F487370
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 980 | 347 | 1960 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300046477|Ga0495664_0098648|Ga0495664_0098648_352_1263 |
| Length | 303 |
| Sequence | MIGDARSDLHVTITGLGAYAPERVLTNADLSELVDTSDEWIMERTGIRERRIAADSQALSDLSLPGARQALEQAGSDGSDVDLLIVATVTPDMMFPSTSAILADRLGAKDAAAYDLSAGCTGFMYAVAQAYGMVAAGLSKRALVVGGDVLSRILDWSDRSTVVLYGAGGEHLWLPGSGSRKFEDPEQFVKMNGREVFKFATRVLVSSAEAVLGRYGATVEDVDVYVPHQANVRIIDHATKKLGIPSDRVVINVDRYGNTSSGSIPLALADAQADGRLREGSLVLMTGMGAGLTWGSALMRWTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 206 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 207 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 208 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 209 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 212 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 213 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 214 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 215 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 216 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 344 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.37 |
| Metatranscriptomes | 1.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 7.55 |
| Rhizosphere | 91.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495664_0098648 | 3300046477 | Bacteria | 1759 |
| 2 | ARcpr5oldR_c001779 | 3300000041 | Bacteria | 2089 |
| 3 | ARcpr5yngRDRAFT_c001848 | 3300000043 | Bacteria | 2260 |
| 4 | ARSoilOldRDRAFT_c001865 | 3300000044 | Bacteria | 1924 |
| 5 | JGI25407J50210_10016918 | 3300003373 | Bacteria | 1891 |
| 6 | Ga0070658_10019227 | 3300005327 | Bacteria | 5472 |
| 7 | Ga0070658_10020064 | 3300005327 | Bacteria | 5354 |
| 8 | Ga0070658_10021346 | 3300005327 | Bacteria | 5190 |
| 9 | Ga0070658_10025030 | 3300005327 | Bacteria | 4784 |
| 10 | Ga0070683_100002072 | 3300005329 | Bacteria | 15836 |
| 11 | Ga0070683_100007870 | 3300005329 | Bacteria | 9029 |
| 12 | Ga0070683_100030290 | 3300005329 | Bacteria | 4910 |
| 13 | Ga0070683_100045200 | 3300005329 | Bacteria | 4064 |
| 14 | Ga0070683_100051715 | 3300005329 | Bacteria | 3804 |
| 15 | Ga0070683_100072245 | 3300005329 | Bacteria | 3220 |
| 16 | Ga0070683_100265181 | 3300005329 | Bacteria | 1634 |
| 17 | Ga0070683_100299205 | 3300005329 | Bacteria | 1531 |
| 18 | Ga0070683_100447598 | 3300005329 | Bacteria | 1232 |
| 19 | Ga0070670_100001416 | 3300005331 | Bacteria | 19282 |
| 20 | Ga0070670_100011662 | 3300005331 | Bacteria | 7516 |
| 21 | Ga0068869_100062498 | 3300005334 | Bacteria | 2733 |
| 22 | Ga0070680_100059775 | 3300005336 | Bacteria | 3119 |
| 23 | Ga0070660_100002486 | 3300005339 | Bacteria | 12647 |
| 24 | Ga0070660_100013951 | 3300005339 | Bacteria | 5781 |
| 25 | Ga0070660_100022670 | 3300005339 | Bacteria | 4647 |
| 26 | Ga0070660_100022817 | 3300005339 | Bacteria | 4634 |
| 27 | Ga0070660_100025106 | 3300005339 | Bacteria | 4427 |
| 28 | Ga0070660_100060948 | 3300005339 | Bacteria | 2929 |
| 29 | Ga0070660_100135677 | 3300005339 | Bacteria | 1971 |
| 30 | Ga0070660_100156499 | 3300005339 | Bacteria | 1834 |
| 31 | Ga0070689_100088971 | 3300005340 | Bacteria | 2432 |
| 32 | Ga0070691_10010916 | 3300005341 | Bacteria | 4147 |
| 33 | Ga0070661_100012594 | 3300005344 | Bacteria | 5919 |
| 34 | Ga0070661_100037444 | 3300005344 | Bacteria | 3529 |
| 35 | Ga0070661_100187860 | 3300005344 | Bacteria | 1575 |
| 36 | Ga0070692_10009297 | 3300005345 | Bacteria | 4429 |
| 37 | Ga0070668_100059507 | 3300005347 | Bacteria | 2957 |
| 38 | Ga0070675_100061915 | 3300005354 | Bacteria | 3091 |
| 39 | Ga0070675_100122522 | 3300005354 | Bacteria | 2210 |
| 40 | Ga0070675_100209389 | 3300005354 | Bacteria | 1694 |
| 41 | Ga0070675_100319030 | 3300005354 | Bacteria | 1372 |
| 42 | Ga0070671_100144638 | 3300005355 | Bacteria | 2007 |
| 43 | Ga0070674_100009583 | 3300005356 | Bacteria | 5803 |
| 44 | Ga0070674_100029938 | 3300005356 | Bacteria | 3594 |
| 45 | Ga0070674_100086538 | 3300005356 | Bacteria | 2251 |
| 46 | Ga0070688_100015217 | 3300005365 | Bacteria | 4370 |
| 47 | Ga0070688_100179125 | 3300005365 | Bacteria | 1469 |
| 48 | Ga0070659_100016361 | 3300005366 | Bacteria | 5568 |
| 49 | Ga0070659_100018681 | 3300005366 | Bacteria | 5233 |
| 50 | Ga0070659_100041557 | 3300005366 | Bacteria | 3595 |
| 51 | Ga0070659_100049468 | 3300005366 | Bacteria | 3306 |
| 52 | Ga0070659_100070351 | 3300005366 | Bacteria | 2779 |
| 53 | Ga0070659_100080287 | 3300005366 | Bacteria | 2604 |
| 54 | Ga0070667_100185173 | 3300005367 | Bacteria | 1843 |
| 55 | Ga0070709_10069891 | 3300005434 | Bacteria | 2262 |
| 56 | Ga0070714_100001442 | 3300005435 | Bacteria | 17314 |
| 57 | Ga0070714_100001730 | 3300005435 | Bacteria | 15912 |
| 58 | Ga0070714_100029368 | 3300005435 | Bacteria | 4571 |
| 59 | Ga0070714_100066811 | 3300005435 | Bacteria | 3099 |
| 60 | Ga0070714_100120683 | 3300005435 | Bacteria | 2331 |
| 61 | Ga0070714_100226202 | 3300005435 | Bacteria | 1722 |
| 62 | Ga0070713_100027513 | 3300005436 | Bacteria | 4477 |
| 63 | Ga0070713_100029682 | 3300005436 | Bacteria | 4333 |
| 64 | Ga0070713_100039309 | 3300005436 | Bacteria | 3839 |
| 65 | Ga0070713_100097436 | 3300005436 | Bacteria | 2541 |
| 66 | Ga0070710_10004523 | 3300005437 | Bacteria | 6575 |
| 67 | Ga0070710_10006096 | 3300005437 | Bacteria | 5768 |
| 68 | Ga0070710_10137403 | 3300005437 | Bacteria | 1495 |
| 69 | Ga0070711_100032777 | 3300005439 | Bacteria | 3457 |
| 70 | Ga0070711_100088200 | 3300005439 | Bacteria | 2229 |
| 71 | Ga0070705_100009442 | 3300005440 | Bacteria | 4850 |
| 72 | Ga0070700_100050823 | 3300005441 | Bacteria | 2578 |
| 73 | Ga0070678_100010494 | 3300005456 | Bacteria | 5664 |
| 74 | Ga0070662_100138330 | 3300005457 | Bacteria | 1885 |
| 75 | Ga0070662_100223356 | 3300005457 | Bacteria | 1504 |
| 76 | Ga0070681_10007863 | 3300005458 | Bacteria | 10431 |
| 77 | Ga0070681_10010706 | 3300005458 | Bacteria | 9062 |
| 78 | Ga0070681_10013095 | 3300005458 | Bacteria | 8236 |
| 79 | Ga0070681_10063154 | 3300005458 | Bacteria | 3676 |
| 80 | Ga0070681_10080307 | 3300005458 | Bacteria | 3217 |
| 81 | Ga0068867_100041467 | 3300005459 | Bacteria | 3364 |
| 82 | Ga0068867_100087168 | 3300005459 | Bacteria | 2363 |
| 83 | Ga0070685_10003914 | 3300005466 | Bacteria | 7525 |
| 84 | Ga0070707_100229155 | 3300005468 | Bacteria | 1809 |
| 85 | Ga0070679_100002705 | 3300005530 | Bacteria | 16140 |
| 86 | Ga0070679_100031014 | 3300005530 | Bacteria | 5282 |
| 87 | Ga0070679_100051987 | 3300005530 | Bacteria | 4082 |
| 88 | Ga0070679_100052099 | 3300005530 | Bacteria | 4077 |
| 89 | Ga0070679_100129899 | 3300005530 | Bacteria | 2501 |
| 90 | Ga0070679_100141123 | 3300005530 | Bacteria | 2389 |
| 91 | Ga0070679_100188074 | 3300005530 | Bacteria | 2034 |
| 92 | Ga0070679_100191576 | 3300005530 | Bacteria | 2013 |
| 93 | Ga0070684_100002119 | 3300005535 | Bacteria | 14629 |
| 94 | Ga0070684_100008878 | 3300005535 | Bacteria | 7883 |
| 95 | Ga0070684_100025726 | 3300005535 | Bacteria | 4950 |
| 96 | Ga0070684_100045568 | 3300005535 | Bacteria | 3797 |
| 97 | Ga0070684_100056546 | 3300005535 | Bacteria | 3424 |
| 98 | Ga0070684_100087574 | 3300005535 | Bacteria | 2765 |
| 99 | Ga0070684_100102186 | 3300005535 | Bacteria | 2562 |
| 100 | Ga0070684_100117141 | 3300005535 | Bacteria | 2393 |
| 101 | Ga0070684_100134471 | 3300005535 | Bacteria | 2232 |
| 102 | Ga0068853_100226790 | 3300005539 | Bacteria | 1708 |
| 103 | Ga0070672_100025720 | 3300005543 | Bacteria | 4370 |
| 104 | Ga0070672_100055863 | 3300005543 | Bacteria | 3094 |
| 105 | Ga0070672_100056251 | 3300005543 | Bacteria | 3084 |
| 106 | Ga0070686_100028499 | 3300005544 | Bacteria | 3387 |
| 107 | Ga0070665_100017936 | 3300005548 | Bacteria | 7107 |
| 108 | Ga0070665_100055070 | 3300005548 | Bacteria | 3989 |
| 109 | Ga0070665_100138775 | 3300005548 | Bacteria | 2434 |
| 110 | Ga0070665_100391412 | 3300005548 | Bacteria | 1398 |
| 111 | Ga0070704_100012873 | 3300005549 | Bacteria | 5175 |
| 112 | Ga0070704_100192829 | 3300005549 | Bacteria | 1639 |
| 113 | Ga0068855_100012520 | 3300005563 | Bacteria | 10238 |
| 114 | Ga0068855_100023892 | 3300005563 | Bacteria | 7320 |
| 115 | Ga0068855_100026748 | 3300005563 | Bacteria | 6903 |
| 116 | Ga0068855_100030862 | 3300005563 | Bacteria | 6406 |
| 117 | Ga0068855_100062367 | 3300005563 | Bacteria | 4352 |
| 118 | Ga0068855_100062802 | 3300005563 | Bacteria | 4335 |
| 119 | Ga0068855_100100041 | 3300005563 | Bacteria | 3339 |
| 120 | Ga0068855_100370081 | 3300005563 | Bacteria | 1575 |
| 121 | Ga0068855_100530316 | 3300005563 | Bacteria | 1276 |
| 122 | Ga0070664_100240330 | 3300005564 | Bacteria | 1626 |
| 123 | Ga0070664_100330114 | 3300005564 | Bacteria | 1384 |
| 124 | Ga0068857_100010392 | 3300005577 | Bacteria | 8089 |
| 125 | Ga0068857_100300092 | 3300005577 | Bacteria | 1481 |
| 126 | Ga0068856_100023490 | 3300005614 | Bacteria | 5994 |
| 127 | Ga0068856_100098363 | 3300005614 | Bacteria | 2916 |
| 128 | Ga0068856_100195013 | 3300005614 | Bacteria | 2039 |
| 129 | Ga0068856_100235927 | 3300005614 | Bacteria | 1844 |
| 130 | Ga0068856_100291199 | 3300005614 | Bacteria | 1650 |
| 131 | Ga0070702_100016371 | 3300005615 | Bacteria | 3803 |
| 132 | Ga0070702_100036076 | 3300005615 | Bacteria | 2736 |
| 133 | Ga0070702_100076237 | 3300005615 | Bacteria | 1995 |
| 134 | Ga0068852_100022416 | 3300005616 | Bacteria | 5065 |
| 135 | Ga0068852_100071256 | 3300005616 | Bacteria | 3051 |
| 136 | Ga0068852_100156456 | 3300005616 | Bacteria | 2124 |
| 137 | Ga0068852_100383161 | 3300005616 | Bacteria | 1380 |
| 138 | Ga0068859_100273176 | 3300005617 | Bacteria | 1782 |
| 139 | Ga0068859_100302800 | 3300005617 | Bacteria | 1692 |
| 140 | Ga0068864_100016474 | 3300005618 | Bacteria | 6152 |
| 141 | Ga0068864_100319987 | 3300005618 | Bacteria | 1457 |
| 142 | Ga0068861_100139709 | 3300005719 | Bacteria | 1976 |
| 143 | Ga0068870_10006546 | 3300005840 | Bacteria | 5139 |
| 144 | Ga0068870_10067258 | 3300005840 | Bacteria | 1943 |
| 145 | Ga0068870_10067987 | 3300005840 | Bacteria | 1934 |
| 146 | Ga0068863_100056847 | 3300005841 | Bacteria | 3704 |
| 147 | Ga0068863_100191810 | 3300005841 | Bacteria | 1964 |
| 148 | Ga0068858_100034222 | 3300005842 | Bacteria | 4712 |
| 149 | Ga0068858_100104478 | 3300005842 | Bacteria | 2643 |
| 150 | Ga0081455_10010288 | 3300005937 | Bacteria | 9512 |
| 151 | Ga0081455_10013183 | 3300005937 | Bacteria | 8188 |
| 152 | Ga0081455_10030383 | 3300005937 | Bacteria | 4907 |
| 153 | Ga0081455_10047239 | 3300005937 | Bacteria | 3730 |
| 154 | Ga0081538_10001451 | 3300005981 | Bacteria | 24366 |
| 155 | Ga0081538_10003447 | 3300005981 | Bacteria | 14936 |
| 156 | Ga0081538_10010380 | 3300005981 | Bacteria | 7637 |
| 157 | Ga0070717_10029414 | 3300006028 | Bacteria | 4407 |
| 158 | Ga0070717_10031104 | 3300006028 | Bacteria | 4292 |
| 159 | Ga0070717_10042288 | 3300006028 | Bacteria | 3716 |
| 160 | Ga0070717_10080120 | 3300006028 | Bacteria | 2739 |
| 161 | Ga0070712_100052688 | 3300006175 | Bacteria | 2839 |
| 162 | Ga0070712_100082607 | 3300006175 | Bacteria | 2330 |
| 163 | Ga0075362_10042223 | 3300006177 | Bacteria | 2015 |
| 164 | Ga0075367_10154529 | 3300006178 | Bacteria | 1425 |
| 165 | Ga0097621_100166659 | 3300006237 | Bacteria | 1897 |
| 166 | Ga0068871_100177867 | 3300006358 | Bacteria | 1827 |
| 167 | Ga0068871_100245585 | 3300006358 | Bacteria | 1558 |
| 168 | Ga0068871_100349465 | 3300006358 | Bacteria | 1308 |
| 169 | Ga0068871_100421428 | 3300006358 | Bacteria | 1192 |
| 170 | Ga0075428_100001085 | 3300006844 | Bacteria | 28954 |
| 171 | Ga0075428_100438781 | 3300006844 | Bacteria | 1399 |
| 172 | Ga0075431_100224078 | 3300006847 | Bacteria | 1917 |
| 173 | Ga0075433_10011798 | 3300006852 | Bacteria | 7037 |
| 174 | Ga0075434_100002359 | 3300006871 | Bacteria | 16542 |
| 175 | Ga0075434_100060938 | 3300006871 | Bacteria | 3753 |
| 176 | Ga0075429_100014750 | 3300006880 | Bacteria | 6773 |
| 177 | Ga0068865_100017702 | 3300006881 | Bacteria | 4586 |
| 178 | Ga0068865_100023380 | 3300006881 | Bacteria | 4045 |
| 179 | Ga0068865_100051639 | 3300006881 | Bacteria | 2847 |
| 180 | Ga0068865_100134036 | 3300006881 | Bacteria | 1859 |
| 181 | Ga0068865_100261403 | 3300006881 | Bacteria | 1370 |
| 182 | Ga0097620_100273179 | 3300006931 | Bacteria | 1782 |
| 183 | Ga0097620_100302780 | 3300006931 | Bacteria | 1692 |
| 184 | Ga0075435_100019848 | 3300007076 | Bacteria | 5141 |
| 185 | Ga0075435_100120168 | 3300007076 | Bacteria | 2192 |
| 186 | Ga0105240_10023072 | 3300009093 | Bacteria | 8241 |
| 187 | Ga0105240_10036412 | 3300009093 | Bacteria | 6331 |
| 188 | Ga0105240_10120457 | 3300009093 | Bacteria | 3160 |
| 189 | Ga0105240_10178584 | 3300009093 | Bacteria | 2507 |
| 190 | Ga0105240_10256198 | 3300009093 | Bacteria | 2021 |
| 191 | Ga0111539_10021516 | 3300009094 | Bacteria | 7935 |
| 192 | Ga0111539_10044091 | 3300009094 | Bacteria | 5345 |
| 193 | Ga0111539_10052555 | 3300009094 | Bacteria | 4850 |
| 194 | Ga0111539_10156475 | 3300009094 | Bacteria | 2667 |
| 195 | Ga0111539_10168633 | 3300009094 | Bacteria | 2558 |
| 196 | Ga0105245_10040914 | 3300009098 | Bacteria | 4131 |
| 197 | Ga0105245_10204635 | 3300009098 | Bacteria | 1897 |
| 198 | Ga0105245_10258067 | 3300009098 | Bacteria | 1695 |
| 199 | Ga0105245_10298694 | 3300009098 | Bacteria | 1579 |
| 200 | Ga0114129_10061904 | 3300009147 | Bacteria | 5230 |
| 201 | Ga0114129_10121776 | 3300009147 | Bacteria | 3590 |
| 202 | Ga0114129_10187184 | 3300009147 | Bacteria | 2813 |
| 203 | Ga0114129_10233725 | 3300009147 | Bacteria | 2475 |
| 204 | Ga0105243_10045431 | 3300009148 | Bacteria | 3452 |
| 205 | Ga0105243_10049448 | 3300009148 | Bacteria | 3317 |
| 206 | Ga0105243_10075872 | 3300009148 | Bacteria | 2730 |
| 207 | Ga0105241_10256096 | 3300009174 | Bacteria | 1486 |
| 208 | Ga0105242_10029242 | 3300009176 | Bacteria | 4393 |
| 209 | Ga0105242_10109831 | 3300009176 | Bacteria | 2348 |
| 210 | Ga0105242_10179460 | 3300009176 | Bacteria | 1867 |
| 211 | Ga0105242_10194545 | 3300009176 | Bacteria | 1798 |
| 212 | Ga0105248_10356824 | 3300009177 | Bacteria | 1646 |
| 213 | Ga0105237_10083196 | 3300009545 | Bacteria | 3192 |
| 214 | Ga0105238_10025932 | 3300009551 | Bacteria | 5975 |
| 215 | Ga0105238_10093907 | 3300009551 | Bacteria | 2988 |
| 216 | Ga0105238_10515906 | 3300009551 | Bacteria | 1197 |
| 217 | Ga0105239_10067240 | 3300010375 | Bacteria | 3936 |
| 218 | Ga0105239_10303672 | 3300010375 | Bacteria | 1798 |
| 219 | Ga0105239_10468167 | 3300010375 | Bacteria | 1431 |
| 220 | Ga0105246_10072539 | 3300011119 | Bacteria | 2427 |
| 221 | Ga0105246_10255079 | 3300011119 | Bacteria | 1394 |
| 222 | Ga0157373_10043309 | 3300013100 | Bacteria | 3215 |
| 223 | Ga0157371_10005984 | 3300013102 | Bacteria | 10146 |
| 224 | Ga0157371_10382052 | 3300013102 | Bacteria | 1028 |
| 225 | Ga0157370_10002516 | 3300013104 | Bacteria | 22041 |
| 226 | Ga0157370_10013425 | 3300013104 | Bacteria | 8439 |
| 227 | Ga0157370_10051763 | 3300013104 | Bacteria | 3922 |
| 228 | Ga0157369_10002737 | 3300013105 | Bacteria | 21049 |
| 229 | Ga0157369_10013174 | 3300013105 | Bacteria | 9357 |
| 230 | Ga0157369_10033465 | 3300013105 | Bacteria | 5648 |
| 231 | Ga0157369_10044191 | 3300013105 | Bacteria | 4850 |
| 232 | Ga0157369_10081251 | 3300013105 | Bacteria | 3469 |
| 233 | Ga0157369_10256533 | 3300013105 | Bacteria | 1824 |
| 234 | Ga0157369_10362181 | 3300013105 | Bacteria | 1505 |
| 235 | Ga0157369_10390413 | 3300013105 | Bacteria | 1444 |
| 236 | Ga0157374_10111555 | 3300013296 | Bacteria | 2631 |
| 237 | Ga0157378_10168812 | 3300013297 | Bacteria | 2051 |
| 238 | Ga0163162_10154082 | 3300013306 | Bacteria | 2417 |
| 239 | Ga0157372_10112973 | 3300013307 | Bacteria | 3113 |
| 240 | Ga0157372_10120900 | 3300013307 | Bacteria | 3008 |
| 241 | Ga0157372_10153468 | 3300013307 | Bacteria | 2659 |
| 242 | Ga0157372_10291351 | 3300013307 | Bacteria | 1898 |
| 243 | Ga0157372_10294828 | 3300013307 | Bacteria | 1886 |
| 244 | Ga0157375_10008240 | 3300013308 | Bacteria | 9122 |
| 245 | Ga0157375_10069120 | 3300013308 | Bacteria | 3537 |
| 246 | Ga0157375_10102659 | 3300013308 | Bacteria | 2945 |
| 247 | Ga0157375_10332384 | 3300013308 | Bacteria | 1685 |
| 248 | Ga0157375_10471731 | 3300013308 | Bacteria | 1420 |
| 249 | Ga0163163_10020509 | 3300014325 | Bacteria | 6225 |
| 250 | Ga0163163_10077735 | 3300014325 | Bacteria | 3314 |
| 251 | Ga0163163_10094594 | 3300014325 | Bacteria | 3006 |
| 252 | Ga0157380_10009782 | 3300014326 | Bacteria | 6884 |
| 253 | Ga0157380_10094956 | 3300014326 | Bacteria | 2469 |
| 254 | Ga0182008_10003425 | 3300014497 | Bacteria | 9576 |
| 255 | Ga0182008_10017041 | 3300014497 | Bacteria | 3770 |
| 256 | Ga0157379_10023154 | 3300014968 | Bacteria | 5508 |
| 257 | Ga0157379_10121416 | 3300014968 | Bacteria | 2350 |
| 258 | Ga0157376_10031446 | 3300014969 | Bacteria | 4250 |
| 259 | Ga0157376_10085135 | 3300014969 | Bacteria | 2723 |
| 260 | Ga0182006_1013195 | 3300015261 | Bacteria | 3591 |
| 261 | Ga0182007_10013137 | 3300015262 | Bacteria | 3169 |
| 262 | Ga0197907_11086716 | 3300020069 | Bacteria | 3553 |
| 263 | Ga0206356_10279172 | 3300020070 | Bacteria | 4175 |
| 264 | Ga0206356_10815587 | 3300020070 | Bacteria | 2928 |
| 265 | Ga0206356_10898699 | 3300020070 | Bacteria | 1114 |
| 266 | Ga0206356_11121660 | 3300020070 | Bacteria | 2701 |
| 267 | Ga0206356_11196203 | 3300020070 | Bacteria | 1463 |
| 268 | Ga0206356_11522396 | 3300020070 | Bacteria | 2193 |
| 269 | Ga0206356_11541977 | 3300020070 | Bacteria | 1885 |
| 270 | Ga0206352_10587334 | 3300020078 | Bacteria | 1624 |
| 271 | Ga0206352_11227318 | 3300020078 | Bacteria | 1858 |
| 272 | Ga0206354_11430067 | 3300020081 | Bacteria | 3221 |
| 273 | Ga0206353_10157270 | 3300020082 | Bacteria | 8978 |
| 274 | Ga0206353_10738018 | 3300020082 | Bacteria | 6433 |
| 275 | Ga0206353_10928214 | 3300020082 | Bacteria | 2944 |
| 276 | Ga0224712_10026165 | 3300022467 | Bacteria | 2060 |
| 277 | Ga0224712_10033947 | 3300022467 | Bacteria | 1872 |
| 278 | Ga0207656_10023374 | 3300025321 | Bacteria | 2489 |
| 279 | Ga0207692_10047524 | 3300025898 | Bacteria | 2155 |
| 280 | Ga0207688_10003504 | 3300025901 | Bacteria | 8563 |
| 281 | Ga0207688_10046169 | 3300025901 | Bacteria | 2431 |
| 282 | Ga0207688_10050259 | 3300025901 | Bacteria | 2333 |
| 283 | Ga0207688_10060605 | 3300025901 | Bacteria | 2132 |
| 284 | Ga0207699_10005456 | 3300025906 | Bacteria | 6086 |
| 285 | Ga0207699_10318886 | 3300025906 | Bacteria | 1090 |
| 286 | Ga0207645_10028109 | 3300025907 | Bacteria | 3632 |
| 287 | Ga0207643_10015562 | 3300025908 | Bacteria | 4142 |
| 288 | Ga0207643_10021733 | 3300025908 | Bacteria | 3529 |
| 289 | Ga0207643_10067683 | 3300025908 | Bacteria | 2050 |
| 290 | Ga0207643_10079250 | 3300025908 | Bacteria | 1901 |
| 291 | Ga0207705_10009302 | 3300025909 | Bacteria | 7146 |
| 292 | Ga0207705_10010580 | 3300025909 | Bacteria | 6704 |
| 293 | Ga0207705_10090975 | 3300025909 | Bacteria | 2234 |
| 294 | Ga0207705_10107552 | 3300025909 | Bacteria | 2058 |
| 295 | Ga0207705_10306544 | 3300025909 | Bacteria | 1218 |
| 296 | Ga0207707_10011362 | 3300025912 | Bacteria | 7753 |
| 297 | Ga0207707_10024618 | 3300025912 | Bacteria | 5269 |
| 298 | Ga0207707_10038402 | 3300025912 | Bacteria | 4184 |
| 299 | Ga0207707_10073051 | 3300025912 | Bacteria | 2990 |
| 300 | Ga0207707_10095963 | 3300025912 | Bacteria | 2591 |
| 301 | Ga0207707_10225514 | 3300025912 | Bacteria | 1631 |
| 302 | Ga0207695_10030376 | 3300025913 | Bacteria | 5948 |
| 303 | Ga0207695_10107810 | 3300025913 | Bacteria | 2770 |
| 304 | Ga0207695_10196018 | 3300025913 | Bacteria | 1936 |
| 305 | Ga0207693_10020457 | 3300025915 | Bacteria | 5264 |
| 306 | Ga0207693_10048916 | 3300025915 | Bacteria | 3320 |
| 307 | Ga0207693_10076157 | 3300025915 | Bacteria | 2627 |
| 308 | Ga0207660_10020890 | 3300025917 | Bacteria | 4398 |
| 309 | Ga0207660_10043606 | 3300025917 | Bacteria | 3152 |
| 310 | Ga0207660_10101967 | 3300025917 | Bacteria | 2145 |
| 311 | Ga0207660_10119259 | 3300025917 | Bacteria | 1996 |
| 312 | Ga0207660_10167391 | 3300025917 | Bacteria | 1699 |
| 313 | Ga0207660_10219081 | 3300025917 | Bacteria | 1493 |
| 314 | Ga0207657_10000388 | 3300025919 | Bacteria | 46370 |
| 315 | Ga0207657_10001654 | 3300025919 | Bacteria | 24052 |
| 316 | Ga0207657_10007555 | 3300025919 | Bacteria | 11142 |
| 317 | Ga0207657_10013743 | 3300025919 | Bacteria | 7926 |
| 318 | Ga0207657_10024293 | 3300025919 | Bacteria | 5618 |
| 319 | Ga0207657_10028373 | 3300025919 | Bacteria | 5106 |
| 320 | Ga0207657_10053710 | 3300025919 | Bacteria | 3489 |
| 321 | Ga0207657_10060602 | 3300025919 | Bacteria | 3247 |
| 322 | Ga0207657_10061747 | 3300025919 | Bacteria | 3211 |
| 323 | Ga0207657_10183182 | 3300025919 | Bacteria | 1692 |
| 324 | Ga0207649_10011165 | 3300025920 | Bacteria | 4946 |
| 325 | Ga0207652_10020251 | 3300025921 | Bacteria | 5477 |
| 326 | Ga0207652_10025744 | 3300025921 | Bacteria | 4895 |
| 327 | Ga0207652_10039695 | 3300025921 | Bacteria | 3995 |
| 328 | Ga0207652_10044674 | 3300025921 | Bacteria | 3775 |
| 329 | Ga0207652_10102240 | 3300025921 | Bacteria | 2532 |
| 330 | Ga0207652_10159422 | 3300025921 | Bacteria | 2022 |
| 331 | Ga0207652_10213535 | 3300025921 | Bacteria | 1738 |
| 332 | Ga0207652_10274518 | 3300025921 | Bacteria | 1520 |
| 333 | Ga0207646_10003943 | 3300025922 | Bacteria | 16459 |
| 334 | Ga0207681_10078272 | 3300025923 | Bacteria | 2327 |
| 335 | Ga0207681_10125422 | 3300025923 | Bacteria | 1890 |
| 336 | Ga0207694_10033511 | 3300025924 | Bacteria | 3934 |
| 337 | Ga0207694_10139557 | 3300025924 | Bacteria | 1948 |
| 338 | Ga0207694_10348444 | 3300025924 | Bacteria | 1226 |
| 339 | Ga0207650_10001970 | 3300025925 | Bacteria | 14402 |
| 340 | Ga0207650_10020697 | 3300025925 | Bacteria | 4643 |
| 341 | Ga0207687_10041874 | 3300025927 | Bacteria | 3148 |
| 342 | Ga0207687_10052385 | 3300025927 | Bacteria | 2848 |
| 343 | Ga0207687_10057508 | 3300025927 | Bacteria | 2732 |
| 344 | Ga0207687_10121658 | 3300025927 | Bacteria | 1953 |
| 345 | Ga0207687_10204723 | 3300025927 | Bacteria | 1545 |
| 346 | Ga0207700_10000012 | 3300025928 | Bacteria | 231712 |
| 347 | Ga0207700_10069265 | 3300025928 | Bacteria | 2707 |
| 348 | Ga0207700_10129214 | 3300025928 | Bacteria | 2060 |
| 349 | Ga0207664_10011840 | 3300025929 | Bacteria | 6221 |
| 350 | Ga0207664_10049060 | 3300025929 | Bacteria | 3322 |
| 351 | Ga0207664_10059156 | 3300025929 | Unclassified | 3051 |
| 352 | Ga0207664_10097057 | 3300025929 | Bacteria | 2427 |
| 353 | Ga0207664_10232080 | 3300025929 | Bacteria | 1604 |
| 354 | Ga0207664_10237483 | 3300025929 | Bacteria | 1586 |
| 355 | Ga0207664_10261075 | 3300025929 | Bacteria | 1515 |
| 356 | Ga0207644_10087252 | 3300025931 | Bacteria | 2319 |
| 357 | Ga0207644_10304609 | 3300025931 | Bacteria | 1285 |
| 358 | Ga0207690_10253202 | 3300025932 | Bacteria | 1361 |
| 359 | Ga0207706_10024869 | 3300025933 | Bacteria | 5368 |
| 360 | Ga0207706_10183488 | 3300025933 | Bacteria | 1838 |
| 361 | Ga0207686_10044525 | 3300025934 | Bacteria | 2725 |
| 362 | Ga0207709_10023417 | 3300025935 | Bacteria | 3514 |
| 363 | Ga0207709_10027841 | 3300025935 | Bacteria | 3261 |
| 364 | Ga0207709_10031752 | 3300025935 | Bacteria | 3088 |
| 365 | Ga0207709_10031952 | 3300025935 | Bacteria | 3079 |
| 366 | Ga0207709_10166986 | 3300025935 | Bacteria | 1541 |
| 367 | Ga0207670_10204726 | 3300025936 | Bacteria | 1501 |
| 368 | Ga0207669_10052783 | 3300025937 | Bacteria | 2444 |
| 369 | Ga0207669_10062788 | 3300025937 | Bacteria | 2290 |
| 370 | Ga0207704_10061701 | 3300025938 | Bacteria | 2327 |
| 371 | Ga0207704_10171905 | 3300025938 | Bacteria | 1555 |
| 372 | Ga0207665_10001348 | 3300025939 | Bacteria | 16557 |
| 373 | Ga0207665_10007682 | 3300025939 | Bacteria | 7119 |
| 374 | Ga0207665_10102769 | 3300025939 | Bacteria | 1998 |
| 375 | Ga0207665_10356041 | 3300025939 | Bacteria | 1106 |
| 376 | Ga0207691_10015833 | 3300025940 | Bacteria | 7167 |
| 377 | Ga0207691_10019906 | 3300025940 | Bacteria | 6348 |
| 378 | Ga0207689_10039123 | 3300025942 | Bacteria | 3927 |
| 379 | Ga0207661_10000991 | 3300025944 | Bacteria | 18777 |
| 380 | Ga0207661_10023312 | 3300025944 | Bacteria | 4675 |
| 381 | Ga0207661_10030896 | 3300025944 | Bacteria | 4130 |
| 382 | Ga0207661_10070915 | 3300025944 | Bacteria | 2846 |
| 383 | Ga0207661_10097823 | 3300025944 | Bacteria | 2458 |
| 384 | Ga0207661_10177817 | 3300025944 | Bacteria | 1856 |
| 385 | Ga0207661_10303647 | 3300025944 | Bacteria | 1431 |
| 386 | Ga0207679_10072862 | 3300025945 | Bacteria | 2596 |
| 387 | Ga0207679_10161725 | 3300025945 | Bacteria | 1834 |
| 388 | Ga0207679_10316332 | 3300025945 | Bacteria | 1350 |
| 389 | Ga0207667_10014549 | 3300025949 | Bacteria | 8964 |
| 390 | Ga0207667_10035925 | 3300025949 | Bacteria | 5314 |
| 391 | Ga0207667_10062963 | 3300025949 | Bacteria | 3877 |
| 392 | Ga0207667_10304488 | 3300025949 | Bacteria | 1628 |
| 393 | Ga0207667_10427067 | 3300025949 | Bacteria | 1348 |
| 394 | Ga0207712_10099401 | 3300025961 | Bacteria | 2160 |
| 395 | Ga0207668_10223264 | 3300025972 | Bacteria | 1514 |
| 396 | Ga0207640_10002196 | 3300025981 | Bacteria | 10489 |
| 397 | Ga0207640_10141303 | 3300025981 | Bacteria | 1755 |
| 398 | Ga0207677_10173102 | 3300026023 | Bacteria | 1690 |
| 399 | Ga0207703_10082927 | 3300026035 | Bacteria | 2677 |
| 400 | Ga0207639_10028626 | 3300026041 | Bacteria | 4070 |
| 401 | Ga0207639_10176479 | 3300026041 | Bacteria | 1814 |
| 402 | Ga0207639_10204477 | 3300026041 | Bacteria | 1696 |
| 403 | Ga0207678_10121124 | 3300026067 | Bacteria | 2233 |
| 404 | Ga0207678_10171353 | 3300026067 | Bacteria | 1853 |
| 405 | Ga0207708_10016277 | 3300026075 | Bacteria | 5588 |
| 406 | Ga0207708_10027622 | 3300026075 | Bacteria | 4298 |
| 407 | Ga0207708_10121668 | 3300026075 | Bacteria | 2034 |
| 408 | Ga0207708_10237766 | 3300026075 | Bacteria | 1464 |
| 409 | Ga0207702_10098431 | 3300026078 | Bacteria | 2576 |
| 410 | Ga0207702_10113980 | 3300026078 | Bacteria | 2408 |
| 411 | Ga0207702_10148408 | 3300026078 | Bacteria | 2131 |
| 412 | Ga0207702_10213439 | 3300026078 | Bacteria | 1795 |
| 413 | Ga0207702_10414720 | 3300026078 | Bacteria | 1301 |
| 414 | Ga0207641_10039645 | 3300026088 | Bacteria | 3941 |
| 415 | Ga0207641_10182070 | 3300026088 | Bacteria | 1925 |
| 416 | Ga0207648_10030244 | 3300026089 | Bacteria | 4797 |
| 417 | Ga0207648_10089885 | 3300026089 | Bacteria | 2683 |
| 418 | Ga0207676_10048095 | 3300026095 | Bacteria | 3309 |
| 419 | Ga0207674_10040088 | 3300026116 | Bacteria | 4854 |
| 420 | Ga0207674_10070893 | 3300026116 | Bacteria | 3503 |
| 421 | Ga0207674_10187235 | 3300026116 | Bacteria | 2020 |
| 422 | Ga0207675_100063624 | 3300026118 | Bacteria | 3447 |
| 423 | Ga0207675_100077083 | 3300026118 | Bacteria | 3122 |
| 424 | Ga0207675_100129180 | 3300026118 | Bacteria | 2395 |
| 425 | Ga0207683_10011071 | 3300026121 | Bacteria | 7685 |
| 426 | Ga0207683_10014760 | 3300026121 | Bacteria | 6650 |
| 427 | Ga0207698_10127694 | 3300026142 | Bacteria | 2166 |
| 428 | Ga0207698_10165360 | 3300026142 | Bacteria | 1941 |
| 429 | Ga0207428_10000108 | 3300027907 | Bacteria | 115378 |
| 430 | Ga0207428_10028039 | 3300027907 | Bacteria | 4681 |
| 431 | Ga0207428_10066635 | 3300027907 | Bacteria | 2836 |
| 432 | Ga0207428_10279485 | 3300027907 | Bacteria | 1240 |
| 433 | Ga0207428_10317667 | 3300027907 | Bacteria | 1151 |
| 434 | Ga0268266_10249719 | 3300028379 | Bacteria | 1640 |
| 435 | Ga0268266_10528291 | 3300028379 | Bacteria | 1129 |
| 436 | Ga0268264_10064761 | 3300028381 | Bacteria | 3077 |
| 437 | Ga0268264_10067791 | 3300028381 | Bacteria | 3013 |
| 438 | Ga0265337_1013734 | 3300028556 | Bacteria | 2706 |
| 439 | Ga0265319_1006111 | 3300028563 | Bacteria | 5631 |
| 440 | Ga0265334_10014826 | 3300028573 | Bacteria | 3244 |
| 441 | Ga0265334_10020139 | 3300028573 | Bacteria | 2734 |
| 442 | Ga0265318_10000691 | 3300028577 | Bacteria | 22716 |
| 443 | Ga0265323_10013669 | 3300028653 | Bacteria | 3231 |
| 444 | Ga0265322_10009294 | 3300028654 | Bacteria | 2855 |
| 445 | Ga0265336_10055659 | 3300028666 | Bacteria | 1189 |
| 446 | Ga0265338_10001048 | 3300028800 | Bacteria | 46186 |
| 447 | Ga0265338_10007115 | 3300028800 | Bacteria | 14011 |
| 448 | Ga0265338_10016447 | 3300028800 | Bacteria | 8049 |
| 449 | Ga0265338_10022563 | 3300028800 | Bacteria | 6510 |
| 450 | Ga0265338_10102538 | 3300028800 | Bacteria | 2326 |
| 451 | Ga0265338_10177048 | 3300028800 | Bacteria | 1629 |
| 452 | Ga0265324_10011053 | 3300029957 | Bacteria | 3455 |
| 453 | Ga0265330_10017205 | 3300031235 | Bacteria | 3333 |
| 454 | Ga0265330_10028366 | 3300031235 | Bacteria | 2523 |
| 455 | Ga0265332_10019646 | 3300031238 | Bacteria | 2982 |
| 456 | Ga0265320_10030136 | 3300031240 | Bacteria | 2801 |
| 457 | Ga0265325_10000102 | 3300031241 | Bacteria | 59998 |
| 458 | Ga0265325_10071667 | 3300031241 | Bacteria | 1738 |
| 459 | Ga0265340_10009900 | 3300031247 | Bacteria | 5108 |
| 460 | Ga0265339_10011172 | 3300031249 | Bacteria | 5541 |
| 461 | Ga0265339_10011424 | 3300031249 | Bacteria | 5465 |
| 462 | Ga0265331_10044392 | 3300031250 | Bacteria | 2149 |
| 463 | Ga0265331_10081634 | 3300031250 | Bacteria | 1501 |
| 464 | Ga0265327_10025194 | 3300031251 | Bacteria | 3474 |
| 465 | Ga0265327_10045810 | 3300031251 | Bacteria | 2321 |
| 466 | Ga0265316_10021633 | 3300031344 | Bacteria | 5441 |
| 467 | Ga0265316_10026717 | 3300031344 | Bacteria | 4795 |
| 468 | Ga0265313_10006148 | 3300031595 | Bacteria | 8619 |
| 469 | Ga0265314_10005023 | 3300031711 | Bacteria | 12056 |
| 470 | Ga0265314_10094884 | 3300031711 | Bacteria | 1932 |
| 471 | Ga0316583_10014535 | 3300032133 | Bacteria | 2837 |
| 472 | Ga0373959_0017193 | 3300034820 | Bacteria | 1348 |
| 473 | Ga0373944_0045995 | 3300035089 | Bacteria | 1363 |
| 474 | Ga0373951_0033237 | 3300035091 | Bacteria | 1222 |
| 475 | Ga0373936_0040438 | 3300035113 | Bacteria | 1868 |
| 476 | Ga0373941_0021219 | 3300035115 | Bacteria | 1830 |
| 477 | Ga0373953_0106830 | 3300035117 | Bacteria | 1181 |
| 478 | Ga0373956_0042005 | 3300035119 | Bacteria | 2032 |
| 479 | Ga0373957_0048955 | 3300035120 | Bacteria | 1612 |
| 480 | Ga0373960_0005206 | 3300035121 | Bacteria | 3004 |
| 481 | Ga0373943_0001097 | 3300035170 | Bacteria | 12064 |
| 482 | Ga0373943_0002704 | 3300035170 | Bacteria | 8056 |
| 483 | Ga0373943_0042489 | 3300035170 | Bacteria | 2203 |
| 484 | Ga0373946_0001645 | 3300035171 | Bacteria | 7787 |
| 485 | Ga0373946_0021452 | 3300035171 | Bacteria | 2505 |
| 486 | Ga0373955_0016364 | 3300035172 | Bacteria | 3649 |
| 487 | Ga0373955_0118168 | 3300035172 | Bacteria | 1539 |
| 488 | Ga0373931_0048671 | 3300035691 | Bacteria | 2248 |
| 489 | Ga0373935_0043603 | 3300035692 | Bacteria | 2824 |
| 490 | Ga0373927_0170406 | 3300035695 | Bacteria | 1427 |
| 491 | Ga0373933_0077793 | 3300035724 | Bacteria | 2028 |
| 492 | Ga0373947_0000635 | 3300035725 | Bacteria | 20773 |
| 493 | Ga0373937_0003562 | 3300036401 | Bacteria | 13119 |
| 494 | Ga0373937_0098658 | 3300036401 | Bacteria | 2709 |
| 495 | Ga0373925_0001320 | 3300037068 | Bacteria | 21707 |
| 496 | Ga0395899_0002355 | 3300037312 | Bacteria | 15381 |
| 497 | Ga0395899_0042546 | 3300037312 | Bacteria | 3391 |
| 498 | Ga0395900_0067531 | 3300037418 | Bacteria | 3673 |
| 499 | Ga0395900_0101231 | 3300037418 | Bacteria | 2959 |
| 500 | Ga0395900_0104024 | 3300037418 | Bacteria | 2917 |
| 501 | Ga0395900_0181493 | 3300037418 | Bacteria | 2138 |
| 502 | Ga0395900_0511431 | 3300037418 | Bacteria | 1150 |
| 503 | Ga0395898_0018968 | 3300037466 | Bacteria | 7008 |
| 504 | Ga0395898_0067856 | 3300037466 | Bacteria | 3452 |
| 505 | Ga0395898_0088361 | 3300037466 | Bacteria | 2983 |
| 506 | Ga0395898_0226796 | 3300037466 | Bacteria | 1782 |
| 507 | Ga0395898_0243926 | 3300037466 | Unclassified | 1713 |
| 508 | Ga0395905_0121213 | 3300037471 | Bacteria | 2458 |
| 509 | Ga0395905_0180739 | 3300037471 | Unclassified | 1980 |
| 510 | Ga0395905_0258211 | 3300037471 | Unclassified | 1627 |
| 511 | Ga0395901_0054876 | 3300038443 | Bacteria | 4142 |
| 512 | Ga0395901_0207256 | 3300038443 | Bacteria | 2053 |
| 513 | Ga0395901_0386275 | 3300038443 | Bacteria | 1440 |
| 514 | Ga0439439_0001010 | 3300041406 | Bacteria | 5295 |
| 515 | Ga0439461_0002398 | 3300041410 | Bacteria | 2988 |
| 516 | Ga0439461_0007625 | 3300041410 | Bacteria | 1923 |
| 517 | Ga0439431_0003015 | 3300041997 | Bacteria | 3693 |
| 518 | Ga0439441_006435 | 3300042001 | Bacteria | 1864 |
| 519 | Ga0439442_001972 | 3300042002 | Bacteria | 4040 |
| 520 | Ga0439445_0002247 | 3300042004 | Bacteria | 4288 |
| 521 | Ga0439448_0030015 | 3300042005 | Bacteria | 1723 |
| 522 | Ga0439454_006301 | 3300042011 | Bacteria | 1453 |
| 523 | Ga0450920_002237 | 3300042122 | Bacteria | 3278 |
| 524 | Ga0450888_004052 | 3300042126 | Bacteria | 1514 |
| 525 | Ga0450898_008799 | 3300042134 | Bacteria | 1603 |
| 526 | Ga0450910_003704 | 3300042147 | Bacteria | 2039 |
| 527 | Ga0450910_007277 | 3300042147 | Bacteria | 1540 |
| 528 | Ga0439446_0001224 | 3300042156 | Bacteria | 5747 |
| 529 | Ga0466969_0004821 | 3300044656 | Bacteria | 7183 |
| 530 | Ga0466972_0047393 | 3300044658 | Bacteria | 2078 |
| 531 | Ga0466965_0003656 | 3300044683 | Bacteria | 6784 |
| 532 | Ga0466965_0011754 | 3300044683 | Bacteria | 4108 |
| 533 | Ga0466966_0003176 | 3300044684 | Bacteria | 10817 |
| 534 | Ga0466961_0012817 | 3300044693 | Bacteria | 5366 |
| 535 | Ga0466961_0017705 | 3300044693 | Bacteria | 4578 |
| 536 | Ga0466961_0022246 | 3300044693 | Bacteria | 4079 |
| 537 | Ga0466963_0002189 | 3300044694 | Bacteria | 10808 |
| 538 | Ga0466963_0003641 | 3300044694 | Bacteria | 8854 |
| 539 | Ga0466963_0008418 | 3300044694 | Bacteria | 6181 |
| 540 | Ga0466963_0010262 | 3300044694 | Bacteria | 5667 |
| 541 | Ga0466963_0012284 | 3300044694 | Bacteria | 5237 |
| 542 | Ga0466963_0013063 | 3300044694 | Bacteria | 5092 |
| 543 | Ga0466963_0016356 | 3300044694 | Bacteria | 4612 |
| 544 | Ga0466963_0021819 | 3300044694 | Bacteria | 4045 |
| 545 | Ga0466963_0030537 | 3300044694 | Bacteria | 3478 |
| 546 | Ga0466963_0039820 | 3300044694 | Bacteria | 3079 |
| 547 | Ga0466963_0068757 | 3300044694 | Bacteria | 2379 |
| 548 | Ga0466963_0103608 | 3300044694 | Bacteria | 1949 |
| 549 | Ga0466964_0018738 | 3300044706 | Bacteria | 2658 |
| 550 | Ga0466964_0019203 | 3300044706 | Bacteria | 2626 |
| 551 | Ga0466964_0039357 | 3300044706 | Bacteria | 1905 |
| 552 | Ga0466964_0085159 | 3300044706 | Bacteria | 1364 |
| 553 | Ga0466971_0000170 | 3300044719 | Bacteria | 24398 |
| 554 | Ga0466971_0027006 | 3300044719 | Bacteria | 2569 |
| 555 | Ga0466971_0034096 | 3300044719 | Bacteria | 2281 |
| 556 | Ga0466968_0001006 | 3300044735 | Bacteria | 9928 |
| 557 | Ga0466968_0074812 | 3300044735 | Bacteria | 1479 |
| 558 | Ga0466970_0000806 | 3300044765 | Bacteria | 15112 |
| 559 | Ga0466970_0015951 | 3300044765 | Bacteria | 3868 |
| 560 | Ga0466970_0020042 | 3300044765 | Bacteria | 3471 |
| 561 | Ga0466957_0003280 | 3300044842 | Bacteria | 8862 |
| 562 | Ga0466957_0004865 | 3300044842 | Bacteria | 7519 |
| 563 | Ga0466957_0009740 | 3300044842 | Bacteria | 5488 |
| 564 | Ga0466957_0011646 | 3300044842 | Bacteria | 5082 |
| 565 | Ga0466957_0021985 | 3300044842 | Bacteria | 3762 |
| 566 | Ga0466957_0030148 | 3300044842 | Bacteria | 3238 |
| 567 | Ga0466957_0063127 | 3300044842 | Bacteria | 2276 |
| 568 | Ga0466960_0031765 | 3300044901 | Bacteria | 2438 |
| 569 | Ga0466959_0000274 | 3300045049 | Bacteria | 31486 |
| 570 | Ga0466959_0003637 | 3300045049 | Bacteria | 10171 |
| 571 | Ga0466959_0005938 | 3300045049 | Bacteria | 8416 |
| 572 | Ga0466959_0028480 | 3300045049 | Bacteria | 4142 |
| 573 | Ga0466959_0166898 | 3300045049 | Bacteria | 1545 |
| 574 | Ga0466958_0000300 | 3300045836 | Bacteria | 19385 |
| 575 | Ga0466958_0001062 | 3300045836 | Bacteria | 12591 |
| 576 | Ga0466958_0006904 | 3300045836 | Bacteria | 6208 |
| 577 | Ga0466958_0017529 | 3300045836 | Bacteria | 4143 |
| 578 | Ga0466958_0021115 | 3300045836 | Bacteria | 3801 |
| 579 | Ga0466958_0022617 | 3300045836 | Bacteria | 3684 |
| 580 | Ga0466958_0040385 | 3300045836 | Bacteria | 2804 |
| 581 | Ga0466958_0068946 | 3300045836 | Bacteria | 2162 |
| 582 | Ga0466967_0000828 | 3300045976 | Bacteria | 16293 |
| 583 | Ga0466967_0002908 | 3300045976 | Bacteria | 10915 |
| 584 | Ga0466967_0010698 | 3300045976 | Bacteria | 6897 |
| 585 | Ga0466967_0012395 | 3300045976 | Bacteria | 6517 |
| 586 | Ga0466967_0021803 | 3300045976 | Bacteria | 5212 |
| 587 | Ga0466967_0027027 | 3300045976 | Bacteria | 4766 |
| 588 | Ga0466967_0029636 | 3300045976 | Bacteria | 4583 |
| 589 | Ga0466967_0030291 | 3300045976 | Bacteria | 4539 |
| 590 | Ga0466967_0034791 | 3300045976 | Bacteria | 4280 |
| 591 | Ga0466967_0105618 | 3300045976 | Bacteria | 2580 |
| 592 | Ga0466967_0117557 | 3300045976 | Bacteria | 2451 |
| 593 | Ga0466967_0137849 | 3300045976 | Bacteria | 2270 |
| 594 | Ga0466967_0139067 | 3300045976 | Bacteria | 2260 |
| 595 | Ga0466967_0157922 | 3300045976 | Bacteria | 2126 |
| 596 | Ga0466967_0169647 | 3300045976 | Bacteria | 2052 |
| 597 | Ga0466967_0207943 | 3300045976 | Bacteria | 1855 |
| 598 | Ga0466967_0306144 | 3300045976 | Bacteria | 1530 |
| 599 | Ga0466967_0390078 | 3300045976 | Bacteria | 1353 |
| 600 | Ga0466967_0409860 | 3300045976 | Bacteria | 1320 |
| 601 | Ga0495592_0014141 | 3300046454 | Bacteria | 6063 |
| 602 | Ga0495592_0038050 | 3300046454 | Bacteria | 3620 |
| 603 | Ga0495603_0053526 | 3300046455 | Bacteria | 2394 |
| 604 | Ga0495603_0060393 | 3300046455 | Bacteria | 2240 |
| 605 | Ga0495603_0089758 | 3300046455 | Bacteria | 1798 |
| 606 | Ga0495629_0001816 | 3300046459 | Bacteria | 16725 |
| 607 | Ga0495629_0082426 | 3300046459 | Bacteria | 2245 |
| 608 | Ga0495641_0004541 | 3300046461 | Bacteria | 9752 |
| 609 | Ga0495641_0007480 | 3300046461 | Bacteria | 6809 |
| 610 | Ga0495641_0017039 | 3300046461 | Bacteria | 3801 |
| 611 | Ga0495641_0032992 | 3300046461 | Bacteria | 2461 |
| 612 | Ga0495641_0035967 | 3300046461 | Bacteria | 2330 |
| 613 | Ga0495651_0000028 | 3300046462 | Bacteria | 105473 |
| 614 | Ga0495651_0011734 | 3300046462 | Bacteria | 6733 |
| 615 | Ga0495653_0000965 | 3300046463 | Bacteria | 22058 |
| 616 | Ga0495653_0019134 | 3300046463 | Bacteria | 5556 |
| 617 | Ga0495653_0023889 | 3300046463 | Bacteria | 4933 |
| 618 | Ga0495653_0061020 | 3300046463 | Bacteria | 2854 |
| 619 | Ga0495653_0123874 | 3300046463 | Bacteria | 1838 |
| 620 | Ga0495653_0145747 | 3300046463 | Bacteria | 1659 |
| 621 | Ga0495580_0042963 | 3300046472 | Bacteria | 3217 |
| 622 | Ga0495582_0000276 | 3300046473 | Bacteria | 28706 |
| 623 | Ga0495582_0012985 | 3300046473 | Bacteria | 4588 |
| 624 | Ga0495582_0016268 | 3300046473 | Bacteria | 4074 |
| 625 | Ga0495582_0031507 | 3300046473 | Bacteria | 2914 |
| 626 | Ga0495582_0270329 | 3300046473 | Bacteria | 975 |
| 627 | Ga0495639_0000416 | 3300046475 | Bacteria | 20358 |
| 628 | Ga0495639_0000630 | 3300046475 | Bacteria | 16276 |
| 629 | Ga0495662_0001339 | 3300046476 | Bacteria | 12171 |
| 630 | Ga0495662_0024242 | 3300046476 | Bacteria | 2928 |
| 631 | Ga0495662_0083248 | 3300046476 | Bacteria | 1557 |
| 632 | Ga0495664_0032023 | 3300046477 | Bacteria | 3083 |
| 633 | Ga0495584_0125480 | 3300046491 | Bacteria | 1301 |
| 634 | Ga0495594_0041053 | 3300046499 | Bacteria | 2534 |
| 635 | Ga0495594_0172832 | 3300046499 | Bacteria | 1229 |
| 636 | Ga0495607_0081915 | 3300046501 | Bacteria | 1772 |
| 637 | Ga0495608_0008137 | 3300046511 | Bacteria | 7364 |
| 638 | Ga0495608_0008892 | 3300046511 | Bacteria | 7021 |
| 639 | Ga0495608_0100374 | 3300046511 | Bacteria | 1866 |
| 640 | Ga0495608_0207262 | 3300046511 | Bacteria | 1233 |
| 641 | Ga0495618_0012985 | 3300046514 | Bacteria | 5063 |
| 642 | Ga0495618_0104083 | 3300046514 | Bacteria | 1817 |
| 643 | Ga0495618_0144261 | 3300046514 | Bacteria | 1522 |
| 644 | Ga0495628_0000069 | 3300046516 | Bacteria | 82366 |
| 645 | Ga0495628_0041826 | 3300046516 | Bacteria | 3657 |
| 646 | Ga0495630_0005233 | 3300046517 | Bacteria | 9144 |
| 647 | Ga0495630_0015336 | 3300046517 | Bacteria | 5595 |
| 648 | Ga0495630_0019923 | 3300046517 | Bacteria | 4938 |
| 649 | Ga0495630_0228351 | 3300046517 | Bacteria | 1422 |
| 650 | Ga0495630_0264057 | 3300046517 | Bacteria | 1315 |
| 651 | Ga0495644_0010118 | 3300046523 | Bacteria | 3634 |
| 652 | Ga0495666_0000145 | 3300046526 | Bacteria | 29818 |
| 653 | Ga0495652_0010813 | 3300046529 | Bacteria | 8270 |
| 654 | Ga0495652_0011205 | 3300046529 | Bacteria | 8119 |
| 655 | Ga0495652_0130565 | 3300046529 | Bacteria | 1989 |
| 656 | Ga0495652_0176769 | 3300046529 | Bacteria | 1642 |
| 657 | Ga0495652_0241125 | 3300046529 | Bacteria | 1345 |
| 658 | Ga0495665_0005590 | 3300046531 | Bacteria | 6775 |
| 659 | Ga0495665_0086666 | 3300046531 | Bacteria | 1646 |
| 660 | Ga0495665_0144742 | 3300046531 | Unclassified | 1241 |
| 661 | Ga0495640_0049979 | 3300046533 | Bacteria | 2881 |
| 662 | Ga0495640_0114844 | 3300046533 | Bacteria | 1755 |
| 663 | Ga0495640_0153341 | 3300046533 | Bacteria | 1479 |
| 664 | Ga0495587_0000062 | 3300046536 | Bacteria | 91862 |
| 665 | Ga0495587_0155964 | 3300046536 | Bacteria | 1300 |
| 666 | Ga0495645_0000418 | 3300046543 | Bacteria | 29334 |
| 667 | Ga0495667_0006358 | 3300046559 | Bacteria | 8013 |
| 668 | Ga0495667_0123792 | 3300046559 | Bacteria | 1669 |
| 669 | Ga0495667_0133183 | 3300046559 | Bacteria | 1603 |
| 670 | Ga0495656_0005449 | 3300046615 | Bacteria | 4394 |
| 671 | Ga0495634_0024563 | 3300046642 | Bacteria | 4226 |
| 672 | Ga0495634_0177880 | 3300046642 | Bacteria | 1334 |
| 673 | Ga0495611_0025111 | 3300046648 | Bacteria | 2595 |
| 674 | Ga0495635_0003672 | 3300046663 | Bacteria | 10640 |
| 675 | Ga0495635_0009289 | 3300046663 | Bacteria | 6870 |
| 676 | Ga0495635_0029747 | 3300046663 | Bacteria | 3799 |
| 677 | Ga0495635_0040696 | 3300046663 | Bacteria | 3211 |
| 678 | Ga0495635_0045955 | 3300046663 | Bacteria | 3012 |
| 679 | Ga0495659_0017863 | 3300046664 | Bacteria | 2357 |
| 680 | Ga0495657_0020111 | 3300046675 | Bacteria | 4803 |
| 681 | Ga0495657_0045579 | 3300046675 | Bacteria | 2975 |
| 682 | Ga0495657_0054159 | 3300046675 | Bacteria | 2681 |
| 683 | Ga0495657_0163967 | 3300046675 | Bacteria | 1373 |
| 684 | Ga0495599_0000542 | 3300046678 | Bacteria | 21674 |
| 685 | Ga0495599_0234593 | 3300046678 | Bacteria | 1120 |
| 686 | Ga0495623_0000435 | 3300046679 | Bacteria | 27481 |
| 687 | Ga0495623_0219911 | 3300046679 | Bacteria | 1083 |
| 688 | Ga0495646_0007673 | 3300046680 | Bacteria | 6857 |
| 689 | Ga0495646_0023000 | 3300046680 | Bacteria | 3925 |
| 690 | Ga0495646_0031340 | 3300046680 | Bacteria | 3314 |
| 691 | Ga0495647_0000560 | 3300046681 | Bacteria | 10950 |
| 692 | Ga0495647_0026163 | 3300046681 | Bacteria | 2135 |
| 693 | Ga0495647_0078177 | 3300046681 | Bacteria | 1337 |
| 694 | Ga0495658_0001373 | 3300046683 | Bacteria | 12760 |
| 695 | Ga0495658_0003249 | 3300046683 | Bacteria | 8081 |
| 696 | Ga0495658_0072704 | 3300046683 | Bacteria | 2000 |
| 697 | Ga0495658_0109691 | 3300046683 | Bacteria | 1658 |
| 698 | Ga0495613_0024193 | 3300046689 | Bacteria | 4525 |
| 699 | Ga0495613_0041694 | 3300046689 | Bacteria | 3398 |
| 700 | Ga0495613_0094944 | 3300046689 | Bacteria | 2157 |
| 701 | Ga0495613_0129368 | 3300046689 | Bacteria | 1809 |
| 702 | Ga0495624_0000753 | 3300046690 | Bacteria | 25488 |
| 703 | Ga0495624_0028902 | 3300046690 | Bacteria | 3618 |
| 704 | Ga0495670_0033252 | 3300046691 | Bacteria | 2566 |
| 705 | Ga0495670_0037405 | 3300046691 | Bacteria | 2419 |
| 706 | Ga0495600_0019857 | 3300046809 | Bacteria | 4295 |
| 707 | Ga0495600_0023999 | 3300046809 | Bacteria | 3926 |
| 708 | Ga0495660_0074975 | 3300046810 | Bacteria | 1786 |
| 709 | Ga0495581_0000407 | 3300047315 | Bacteria | 21707 |
| 710 | Ga0495581_0007334 | 3300047315 | Bacteria | 6379 |
| 711 | Ga0495581_0025376 | 3300047315 | Bacteria | 3436 |
| 712 | Ga0495604_0009317 | 3300047317 | Bacteria | 7773 |
| 713 | Ga0495604_0028425 | 3300047317 | Bacteria | 4449 |
| 714 | Ga0495604_0052634 | 3300047317 | Bacteria | 3151 |
| 715 | Ga0495604_0054650 | 3300047317 | Bacteria | 3081 |
| 716 | Ga0495604_0066588 | 3300047317 | Bacteria | 2739 |
| 717 | Ga0495674_0031730 | 3300047319 | Bacteria | 4796 |
| 718 | Ga0495674_0112853 | 3300047319 | Bacteria | 2302 |
| 719 | Ga0495674_0167991 | 3300047319 | Bacteria | 1832 |
| 720 | Ga0495676_0002534 | 3300047321 | Bacteria | 16250 |
| 721 | Ga0495676_0029650 | 3300047321 | Bacteria | 4657 |
| 722 | Ga0495676_0112417 | 3300047321 | Bacteria | 1996 |
| 723 | Ga0495676_0184158 | 3300047321 | Bacteria | 1461 |
| 724 | Ga0495676_0272111 | 3300047321 | Bacteria | 1149 |
| 725 | Ga0495680_0004620 | 3300047322 | Bacteria | 13121 |
| 726 | Ga0495680_0009043 | 3300047322 | Bacteria | 8999 |
| 727 | Ga0495680_0016809 | 3300047322 | Bacteria | 6271 |
| 728 | Ga0495680_0025875 | 3300047322 | Bacteria | 4850 |
| 729 | Ga0495680_0032626 | 3300047322 | Bacteria | 4224 |
| 730 | Ga0495680_0182791 | 3300047322 | Bacteria | 1512 |
| 731 | Ga0495680_0219365 | 3300047322 | Bacteria | 1358 |
| 732 | Ga0495675_0004323 | 3300047444 | Bacteria | 8594 |
| 733 | Ga0495675_0252004 | 3300047444 | Bacteria | 1060 |
| 734 | Ga0495685_043865 | 3300047447 | Bacteria | 1526 |
| 735 | Ga0495684_0012597 | 3300047471 | Bacteria | 6522 |
| 736 | Ga0495684_0013231 | 3300047471 | Bacteria | 6368 |
| 737 | Ga0495684_0013780 | 3300047471 | Bacteria | 6222 |
| 738 | Ga0495684_0022672 | 3300047471 | Bacteria | 4829 |
| 739 | Ga0495593_0000807 | 3300047673 | Bacteria | 18118 |
| 740 | Ga0495593_0021844 | 3300047673 | Bacteria | 3571 |
| 741 | Ga0495593_0032247 | 3300047673 | Bacteria | 2857 |
| 742 | Ga0495602_0005881 | 3300048088 | Bacteria | 12881 |
| 743 | Ga0495602_0035846 | 3300048088 | Bacteria | 4622 |
| 744 | Ga0495602_0318701 | 3300048088 | Bacteria | 1132 |
| 745 | Ga0495614_0008651 | 3300048089 | Bacteria | 4527 |
| 746 | Ga0495614_0031783 | 3300048089 | Bacteria | 2272 |
| 747 | Ga0496100_0058160 | 3300048903 | Bacteria | 2536 |
| 748 | Ga0496101_0034217 | 3300048904 | Bacteria | 3587 |
| 749 | Ga0496101_0037263 | 3300048904 | Bacteria | 3449 |
| 750 | Ga0496101_0054431 | 3300048904 | Bacteria | 2889 |
| 751 | Ga0496101_0082868 | 3300048904 | Bacteria | 2374 |
| 752 | Ga0496101_0126310 | 3300048904 | Bacteria | 1938 |
| 753 | Ga0496101_0150233 | 3300048904 | Bacteria | 1781 |
| 754 | Ga0496103_0066505 | 3300048906 | Bacteria | 2250 |
| 755 | Ga0496103_0187516 | 3300048906 | Bacteria | 1330 |
| 756 | Ga0496104_0002502 | 3300048907 | Bacteria | 15814 |
| 757 | Ga0496104_0011326 | 3300048907 | Bacteria | 7984 |
| 758 | Ga0496104_0014077 | 3300048907 | Bacteria | 7220 |
| 759 | Ga0496104_0272129 | 3300048907 | Bacteria | 1606 |
| 760 | Ga0496105_0025913 | 3300048908 | Bacteria | 4777 |
| 761 | Ga0496105_0118367 | 3300048908 | Bacteria | 2185 |
| 762 | Ga0496105_0122667 | 3300048908 | Bacteria | 2142 |
| 763 | Ga0496106_0012693 | 3300048909 | Bacteria | 6223 |
| 764 | Ga0496107_0011878 | 3300048910 | Bacteria | 6083 |
| 765 | Ga0496107_0130825 | 3300048910 | Bacteria | 1853 |
| 766 | Ga0496107_0166116 | 3300048910 | Bacteria | 1636 |
| 767 | Ga0496107_0189405 | 3300048910 | Bacteria | 1528 |
| 768 | Ga0496107_0214628 | 3300048910 | Bacteria | 1431 |
| 769 | Ga0496107_0306741 | 3300048910 | Bacteria | 1181 |
| 770 | Ga0496108_0012837 | 3300048911 | Bacteria | 6822 |
| 771 | Ga0496108_0021721 | 3300048911 | Bacteria | 5277 |
| 772 | Ga0496108_0047762 | 3300048911 | Bacteria | 3578 |
| 773 | Ga0496108_0054644 | 3300048911 | Bacteria | 3351 |
| 774 | Ga0496108_0121098 | 3300048911 | Bacteria | 2244 |
| 775 | Ga0496108_0172184 | 3300048911 | Bacteria | 1873 |
| 776 | Ga0496109_0009864 | 3300048912 | Bacteria | 8152 |
| 777 | Ga0496109_0012739 | 3300048912 | Bacteria | 7266 |
| 778 | Ga0496109_0028593 | 3300048912 | Bacteria | 4987 |
| 779 | Ga0496109_0030645 | 3300048912 | Bacteria | 4821 |
| 780 | Ga0496109_0049496 | 3300048912 | Bacteria | 3825 |
| 781 | Ga0496109_0068013 | 3300048912 | Bacteria | 3264 |
| 782 | Ga0496109_0094262 | 3300048912 | Bacteria | 2771 |
| 783 | Ga0496109_0116337 | 3300048912 | Bacteria | 2488 |
| 784 | Ga0496109_0213883 | 3300048912 | Bacteria | 1813 |
| 785 | Ga0496109_0310045 | 3300048912 | Bacteria | 1489 |
| 786 | Ga0496110_0014622 | 3300048913 | Bacteria | 6521 |
| 787 | Ga0496110_0021211 | 3300048913 | Bacteria | 5495 |
| 788 | Ga0496110_0063492 | 3300048913 | Bacteria | 3263 |
| 789 | Ga0496110_0074625 | 3300048913 | Bacteria | 3012 |
| 790 | Ga0496110_0255983 | 3300048913 | Bacteria | 1593 |
| 791 | Ga0496110_0348488 | 3300048913 | Bacteria | 1349 |
| 792 | Ga0496110_0506961 | 3300048913 | Bacteria | 1098 |
| 793 | Ga0496111_0003615 | 3300048914 | Bacteria | 9586 |
| 794 | Ga0496111_0003834 | 3300048914 | Bacteria | 9390 |
| 795 | Ga0496111_0011695 | 3300048914 | Bacteria | 5924 |
| 796 | Ga0496111_0058727 | 3300048914 | Bacteria | 2785 |
| 797 | Ga0496111_0082017 | 3300048914 | Bacteria | 2354 |
| 798 | Ga0496111_0095042 | 3300048914 | Bacteria | 2186 |
| 799 | Ga0496111_0214743 | 3300048914 | Bacteria | 1429 |
| 800 | Ga0496112_0000598 | 3300048915 | Bacteria | 24854 |
| 801 | Ga0496112_0024171 | 3300048915 | Bacteria | 5815 |
| 802 | Ga0496112_0042134 | 3300048915 | Bacteria | 4467 |
| 803 | Ga0496112_0056022 | 3300048915 | Bacteria | 3879 |
| 804 | Ga0496112_0208142 | 3300048915 | Bacteria | 1914 |
| 805 | Ga0496112_0228515 | 3300048915 | Bacteria | 1815 |
| 806 | Ga0496112_0553904 | 3300048915 | Bacteria | 1084 |
| 807 | Ga0496113_0014459 | 3300048916 | Bacteria | 5385 |
| 808 | Ga0496113_0330833 | 3300048916 | Bacteria | 1221 |
| 809 | Ga0496114_0001985 | 3300048917 | Bacteria | 15563 |
| 810 | Ga0496114_0002716 | 3300048917 | Bacteria | 13516 |
| 811 | Ga0496114_0003682 | 3300048917 | Bacteria | 11789 |
| 812 | Ga0496114_0015753 | 3300048917 | Bacteria | 6083 |
| 813 | Ga0496114_0112125 | 3300048917 | Bacteria | 2338 |
| 814 | Ga0496114_0158201 | 3300048917 | Bacteria | 1968 |
| 815 | Ga0496114_0494644 | 3300048917 | Bacteria | 1082 |
| 816 | Ga0496115_0003805 | 3300048918 | Bacteria | 10865 |
| 817 | Ga0496115_0025452 | 3300048918 | Bacteria | 4607 |
| 818 | Ga0496115_0075583 | 3300048918 | Bacteria | 2736 |
| 819 | Ga0496115_0123645 | 3300048918 | Bacteria | 2130 |
| 820 | Ga0496115_0123748 | 3300048918 | Bacteria | 2129 |
| 821 | Ga0501031_0009175 | 3300049568 | Bacteria | 6430 |
| 822 | Ga0501031_0039446 | 3300049568 | Bacteria | 3081 |
| 823 | Ga0501032_0006986 | 3300049569 | Bacteria | 8275 |
| 824 | Ga0501032_0024055 | 3300049569 | Bacteria | 4207 |
| 825 | Ga0501033_0031758 | 3300049570 | Bacteria | 3965 |
| 826 | Ga0501033_0131383 | 3300049570 | Bacteria | 1814 |
| 827 | Ga0501034_0007715 | 3300049571 | Bacteria | 11447 |
| 828 | Ga0501036_0002934 | 3300049572 | Bacteria | 13537 |
| 829 | Ga0501036_0027279 | 3300049572 | Bacteria | 4825 |
| 830 | Ga0501036_0037136 | 3300049572 | Bacteria | 4121 |
| 831 | Ga0501036_0215304 | 3300049572 | Bacteria | 1614 |
| 832 | Ga0501036_0294097 | 3300049572 | Bacteria | 1358 |
| 833 | Ga0501037_0008319 | 3300049573 | Bacteria | 7603 |
| 834 | Ga0501037_0030682 | 3300049573 | Bacteria | 3972 |
| 835 | Ga0501037_0039891 | 3300049573 | Bacteria | 3455 |
| 836 | Ga0501038_0032109 | 3300049574 | Bacteria | 4634 |
| 837 | Ga0501038_0035346 | 3300049574 | Bacteria | 4387 |
| 838 | Ga0501038_0036131 | 3300049574 | Bacteria | 4336 |
| 839 | Ga0501038_0058938 | 3300049574 | Bacteria | 3290 |
| 840 | Ga0501038_0080022 | 3300049574 | Bacteria | 2755 |
| 841 | Ga0501039_0012109 | 3300049575 | Bacteria | 6575 |
| 842 | Ga0501039_0013548 | 3300049575 | Bacteria | 6235 |
| 843 | Ga0501039_0031955 | 3300049575 | Bacteria | 4058 |
| 844 | Ga0501039_0140411 | 3300049575 | Bacteria | 1897 |
| 845 | Ga0501039_0188829 | 3300049575 | Bacteria | 1621 |
| 846 | Ga0501040_0003297 | 3300049576 | Bacteria | 10433 |
| 847 | Ga0501040_0060661 | 3300049576 | Bacteria | 2599 |
| 848 | Ga0501040_0068943 | 3300049576 | Bacteria | 2439 |
| 849 | Ga0501041_0001889 | 3300049577 | Bacteria | 11746 |
| 850 | Ga0501041_0024997 | 3300049577 | Bacteria | 3588 |
| 851 | Ga0501041_0029975 | 3300049577 | Bacteria | 3283 |
| 852 | Ga0501041_0094326 | 3300049577 | Bacteria | 1848 |
| 853 | Ga0501042_0013766 | 3300049578 | Bacteria | 5510 |
| 854 | Ga0501042_0033857 | 3300049578 | Bacteria | 3622 |
| 855 | Ga0501042_0071633 | 3300049578 | Bacteria | 2479 |
| 856 | Ga0501043_0014807 | 3300049579 | Bacteria | 6106 |
| 857 | Ga0501043_0211654 | 3300049579 | Bacteria | 1502 |
| 858 | Ga0501046_0004587 | 3300049580 | Bacteria | 12478 |
| 859 | Ga0501046_0084140 | 3300049580 | Bacteria | 2454 |
| 860 | Ga0501046_0098470 | 3300049580 | Bacteria | 2245 |
| 861 | Ga0501067_0001274 | 3300049583 | Bacteria | 13704 |
| 862 | Ga0501067_0024164 | 3300049583 | Bacteria | 3369 |
| 863 | Ga0501067_0028554 | 3300049583 | Bacteria | 3092 |
| 864 | Ga0501067_0125481 | 3300049583 | Bacteria | 1428 |
| 865 | Ga0501068_0011505 | 3300049584 | Bacteria | 4996 |
| 866 | Ga0501068_0022471 | 3300049584 | Bacteria | 3688 |
| 867 | Ga0501068_0082830 | 3300049584 | Bacteria | 1971 |
| 868 | Ga0501069_0076896 | 3300049585 | Bacteria | 1877 |
| 869 | Ga0501070_0016126 | 3300049586 | Bacteria | 6280 |
| 870 | Ga0501070_0037276 | 3300049586 | Bacteria | 4060 |
| 871 | Ga0501070_0112052 | 3300049586 | Bacteria | 2255 |
| 872 | Ga0501070_0161130 | 3300049586 | Bacteria | 1849 |
| 873 | Ga0501070_0212642 | 3300049586 | Bacteria | 1587 |
| 874 | Ga0501071_0004560 | 3300049587 | Bacteria | 8784 |
| 875 | Ga0501071_0009228 | 3300049587 | Bacteria | 6560 |
| 876 | Ga0501071_0019776 | 3300049587 | Bacteria | 4675 |
| 877 | Ga0501071_0146912 | 3300049587 | Bacteria | 1757 |
| 878 | Ga0501072_0022091 | 3300049588 | Bacteria | 4935 |
| 879 | Ga0501072_0040065 | 3300049588 | Bacteria | 3678 |
| 880 | Ga0501072_0067455 | 3300049588 | Bacteria | 2823 |
| 881 | Ga0501072_0313609 | 3300049588 | Bacteria | 1246 |
| 882 | Ga0501073_0098613 | 3300049589 | Bacteria | 2029 |
| 883 | Ga0501073_0171651 | 3300049589 | Bacteria | 1501 |
| 884 | Ga0501074_0018991 | 3300049590 | Bacteria | 4994 |
| 885 | Ga0501074_0022796 | 3300049590 | Bacteria | 4552 |
| 886 | Ga0501074_0075752 | 3300049590 | Bacteria | 2415 |
| 887 | Ga0501074_0330898 | 3300049590 | Bacteria | 1081 |
| 888 | Ga0501075_0014195 | 3300049591 | Bacteria | 5708 |
| 889 | Ga0501075_0022744 | 3300049591 | Bacteria | 4582 |
| 890 | Ga0501075_0045885 | 3300049591 | Bacteria | 3281 |
| 891 | Ga0501075_0071062 | 3300049591 | Bacteria | 2631 |
| 892 | Ga0501075_0169890 | 3300049591 | Bacteria | 1664 |
| 893 | Ga0501076_0002712 | 3300049592 | Bacteria | 12243 |
| 894 | Ga0501076_0016448 | 3300049592 | Bacteria | 5608 |
| 895 | Ga0501076_0019374 | 3300049592 | Bacteria | 5201 |
| 896 | Ga0501076_0019639 | 3300049592 | Bacteria | 5166 |
| 897 | Ga0501076_0152737 | 3300049592 | Bacteria | 1878 |
| 898 | Ga0501076_0345489 | 3300049592 | Bacteria | 1221 |
| 899 | Ga0501077_0000736 | 3300049593 | Bacteria | 19805 |
| 900 | Ga0501077_0019935 | 3300049593 | Bacteria | 4242 |
| 901 | Ga0501079_0003106 | 3300049741 | Bacteria | 12166 |
| 902 | Ga0501079_0014599 | 3300049741 | Bacteria | 5989 |
| 903 | Ga0501079_0023191 | 3300049741 | Bacteria | 4764 |
| 904 | Ga0501079_0082272 | 3300049741 | Bacteria | 2490 |
| 905 | Ga0501079_0151086 | 3300049741 | Bacteria | 1810 |
| 906 | Ga0501079_0240613 | 3300049741 | Bacteria | 1414 |
| 907 | Ga0501080_0002078 | 3300049742 | Bacteria | 17369 |
| 908 | Ga0501080_0115759 | 3300049742 | Bacteria | 2485 |
| 909 | Ga0501080_0217168 | 3300049742 | Bacteria | 1751 |
| 910 | Ga0501081_0005825 | 3300049743 | Bacteria | 7977 |
| 911 | Ga0501081_0035147 | 3300049743 | Bacteria | 3411 |
| 912 | Ga0501081_0097441 | 3300049743 | Bacteria | 2075 |
| 913 | Ga0501083_0006162 | 3300049744 | Bacteria | 8508 |
| 914 | Ga0501083_0045654 | 3300049744 | Bacteria | 2963 |
| 915 | Ga0501083_0117028 | 3300049744 | Bacteria | 1749 |
| 916 | Ga0501035_0044278 | 3300049822 | Bacteria | 4008 |
| 917 | Ga0501035_0242551 | 3300049822 | Bacteria | 1532 |
| 918 | Ga0501035_0256483 | 3300049822 | Bacteria | 1484 |
| 919 | Ga0501044_0055769 | 3300049823 | Bacteria | 4058 |
| 920 | Ga0501045_0021550 | 3300049824 | Bacteria | 4610 |
| 921 | Ga0501045_0029191 | 3300049824 | Bacteria | 3984 |
| 922 | Ga0501045_0034207 | 3300049824 | Bacteria | 3687 |
| 923 | nmdc:mga00v17_199616_c1 | 3300050491 | Bacteria | 1293 |
| 924 | nmdc:mga0yw44_124969_c1 | 3300050492 | Bacteria | 1660 |
| 925 | nmdc:mga06z11_133121_c1 | 3300050494 | Bacteria | 1398 |
| 926 | nmdc:mga05p37_146671_c1 | 3300050507 | Bacteria | 2889 |
| 927 | nmdc:mga05p37_42560_c1 | 3300050507 | Bacteria | 5581 |
| 928 | nmdc:mga09592_119005_c1 | 3300050508 | Bacteria | 2268 |
| 929 | nmdc:mga09592_211435_c1 | 3300050508 | Bacteria | 1680 |
| 930 | nmdc:mga09592_52471_c1 | 3300050508 | Bacteria | 3442 |
| 931 | nmdc:mga06r32_119323_c1 | 3300050510 | Bacteria | 2601 |
| 932 | nmdc:mga06r32_328538_c1 | 3300050510 | Bacteria | 1514 |
| 933 | nmdc:mga08y16_149410_c1 | 3300050511 | Bacteria | 2429 |
| 934 | nmdc:mga08y16_28150_c1 | 3300050511 | Bacteria | 5924 |
| 935 | nmdc:mga08y16_33389_c1 | 3300050511 | Bacteria | 5404 |
| 936 | nmdc:mga08y16_40104_c1 | 3300050511 | Bacteria | 4909 |
| 937 | nmdc:mga0n895_151111_c1 | 3300050512 | Bacteria | 2352 |
| 938 | nmdc:mga0n895_37865_c1 | 3300050512 | Bacteria | 4669 |
| 939 | nmdc:mga0n895_469_c1 | 3300050512 | Bacteria | 27118 |
| 940 | nmdc:mga0a205_302572_c1 | 3300050515 | Bacteria | 1472 |
| 941 | nmdc:mga0a205_31297_c1 | 3300050515 | Bacteria | 5097 |
| 942 | nmdc:mga0a205_61096_c1 | 3300050515 | Bacteria | 3639 |
| 943 | nmdc:mga0a205_66960_c1 | 3300050515 | Bacteria | 3469 |
| 944 | Ga0495601_0004004 | 3300053077 | Bacteria | 8484 |
| 945 | Ga0495601_0027217 | 3300053077 | Bacteria | 3534 |
| 946 | Ga0495601_0070843 | 3300053077 | Bacteria | 2225 |
| 947 | Ga0495601_0142175 | 3300053077 | Bacteria | 1565 |
| 948 | Ga0495601_0173000 | 3300053077 | Bacteria | 1412 |
| 949 | Ga0495612_0002367 | 3300053078 | Bacteria | 7771 |
| 950 | Ga0495612_0015793 | 3300053078 | Bacteria | 3027 |
| 951 | Ga0495595_0013724 | 3300053084 | Bacteria | 3426 |
| 952 | Ga0495595_0019382 | 3300053084 | Bacteria | 2951 |
| 953 | Ga0495595_0025782 | 3300053084 | Bacteria | 2607 |
| 954 | Ga0495595_0028463 | 3300053084 | Bacteria | 2496 |
| 955 | Ga0495595_0103084 | 3300053084 | Bacteria | 1378 |
| 956 | Ga0495619_0000123 | 3300053085 | Bacteria | 57052 |
| 957 | Ga0495619_0001783 | 3300053085 | Bacteria | 14316 |
| 958 | Ga0495619_0005855 | 3300053085 | Bacteria | 7790 |
| 959 | Ga0495619_0012550 | 3300053085 | Bacteria | 5336 |
| 960 | Ga0495619_0027860 | 3300053085 | Bacteria | 3643 |
| 961 | Ga0495619_0225819 | 3300053085 | Bacteria | 1297 |
| 962 | Ga0500566_0097207 | 3300053094 | Bacteria | 1619 |
| 963 | Ga0501084_0054541 | 3300054114 | Bacteria | 3344 |
| 964 | Ga0501084_0072005 | 3300054114 | Bacteria | 2894 |
| 965 | Ga0501084_0072532 | 3300054114 | Bacteria | 2883 |
| 966 | Ga0501084_0130061 | 3300054114 | Bacteria | 2119 |
| 967 | Ga0501082_0022866 | 3300060353 | Bacteria | 5386 |
| 968 | Ga0501082_0030879 | 3300060353 | Bacteria | 4618 |
| 969 | Ga0501082_0076561 | 3300060353 | Bacteria | 2884 |
| 970 | Ga0501082_0339777 | 3300060353 | Bacteria | 1308 |
| 971 | Ga0466962_0000436 | 3300061719 | Bacteria | 18149 |
| 972 | Ga0466962_0011984 | 3300061719 | Bacteria | 4170 |
| 973 | Ga0466962_0071300 | 3300061719 | Bacteria | 1660 |
| 974 | Ga0466962_0099087 | 3300061719 | Bacteria | 1399 |
| 975 | Ga0530510_0022085 | 3300061734 | Bacteria | 4531 |
| 976 | Ga0530510_0079967 | 3300061734 | Bacteria | 2378 |
| 977 | Ga0530510_0082074 | 3300061734 | Bacteria | 2347 |
| 978 | Ga0530510_0086446 | 3300061734 | Bacteria | 2284 |
| 979 | Ga0530510_0088037 | 3300061734 | Bacteria | 2263 |
| 980 | Ga0530510_0089901 | 3300061734 | Bacteria | 2239 |
| 981 | Ga0495664_0098648 | |||
| 982 | ARcpr5oldR_c001779 | |||
| 983 | ARcpr5yngRDRAFT_c001848 | |||
| 984 | ARSoilOldRDRAFT_c001865 | |||
| 985 | JGI25407J50210_10016918 | |||
| 986 | Ga0070658_10019227 | |||
| 987 | Ga0070658_10020064 | |||
| 988 | Ga0070658_10021346 | |||
| 989 | Ga0070658_10025030 | |||
| 990 | Ga0070683_100002072 | |||
| 991 | Ga0070683_100007870 | |||
| 992 | Ga0070683_100030290 | |||
| 993 | Ga0070683_100045200 | |||
| 994 | Ga0070683_100051715 | |||
| 995 | Ga0070683_100072245 | |||
| 996 | Ga0070683_100265181 | |||
| 997 | Ga0070683_100299205 | |||
| 998 | Ga0070683_100447598 | |||
| 999 | Ga0070670_100001416 | |||
| 1000 | Ga0070670_100011662 | |||
| 1001 | Ga0068869_100062498 | |||
| 1002 | Ga0070680_100059775 | |||
| 1003 | Ga0070660_100002486 | |||
| 1004 | Ga0070660_100013951 | |||
| 1005 | Ga0070660_100022670 | |||
| 1006 | Ga0070660_100022817 | |||
| 1007 | Ga0070660_100025106 | |||
| 1008 | Ga0070660_100060948 | |||
| 1009 | Ga0070660_100135677 | |||
| 1010 | Ga0070660_100156499 | |||
| 1011 | Ga0070689_100088971 | |||
| 1012 | Ga0070691_10010916 | |||
| 1013 | Ga0070661_100012594 | |||
| 1014 | Ga0070661_100037444 | |||
| 1015 | Ga0070661_100187860 | |||
| 1016 | Ga0070692_10009297 | |||
| 1017 | Ga0070668_100059507 | |||
| 1018 | Ga0070675_100061915 | |||
| 1019 | Ga0070675_100122522 | |||
| 1020 | Ga0070675_100209389 | |||
| 1021 | Ga0070675_100319030 | |||
| 1022 | Ga0070671_100144638 | |||
| 1023 | Ga0070674_100009583 | |||
| 1024 | Ga0070674_100029938 | |||
| 1025 | Ga0070674_100086538 | |||
| 1026 | Ga0070688_100015217 | |||
| 1027 | Ga0070688_100179125 | |||
| 1028 | Ga0070659_100016361 | |||
| 1029 | Ga0070659_100018681 | |||
| 1030 | Ga0070659_100041557 | |||
| 1031 | Ga0070659_100049468 | |||
| 1032 | Ga0070659_100070351 | |||
| 1033 | Ga0070659_100080287 | |||
| 1034 | Ga0070667_100185173 | |||
| 1035 | Ga0070709_10069891 | |||
| 1036 | Ga0070714_100001442 | |||
| 1037 | Ga0070714_100001730 | |||
| 1038 | Ga0070714_100029368 | |||
| 1039 | Ga0070714_100066811 | |||
| 1040 | Ga0070714_100120683 | |||
| 1041 | Ga0070714_100226202 | |||
| 1042 | Ga0070713_100027513 | |||
| 1043 | Ga0070713_100029682 | |||
| 1044 | Ga0070713_100039309 | |||
| 1045 | Ga0070713_100097436 | |||
| 1046 | Ga0070710_10004523 | |||
| 1047 | Ga0070710_10006096 | |||
| 1048 | Ga0070710_10137403 | |||
| 1049 | Ga0070711_100032777 | |||
| 1050 | Ga0070711_100088200 | |||
| 1051 | Ga0070705_100009442 | |||
| 1052 | Ga0070700_100050823 | |||
| 1053 | Ga0070678_100010494 | |||
| 1054 | Ga0070662_100138330 | |||
| 1055 | Ga0070662_100223356 | |||
| 1056 | Ga0070681_10007863 | |||
| 1057 | Ga0070681_10010706 | |||
| 1058 | Ga0070681_10013095 | |||
| 1059 | Ga0070681_10063154 | |||
| 1060 | Ga0070681_10080307 | |||
| 1061 | Ga0068867_100041467 | |||
| 1062 | Ga0068867_100087168 | |||
| 1063 | Ga0070685_10003914 | |||
| 1064 | Ga0070707_100229155 | |||
| 1065 | Ga0070679_100002705 | |||
| 1066 | Ga0070679_100031014 | |||
| 1067 | Ga0070679_100051987 | |||
| 1068 | Ga0070679_100052099 | |||
| 1069 | Ga0070679_100129899 | |||
| 1070 | Ga0070679_100141123 | |||
| 1071 | Ga0070679_100188074 | |||
| 1072 | Ga0070679_100191576 | |||
| 1073 | Ga0070684_100002119 | |||
| 1074 | Ga0070684_100008878 | |||
| 1075 | Ga0070684_100025726 | |||
| 1076 | Ga0070684_100045568 | |||
| 1077 | Ga0070684_100056546 | |||
| 1078 | Ga0070684_100087574 | |||
| 1079 | Ga0070684_100102186 | |||
| 1080 | Ga0070684_100117141 | |||
| 1081 | Ga0070684_100134471 | |||
| 1082 | Ga0068853_100226790 | |||
| 1083 | Ga0070672_100025720 | |||
| 1084 | Ga0070672_100055863 | |||
| 1085 | Ga0070672_100056251 | |||
| 1086 | Ga0070686_100028499 | |||
| 1087 | Ga0070665_100017936 | |||
| 1088 | Ga0070665_100055070 | |||
| 1089 | Ga0070665_100138775 | |||
| 1090 | Ga0070665_100391412 | |||
| 1091 | Ga0070704_100012873 | |||
| 1092 | Ga0070704_100192829 | |||
| 1093 | Ga0068855_100012520 | |||
| 1094 | Ga0068855_100023892 | |||
| 1095 | Ga0068855_100026748 | |||
| 1096 | Ga0068855_100030862 | |||
| 1097 | Ga0068855_100062367 | |||
| 1098 | Ga0068855_100062802 | |||
| 1099 | Ga0068855_100100041 | |||
| 1100 | Ga0068855_100370081 | |||
| 1101 | Ga0068855_100530316 | |||
| 1102 | Ga0070664_100240330 | |||
| 1103 | Ga0070664_100330114 | |||
| 1104 | Ga0068857_100010392 | |||
| 1105 | Ga0068857_100300092 | |||
| 1106 | Ga0068856_100023490 | |||
| 1107 | Ga0068856_100098363 | |||
| 1108 | Ga0068856_100195013 | |||
| 1109 | Ga0068856_100235927 | |||
| 1110 | Ga0068856_100291199 | |||
| 1111 | Ga0070702_100016371 | |||
| 1112 | Ga0070702_100036076 | |||
| 1113 | Ga0070702_100076237 | |||
| 1114 | Ga0068852_100022416 | |||
| 1115 | Ga0068852_100071256 | |||
| 1116 | Ga0068852_100156456 | |||
| 1117 | Ga0068852_100383161 | |||
| 1118 | Ga0068859_100273176 | |||
| 1119 | Ga0068859_100302800 | |||
| 1120 | Ga0068864_100016474 | |||
| 1121 | Ga0068864_100319987 | |||
| 1122 | Ga0068861_100139709 | |||
| 1123 | Ga0068870_10006546 | |||
| 1124 | Ga0068870_10067258 | |||
| 1125 | Ga0068870_10067987 | |||
| 1126 | Ga0068863_100056847 | |||
| 1127 | Ga0068863_100191810 | |||
| 1128 | Ga0068858_100034222 | |||
| 1129 | Ga0068858_100104478 | |||
| 1130 | Ga0081455_10010288 | |||
| 1131 | Ga0081455_10013183 | |||
| 1132 | Ga0081455_10030383 | |||
| 1133 | Ga0081455_10047239 | |||
| 1134 | Ga0081538_10001451 | |||
| 1135 | Ga0081538_10003447 | |||
| 1136 | Ga0081538_10010380 | |||
| 1137 | Ga0070717_10029414 | |||
| 1138 | Ga0070717_10031104 | |||
| 1139 | Ga0070717_10042288 | |||
| 1140 | Ga0070717_10080120 | |||
| 1141 | Ga0070712_100052688 | |||
| 1142 | Ga0070712_100082607 | |||
| 1143 | Ga0075362_10042223 | |||
| 1144 | Ga0075367_10154529 | |||
| 1145 | Ga0097621_100166659 | |||
| 1146 | Ga0068871_100177867 | |||
| 1147 | Ga0068871_100245585 | |||
| 1148 | Ga0068871_100349465 | |||
| 1149 | Ga0068871_100421428 | |||
| 1150 | Ga0075428_100001085 | |||
| 1151 | Ga0075428_100438781 | |||
| 1152 | Ga0075431_100224078 | |||
| 1153 | Ga0075433_10011798 | |||
| 1154 | Ga0075434_100002359 | |||
| 1155 | Ga0075434_100060938 | |||
| 1156 | Ga0075429_100014750 | |||
| 1157 | Ga0068865_100017702 | |||
| 1158 | Ga0068865_100023380 | |||
| 1159 | Ga0068865_100051639 | |||
| 1160 | Ga0068865_100134036 | |||
| 1161 | Ga0068865_100261403 | |||
| 1162 | Ga0097620_100273179 | |||
| 1163 | Ga0097620_100302780 | |||
| 1164 | Ga0075435_100019848 | |||
| 1165 | Ga0075435_100120168 | |||
| 1166 | Ga0105240_10023072 | |||
| 1167 | Ga0105240_10036412 | |||
| 1168 | Ga0105240_10120457 | |||
| 1169 | Ga0105240_10178584 | |||
| 1170 | Ga0105240_10256198 | |||
| 1171 | Ga0111539_10021516 | |||
| 1172 | Ga0111539_10044091 | |||
| 1173 | Ga0111539_10052555 | |||
| 1174 | Ga0111539_10156475 | |||
| 1175 | Ga0111539_10168633 | |||
| 1176 | Ga0105245_10040914 | |||
| 1177 | Ga0105245_10204635 | |||
| 1178 | Ga0105245_10258067 | |||
| 1179 | Ga0105245_10298694 | |||
| 1180 | Ga0114129_10061904 | |||
| 1181 | Ga0114129_10121776 | |||
| 1182 | Ga0114129_10187184 | |||
| 1183 | Ga0114129_10233725 | |||
| 1184 | Ga0105243_10045431 | |||
| 1185 | Ga0105243_10049448 | |||
| 1186 | Ga0105243_10075872 | |||
| 1187 | Ga0105241_10256096 | |||
| 1188 | Ga0105242_10029242 | |||
| 1189 | Ga0105242_10109831 | |||
| 1190 | Ga0105242_10179460 | |||
| 1191 | Ga0105242_10194545 | |||
| 1192 | Ga0105248_10356824 | |||
| 1193 | Ga0105237_10083196 | |||
| 1194 | Ga0105238_10025932 | |||
| 1195 | Ga0105238_10093907 | |||
| 1196 | Ga0105238_10515906 | |||
| 1197 | Ga0105239_10067240 | |||
| 1198 | Ga0105239_10303672 | |||
| 1199 | Ga0105239_10468167 | |||
| 1200 | Ga0105246_10072539 | |||
| 1201 | Ga0105246_10255079 | |||
| 1202 | Ga0157373_10043309 | |||
| 1203 | Ga0157371_10005984 | |||
| 1204 | Ga0157371_10382052 | |||
| 1205 | Ga0157370_10002516 | |||
| 1206 | Ga0157370_10013425 | |||
| 1207 | Ga0157370_10051763 | |||
| 1208 | Ga0157369_10002737 | |||
| 1209 | Ga0157369_10013174 | |||
| 1210 | Ga0157369_10033465 | |||
| 1211 | Ga0157369_10044191 | |||
| 1212 | Ga0157369_10081251 | |||
| 1213 | Ga0157369_10256533 | |||
| 1214 | Ga0157369_10362181 | |||
| 1215 | Ga0157369_10390413 | |||
| 1216 | Ga0157374_10111555 | |||
| 1217 | Ga0157378_10168812 | |||
| 1218 | Ga0163162_10154082 | |||
| 1219 | Ga0157372_10112973 | |||
| 1220 | Ga0157372_10120900 | |||
| 1221 | Ga0157372_10153468 | |||
| 1222 | Ga0157372_10291351 | |||
| 1223 | Ga0157372_10294828 | |||
| 1224 | Ga0157375_10008240 | |||
| 1225 | Ga0157375_10069120 | |||
| 1226 | Ga0157375_10102659 | |||
| 1227 | Ga0157375_10332384 | |||
| 1228 | Ga0157375_10471731 | |||
| 1229 | Ga0163163_10020509 | |||
| 1230 | Ga0163163_10077735 | |||
| 1231 | Ga0163163_10094594 | |||
| 1232 | Ga0157380_10009782 | |||
| 1233 | Ga0157380_10094956 | |||
| 1234 | Ga0182008_10003425 | |||
| 1235 | Ga0182008_10017041 | |||
| 1236 | Ga0157379_10023154 | |||
| 1237 | Ga0157379_10121416 | |||
| 1238 | Ga0157376_10031446 | |||
| 1239 | Ga0157376_10085135 | |||
| 1240 | Ga0182006_1013195 | |||
| 1241 | Ga0182007_10013137 | |||
| 1242 | Ga0197907_11086716 | |||
| 1243 | Ga0206356_10279172 | |||
| 1244 | Ga0206356_10815587 | |||
| 1245 | Ga0206356_10898699 | |||
| 1246 | Ga0206356_11121660 | |||
| 1247 | Ga0206356_11196203 | |||
| 1248 | Ga0206356_11522396 | |||
| 1249 | Ga0206356_11541977 | |||
| 1250 | Ga0206352_10587334 | |||
| 1251 | Ga0206352_11227318 | |||
| 1252 | Ga0206354_11430067 | |||
| 1253 | Ga0206353_10157270 | |||
| 1254 | Ga0206353_10738018 | |||
| 1255 | Ga0206353_10928214 | |||
| 1256 | Ga0224712_10026165 | |||
| 1257 | Ga0224712_10033947 | |||
| 1258 | Ga0207656_10023374 | |||
| 1259 | Ga0207692_10047524 | |||
| 1260 | Ga0207688_10003504 | |||
| 1261 | Ga0207688_10046169 | |||
| 1262 | Ga0207688_10050259 | |||
| 1263 | Ga0207688_10060605 | |||
| 1264 | Ga0207699_10005456 | |||
| 1265 | Ga0207699_10318886 | |||
| 1266 | Ga0207645_10028109 | |||
| 1267 | Ga0207643_10015562 | |||
| 1268 | Ga0207643_10021733 | |||
| 1269 | Ga0207643_10067683 | |||
| 1270 | Ga0207643_10079250 | |||
| 1271 | Ga0207705_10009302 | |||
| 1272 | Ga0207705_10010580 | |||
| 1273 | Ga0207705_10090975 | |||
| 1274 | Ga0207705_10107552 | |||
| 1275 | Ga0207705_10306544 | |||
| 1276 | Ga0207707_10011362 | |||
| 1277 | Ga0207707_10024618 | |||
| 1278 | Ga0207707_10038402 | |||
| 1279 | Ga0207707_10073051 | |||
| 1280 | Ga0207707_10095963 | |||
| 1281 | Ga0207707_10225514 | |||
| 1282 | Ga0207695_10030376 | |||
| 1283 | Ga0207695_10107810 | |||
| 1284 | Ga0207695_10196018 | |||
| 1285 | Ga0207693_10020457 | |||
| 1286 | Ga0207693_10048916 | |||
| 1287 | Ga0207693_10076157 | |||
| 1288 | Ga0207660_10020890 | |||
| 1289 | Ga0207660_10043606 | |||
| 1290 | Ga0207660_10101967 | |||
| 1291 | Ga0207660_10119259 | |||
| 1292 | Ga0207660_10167391 | |||
| 1293 | Ga0207660_10219081 | |||
| 1294 | Ga0207657_10000388 | |||
| 1295 | Ga0207657_10001654 | |||
| 1296 | Ga0207657_10007555 | |||
| 1297 | Ga0207657_10013743 | |||
| 1298 | Ga0207657_10024293 | |||
| 1299 | Ga0207657_10028373 | |||
| 1300 | Ga0207657_10053710 | |||
| 1301 | Ga0207657_10060602 | |||
| 1302 | Ga0207657_10061747 | |||
| 1303 | Ga0207657_10183182 | |||
| 1304 | Ga0207649_10011165 | |||
| 1305 | Ga0207652_10020251 | |||
| 1306 | Ga0207652_10025744 | |||
| 1307 | Ga0207652_10039695 | |||
| 1308 | Ga0207652_10044674 | |||
| 1309 | Ga0207652_10102240 | |||
| 1310 | Ga0207652_10159422 | |||
| 1311 | Ga0207652_10213535 | |||
| 1312 | Ga0207652_10274518 | |||
| 1313 | Ga0207646_10003943 | |||
| 1314 | Ga0207681_10078272 | |||
| 1315 | Ga0207681_10125422 | |||
| 1316 | Ga0207694_10033511 | |||
| 1317 | Ga0207694_10139557 | |||
| 1318 | Ga0207694_10348444 | |||
| 1319 | Ga0207650_10001970 | |||
| 1320 | Ga0207650_10020697 | |||
| 1321 | Ga0207687_10041874 | |||
| 1322 | Ga0207687_10052385 | |||
| 1323 | Ga0207687_10057508 | |||
| 1324 | Ga0207687_10121658 | |||
| 1325 | Ga0207687_10204723 | |||
| 1326 | Ga0207700_10000012 | |||
| 1327 | Ga0207700_10069265 | |||
| 1328 | Ga0207700_10129214 | |||
| 1329 | Ga0207664_10011840 | |||
| 1330 | Ga0207664_10049060 | |||
| 1331 | Ga0207664_10059156 | |||
| 1332 | Ga0207664_10097057 | |||
| 1333 | Ga0207664_10232080 | |||
| 1334 | Ga0207664_10237483 | |||
| 1335 | Ga0207664_10261075 | |||
| 1336 | Ga0207644_10087252 | |||
| 1337 | Ga0207644_10304609 | |||
| 1338 | Ga0207690_10253202 | |||
| 1339 | Ga0207706_10024869 | |||
| 1340 | Ga0207706_10183488 | |||
| 1341 | Ga0207686_10044525 | |||
| 1342 | Ga0207709_10023417 | |||
| 1343 | Ga0207709_10027841 | |||
| 1344 | Ga0207709_10031752 | |||
| 1345 | Ga0207709_10031952 | |||
| 1346 | Ga0207709_10166986 | |||
| 1347 | Ga0207670_10204726 | |||
| 1348 | Ga0207669_10052783 | |||
| 1349 | Ga0207669_10062788 | |||
| 1350 | Ga0207704_10061701 | |||
| 1351 | Ga0207704_10171905 | |||
| 1352 | Ga0207665_10001348 | |||
| 1353 | Ga0207665_10007682 | |||
| 1354 | Ga0207665_10102769 | |||
| 1355 | Ga0207665_10356041 | |||
| 1356 | Ga0207691_10015833 | |||
| 1357 | Ga0207691_10019906 | |||
| 1358 | Ga0207689_10039123 | |||
| 1359 | Ga0207661_10000991 | |||
| 1360 | Ga0207661_10023312 | |||
| 1361 | Ga0207661_10030896 | |||
| 1362 | Ga0207661_10070915 | |||
| 1363 | Ga0207661_10097823 | |||
| 1364 | Ga0207661_10177817 | |||
| 1365 | Ga0207661_10303647 | |||
| 1366 | Ga0207679_10072862 | |||
| 1367 | Ga0207679_10161725 | |||
| 1368 | Ga0207679_10316332 | |||
| 1369 | Ga0207667_10014549 | |||
| 1370 | Ga0207667_10035925 | |||
| 1371 | Ga0207667_10062963 | |||
| 1372 | Ga0207667_10304488 | |||
| 1373 | Ga0207667_10427067 | |||
| 1374 | Ga0207712_10099401 | |||
| 1375 | Ga0207668_10223264 | |||
| 1376 | Ga0207640_10002196 | |||
| 1377 | Ga0207640_10141303 | |||
| 1378 | Ga0207677_10173102 | |||
| 1379 | Ga0207703_10082927 | |||
| 1380 | Ga0207639_10028626 | |||
| 1381 | Ga0207639_10176479 | |||
| 1382 | Ga0207639_10204477 | |||
| 1383 | Ga0207678_10121124 | |||
| 1384 | Ga0207678_10171353 | |||
| 1385 | Ga0207708_10016277 | |||
| 1386 | Ga0207708_10027622 | |||
| 1387 | Ga0207708_10121668 | |||
| 1388 | Ga0207708_10237766 | |||
| 1389 | Ga0207702_10098431 | |||
| 1390 | Ga0207702_10113980 | |||
| 1391 | Ga0207702_10148408 | |||
| 1392 | Ga0207702_10213439 | |||
| 1393 | Ga0207702_10414720 | |||
| 1394 | Ga0207641_10039645 | |||
| 1395 | Ga0207641_10182070 | |||
| 1396 | Ga0207648_10030244 | |||
| 1397 | Ga0207648_10089885 | |||
| 1398 | Ga0207676_10048095 | |||
| 1399 | Ga0207674_10040088 | |||
| 1400 | Ga0207674_10070893 | |||
| 1401 | Ga0207674_10187235 | |||
| 1402 | Ga0207675_100063624 | |||
| 1403 | Ga0207675_100077083 | |||
| 1404 | Ga0207675_100129180 | |||
| 1405 | Ga0207683_10011071 | |||
| 1406 | Ga0207683_10014760 | |||
| 1407 | Ga0207698_10127694 | |||
| 1408 | Ga0207698_10165360 | |||
| 1409 | Ga0207428_10000108 | |||
| 1410 | Ga0207428_10028039 | |||
| 1411 | Ga0207428_10066635 | |||
| 1412 | Ga0207428_10279485 | |||
| 1413 | Ga0207428_10317667 | |||
| 1414 | Ga0268266_10249719 | |||
| 1415 | Ga0268266_10528291 | |||
| 1416 | Ga0268264_10064761 | |||
| 1417 | Ga0268264_10067791 | |||
| 1418 | Ga0265337_1013734 | |||
| 1419 | Ga0265319_1006111 | |||
| 1420 | Ga0265334_10014826 | |||
| 1421 | Ga0265334_10020139 | |||
| 1422 | Ga0265318_10000691 | |||
| 1423 | Ga0265323_10013669 | |||
| 1424 | Ga0265322_10009294 | |||
| 1425 | Ga0265336_10055659 | |||
| 1426 | Ga0265338_10001048 | |||
| 1427 | Ga0265338_10007115 | |||
| 1428 | Ga0265338_10016447 | |||
| 1429 | Ga0265338_10022563 | |||
| 1430 | Ga0265338_10102538 | |||
| 1431 | Ga0265338_10177048 | |||
| 1432 | Ga0265324_10011053 | |||
| 1433 | Ga0265330_10017205 | |||
| 1434 | Ga0265330_10028366 | |||
| 1435 | Ga0265332_10019646 | |||
| 1436 | Ga0265320_10030136 | |||
| 1437 | Ga0265325_10000102 | |||
| 1438 | Ga0265325_10071667 | |||
| 1439 | Ga0265340_10009900 | |||
| 1440 | Ga0265339_10011172 | |||
| 1441 | Ga0265339_10011424 | |||
| 1442 | Ga0265331_10044392 | |||
| 1443 | Ga0265331_10081634 | |||
| 1444 | Ga0265327_10025194 | |||
| 1445 | Ga0265327_10045810 | |||
| 1446 | Ga0265316_10021633 | |||
| 1447 | Ga0265316_10026717 | |||
| 1448 | Ga0265313_10006148 | |||
| 1449 | Ga0265314_10005023 | |||
| 1450 | Ga0265314_10094884 | |||
| 1451 | Ga0316583_10014535 | |||
| 1452 | Ga0373959_0017193 | |||
| 1453 | Ga0373944_0045995 | |||
| 1454 | Ga0373951_0033237 | |||
| 1455 | Ga0373936_0040438 | |||
| 1456 | Ga0373941_0021219 | |||
| 1457 | Ga0373953_0106830 | |||
| 1458 | Ga0373956_0042005 | |||
| 1459 | Ga0373957_0048955 | |||
| 1460 | Ga0373960_0005206 | |||
| 1461 | Ga0373943_0001097 | |||
| 1462 | Ga0373943_0002704 | |||
| 1463 | Ga0373943_0042489 | |||
| 1464 | Ga0373946_0001645 | |||
| 1465 | Ga0373946_0021452 | |||
| 1466 | Ga0373955_0016364 | |||
| 1467 | Ga0373955_0118168 | |||
| 1468 | Ga0373931_0048671 | |||
| 1469 | Ga0373935_0043603 | |||
| 1470 | Ga0373927_0170406 | |||
| 1471 | Ga0373933_0077793 | |||
| 1472 | Ga0373947_0000635 | |||
| 1473 | Ga0373937_0003562 | |||
| 1474 | Ga0373937_0098658 | |||
| 1475 | Ga0373925_0001320 | |||
| 1476 | Ga0395899_0002355 | |||
| 1477 | Ga0395899_0042546 | |||
| 1478 | Ga0395900_0067531 | |||
| 1479 | Ga0395900_0101231 | |||
| 1480 | Ga0395900_0104024 | |||
| 1481 | Ga0395900_0181493 | |||
| 1482 | Ga0395900_0511431 | |||
| 1483 | Ga0395898_0018968 | |||
| 1484 | Ga0395898_0067856 | |||
| 1485 | Ga0395898_0088361 | |||
| 1486 | Ga0395898_0226796 | |||
| 1487 | Ga0395898_0243926 | |||
| 1488 | Ga0395905_0121213 | |||
| 1489 | Ga0395905_0180739 | |||
| 1490 | Ga0395905_0258211 | |||
| 1491 | Ga0395901_0054876 | |||
| 1492 | Ga0395901_0207256 | |||
| 1493 | Ga0395901_0386275 | |||
| 1494 | Ga0439439_0001010 | |||
| 1495 | Ga0439461_0002398 | |||
| 1496 | Ga0439461_0007625 | |||
| 1497 | Ga0439431_0003015 | |||
| 1498 | Ga0439441_006435 | |||
| 1499 | Ga0439442_001972 | |||
| 1500 | Ga0439445_0002247 | |||
| 1501 | Ga0439448_0030015 | |||
| 1502 | Ga0439454_006301 | |||
| 1503 | Ga0450920_002237 | |||
| 1504 | Ga0450888_004052 | |||
| 1505 | Ga0450898_008799 | |||
| 1506 | Ga0450910_003704 | |||
| 1507 | Ga0450910_007277 | |||
| 1508 | Ga0439446_0001224 | |||
| 1509 | Ga0466969_0004821 | |||
| 1510 | Ga0466972_0047393 | |||
| 1511 | Ga0466965_0003656 | |||
| 1512 | Ga0466965_0011754 | |||
| 1513 | Ga0466966_0003176 | |||
| 1514 | Ga0466961_0012817 | |||
| 1515 | Ga0466961_0017705 | |||
| 1516 | Ga0466961_0022246 | |||
| 1517 | Ga0466963_0002189 | |||
| 1518 | Ga0466963_0003641 | |||
| 1519 | Ga0466963_0008418 | |||
| 1520 | Ga0466963_0010262 | |||
| 1521 | Ga0466963_0012284 | |||
| 1522 | Ga0466963_0013063 | |||
| 1523 | Ga0466963_0016356 | |||
| 1524 | Ga0466963_0021819 | |||
| 1525 | Ga0466963_0030537 | |||
| 1526 | Ga0466963_0039820 | |||
| 1527 | Ga0466963_0068757 | |||
| 1528 | Ga0466963_0103608 | |||
| 1529 | Ga0466964_0018738 | |||
| 1530 | Ga0466964_0019203 | |||
| 1531 | Ga0466964_0039357 | |||
| 1532 | Ga0466964_0085159 | |||
| 1533 | Ga0466971_0000170 | |||
| 1534 | Ga0466971_0027006 | |||
| 1535 | Ga0466971_0034096 | |||
| 1536 | Ga0466968_0001006 | |||
| 1537 | Ga0466968_0074812 | |||
| 1538 | Ga0466970_0000806 | |||
| 1539 | Ga0466970_0015951 | |||
| 1540 | Ga0466970_0020042 | |||
| 1541 | Ga0466957_0003280 | |||
| 1542 | Ga0466957_0004865 | |||
| 1543 | Ga0466957_0009740 | |||
| 1544 | Ga0466957_0011646 | |||
| 1545 | Ga0466957_0021985 | |||
| 1546 | Ga0466957_0030148 | |||
| 1547 | Ga0466957_0063127 | |||
| 1548 | Ga0466960_0031765 | |||
| 1549 | Ga0466959_0000274 | |||
| 1550 | Ga0466959_0003637 | |||
| 1551 | Ga0466959_0005938 | |||
| 1552 | Ga0466959_0028480 | |||
| 1553 | Ga0466959_0166898 | |||
| 1554 | Ga0466958_0000300 | |||
| 1555 | Ga0466958_0001062 | |||
| 1556 | Ga0466958_0006904 | |||
| 1557 | Ga0466958_0017529 | |||
| 1558 | Ga0466958_0021115 | |||
| 1559 | Ga0466958_0022617 | |||
| 1560 | Ga0466958_0040385 | |||
| 1561 | Ga0466958_0068946 | |||
| 1562 | Ga0466967_0000828 | |||
| 1563 | Ga0466967_0002908 | |||
| 1564 | Ga0466967_0010698 | |||
| 1565 | Ga0466967_0012395 | |||
| 1566 | Ga0466967_0021803 | |||
| 1567 | Ga0466967_0027027 | |||
| 1568 | Ga0466967_0029636 | |||
| 1569 | Ga0466967_0030291 | |||
| 1570 | Ga0466967_0034791 | |||
| 1571 | Ga0466967_0105618 | |||
| 1572 | Ga0466967_0117557 | |||
| 1573 | Ga0466967_0137849 | |||
| 1574 | Ga0466967_0139067 | |||
| 1575 | Ga0466967_0157922 | |||
| 1576 | Ga0466967_0169647 | |||
| 1577 | Ga0466967_0207943 | |||
| 1578 | Ga0466967_0306144 | |||
| 1579 | Ga0466967_0390078 | |||
| 1580 | Ga0466967_0409860 | |||
| 1581 | Ga0495592_0014141 | |||
| 1582 | Ga0495592_0038050 | |||
| 1583 | Ga0495603_0053526 | |||
| 1584 | Ga0495603_0060393 | |||
| 1585 | Ga0495603_0089758 | |||
| 1586 | Ga0495629_0001816 | |||
| 1587 | Ga0495629_0082426 | |||
| 1588 | Ga0495641_0004541 | |||
| 1589 | Ga0495641_0007480 | |||
| 1590 | Ga0495641_0017039 | |||
| 1591 | Ga0495641_0032992 | |||
| 1592 | Ga0495641_0035967 | |||
| 1593 | Ga0495651_0000028 | |||
| 1594 | Ga0495651_0011734 | |||
| 1595 | Ga0495653_0000965 | |||
| 1596 | Ga0495653_0019134 | |||
| 1597 | Ga0495653_0023889 | |||
| 1598 | Ga0495653_0061020 | |||
| 1599 | Ga0495653_0123874 | |||
| 1600 | Ga0495653_0145747 | |||
| 1601 | Ga0495580_0042963 | |||
| 1602 | Ga0495582_0000276 | |||
| 1603 | Ga0495582_0012985 | |||
| 1604 | Ga0495582_0016268 | |||
| 1605 | Ga0495582_0031507 | |||
| 1606 | Ga0495582_0270329 | |||
| 1607 | Ga0495639_0000416 | |||
| 1608 | Ga0495639_0000630 | |||
| 1609 | Ga0495662_0001339 | |||
| 1610 | Ga0495662_0024242 | |||
| 1611 | Ga0495662_0083248 | |||
| 1612 | Ga0495664_0032023 | |||
| 1613 | Ga0495584_0125480 | |||
| 1614 | Ga0495594_0041053 | |||
| 1615 | Ga0495594_0172832 | |||
| 1616 | Ga0495607_0081915 | |||
| 1617 | Ga0495608_0008137 | |||
| 1618 | Ga0495608_0008892 | |||
| 1619 | Ga0495608_0100374 | |||
| 1620 | Ga0495608_0207262 | |||
| 1621 | Ga0495618_0012985 | |||
| 1622 | Ga0495618_0104083 | |||
| 1623 | Ga0495618_0144261 | |||
| 1624 | Ga0495628_0000069 | |||
| 1625 | Ga0495628_0041826 | |||
| 1626 | Ga0495630_0005233 | |||
| 1627 | Ga0495630_0015336 | |||
| 1628 | Ga0495630_0019923 | |||
| 1629 | Ga0495630_0228351 | |||
| 1630 | Ga0495630_0264057 | |||
| 1631 | Ga0495644_0010118 | |||
| 1632 | Ga0495666_0000145 | |||
| 1633 | Ga0495652_0010813 | |||
| 1634 | Ga0495652_0011205 | |||
| 1635 | Ga0495652_0130565 | |||
| 1636 | Ga0495652_0176769 | |||
| 1637 | Ga0495652_0241125 | |||
| 1638 | Ga0495665_0005590 | |||
| 1639 | Ga0495665_0086666 | |||
| 1640 | Ga0495665_0144742 | |||
| 1641 | Ga0495640_0049979 | |||
| 1642 | Ga0495640_0114844 | |||
| 1643 | Ga0495640_0153341 | |||
| 1644 | Ga0495587_0000062 | |||
| 1645 | Ga0495587_0155964 | |||
| 1646 | Ga0495645_0000418 | |||
| 1647 | Ga0495667_0006358 | |||
| 1648 | Ga0495667_0123792 | |||
| 1649 | Ga0495667_0133183 | |||
| 1650 | Ga0495656_0005449 | |||
| 1651 | Ga0495634_0024563 | |||
| 1652 | Ga0495634_0177880 | |||
| 1653 | Ga0495611_0025111 | |||
| 1654 | Ga0495635_0003672 | |||
| 1655 | Ga0495635_0009289 | |||
| 1656 | Ga0495635_0029747 | |||
| 1657 | Ga0495635_0040696 | |||
| 1658 | Ga0495635_0045955 | |||
| 1659 | Ga0495659_0017863 | |||
| 1660 | Ga0495657_0020111 | |||
| 1661 | Ga0495657_0045579 | |||
| 1662 | Ga0495657_0054159 | |||
| 1663 | Ga0495657_0163967 | |||
| 1664 | Ga0495599_0000542 | |||
| 1665 | Ga0495599_0234593 | |||
| 1666 | Ga0495623_0000435 | |||
| 1667 | Ga0495623_0219911 | |||
| 1668 | Ga0495646_0007673 | |||
| 1669 | Ga0495646_0023000 | |||
| 1670 | Ga0495646_0031340 | |||
| 1671 | Ga0495647_0000560 | |||
| 1672 | Ga0495647_0026163 | |||
| 1673 | Ga0495647_0078177 | |||
| 1674 | Ga0495658_0001373 | |||
| 1675 | Ga0495658_0003249 | |||
| 1676 | Ga0495658_0072704 | |||
| 1677 | Ga0495658_0109691 | |||
| 1678 | Ga0495613_0024193 | |||
| 1679 | Ga0495613_0041694 | |||
| 1680 | Ga0495613_0094944 | |||
| 1681 | Ga0495613_0129368 | |||
| 1682 | Ga0495624_0000753 | |||
| 1683 | Ga0495624_0028902 | |||
| 1684 | Ga0495670_0033252 | |||
| 1685 | Ga0495670_0037405 | |||
| 1686 | Ga0495600_0019857 | |||
| 1687 | Ga0495600_0023999 | |||
| 1688 | Ga0495660_0074975 | |||
| 1689 | Ga0495581_0000407 | |||
| 1690 | Ga0495581_0007334 | |||
| 1691 | Ga0495581_0025376 | |||
| 1692 | Ga0495604_0009317 | |||
| 1693 | Ga0495604_0028425 | |||
| 1694 | Ga0495604_0052634 | |||
| 1695 | Ga0495604_0054650 | |||
| 1696 | Ga0495604_0066588 | |||
| 1697 | Ga0495674_0031730 | |||
| 1698 | Ga0495674_0112853 | |||
| 1699 | Ga0495674_0167991 | |||
| 1700 | Ga0495676_0002534 | |||
| 1701 | Ga0495676_0029650 | |||
| 1702 | Ga0495676_0112417 | |||
| 1703 | Ga0495676_0184158 | |||
| 1704 | Ga0495676_0272111 | |||
| 1705 | Ga0495680_0004620 | |||
| 1706 | Ga0495680_0009043 | |||
| 1707 | Ga0495680_0016809 | |||
| 1708 | Ga0495680_0025875 | |||
| 1709 | Ga0495680_0032626 | |||
| 1710 | Ga0495680_0182791 | |||
| 1711 | Ga0495680_0219365 | |||
| 1712 | Ga0495675_0004323 | |||
| 1713 | Ga0495675_0252004 | |||
| 1714 | Ga0495685_043865 | |||
| 1715 | Ga0495684_0012597 | |||
| 1716 | Ga0495684_0013231 | |||
| 1717 | Ga0495684_0013780 | |||
| 1718 | Ga0495684_0022672 | |||
| 1719 | Ga0495593_0000807 | |||
| 1720 | Ga0495593_0021844 | |||
| 1721 | Ga0495593_0032247 | |||
| 1722 | Ga0495602_0005881 | |||
| 1723 | Ga0495602_0035846 | |||
| 1724 | Ga0495602_0318701 | |||
| 1725 | Ga0495614_0008651 | |||
| 1726 | Ga0495614_0031783 | |||
| 1727 | Ga0496100_0058160 | |||
| 1728 | Ga0496101_0034217 | |||
| 1729 | Ga0496101_0037263 | |||
| 1730 | Ga0496101_0054431 | |||
| 1731 | Ga0496101_0082868 | |||
| 1732 | Ga0496101_0126310 | |||
| 1733 | Ga0496101_0150233 | |||
| 1734 | Ga0496103_0066505 | |||
| 1735 | Ga0496103_0187516 | |||
| 1736 | Ga0496104_0002502 | |||
| 1737 | Ga0496104_0011326 | |||
| 1738 | Ga0496104_0014077 | |||
| 1739 | Ga0496104_0272129 | |||
| 1740 | Ga0496105_0025913 | |||
| 1741 | Ga0496105_0118367 | |||
| 1742 | Ga0496105_0122667 | |||
| 1743 | Ga0496106_0012693 | |||
| 1744 | Ga0496107_0011878 | |||
| 1745 | Ga0496107_0130825 | |||
| 1746 | Ga0496107_0166116 | |||
| 1747 | Ga0496107_0189405 | |||
| 1748 | Ga0496107_0214628 | |||
| 1749 | Ga0496107_0306741 | |||
| 1750 | Ga0496108_0012837 | |||
| 1751 | Ga0496108_0021721 | |||
| 1752 | Ga0496108_0047762 | |||
| 1753 | Ga0496108_0054644 | |||
| 1754 | Ga0496108_0121098 | |||
| 1755 | Ga0496108_0172184 | |||
| 1756 | Ga0496109_0009864 | |||
| 1757 | Ga0496109_0012739 | |||
| 1758 | Ga0496109_0028593 | |||
| 1759 | Ga0496109_0030645 | |||
| 1760 | Ga0496109_0049496 | |||
| 1761 | Ga0496109_0068013 | |||
| 1762 | Ga0496109_0094262 | |||
| 1763 | Ga0496109_0116337 | |||
| 1764 | Ga0496109_0213883 | |||
| 1765 | Ga0496109_0310045 | |||
| 1766 | Ga0496110_0014622 | |||
| 1767 | Ga0496110_0021211 | |||
| 1768 | Ga0496110_0063492 | |||
| 1769 | Ga0496110_0074625 | |||
| 1770 | Ga0496110_0255983 | |||
| 1771 | Ga0496110_0348488 | |||
| 1772 | Ga0496110_0506961 | |||
| 1773 | Ga0496111_0003615 | |||
| 1774 | Ga0496111_0003834 | |||
| 1775 | Ga0496111_0011695 | |||
| 1776 | Ga0496111_0058727 | |||
| 1777 | Ga0496111_0082017 | |||
| 1778 | Ga0496111_0095042 | |||
| 1779 | Ga0496111_0214743 | |||
| 1780 | Ga0496112_0000598 | |||
| 1781 | Ga0496112_0024171 | |||
| 1782 | Ga0496112_0042134 | |||
| 1783 | Ga0496112_0056022 | |||
| 1784 | Ga0496112_0208142 | |||
| 1785 | Ga0496112_0228515 | |||
| 1786 | Ga0496112_0553904 | |||
| 1787 | Ga0496113_0014459 | |||
| 1788 | Ga0496113_0330833 | |||
| 1789 | Ga0496114_0001985 | |||
| 1790 | Ga0496114_0002716 | |||
| 1791 | Ga0496114_0003682 | |||
| 1792 | Ga0496114_0015753 | |||
| 1793 | Ga0496114_0112125 | |||
| 1794 | Ga0496114_0158201 | |||
| 1795 | Ga0496114_0494644 | |||
| 1796 | Ga0496115_0003805 | |||
| 1797 | Ga0496115_0025452 | |||
| 1798 | Ga0496115_0075583 | |||
| 1799 | Ga0496115_0123645 | |||
| 1800 | Ga0496115_0123748 | |||
| 1801 | Ga0501031_0009175 | |||
| 1802 | Ga0501031_0039446 | |||
| 1803 | Ga0501032_0006986 | |||
| 1804 | Ga0501032_0024055 | |||
| 1805 | Ga0501033_0031758 | |||
| 1806 | Ga0501033_0131383 | |||
| 1807 | Ga0501034_0007715 | |||
| 1808 | Ga0501036_0002934 | |||
| 1809 | Ga0501036_0027279 | |||
| 1810 | Ga0501036_0037136 | |||
| 1811 | Ga0501036_0215304 | |||
| 1812 | Ga0501036_0294097 | |||
| 1813 | Ga0501037_0008319 | |||
| 1814 | Ga0501037_0030682 | |||
| 1815 | Ga0501037_0039891 | |||
| 1816 | Ga0501038_0032109 | |||
| 1817 | Ga0501038_0035346 | |||
| 1818 | Ga0501038_0036131 | |||
| 1819 | Ga0501038_0058938 | |||
| 1820 | Ga0501038_0080022 | |||
| 1821 | Ga0501039_0012109 | |||
| 1822 | Ga0501039_0013548 | |||
| 1823 | Ga0501039_0031955 | |||
| 1824 | Ga0501039_0140411 | |||
| 1825 | Ga0501039_0188829 | |||
| 1826 | Ga0501040_0003297 | |||
| 1827 | Ga0501040_0060661 | |||
| 1828 | Ga0501040_0068943 | |||
| 1829 | Ga0501041_0001889 | |||
| 1830 | Ga0501041_0024997 | |||
| 1831 | Ga0501041_0029975 | |||
| 1832 | Ga0501041_0094326 | |||
| 1833 | Ga0501042_0013766 | |||
| 1834 | Ga0501042_0033857 | |||
| 1835 | Ga0501042_0071633 | |||
| 1836 | Ga0501043_0014807 | |||
| 1837 | Ga0501043_0211654 | |||
| 1838 | Ga0501046_0004587 | |||
| 1839 | Ga0501046_0084140 | |||
| 1840 | Ga0501046_0098470 | |||
| 1841 | Ga0501067_0001274 | |||
| 1842 | Ga0501067_0024164 | |||
| 1843 | Ga0501067_0028554 | |||
| 1844 | Ga0501067_0125481 | |||
| 1845 | Ga0501068_0011505 | |||
| 1846 | Ga0501068_0022471 | |||
| 1847 | Ga0501068_0082830 | |||
| 1848 | Ga0501069_0076896 | |||
| 1849 | Ga0501070_0016126 | |||
| 1850 | Ga0501070_0037276 | |||
| 1851 | Ga0501070_0112052 | |||
| 1852 | Ga0501070_0161130 | |||
| 1853 | Ga0501070_0212642 | |||
| 1854 | Ga0501071_0004560 | |||
| 1855 | Ga0501071_0009228 | |||
| 1856 | Ga0501071_0019776 | |||
| 1857 | Ga0501071_0146912 | |||
| 1858 | Ga0501072_0022091 | |||
| 1859 | Ga0501072_0040065 | |||
| 1860 | Ga0501072_0067455 | |||
| 1861 | Ga0501072_0313609 | |||
| 1862 | Ga0501073_0098613 | |||
| 1863 | Ga0501073_0171651 | |||
| 1864 | Ga0501074_0018991 | |||
| 1865 | Ga0501074_0022796 | |||
| 1866 | Ga0501074_0075752 | |||
| 1867 | Ga0501074_0330898 | |||
| 1868 | Ga0501075_0014195 | |||
| 1869 | Ga0501075_0022744 | |||
| 1870 | Ga0501075_0045885 | |||
| 1871 | Ga0501075_0071062 | |||
| 1872 | Ga0501075_0169890 | |||
| 1873 | Ga0501076_0002712 | |||
| 1874 | Ga0501076_0016448 | |||
| 1875 | Ga0501076_0019374 | |||
| 1876 | Ga0501076_0019639 | |||
| 1877 | Ga0501076_0152737 | |||
| 1878 | Ga0501076_0345489 | |||
| 1879 | Ga0501077_0000736 | |||
| 1880 | Ga0501077_0019935 | |||
| 1881 | Ga0501079_0003106 | |||
| 1882 | Ga0501079_0014599 | |||
| 1883 | Ga0501079_0023191 | |||
| 1884 | Ga0501079_0082272 | |||
| 1885 | Ga0501079_0151086 | |||
| 1886 | Ga0501079_0240613 | |||
| 1887 | Ga0501080_0002078 | |||
| 1888 | Ga0501080_0115759 | |||
| 1889 | Ga0501080_0217168 | |||
| 1890 | Ga0501081_0005825 | |||
| 1891 | Ga0501081_0035147 | |||
| 1892 | Ga0501081_0097441 | |||
| 1893 | Ga0501083_0006162 | |||
| 1894 | Ga0501083_0045654 | |||
| 1895 | Ga0501083_0117028 | |||
| 1896 | Ga0501035_0044278 | |||
| 1897 | Ga0501035_0242551 | |||
| 1898 | Ga0501035_0256483 | |||
| 1899 | Ga0501044_0055769 | |||
| 1900 | Ga0501045_0021550 | |||
| 1901 | Ga0501045_0029191 | |||
| 1902 | Ga0501045_0034207 | |||
| 1903 | nmdc:mga00v17_199616_c1 | |||
| 1904 | nmdc:mga0yw44_124969_c1 | |||
| 1905 | nmdc:mga06z11_133121_c1 | |||
| 1906 | nmdc:mga05p37_146671_c1 | |||
| 1907 | nmdc:mga05p37_42560_c1 | |||
| 1908 | nmdc:mga09592_119005_c1 | |||
| 1909 | nmdc:mga09592_211435_c1 | |||
| 1910 | nmdc:mga09592_52471_c1 | |||
| 1911 | nmdc:mga06r32_119323_c1 | |||
| 1912 | nmdc:mga06r32_328538_c1 | |||
| 1913 | nmdc:mga08y16_149410_c1 | |||
| 1914 | nmdc:mga08y16_28150_c1 | |||
| 1915 | nmdc:mga08y16_33389_c1 | |||
| 1916 | nmdc:mga08y16_40104_c1 | |||
| 1917 | nmdc:mga0n895_151111_c1 | |||
| 1918 | nmdc:mga0n895_37865_c1 | |||
| 1919 | nmdc:mga0n895_469_c1 | |||
| 1920 | nmdc:mga0a205_302572_c1 | |||
| 1921 | nmdc:mga0a205_31297_c1 | |||
| 1922 | nmdc:mga0a205_61096_c1 | |||
| 1923 | nmdc:mga0a205_66960_c1 | |||
| 1924 | Ga0495601_0004004 | |||
| 1925 | Ga0495601_0027217 | |||
| 1926 | Ga0495601_0070843 | |||
| 1927 | Ga0495601_0142175 | |||
| 1928 | Ga0495601_0173000 | |||
| 1929 | Ga0495612_0002367 | |||
| 1930 | Ga0495612_0015793 | |||
| 1931 | Ga0495595_0013724 | |||
| 1932 | Ga0495595_0019382 | |||
| 1933 | Ga0495595_0025782 | |||
| 1934 | Ga0495595_0028463 | |||
| 1935 | Ga0495595_0103084 | |||
| 1936 | Ga0495619_0000123 | |||
| 1937 | Ga0495619_0001783 | |||
| 1938 | Ga0495619_0005855 | |||
| 1939 | Ga0495619_0012550 | |||
| 1940 | Ga0495619_0027860 | |||
| 1941 | Ga0495619_0225819 | |||
| 1942 | Ga0500566_0097207 | |||
| 1943 | Ga0501084_0054541 | |||
| 1944 | Ga0501084_0072005 | |||
| 1945 | Ga0501084_0072532 | |||
| 1946 | Ga0501084_0130061 | |||
| 1947 | Ga0501082_0022866 | |||
| 1948 | Ga0501082_0030879 | |||
| 1949 | Ga0501082_0076561 | |||
| 1950 | Ga0501082_0339777 | |||
| 1951 | Ga0466962_0000436 | |||
| 1952 | Ga0466962_0011984 | |||
| 1953 | Ga0466962_0071300 | |||
| 1954 | Ga0466962_0099087 | |||
| 1955 | Ga0530510_0022085 | |||
| 1956 | Ga0530510_0079967 | |||
| 1957 | Ga0530510_0082074 | |||
| 1958 | Ga0530510_0086446 | |||
| 1959 | Ga0530510_0088037 | |||
| 1960 | Ga0530510_0089901 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9624 | 10 | 325 |
| 4x9o-assembly1.cif.gz_B | beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate | 0.9579 | 9 | 327 |
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9563 | 10 | 325 |
| 1zow-assembly1.cif.gz_A | crystal structure of s. aureus fabh, beta-ketoacyl carrier protein synthase iii | 0.9552 | 9 | 326 |
| 4x9o-assembly1.cif.gz_A | beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate | 0.9551 | 9 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zowB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9794 | 9 | 178 | 3.40.47.10 |
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9767 | 9 | 176 | 3.40.47.10 |
| 3il4B01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9688 | 9 | 176 | 3.40.47.10 |
| 2x3eB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9623 | 9 | 176 | 3.40.47.10 |
| 3h77A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.962 | 8 | 176 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1FU58-F1-model_v4 | deleted | 0.9854 | 10 | 176 |
|
| AF-A0A800M9R9-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9841 | 11 | 159 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A351J771-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9837 | 11 | 160 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A535AJN1-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9834 | 7 | 166 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A662JUN4-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9821 | 7 | 177 |
GO:0004315
GO:0006633 GO:0044550 |