025945 Bacteria 1493
416 Ga0207679_10420673 3300025945 Bacteria 1179
417 Ga0207667_10021249 3300025949 Bacteria 7195
418 Ga0207667_10028682 3300025949 Bacteria 6043
419 Ga0207667_10311268 3300025949 Bacteria 1609
420 Ga0207712_10010611 3300025961 Bacteria 5848
421 Ga0207712_10064017 3300025961 Bacteria 2620
422 Ga0207712_10553563 3300025961 Unclassified 990
423 Ga0207668_10107518 3300025972 Bacteria 2086
424 Ga0207640_10083435 3300025981 Bacteria 2191
425 Ga0207640_10423394 3300025981 Bacteria 1090
426 Ga0207677_10146500 3300026023 Bacteria 1815
427 Ga0207703_10055815 3300026035 Bacteria 3214
428 Ga0207678_10040467 3300026067 Bacteria 4043
429 Ga0207678_10043387 3300026067 Bacteria 3892
430 Ga0207678_10115786 3300026067 Bacteria 2287
431 Ga0207678_10620971 3300026067 Bacteria 948
432 Ga0207708_10033558 3300026075 Bacteria 3900
433 Ga0207702_10096086 3300026078 Bacteria 2605
434 Ga0207702_10131506 3300026078 Bacteria 2253
435 Ga0207702_10208111 3300026078 Bacteria 1817
436 Ga0207641_10022430 3300026088 Bacteria 5198
437 Ga0207641_10458504 3300026088 Bacteria 1233
438 Ga0207648_10064281 3300026089 Bacteria 3198
439 Ga0207676_10036261 3300026095 Bacteria 3750
440 Ga0207676_10313302 3300026095 Bacteria 1437
441 Ga0207676_10338836 3300026095 Unclassified 1387
442 Ga0207674_10024169 3300026116 Bacteria 6497
443 Ga0207674_10067884 3300026116 Bacteria 3589
444 Ga0207674_10179296 3300026116 Bacteria 2070
445 Ga0207675_100009207 3300026118 Bacteria 9261
446 Ga0207675_100064783 3300026118 Bacteria 3416
447 Ga0207683_10039499 3300026121 Bacteria 4118
448 Ga0207683_10174320 3300026121 Bacteria 1949
449 Ga0207683_10664302 3300026121 Bacteria 966
450 Ga0207698_10039132 3300026142 Bacteria 3510
451 Ga0207698_10118085 3300026142 Bacteria 2239
452 Ga0207698_10859235 3300026142 Bacteria 913
453 Ga0209179_1042848 3300027512 Bacteria 956
454 Ga0207428_10002280 3300027907 Bacteria 19250
455 Ga0268266_10140268 3300028379 Bacteria 2169
456 Ga0268264_10209086 3300028381 Bacteria 1790
457 Ga0307512_10158741 3300030522 Bacteria 1331
458 Ga0307408_100162690 3300031548 Bacteria 1774
459 Ga0307405_10010538 3300031731 Bacteria 4798
460 Ga0307405_10015094 3300031731 Bacteria 4173
461 Ga0307405_10098553 3300031731 Bacteria 1954
462 Ga0307413_10031652 3300031824 Bacteria 2988
463 Ga0307413_10035071 3300031824 Bacteria 2874
464 Ga0307410_10001287 3300031852 Bacteria 11173
465 Ga0307410_10010927 3300031852 Bacteria 5168
466 Ga0307410_10251102 3300031852 Bacteria 1375
467 Ga0307406_10111347 3300031901 Bacteria 1885
468 Ga0307407_10024002 3300031903 Bacteria 3190
469 Ga0307409_100002277 3300031995 Bacteria 9943
470 Ga0307409_100018550 3300031995 Bacteria 4682
471 Ga0307409_100027257 3300031995 Bacteria 4046
472 Ga0307409_100101902 3300031995 Bacteria 2384
473 Ga0307416_100001993 3300032002 Bacteria 11456
474 Ga0307416_100005066 3300032002 Bacteria 8036
475 Ga0307416_100032459 3300032002 Bacteria 3945
476 Ga0307416_100209124 3300032002 Bacteria 1859
477 Ga0307414_10023364 3300032004 Bacteria 3921
478 Ga0307414_10113402 3300032004 Bacteria 2069
479 Ga0307411_10049930 3300032005 Bacteria 2722
480 Ga0307411_10142156 3300032005 Bacteria 1771
481 Ga0307415_100000849 3300032126 Bacteria 13973
482 Ga0307415_100021788 3300032126 Bacteria 3946
483 Ga0307415_100023412 3300032126 Bacteria 3832
484 Ga0307415_100183403 3300032126 Bacteria 1644
485 Ga0316212_1006845 3300033547 Bacteria 1650
486 Ga0373930_0002420 3300034816 Bacteria 2883
487 Ga0373948_0010324 3300034817 Bacteria 1628
488 Ga0373958_0001957 3300034819 Bacteria 2831
489 Ga0373938_0002054 3300034957 Bacteria 3232
490 Ga0373934_0007496 3300035086 Bacteria 4053
491 Ga0373940_0014214 3300035088 Bacteria 1938
492 Ga0373949_0012367 3300035090 Bacteria 1888
493 Ga0373951_0009135 3300035091 Bacteria 2233
494 Ga0373951_0019096 3300035091 Bacteria 1561
495 Ga0373939_0003465 3300035114 Bacteria 3702
496 Ga0373941_0008018 3300035115 Bacteria 2608
497 Ga0373941_0038187 3300035115 Bacteria 1469
498 Ga0373954_0055624 3300035118 Bacteria 1862
499 Ga0373954_0184959 3300035118 Bacteria 1022
500 Ga0373956_0051871 3300035119 Bacteria 1844
501 Ga0373957_0012014 3300035120 Bacteria 2905
502 Ga0373957_0041992 3300035120 Bacteria 1724
503 Ga0373957_0101218 3300035120 Bacteria 1154
504 Ga0373960_0015618 3300035121 Bacteria 1941
505 Ga0373943_0015162 3300035170 Bacteria 3499
506 Ga0373943_0074323 3300035170 Bacteria 1728
507 Ga0373943_0229329 3300035170 Bacteria 1037
508 Ga0373943_0230070 3300035170 Bacteria 1035
509 Ga0373955_0190793 3300035172 Bacteria 1218
510 Ga0373942_0007998 3300035207 Bacteria 2458
511 Ga0373961_0006508 3300035241 Bacteria 2805
512 Ga0373961_0025299 3300035241 Bacteria 1612
513 Ga0373924_0048260 3300035410 Bacteria 1758
514 Ga0373931_0004582 3300035691 Bacteria 6324
515 Ga0373935_0010449 3300035692 Bacteria 5568
516 Ga0373933_0008334 3300035724 Bacteria 5660
517 Ga0373933_0015855 3300035724 Bacteria 4206
518 Ga0373933_0184653 3300035724 Bacteria 1331
519 Ga0373947_0146097 3300035725 Bacteria 1520
520 Ga0373937_0020628 3300036401 Bacteria 5908
521 Ga0373937_0134035 3300036401 Bacteria 2315
522 Ga0373937_0324186 3300036401 Bacteria 1457
523 Ga0373925_0003342 3300037068 Bacteria 12459
524 Ga0373925_0057874 3300037068 Bacteria 2905
525 Ga0373925_0058736 3300037068 Bacteria 2884
526 Ga0373925_0145286 3300037068 Bacteria 1859
527 Ga0395899_0004556 3300037312 Bacteria 10793
528 Ga0395899_0048153 3300037312 Bacteria 3173
529 Ga0395899_0070110 3300037312 Bacteria 2566
530 Ga0395899_0144064 3300037312 Bacteria 1693
531 Ga0395899_0192209 3300037312 Bacteria 1428
532 Ga0395900_0005315 3300037418 Bacteria 13496
533 Ga0395900_0033991 3300037418 Bacteria 5248
534 Ga0395900_0117896 3300037418 Bacteria 2724
535 Ga0395900_0123111 3300037418 Bacteria 2660
536 Ga0395900_0141725 3300037418 Bacteria 2461
537 Ga0395900_0167531 3300037418 Bacteria 2238
538 Ga0395900_0382399 3300037418 Bacteria 1375
539 Ga0395900_0932478 3300037418 Bacteria 790
540 Ga0395898_0002844 3300037466 Bacteria 19791
541 Ga0395898_0012364 3300037466 Bacteria 8828
542 Ga0395898_0131786 3300037466 Bacteria 2394
543 Ga0395898_0275927 3300037466 Bacteria 1603
544 Ga0395898_0758056 3300037466 Bacteria 912
545 Ga0395905_0001967 3300037471 Bacteria 23493
546 Ga0395905_0041976 3300037471 Bacteria 4292
547 Ga0395905_0170315 3300037471 Bacteria 2045
548 Ga0395905_0331729 3300037471 Bacteria 1412
549 Ga0395905_0557070 3300037471 Bacteria 1048
550 Ga0436364_0025330 3300037853 Bacteria 1503
551 Ga0436364_0077046 3300037853 Bacteria 111992
552 Ga0436364_0212006 3300037853 Bacteria 61210
553 Ga0436364_0565857 3300037853 Bacteria 1517
554 Ga0436364_0721645 3300037853 Bacteria 2986
555 Ga0436364_1181445 3300037853 Bacteria 9028
556 Ga0436364_1370870 3300037853 Bacteria 1337
557 Ga0395901_0001069 3300038443 Bacteria 29372
558 Ga0395901_0040772 3300038443 Bacteria 4809
559 Ga0395901_0042265 3300038443 Bacteria 4725
560 Ga0395901_0100283 3300038443 Bacteria 3037
561 Ga0395901_0132266 3300038443 Bacteria 2621
562 Ga0395901_0178470 3300038443 Bacteria 2227
563 Ga0395901_0185908 3300038443 Bacteria 2179
564 Ga0395901_0844552 3300038443 Bacteria 901
565 Ga0395901_0921349 3300038443 Bacteria 854
566 Ga0436362_0561529 3300039453 Bacteria 1439
567 Ga0439443_004128 3300042003 Bacteria 1875
568 Ga0439448_0011857 3300042005 Bacteria 2600
569 Ga0439448_0084843 3300042005 Bacteria 1066
570 Ga0439450_000457 3300042008 Bacteria 5296
571 Ga0439450_010723 3300042008 Bacteria 1775
572 Ga0439451_007941 3300042009 Bacteria 2154
573 Ga0439454_008156 3300042011 Bacteria 1331
574 Ga0439463_001832 3300042016 Bacteria 5519
575 Ga0439463_007320 3300042016 Bacteria 2727
576 Ga0450888_006260 3300042126 Bacteria 1290
577 Ga0450900_007727 3300042136 Bacteria 1330
578 Ga0450905_000683 3300042142 Bacteria 4155
579 Ga0439435_0019844 3300042436 Bacteria 1728
580 Ga0439444_0002788 3300042437 Bacteria 2421
581 Ga0439464_0000611 3300042439 Bacteria 7548
582 Ga0439464_0084967 3300042439 Bacteria 948
583 Ga0439460_0001195 3300042461 Bacteria 6112
584 Ga0439460_0045737 3300042461 Bacteria 1299
585 Ga0439460_0074999 3300042461 Unclassified 1053
586 Ga0450916_000443 3300042530 Bacteria 3562
587 Ga0439440_0000138 3300042993 Bacteria 10454
588 Ga0439440_0040887 3300042993 Bacteria 1129
589 Ga0466969_0007236 3300044656 Bacteria 5906
590 Ga0466969_0030840 3300044656 Bacteria 2730
591 Ga0466966_0042731 3300044684 Bacteria 2907
592 Ga0466961_0017607 3300044693 Bacteria 4590
593 Ga0466961_0024414 3300044693 Bacteria 3890
594 Ga0466963_0154394 3300044694 Bacteria 1595
595 Ga0466963_0230172 3300044694 Bacteria 1299
596 Ga0466971_0005673 3300044719 Bacteria 5425
597 Ga0466970_0006512 3300044765 Bacteria 5837
598 Ga0466970_0233606 3300044765 Bacteria 1028
599 Ga0466957_0118038 3300044842 Bacteria 1689
600 Ga0466959_0006218 3300045049 Bacteria 8253
601 Ga0466959_0047709 3300045049 Bacteria 3150
602 Ga0466959_0076883 3300045049 Bacteria 2410
603 Ga0466959_0171899 3300045049 Bacteria 1520
604 Ga0466958_0117574 3300045836 Bacteria 1662
605 Ga0466967_0015406 3300045976 Bacteria 5991
606 Ga0466967_0181203 3300045976 Bacteria 1987
607 Ga0466967_0367604 3300045976 Bacteria 1395
608 Ga0495592_0030009 3300046454 Bacteria 4113
609 Ga0495592_0122017 3300046454 Bacteria 1832
610 Ga0495592_0126824 3300046454 Bacteria 1789
611 Ga0495603_0006845 3300046455 Bacteria 6840
612 Ga0495641_0080404 3300046461 Bacteria 1460
613 Ga0495651_0008074 3300046462 Bacteria 8071
614 Ga0495651_0023871 3300046462 Bacteria 4755
615 Ga0495651_0031173 3300046462 Bacteria 4159
616 Ga0495651_0037806 3300046462 Bacteria 3758
617 Ga0495651_0043718 3300046462 Bacteria 3474
618 Ga0495651_0081301 3300046462 Bacteria 2446
619 Ga0495651_0236269 3300046462 Bacteria 1256
620 Ga0495653_0001681 3300046463 Bacteria 17410
621 Ga0495653_0011612 3300046463 Bacteria 7190
622 Ga0495653_0065294 3300046463 Bacteria 2739
623 Ga0495653_0110223 3300046463 Bacteria 1979
624 Ga0495580_0128389 3300046472 Bacteria 1759
625 Ga0495664_0010356 3300046477 Bacteria 5231
626 Ga0495664_0011383 3300046477 Bacteria 5014
627 Ga0495584_0088945 3300046491 Bacteria 1557
628 Ga0495594_0095754 3300046499 Bacteria 1667
629 Ga0495596_0049482 3300046500 Bacteria 1648
630 Ga0495607_0214476 3300046501 Bacteria 945
631 Ga0495607_0217776 3300046501 Unclassified 936
632 Ga0495608_0038199 3300046511 Bacteria 3225
633 Ga0495608_0046096 3300046511 Bacteria 2902
634 Ga0495608_0089639 3300046511 Bacteria 1990
635 Ga0495608_0128943 3300046511 Bacteria 1619
636 Ga0495616_0125470 3300046513 Bacteria 1181
637 Ga0495618_0015050 3300046514 Bacteria 4718
638 Ga0495618_0084435 3300046514 Bacteria 2029
639 Ga0495628_0005291 3300046516 Bacteria 11319
640 Ga0495628_0029092 3300046516 Bacteria 4484
641 Ga0495628_0056532 3300046516 Bacteria 3088
642 Ga0495628_0076877 3300046516 Bacteria 2597
643 Ga0495628_0360253 3300046516 Bacteria 1068
644 Ga0495630_0300543 3300046517 Bacteria 1226
645 Ga0495637_0084402 3300046520 Bacteria 1262
646 Ga0495644_0026909 3300046523 Bacteria 2181
647 Ga0495644_0067683 3300046523 Bacteria 1342
648 Ga0495652_0000731 3300046529 Bacteria 38018
649 Ga0495652_0004416 3300046529 Bacteria 13447
650 Ga0495652_0005702 3300046529 Bacteria 11660
651 Ga0495652_0030389 3300046529 Bacteria 4739
652 Ga0495652_0067853 3300046529 Bacteria 2989
653 Ga0495665_0019512 3300046531 Bacteria 3646
654 Ga0495640_0010835 3300046533 Bacteria 7034
655 Ga0495640_0056712 3300046533 Bacteria 2675
656 Ga0495640_0125088 3300046533 Bacteria 1668
657 Ga0495586_0062901 3300046535 Bacteria 2021
658 Ga0495586_0139911 3300046535 Bacteria 1358
659 Ga0495587_0003110 3300046536 Bacteria 11099
660 Ga0495587_0007004 3300046536 Bacteria 7321
661 Ga0495587_0037051 3300046536 Bacteria 2931
662 Ga0495609_0053328 3300046538 Bacteria 1798
663 Ga0495645_0011691 3300046543 Bacteria 6179
664 Ga0495645_0061719 3300046543 Bacteria 2716
665 Ga0495645_0078745 3300046543 Bacteria 2368
666 Ga0495645_0196281 3300046543 Bacteria 1372
667 Ga0495622_0132949 3300046557 Bacteria 1132
668 Ga0495667_0000230 3300046559 Bacteria 36657
669 Ga0495667_0012947 3300046559 Bacteria 5655
670 Ga0495667_0028768 3300046559 Bacteria 3742
671 Ga0495667_0038181 3300046559 Bacteria 3198
672 Ga0495667_0069636 3300046559 Bacteria 2296
673 Ga0495667_0071785 3300046559 Bacteria 2257
674 Ga0495656_0024362 3300046615 Bacteria 2389
675 Ga0495656_0105436 3300046615 Bacteria 1310
676 Ga0495656_0164777 3300046615 Bacteria 1079
677 Ga0495634_0010984 3300046642 Bacteria 6610
678 Ga0495611_0141861 3300046648 Bacteria 1122
679 Ga0495635_0015411 3300046663 Bacteria 5346
680 Ga0495635_0028333 3300046663 Bacteria 3892
681 Ga0495635_0063918 3300046663 Bacteria 2527
682 Ga0495635_0203332 3300046663 Bacteria 1343
683 Ga0495659_0047392 3300046664 Bacteria 1554
684 Ga0495659_0113245 3300046664 Unclassified 1061
685 Ga0495588_0034182 3300046674 Bacteria 2572
686 Ga0495657_0006566 3300046675 Bacteria 9087
687 Ga0495657_0015874 3300046675 Bacteria 5498
688 Ga0495657_0029078 3300046675 Bacteria 3879
689 Ga0495657_0049466 3300046675 Bacteria 2831
690 Ga0495657_0095821 3300046675 Bacteria 1896
691 Ga0495657_0106551 3300046675 Bacteria 1780
692 Ga0495599_0024054 3300046678 Bacteria 3809
693 Ga0495599_0107418 3300046678 Bacteria 1739
694 Ga0495623_0010932 3300046679 Bacteria 5874
695 Ga0495623_0011007 3300046679 Bacteria 5854
696 Ga0495623_0050003 3300046679 Bacteria 2649
697 Ga0495623_0065624 3300046679 Bacteria 2269
698 Ga0495646_0001297 3300046680 Bacteria 14748
699 Ga0495646_0052943 3300046680 Bacteria 2449
700 Ga0495647_0162727 3300046681 Bacteria 962
701 Ga0495613_0026413 3300046689 Bacteria 4326
702 Ga0495613_0026934 3300046689 Bacteria 4280
703 Ga0495624_0057729 3300046690 Bacteria 2440
704 Ga0495670_0102710 3300046691 Bacteria 1473
705 Ga0495671_0101040 3300046692 Bacteria 1410
706 Ga0495600_0011317 3300046809 Bacteria 5558
707 Ga0495600_0033653 3300046809 Bacteria 3326
708 Ga0495600_0073269 3300046809 Bacteria 2236
709 Ga0495600_0290193 3300046809 Bacteria 1034
710 Ga0495604_0009037 3300047317 Bacteria 7883
711 Ga0495604_0027235 3300047317 Bacteria 4547
712 Ga0495604_0047627 3300047317 Bacteria 3338
713 Ga0495604_0388611 3300047317 Unclassified 921
714 Ga0495674_0064492 3300047319 Bacteria 3184
715 Ga0495674_0084036 3300047319 Bacteria 2728
716 Ga0495674_0188857 3300047319 Bacteria 1713
717 Ga0495674_0399777 3300047319 Bacteria 1109
718 Ga0495676_0248073 3300047321 Bacteria 1216
719 Ga0495680_0015996 3300047322 Bacteria 6453
720 Ga0495680_0027890 3300047322 Bacteria 4633
721 Ga0495680_0028167 3300047322 Bacteria 4608
722 Ga0495680_0040467 3300047322 Bacteria 3714
723 Ga0495680_0116584 3300047322 Bacteria 1975
724 Ga0495680_0163577 3300047322 Bacteria 1614
725 Ga0495680_0348849 3300047322 Bacteria 1031
726 Ga0495675_0073953 3300047444 Bacteria 2148
727 Ga0495684_0039835 3300047471 Bacteria 3602
728 Ga0495684_0055703 3300047471 Bacteria 3015
729 Ga0495602_0003730 3300048088 Bacteria 15821
730 Ga0495602_0022067 3300048088 Bacteria 6239
731 Ga0495602_0053308 3300048088 Bacteria 3583
732 Ga0495602_0209220 3300048088 Bacteria 1482
733 Ga0496100_0131438 3300048903 Bacteria 1764
734 Ga0496100_0246021 3300048903 Bacteria 1321
735 Ga0496100_0568345 3300048903 Unclassified 878
736 Ga0496101_0009273 3300048904 Bacteria 6462
737 Ga0496101_0054617 3300048904 Bacteria 2884
738 Ga0496101_0066251 3300048904 Bacteria 2634
739 Ga0496102_0038032 3300048905 Bacteria 4341
740 Ga0496102_0168099 3300048905 Unclassified 2064
741 Ga0496104_0013522 3300048907 Bacteria 7353
742 Ga0496104_0027757 3300048907 Bacteria 5239
743 Ga0496104_0046157 3300048907 Bacteria 4101
744 Ga0496104_0074089 3300048907 Bacteria 3241
745 Ga0496104_0104810 3300048907 Bacteria 2710
746 Ga0496105_0011075 3300048908 Bacteria 7108
747 Ga0496105_0051797 3300048908 Bacteria 3390
748 Ga0496105_0105840 3300048908 Bacteria 2322
749 Ga0496106_0009855 3300048909 Bacteria 7055
750 Ga0496106_0034483 3300048909 Bacteria 3780
751 Ga0496106_0136090 3300048909 Unclassified 1930
752 Ga0496107_0083340 3300048910 Bacteria 2332
753 Ga0496108_0024011 3300048911 Bacteria 5019
754 Ga0496108_0027816 3300048911 Bacteria 4674
755 Ga0496108_0073268 3300048911 Bacteria 2891
756 Ga0496108_0111865 3300048911 Bacteria 2336
757 Ga0496108_0272712 3300048911 Bacteria 1473
758 Ga0496109_0023936 3300048912 Bacteria 5423
759 Ga0496109_0031186 3300048912 Bacteria 4782
760 Ga0496109_0063514 3300048912 Bacteria 3378
761 Ga0496109_0077477 3300048912 Bacteria 3059
762 Ga0496109_0126967 3300048912 Bacteria 2378
763 Ga0496109_0198975 3300048912 Bacteria 1884
764 Ga0496109_0623882 3300048912 Bacteria 1015
765 Ga0496110_0081573 3300048913 Bacteria 2883
766 Ga0496110_0094205 3300048913 Bacteria 2681
767 Ga0496110_0103784 3300048913 Bacteria 2550
768 Ga0496111_0017139 3300048914 Bacteria 5003
769 Ga0496111_0062831 3300048914 Bacteria 2693
770 Ga0496111_0076770 3300048914 Bacteria 2435
771 Ga0496111_0083739 3300048914 Bacteria 2331
772 Ga0496111_0132876 3300048914 Bacteria 1842
773 Ga0496112_0006374 3300048915 Bacteria 10357
774 Ga0496112_0169183 3300048915 Bacteria 2151
775 Ga0496112_0176229 3300048915 Bacteria 2103
776 Ga0496112_0182905 3300048915 Bacteria 2060
777 Ga0496113_0011428 3300048916 Bacteria 5922
778 Ga0496113_0013158 3300048916 Bacteria 5591
779 Ga0496113_0045651 3300048916 Bacteria 3250
780 Ga0496113_0186785 3300048916 Bacteria 1644
781 Ga0496113_0343534 3300048916 Unclassified 1197
782 Ga0496114_0016291 3300048917 Bacteria 5987
783 Ga0496114_0207742 3300048917 Unclassified 1716
784 Ga0496115_0002340 3300048918 Bacteria 13593
785 Ga0496115_0326532 3300048918 Bacteria 1254
786 Ga0496126_0047192 3300048929 Bacteria 3944
787 Ga0496126_0166963 3300048929 Bacteria 1878
788 Ga0501031_0004126 3300049568 Bacteria 9382
789 Ga0501031_0008038 3300049568 Bacteria 6869
790 Ga0501031_0021617 3300049568 Bacteria 4194
791 Ga0501031_0100417 3300049568 Bacteria 1888
792 Ga0501032_0023141 3300049569 Bacteria 4301
793 Ga0501032_0052254 3300049569 Bacteria 2754
794 Ga0501033_0006419 3300049570 Bacteria 9208
795 Ga0501033_0041685 3300049570 Bacteria 3424
796 Ga0501033_0074091 3300049570 Bacteria 2499
797 Ga0501034_0021538 3300049571 Bacteria 6568
798 Ga0501036_0000868 3300049572 Bacteria 22508
799 Ga0501036_0018563 3300049572 Bacteria 5830
800 Ga0501036_0033097 3300049572 Bacteria 4371
801 Ga0501036_0048287 3300049572 Bacteria 3603
802 Ga0501036_0051775 3300049572 Bacteria 3477
803 Ga0501037_0007242 3300049573 Bacteria 8104
804 Ga0501037_0031573 3300049573 Bacteria 3911
805 Ga0501037_0075919 3300049573 Bacteria 2440
806 Ga0501037_0182984 3300049573 Bacteria 1486
807 Ga0501038_0015642 3300049574 Bacteria 6896
808 Ga0501038_0016922 3300049574 Bacteria 6598
809 Ga0501038_0018692 3300049574 Bacteria 6257
810 Ga0501038_0023764 3300049574 Bacteria 5476
811 Ga0501038_0051125 3300049574 Bacteria 3568
812 Ga0501039_0001861 3300049575 Bacteria 15592
813 Ga0501039_0017741 3300049575 Bacteria 5460
814 Ga0501039_0018772 3300049575 Bacteria 5308
815 Ga0501039_0027934 3300049575 Bacteria 4340
816 Ga0501039_0064832 3300049575 Bacteria 2832
817 Ga0501039_0120346 3300049575 Bacteria 2057
818 Ga0501040_0000619 3300049576 Bacteria 21740
819 Ga0501040_0006111 3300049576 Bacteria 7812
820 Ga0501040_0027955 3300049576 Bacteria 3799
821 Ga0501040_0028606 3300049576 Bacteria 3758
822 Ga0501040_0063177 3300049576 Bacteria 2547
823 Ga0501040_0152897 3300049576 Bacteria 1628
824 Ga0501040_0324886 3300049576 Bacteria 1101
825 Ga0501041_0009934 3300049577 Bacteria 5606
826 Ga0501041_0015722 3300049577 Bacteria 4494
827 Ga0501041_0019945 3300049577 Bacteria 4005
828 Ga0501041_0044119 3300049577 Bacteria 2711
829 Ga0501041_0090993 3300049577 Bacteria 1883
830 Ga0501042_0000527 3300049578 Bacteria 19961
831 Ga0501042_0003690 3300049578 Bacteria 9666
832 Ga0501042_0012887 3300049578 Bacteria 5678
833 Ga0501042_0014056 3300049578 Bacteria 5458
834 Ga0501042_0020232 3300049578 Bacteria 4630
835 Ga0501042_0042241 3300049578 Bacteria 3244
836 Ga0501042_0063576 3300049578 Bacteria 2637
837 Ga0501043_0024448 3300049579 Bacteria 4740
838 Ga0501043_0082154 3300049579 Bacteria 2532
839 Ga0501043_0117736 3300049579 Bacteria 2084
840 Ga0501046_0004361 3300049580 Bacteria 12872
841 Ga0501046_0016569 3300049580 Bacteria 6166
842 Ga0501046_0039274 3300049580 Bacteria 3791
843 Ga0501046_0055033 3300049580 Bacteria 3128
844 Ga0501046_0164252 3300049580 Bacteria 1668
845 Ga0501046_0289404 3300049580 Bacteria 1198
846 Ga0501047_0066722 3300049581 Bacteria 3469
847 Ga0501047_0077290 3300049581 Bacteria 3203
848 Ga0501048_0002081 3300049582 Bacteria 15238
849 Ga0501048_0005088 3300049582 Bacteria 10014
850 Ga0501048_0018107 3300049582 Bacteria 5182
851 Ga0501048_0026018 3300049582 Bacteria 4262
852 Ga0501048_0053249 3300049582 Bacteria 2879
853 Ga0501048_0060399 3300049582 Bacteria 2686
854 Ga0501067_0207509 3300049583 Bacteria 1091
855 Ga0501067_0268008 3300049583 Bacteria 951
856 Ga0501068_0000603 3300049584 Bacteria 18272
857 Ga0501068_0032489 3300049584 Bacteria 3104
858 Ga0501068_0046981 3300049584 Bacteria 2603
859 Ga0501068_0135083 3300049584 Bacteria 1544
860 Ga0501069_0000228 3300049585 Bacteria 25115
861 Ga0501070_0016833 3300049586 Bacteria 6136
862 Ga0501070_0109830 3300049586 Bacteria 2279
863 Ga0501071_0001890 3300049587 Bacteria 12447
864 Ga0501071_0005701 3300049587 Bacteria 8027
865 Ga0501071_0007010 3300049587 Bacteria 7360
866 Ga0501071_0009056 3300049587 Bacteria 6608
867 Ga0501071_0032918 3300049587 Bacteria 3682
868 Ga0501072_0003544 3300049588 Bacteria 11742
869 Ga0501072_0019574 3300049588 Bacteria 5234
870 Ga0501072_0021349 3300049588 Bacteria 5022
871 Ga0501072_0024736 3300049588 Bacteria 4673
872 Ga0501072_0151183 3300049588 Bacteria 1851
873 Ga0501072_0369699 3300049588 Bacteria 1138
874 Ga0501073_0001635 3300049589 Bacteria 16616
875 Ga0501073_0080222 3300049589 Bacteria 2271
876 Ga0501073_0193559 3300049589 Bacteria 1407
877 Ga0501074_0003309 3300049590 Bacteria 11397
878 Ga0501074_0017125 3300049590 Bacteria 5257
879 Ga0501074_0018704 3300049590 Bacteria 5033
880 Ga0501074_0019408 3300049590 Bacteria 4938
881 Ga0501074_0126060 3300049590 Bacteria 1831
882 Ga0501075_0000224 3300049591 Bacteria 30212
883 Ga0501075_0002582 3300049591 Bacteria 12084
884 Ga0501075_0022840 3300049591 Bacteria 4574
885 Ga0501075_0028323 3300049591 Bacteria 4134
886 Ga0501075_0069950 3300049591 Bacteria 2652
887 Ga0501075_0105506 3300049591 Bacteria 2141
888 Ga0501076_0000544 3300049592 Bacteria 24072
889 Ga0501076_0014133 3300049592 Bacteria 6003
890 Ga0501076_0014229 3300049592 Bacteria 5988
891 Ga0501076_0021406 3300049592 Bacteria 4959
892 Ga0501076_0252599 3300049592 Bacteria 1443
893 Ga0501077_0002174 3300049593 Bacteria 11848
894 Ga0501077_0005502 3300049593 Bacteria 7702
895 Ga0501077_0148021 3300049593 Bacteria 1490
896 Ga0501077_0180999 3300049593 Bacteria 1340
897 Ga0501079_0000269 3300049741 Bacteria 31990
898 Ga0501079_0008835 3300049741 Bacteria 7629
899 Ga0501079_0014148 3300049741 Bacteria 6081
900 Ga0501079_0016461 3300049741 Bacteria 5645
901 Ga0501079_0052197 3300049741 Bacteria 3156
902 Ga0501079_0418211 3300049741 Bacteria 1052
903 Ga0501080_0033224 3300049742 Bacteria 4815
904 Ga0501080_0055307 3300049742 Bacteria 3696
905 Ga0501080_0179308 3300049742 Bacteria 1950
906 Ga0501081_0006116 3300049743 Bacteria 7802
907 Ga0501081_0015908 3300049743 Bacteria 4967
908 Ga0501081_0022842 3300049743 Bacteria 4187
909 Ga0501081_0117170 3300049743 Bacteria 1894
910 Ga0501083_0005179 3300049744 Bacteria 9222
911 Ga0501083_0019519 3300049744 Bacteria 4721
912 Ga0501083_0028477 3300049744 Bacteria 3849
913 Ga0501083_0099647 3300049744 Bacteria 1916
914 Ga0501035_0045429 3300049822 Bacteria 3952
915 Ga0501035_0249737 3300049822 Bacteria 1507
916 Ga0501044_0005842 3300049823 Bacteria 13629
917 Ga0501044_0039522 3300049823 Bacteria 4922
918 Ga0501044_0097613 3300049823 Bacteria 2959
919 Ga0501045_0000261 3300049824 Bacteria 30562
920 Ga0501045_0009032 3300049824 Bacteria 6962
921 Ga0501045_0015095 3300049824 Bacteria 5482
922 Ga0501045_0028504 3300049824 Bacteria 4028
923 Ga0501045_0135190 3300049824 Bacteria 1833
924 Ga0501045_0361747 3300049824 Bacteria 1080
925 nmdc:mga05p37_192922_c1 3300050507 Bacteria 2472
926 nmdc:mga05p37_223895_c1 3300050507 Bacteria 2269
927 nmdc:mga05p37_312751_c1 3300050507 Bacteria 1861
928 nmdc:mga05p37_68759_c2 3300050507 Bacteria 2612
929 nmdc:mga05p37_7014_c1 3300050507 Bacteria 13281
930 nmdc:mga09592_105203_c1 3300050508 Bacteria 2419
931 nmdc:mga09592_12307_c1 3300050508 Bacteria 6967
932 nmdc:mga0qj67_74070_c1 3300050509 Bacteria 2721
933 nmdc:mga06r32_497521_c1 3300050510 Unclassified 1196
934 nmdc:mga06r32_65967_c1 3300050510 Bacteria 3493
935 nmdc:mga08y16_56483_c1 3300050511 Bacteria 4103
936 nmdc:mga0n895_20018_c1 3300050512 Bacteria 6231
937 nmdc:mga0n895_238296_c1 3300050512 Bacteria 1846
938 nmdc:mga0n895_31992_c1 3300050512 Bacteria 5044
939 nmdc:mga0n895_382426_c1 3300050512 Bacteria 1424
940 nmdc:mga0n895_46907_c1 3300050512 Bacteria 4223
941 nmdc:mga0n895_47781_c1 3300050512 Bacteria 4186
942 nmdc:mga0n895_70162_c1 3300050512 Bacteria 3473
943 nmdc:mga0rr50_291791_c1 3300050513 Bacteria 1363
944 nmdc:mga0rr50_58822_c1 3300050513 Bacteria 2882
945 nmdc:mga0rr50_73518_c1 3300050513 Bacteria 2614
946 nmdc:mga08x19_17380_c1 3300050514 Bacteria 4400
947 nmdc:mga08x19_43265_c1 3300050514 Bacteria 2873
948 nmdc:mga0a205_152773_c1 3300050515 Bacteria 2207
949 nmdc:mga0a205_16824_c1 3300050515 Bacteria 6849
950 nmdc:mga0a205_52657_c1 3300050515 Bacteria 3928
951 nmdc:mga0a205_73016_c1 3300050515 Bacteria 3315
952 nmdc:mga0a205_783369_c1 3300050515 Bacteria 801
953 nmdc:mga0a205_7938_c1 3300050515 Bacteria 9638
954 Ga0495601_0004265 3300053077 Bacteria 8257
955 Ga0495601_0188601 3300053077 Bacteria 1348
956 Ga0495612_0012471 3300053078 Bacteria 3426
957 Ga0495612_0020207 3300053078 Bacteria 2669
958 Ga0495619_0123606 3300053085 Bacteria 1775
959 Ga0501084_0009738 3300054114 Bacteria 7949
960 Ga0501084_0025891 3300054114 Bacteria 4892
961 Ga0501084_0030837 3300054114 Bacteria 4482
962 Ga0501084_0052286 3300054114 Bacteria 3418
963 Ga0501084_0064590 3300054114 Bacteria 3062
964 Ga0501084_0212425 3300054114 Bacteria 1632
965 Ga0590074_003008 3300059423 Bacteria 2783
966 Ga0590075_025083 3300059424 Bacteria 1498
967 Ga0590077_003153 3300059426 Bacteria 3447
968 Ga0590077_007353 3300059426 Bacteria 2253
969 Ga0501082_0000767 3300060353 Bacteria 28110
970 Ga0501082_0020138 3300060353 Bacteria 5748
971 Ga0501082_0043677 3300060353 Bacteria 3865
972 Ga0501082_0050136 3300060353 Bacteria 3600
973 Ga0466962_0005687 3300061719 Bacteria 5990
974 Ga0530510_0001223 3300061734 Bacteria 17156
975 Ga0530510_0005952 3300061734 Bacteria 8458
976 Ga0530510_0109172 3300061734 Bacteria 2025
977 Ga0530510_0258128 3300061734 Bacteria 1299
978 2891402858 2891395885 Bacteria 9251614
979 2891554832 2891554331 Bacteria 8812224
980 2997457445 2997451912 Bacteria 8492419
981 Ga0496102_0281896
982 Ga0070683_100060765
983 Ga0070670_100102969
984 Ga0070680_100129875
985 Ga0070682_100159670
986 Ga0070682_100203147
987 Ga0068868_100028993
988 Ga0068868_100042560
989 Ga0070660_100257304
990 Ga0070689_100121780
991 Ga0070689_100546938
992 Ga0070691_10084472
993 Ga0070661_100215459
994 Ga0070669_100235960
995 Ga0070703_10000005
996 Ga0070703_10011257
997 Ga0070709_10000936
998 Ga0070709_10010332
999 Ga0070709_10017721
1000 Ga0070709_10037240
1001 Ga0070714_100008560
1002 Ga0070714_100015228
1003 Ga0070714_100075357
1004 Ga0070714_100146227
1005 Ga0070714_100217442
1006 Ga0070714_100524625
1007 Ga0070714_100878267
1008 Ga0070713_100002341
1009 Ga0070713_100020797
1010 Ga0070713_100030612
1011 Ga0070713_100101020
1012 Ga0070713_100120831
1013 Ga0070713_100132283
1014 Ga0070713_100153967
1015 Ga0070713_100249147
1016 Ga0070713_100327440
1017 Ga0070713_100477227
1018 Ga0070710_10003344
1019 Ga0070710_10003544
1020 Ga0070710_10016273
1021 Ga0070710_10063649
1022 Ga0070701_10050836
1023 Ga0070711_100001972
1024 Ga0070711_100019864
1025 Ga0070711_100022459
1026 Ga0070711_100022794
1027 Ga0070711_100048894
1028 Ga0070711_100389002
1029 Ga0070711_100591675
1030 Ga0070705_100008189
1031 Ga0070705_100029213
1032 Ga0070705_100140657
1033 Ga0070694_100038314
1034 Ga0070694_100334090
1035 Ga0070708_100000074
1036 Ga0070708_100001238
1037 Ga0070708_100001603
1038 Ga0070708_100118040
1039 Ga0070708_100153843
1040 Ga0070708_100181477
1041 Ga0070708_100675851
1042 Ga0070663_100024890
1043 Ga0070663_100075280
1044 Ga0070663_100091646
1045 Ga0070678_100020458
1046 Ga0070678_100620959
1047 Ga0070662_100125049
1048 Ga0070681_10015186
1049 Ga0070681_10268021
1050 Ga0070681_10408939
1051 Ga0070681_10457813
1052 Ga0068867_100175967
1053 Ga0070706_100001907
1054 Ga0070706_100006141
1055 Ga0070706_100007464
1056 Ga0070706_100021579
1057 Ga0070706_100027442
1058 Ga0070706_100031066
1059 Ga0070706_100070908
1060 Ga0070706_100073130
1061 Ga0070706_100078530
1062 Ga0070706_100152939
1063 Ga0070706_100200826
1064 Ga0070706_100589054
1065 Ga0070707_100000637
1066 Ga0070707_100002195
1067 Ga0070707_100004568
1068 Ga0070707_100005640
1069 Ga0070707_100009909
1070 Ga0070707_100024185
1071 Ga0070707_100031092
1072 Ga0070707_100042754
1073 Ga0070707_100057084
1074 Ga0070707_100057133
1075 Ga0070707_100084603
1076 Ga0070707_100113629
1077 Ga0070707_100158398
1078 Ga0070707_100255719
1079 Ga0070707_100389879
1080 Ga0070698_100000082
1081 Ga0070698_100002067
1082 Ga0070698_100006327
1083 Ga0070698_100009295
1084 Ga0070698_100010143
1085 Ga0070698_100011159
1086 Ga0070698_100013845
1087 Ga0070698_100019349
1088 Ga0070698_100025985
1089 Ga0070698_100039922
1090 Ga0070698_100091562
1091 Ga0070698_100092469
1092 Ga0070698_100097124
1093 Ga0070698_100119956
1094 Ga0070698_100406277
1095 Ga0070699_100001106
1096 Ga0070699_100010091
1097 Ga0070699_100024128
1098 Ga0070699_100044724
1099 Ga0070699_100106047
1100 Ga0070699_100163958
1101 Ga0070679_100100227
1102 Ga0070679_100182357
1103 Ga0070684_100034153
1104 Ga0070684_100079692
1105 Ga0070684_100154071
1106 Ga0070684_100226699
1107 Ga0070684_100282126
1108 Ga0070697_100128414
1109 Ga0070697_100139624
1110 Ga0070697_100343954
1111 Ga0070686_100102933
1112 Ga0070695_100036735
1113 Ga0070695_100053815
1114 Ga0070696_100014341
1115 Ga0070696_100026882
1116 Ga0070696_100170887
1117 Ga0070696_100272658
1118 Ga0070693_100059353
1119 Ga0070665_100037887
1120 Ga0070665_100060734
1121 Ga0070665_100103077
1122 Ga0068855_100015019
1123 Ga0068855_100057398
1124 Ga0068855_100638293
1125 Ga0070664_100101554
1126 Ga0068857_100367418
1127 Ga0068854_100245493
1128 Ga0068856_100042997
1129 Ga0068856_100288919
1130 Ga0068856_100389414
1131 Ga0068856_100782337
1132 Ga0070702_100040027
1133 Ga0070702_100097035
1134 Ga0068852_100012576
1135 Ga0068852_100037902
1136 Ga0068852_100279856
1137 Ga0068864_100151195
1138 Ga0068866_10013129
1139 Ga0068861_100084029
1140 Ga0068863_100015496
1141 Ga0068858_100013504
1142 Ga0068858_100338018
1143 Ga0068858_100389930
1144 Ga0068860_100303023
1145 Ga0068860_100483283
1146 Ga0081455_10008399
1147 Ga0081538_10002838
1148 Ga0081538_10003979
1149 Ga0081538_10004688
1150 Ga0081538_10075464
1151 Ga0081540_1001407
1152 Ga0081539_10005520
1153 Ga0081539_10019810
1154 Ga0081539_10044537
1155 Ga0070717_10006347
1156 Ga0070717_10006576
1157 Ga0070717_10017441
1158 Ga0070717_10019394
1159 Ga0070717_10033140
1160 Ga0070717_10060140
1161 Ga0070717_10091920
1162 Ga0070717_10634615
1163 Ga0070715_10001082
1164 Ga0070715_10002235
1165 Ga0070715_10010780
1166 Ga0070715_10034807
1167 Ga0070716_100002738
1168 Ga0070716_100007339
1169 Ga0070716_100011043
1170 Ga0070712_100009206
1171 Ga0070712_100027795
1172 Ga0070712_100029667
1173 Ga0070712_100153508
1174 Ga0070712_100186918
1175 Ga0070712_100189940
1176 Ga0070712_100190787
1177 Ga0075427_10006620
1178 Ga0097621_100027570
1179 Ga0097621_100239204
1180 Ga0075428_100151851
1181 Ga0075428_100376443
1182 Ga0075430_100003287
1183 Ga0075431_100002693
1184 Ga0075431_100224388
1185 Ga0075433_10015709
1186 Ga0075433_10046642
1187 Ga0075433_10054586
1188 Ga0075433_10716931
1189 Ga0075434_100001693
1190 Ga0075434_100022020
1191 Ga0075434_100054495
1192 Ga0075434_100060715
1193 Ga0075434_100282956
1194 Ga0075429_100037097
1195 Ga0075429_100176498
1196 Ga0068865_100011404
1197 Ga0075436_100050921
1198 Ga0075436_100126236
1199 Ga0075436_100544547
1200 Ga0075435_100024351
1201 Ga0075435_100073248
1202 Ga0075435_100096126
1203 Ga0099794_10155724
1204 Ga0099795_10027524
1205 Ga0105240_10011678
1206 Ga0105240_10057051
1207 Ga0105240_10793519
1208 Ga0111539_10009833
1209 Ga0111539_10381512
1210 Ga0111539_10448037
1211 Ga0105245_10026493
1212 Ga0105245_10254069
1213 Ga0105245_10395405
1214 Ga0105245_10688787
1215 Ga0105247_10308919
1216 Ga0114129_10066227
1217 Ga0114129_10095375
1218 Ga0114129_10202251
1219 Ga0114129_10226187
1220 Ga0114129_10356006
1221 Ga0114129_10399215
1222 Ga0114129_10496739
1223 Ga0114129_10651209
1224 Ga0105243_10039760
1225 Ga0105243_10081531
1226 Ga0105243_10223315
1227 Ga0105241_10015186
1228 Ga0105248_10010737
1229 Ga0105248_10049581
1230 Ga0105237_10039204
1231 Ga0105237_10134879
1232 Ga0105237_10580494
1233 Ga0105238_10007703
1234 Ga0105238_10438954
1235 Ga0105238_10528076
1236 Ga0105249_10011780
1237 Ga0105249_10013267
1238 Ga0105249_10173176
1239 Ga0105249_10344411
1240 Ga0105239_10025385
1241 Ga0157370_10036126
1242 Ga0157370_10073380
1243 Ga0157370_10153129
1244 Ga0157370_10163904
1245 Ga0157369_10008975
1246 Ga0157369_10046070
1247 Ga0157369_10079297
1248 Ga0157369_10115893
1249 Ga0157369_10185806
1250 Ga0157374_10036164
1251 Ga0157374_10056454
1252 Ga0157378_10005547
1253 Ga0163162_10079399
1254 Ga0157372_10123614
1255 Ga0157372_10350375
1256 Ga0157372_10803550
1257 Ga0163163_10017404
1258 Ga0163163_10224599
1259 Ga0163163_10324806
1260 Ga0157380_10899236
1261 Ga0157379_10017813
1262 Ga0157379_10202767
1263 Ga0157376_10126189
1264 Ga0206351_10697221
1265 Ga0206350_10034970
1266 Ga0206354_10010395
1267 Ga0206354_10248428
1268 Ga0206354_10358818
1269 Ga0206353_10982929
1270 Ga0206353_11739985
1271 Ga0206353_12011555
1272 Ga0213875_10000197
1273 Ga0213875_10000281
1274 Ga0213875_10000768
1275 Ga0213875_10134856
1276 Ga0213875_10146460
1277 Ga0224712_10001664
1278 Ga0224712_10095271
1279 Ga0224712_10245051
1280 Ga0207426_1000875
1281 Ga0207653_10000002
1282 Ga0207692_10000435
1283 Ga0207692_10001293
1284 Ga0207692_10005264
1285 Ga0207692_10009511
1286 Ga0207685_10000488
1287 Ga0207685_10013342
1288 Ga0207685_10087334
1289 Ga0207699_10001146
1290 Ga0207699_10002053
1291 Ga0207699_10004947
1292 Ga0207699_10028323
1293 Ga0207699_10035947
1294 Ga0207699_10084494
1295 Ga0207684_10000123
1296 Ga0207684_10000339
1297 Ga0207684_10000574
1298 Ga0207684_10009068
1299 Ga0207684_10013508
1300 Ga0207684_10047001
1301 Ga0207684_10071717
1302 Ga0207684_10076794
1303 Ga0207684_10078735
1304 Ga0207684_10092948
1305 Ga0207684_10167903
1306 Ga0207684_10373769
1307 Ga0207684_10558274
1308 Ga0207707_10047197
1309 Ga0207707_10189427
1310 Ga0207695_10001971
1311 Ga0207695_10033576
1312 Ga0207671_10000203
1313 Ga0207671_10246432
1314 Ga0207693_10005318
1315 Ga0207693_10005872
1316 Ga0207693_10011807
1317 Ga0207693_10034813
1318 Ga0207693_10055161
1319 Ga0207693_10109789
1320 Ga0207693_10397053
1321 Ga0207663_10001814
1322 Ga0207663_10006086
1323 Ga0207663_10028399
1324 Ga0207663_10039773
1325 Ga0207663_10103685
1326 Ga0207663_10243453
1327 Ga0207660_10437468
1328 Ga0207657_10027219
1329 Ga0207649_10215912
1330 Ga0207652_10024768
1331 Ga0207652_10337547
1332 Ga0207646_10000061
1333 Ga0207646_10001194
1334 Ga0207646_10002341
1335 Ga0207646_10004121
1336 Ga0207646_10018758
1337 Ga0207646_10027513
1338 Ga0207646_10052080
1339 Ga0207646_10053559
1340 Ga0207646_10054966
1341 Ga0207646_10073851
1342 Ga0207646_10112716
1343 Ga0207646_10255525
1344 Ga0207694_10002093
1345 Ga0207650_10023834
1346 Ga0207659_10292967
1347 Ga0207687_10099438
1348 Ga0207687_10277710
1349 Ga0207687_10596894
1350 Ga0207700_10000714
1351 Ga0207700_10003538
1352 Ga0207700_10004876
1353 Ga0207700_10018529
1354 Ga0207700_10020336
1355 Ga0207700_10027887
1356 Ga0207700_10071906
1357 Ga0207700_10222702
1358 Ga0207700_10229272
1359 Ga0207700_10260979
1360 Ga0207700_10293778
1361 Ga0207700_10430022
1362 Ga0207700_10619866
1363 Ga0207664_10000825
1364 Ga0207664_10004487
1365 Ga0207664_10010010
1366 Ga0207664_10012761
1367 Ga0207664_10014707
1368 Ga0207664_10022552
1369 Ga0207664_10023375
1370 Ga0207664_10164389
1371 Ga0207664_10251932
1372 Ga0207664_10316996
1373 Ga0207664_10722382
1374 Ga0207690_10353826
1375 Ga0207706_10015126
1376 Ga0207706_10254699
1377 Ga0207670_10099670
1378 Ga0207670_10343074
1379 Ga0207704_10039306
1380 Ga0207704_10192111
1381 Ga0207665_10001557
1382 Ga0207665_10002854
1383 Ga0207665_10003130
1384 Ga0207665_10004964
1385 Ga0207665_10008897
1386 Ga0207665_10351336
1387 Ga0207711_10034042
1388 Ga0207711_10063783
1389 Ga0207711_10378600
1390 Ga0207661_10138672
1391 Ga0207661_10301634
1392 Ga0207661_10317803
1393 Ga0207661_10513090
1394 Ga0207661_10633727
1395 Ga0207679_10255239
1396 Ga0207679_10420673
1397 Ga0207667_10021249
1398 Ga0207667_10028682
1399 Ga0207667_10311268
1400 Ga0207712_10010611
1401 Ga0207712_10064017
1402 Ga0207712_10553563
1403 Ga0207668_10107518
1404 Ga0207640_10083435
1405 Ga0207640_10423394
1406 Ga0207677_10146500
1407 Ga0207703_10055815
1408 Ga0207678_10040467
1409 Ga0207678_10043387
1410 Ga0207678_10115786
1411 Ga0207678_10620971
1412 Ga0207708_10033558
1413 Ga0207702_10096086
1414 Ga0207702_10131506
1415 Ga0207702_10208111
1416 Ga0207641_10022430
1417 Ga0207641_10458504
1418 Ga0207648_10064281
1419 Ga0207676_10036261
1420 Ga0207676_10313302
1421 Ga0207676_10338836
1422 Ga0207674_10024169
1423 Ga0207674_10067884
1424 Ga0207674_10179296
1425 Ga0207675_100009207
1426 Ga0207675_100064783
1427 Ga0207683_10039499
1428 Ga0207683_10174320
1429 Ga0207683_10664302
1430 Ga0207698_10039132
1431 Ga0207698_10118085
1432 Ga0207698_10859235
1433 Ga0209179_1042848
1434 Ga0207428_10002280
1435 Ga0268266_10140268
1436 Ga0268264_10209086
1437 Ga0307512_10158741
1438 Ga0307408_100162690
1439 Ga0307405_10010538
1440 Ga0307405_10015094
1441 Ga0307405_10098553
1442 Ga0307413_10031652
1443 Ga0307413_10035071
1444 Ga0307410_10001287
1445 Ga0307410_10010927
1446 Ga0307410_10251102
1447 Ga0307406_10111347
1448 Ga0307407_10024002
1449 Ga0307409_100002277
1450 Ga0307409_100018550
1451 Ga0307409_100027257
1452 Ga0307409_100101902
1453 Ga0307416_100001993
1454 Ga0307416_100005066
1455 Ga0307416_100032459
1456 Ga0307416_100209124
1457 Ga0307414_10023364
1458 Ga0307414_10113402
1459 Ga0307411_10049930
1460 Ga0307411_10142156
1461 Ga0307415_100000849
1462 Ga0307415_100021788
1463 Ga0307415_100023412
1464 Ga0307415_100183403
1465 Ga0316212_1006845
1466 Ga0373930_0002420
1467 Ga0373948_0010324
1468 Ga0373958_0001957
1469 Ga0373938_0002054
1470 Ga0373934_0007496
1471 Ga0373940_0014214
1472 Ga0373949_0012367
1473 Ga0373951_0009135
1474 Ga0373951_0019096
1475 Ga0373939_0003465
1476 Ga0373941_0008018
1477 Ga0373941_0038187
1478 Ga0373954_0055624
1479 Ga0373954_0184959
1480 Ga0373956_0051871
1481 Ga0373957_0012014
1482 Ga0373957_0041992
1483 Ga0373957_0101218
1484 Ga0373960_0015618
1485 Ga0373943_0015162
1486 Ga0373943_0074323
1487 Ga0373943_0229329
1488 Ga0373943_0230070
1489 Ga0373955_0190793
1490 Ga0373942_0007998
1491 Ga0373961_0006508
1492 Ga0373961_0025299
1493 Ga0373924_0048260
1494 Ga0373931_0004582
1495 Ga0373935_0010449
1496 Ga0373933_0008334
1497 Ga0373933_0015855
1498 Ga0373933_0184653
1499 Ga0373947_0146097
1500 Ga0373937_0020628
1501 Ga0373937_0134035
1502 Ga0373937_0324186
1503 Ga0373925_0003342
1504 Ga0373925_0057874
1505 Ga0373925_0058736
1506 Ga0373925_0145286
1507 Ga0395899_0004556
1508 Ga0395899_0048153
1509 Ga0395899_0070110
1510 Ga0395899_0144064
1511 Ga0395899_0192209
1512 Ga0395900_0005315
1513 Ga0395900_0033991
1514 Ga0395900_0117896
1515 Ga0395900_0123111
1516 Ga0395900_0141725
1517 Ga0395900_0167531
1518 Ga0395900_0382399
1519 Ga0395900_0932478
1520 Ga0395898_0002844
1521 Ga0395898_0012364
1522 Ga0395898_0131786
1523 Ga0395898_0275927
1524 Ga0395898_0758056
1525 Ga0395905_0001967
1526 Ga0395905_0041976
1527 Ga0395905_0170315
1528 Ga0395905_0331729
1529 Ga0395905_0557070
1530 Ga0436364_0025330
1531 Ga0436364_0077046
1532 Ga0436364_0212006
1533 Ga0436364_0565857
1534 Ga0436364_0721645
1535 Ga0436364_1181445
1536 Ga0436364_1370870
1537 Ga0395901_0001069
1538 Ga0395901_0040772
1539 Ga0395901_0042265
1540 Ga0395901_0100283
1541 Ga0395901_0132266
1542 Ga0395901_0178470
1543 Ga0395901_0185908
1544 Ga0395901_0844552
1545 Ga0395901_0921349
1546 Ga0436362_0561529
1547 Ga0439443_004128
1548 Ga0439448_0011857
1549 Ga0439448_0084843
1550 Ga0439450_000457
1551 Ga0439450_010723
1552 Ga0439451_007941
1553 Ga0439454_008156
1554 Ga0439463_001832
1555 Ga0439463_007320
1556 Ga0450888_006260
1557 Ga0450900_007727
1558 Ga0450905_000683
1559 Ga0439435_0019844
1560 Ga0439444_0002788
1561 Ga0439464_0000611
1562 Ga0439464_0084967
1563 Ga0439460_0001195
1564 Ga0439460_0045737
1565 Ga0439460_0074999
1566 Ga0450916_000443
1567 Ga0439440_0000138
1568 Ga0439440_0040887
1569 Ga0466969_0007236
1570 Ga0466969_0030840
1571 Ga0466966_0042731
1572 Ga0466961_0017607
1573 Ga0466961_0024414
1574 Ga0466963_0154394
1575 Ga0466963_0230172
1576 Ga0466971_0005673
1577 Ga0466970_0006512
1578 Ga0466970_0233606
1579 Ga0466957_0118038
1580 Ga0466959_0006218
1581 Ga0466959_0047709
1582 Ga0466959_0076883
1583 Ga0466959_0171899
1584 Ga0466958_0117574
1585 Ga0466967_0015406
1586 Ga0466967_0181203
1587 Ga0466967_0367604
1588 Ga0495592_0030009
1589 Ga0495592_0122017
1590 Ga0495592_0126824
1591 Ga0495603_0006845
1592 Ga0495641_0080404
1593 Ga0495651_0008074
1594 Ga0495651_0023871
1595 Ga0495651_0031173
1596 Ga0495651_0037806
1597 Ga0495651_0043718
1598 Ga0495651_0081301
1599 Ga0495651_0236269
1600 Ga0495653_0001681
1601 Ga0495653_0011612
1602 Ga0495653_0065294
1603 Ga0495653_0110223
1604 Ga0495580_0128389
1605 Ga0495664_0010356
1606 Ga0495664_0011383
1607 Ga0495584_0088945
1608 Ga0495594_0095754
1609 Ga0495596_0049482
1610 Ga0495607_0214476
1611 Ga0495607_0217776
1612 Ga0495608_0038199
1613 Ga0495608_0046096
1614 Ga0495608_0089639
1615 Ga0495608_0128943
1616 Ga0495616_0125470
1617 Ga0495618_0015050
1618 Ga0495618_0084435
1619 Ga0495628_0005291
1620 Ga0495628_0029092
1621 Ga0495628_0056532
1622 Ga0495628_0076877
1623 Ga0495628_0360253
1624 Ga0495630_0300543
1625 Ga0495637_0084402
1626 Ga0495644_0026909
1627 Ga0495644_0067683
1628 Ga0495652_0000731
1629 Ga0495652_0004416
1630 Ga0495652_0005702
1631 Ga0495652_0030389
1632 Ga0495652_0067853
1633 Ga0495665_0019512
1634 Ga0495640_0010835
1635 Ga0495640_0056712
1636 Ga0495640_0125088
1637 Ga0495586_0062901
1638 Ga0495586_0139911
1639 Ga0495587_0003110
1640 Ga0495587_0007004
1641 Ga0495587_0037051
1642 Ga0495609_0053328
1643 Ga0495645_0011691
1644 Ga0495645_0061719
1645 Ga0495645_0078745
1646 Ga0495645_0196281
1647 Ga0495622_0132949
1648 Ga0495667_0000230
1649 Ga0495667_0012947
1650 Ga0495667_0028768
1651 Ga0495667_0038181
1652 Ga0495667_0069636
1653 Ga0495667_0071785
1654 Ga0495656_0024362
1655 Ga0495656_0105436
1656 Ga0495656_0164777
1657 Ga0495634_0010984
1658 Ga0495611_0141861
1659 Ga0495635_0015411
1660 Ga0495635_0028333
1661 Ga0495635_0063918
1662 Ga0495635_0203332
1663 Ga0495659_0047392
1664 Ga0495659_0113245
1665 Ga0495588_0034182
1666 Ga0495657_0006566
1667 Ga0495657_0015874
1668 Ga0495657_0029078
1669 Ga0495657_0049466
1670 Ga0495657_0095821
1671 Ga0495657_0106551
1672 Ga0495599_0024054
1673 Ga0495599_0107418
1674 Ga0495623_0010932
1675 Ga0495623_0011007
1676 Ga0495623_0050003
1677 Ga0495623_0065624
1678 Ga0495646_0001297
1679 Ga0495646_0052943
1680 Ga0495647_0162727
1681 Ga0495613_0026413
1682 Ga0495613_0026934
1683 Ga0495624_0057729
1684 Ga0495670_0102710
1685 Ga0495671_0101040
1686 Ga0495600_0011317
1687 Ga0495600_0033653
1688 Ga0495600_0073269
1689 Ga0495600_0290193
1690 Ga0495604_0009037
1691 Ga0495604_0027235
1692 Ga0495604_0047627
1693 Ga0495604_0388611
1694 Ga0495674_0064492
1695 Ga0495674_0084036
1696 Ga0495674_0188857
1697 Ga0495674_0399777
1698 Ga0495676_0248073
1699 Ga0495680_0015996
1700 Ga0495680_0027890
1701 Ga0495680_0028167
1702 Ga0495680_0040467
1703 Ga0495680_0116584
1704 Ga0495680_0163577
1705 Ga0495680_0348849
1706 Ga0495675_0073953
1707 Ga0495684_0039835
1708 Ga0495684_0055703
1709 Ga0495602_0003730
1710 Ga0495602_0022067
1711 Ga0495602_0053308
1712 Ga0495602_0209220
1713 Ga0496100_0131438
1714 Ga0496100_0246021
1715 Ga0496100_0568345
1716 Ga0496101_0009273
1717 Ga0496101_0054617
1718 Ga0496101_0066251
1719 Ga0496102_0038032
1720 Ga0496102_0168099
1721 Ga0496104_0013522
1722 Ga0496104_0027757
1723 Ga0496104_0046157
1724 Ga0496104_0074089
1725 Ga0496104_0104810
1726 Ga0496105_0011075
1727 Ga0496105_0051797
1728 Ga0496105_0105840
1729 Ga0496106_0009855
1730 Ga0496106_0034483
1731 Ga0496106_0136090
1732 Ga0496107_0083340
1733 Ga0496108_0024011
1734 Ga0496108_0027816
1735 Ga0496108_0073268
1736 Ga0496108_0111865
1737 Ga0496108_0272712
1738 Ga0496109_0023936
1739 Ga0496109_0031186
1740 Ga0496109_0063514
1741 Ga0496109_0077477
1742 Ga0496109_0126967
1743 Ga0496109_0198975
1744 Ga0496109_0623882
1745 Ga0496110_0081573
1746 Ga0496110_0094205
1747 Ga0496110_0103784
1748 Ga0496111_0017139
1749 Ga0496111_0062831
1750 Ga0496111_0076770
1751 Ga0496111_0083739
1752 Ga0496111_0132876
1753 Ga0496112_0006374
1754 Ga0496112_0169183
1755 Ga0496112_0176229
1756 Ga0496112_0182905
1757 Ga0496113_0011428
1758 Ga0496113_0013158
1759 Ga0496113_0045651
1760 Ga0496113_0186785
1761 Ga0496113_0343534
1762 Ga0496114_0016291
1763 Ga0496114_0207742
1764 Ga0496115_0002340
1765 Ga0496115_0326532
1766 Ga0496126_0047192
1767 Ga0496126_0166963
1768 Ga0501031_0004126
1769 Ga0501031_0008038
1770 Ga0501031_0021617
1771 Ga0501031_0100417
1772 Ga0501032_0023141
1773 Ga0501032_0052254
1774 Ga0501033_0006419
1775 Ga0501033_0041685
1776 Ga0501033_0074091
1777 Ga0501034_0021538
1778 Ga0501036_0000868
1779 Ga0501036_0018563
1780 Ga0501036_0033097
1781 Ga0501036_0048287
1782 Ga0501036_0051775
1783 Ga0501037_0007242
1784 Ga0501037_0031573
1785 Ga0501037_0075919
1786 Ga0501037_0182984
1787 Ga0501038_0015642
1788 Ga0501038_0016922
1789 Ga0501038_0018692
1790 Ga0501038_0023764
1791 Ga0501038_0051125
1792 Ga0501039_0001861
1793 Ga0501039_0017741
1794 Ga0501039_0018772
1795 Ga0501039_0027934
1796 Ga0501039_0064832
1797 Ga0501039_0120346
1798 Ga0501040_0000619
1799 Ga0501040_0006111
1800 Ga0501040_0027955
1801 Ga0501040_0028606
1802 Ga0501040_0063177
1803 Ga0501040_0152897
1804 Ga0501040_0324886
1805 Ga0501041_0009934
1806 Ga0501041_0015722
1807 Ga0501041_0019945
1808 Ga0501041_0044119
1809 Ga0501041_0090993
1810 Ga0501042_0000527
1811 Ga0501042_0003690
1812 Ga0501042_0012887
1813 Ga0501042_0014056
1814 Ga0501042_0020232
1815 Ga0501042_0042241
1816 Ga0501042_0063576
1817 Ga0501043_0024448
1818 Ga0501043_0082154
1819 Ga0501043_0117736
1820 Ga0501046_0004361
1821 Ga0501046_0016569
1822 Ga0501046_0039274
1823 Ga0501046_0055033
1824 Ga0501046_0164252
1825 Ga0501046_0289404
1826 Ga0501047_0066722
1827 Ga0501047_0077290
1828 Ga0501048_0002081
1829 Ga0501048_0005088
1830 Ga0501048_0018107
1831 Ga0501048_0026018
1832 Ga0501048_0053249
1833 Ga0501048_0060399
1834 Ga0501067_0207509
1835 Ga0501067_0268008
1836 Ga0501068_0000603
1837 Ga0501068_0032489
1838 Ga0501068_0046981
1839 Ga0501068_0135083
1840 Ga0501069_0000228
1841 Ga0501070_0016833
1842 Ga0501070_0109830
1843 Ga0501071_0001890
1844 Ga0501071_0005701
1845 Ga0501071_0007010
1846 Ga0501071_0009056
1847 Ga0501071_0032918
1848 Ga0501072_0003544
1849 Ga0501072_0019574
1850 Ga0501072_0021349
1851 Ga0501072_0024736
1852 Ga0501072_0151183
1853 Ga0501072_0369699
1854 Ga0501073_0001635
1855 Ga0501073_0080222
1856 Ga0501073_0193559
1857 Ga0501074_0003309
1858 Ga0501074_0017125
1859 Ga0501074_0018704
1860 Ga0501074_0019408
1861 Ga0501074_0126060
1862 Ga0501075_0000224
1863 Ga0501075_0002582
1864 Ga0501075_0022840
1865 Ga0501075_0028323
1866 Ga0501075_0069950
1867 Ga0501075_0105506
1868 Ga0501076_0000544
1869 Ga0501076_0014133
1870 Ga0501076_0014229
1871 Ga0501076_0021406
1872 Ga0501076_0252599
1873 Ga0501077_0002174
1874 Ga0501077_0005502
1875 Ga0501077_0148021
1876 Ga0501077_0180999
1877 Ga0501079_0000269
1878 Ga0501079_0008835
1879 Ga0501079_0014148
1880 Ga0501079_0016461
1881 Ga0501079_0052197
1882 Ga0501079_0418211
1883 Ga0501080_0033224
1884 Ga0501080_0055307
1885 Ga0501080_0179308
1886 Ga0501081_0006116
1887 Ga0501081_0015908
1888 Ga0501081_0022842
1889 Ga0501081_0117170
1890 Ga0501083_0005179
1891 Ga0501083_0019519
1892 Ga0501083_0028477
1893 Ga0501083_0099647
1894 Ga0501035_0045429
1895 Ga0501035_0249737
1896 Ga0501044_0005842
1897 Ga0501044_0039522
1898 Ga0501044_0097613
1899 Ga0501045_0000261
1900 Ga0501045_0009032
1901 Ga0501045_0015095
1902 Ga0501045_0028504
1903 Ga0501045_0135190
1904 Ga0501045_0361747
1905 nmdc:mga05p37_192922_c1
1906 nmdc:mga05p37_223895_c1
1907 nmdc:mga05p37_312751_c1
1908 nmdc:mga05p37_68759_c2
1909 nmdc:mga05p37_7014_c1
1910 nmdc:mga09592_105203_c1
1911 nmdc:mga09592_12307_c1
1912 nmdc:mga0qj67_74070_c1
1913 nmdc:mga06r32_497521_c1
1914 nmdc:mga06r32_65967_c1
1915 nmdc:mga08y16_56483_c1
1916 nmdc:mga0n895_20018_c1
1917 nmdc:mga0n895_238296_c1
1918 nmdc:mga0n895_31992_c1
1919 nmdc:mga0n895_382426_c1
1920 nmdc:mga0n895_46907_c1
1921 nmdc:mga0n895_47781_c1
1922 nmdc:mga0n895_70162_c1
1923 nmdc:mga0rr50_291791_c1
1924 nmdc:mga0rr50_58822_c1
1925 nmdc:mga0rr50_73518_c1
1926 nmdc:mga08x19_17380_c1
1927 nmdc:mga08x19_43265_c1
1928 nmdc:mga0a205_152773_c1
1929 nmdc:mga0a205_16824_c1
1930 nmdc:mga0a205_52657_c1
1931 nmdc:mga0a205_73016_c1
1932 nmdc:mga0a205_783369_c1
1933 nmdc:mga0a205_7938_c1
1934 Ga0495601_0004265
1935 Ga0495601_0188601
1936 Ga0495612_0012471
1937 Ga0495612_0020207
1938 Ga0495619_0123606
1939 Ga0501084_0009738
1940 Ga0501084_0025891
1941 Ga0501084_0030837
1942 Ga0501084_0052286
1943 Ga0501084_0064590
1944 Ga0501084_0212425
1945 Ga0590074_003008
1946 Ga0590075_025083
1947 Ga0590077_003153
1948 Ga0590077_007353
1949 Ga0501082_0000767
1950 Ga0501082_0020138
1951 Ga0501082_0043677
1952 Ga0501082_0050136
1953 Ga0466962_0005687
1954 Ga0530510_0001223
1955 Ga0530510_0005952
1956 Ga0530510_0109172
1957 Ga0530510_0258128
1958 2891402858
1959 2891554832
1960 2997457445

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01614

IclR

Bacterial transcriptional regulator

78

251

0.98

PF09339

HTH_IclR

IclR helix-turn-helix domain

11

62

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

15

59

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

13

60

0.93

PF12802

MarR_2

MarR family

12

66

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9701 5 62
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9596 5 62
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9493 8 62
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9385 8 63
7c0i-assembly1.cif.gz_A crystal structure of chimeric mutant of e3l in complex with z-dna 0.9278 8 62
ID Description Score Start End Superfamily
5tjjB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9816 1 70 1.10.10.10
af_P77569_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9809 1 62 1.10.10.10
af_P0ACN4_17_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9749 3 73 1.10.10.10
4wcgB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.97 5 62 1.10.10.10
af_P16528_22_97_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9665 1 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0A8EZV7-F1-model_v4 IclR family transcriptional regulator 0.9303 1 221 GO:0003677
GO:0003700
GO:0045892
AF-A0A6V8KQV5-F1-model_v4 IclR-ED domain-containing protein 0.9234 126 221 GO:0003677
GO:0003700
GO:0045892
AF-X1EUD4-F1-model_v4 IclR-ED domain-containing protein 0.9226 83 218 GO:0003677
GO:0003700
GO:0045892
AF-A0A2V9QTZ5-F1-model_v4 IclR-ED domain-containing protein 0.9117 83 216 GO:0003677
GO:0003700
GO:0045892
AF-A0A117I9M0-F1-model_v4 Transcriptional regulator 0.9043 1 225 GO:0003677
GO:0003700
GO:0045892

Map