F487332

General Info

Members Datasets Scaffolds Average Seq Length
979 263 1958 61

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10074673|Ga0207683_100746732
Length 59
Sequence MADRLRLEDCVNDVCPWSGEPVSADSLTLYKGEVVCNTGCRDKFDAASRAFDAAIKGKE

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
206 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
207 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
253 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.72
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 3.17
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10074673 3300026121 Bacteria 3000
2 CNBas_1014164 3300000531 Bacteria 508
3 JGI24736J21556_1000511 3300001904 Bacteria 7246
4 JGI24736J21556_1070596 3300001904 Bacteria 545
5 JGI24741J21665_1000332 3300001915 Bacteria 14089
6 JGI24740J21852_10007157 3300001979 Bacteria 4555
7 JGI24737J22298_10008394 3300001990 Bacteria 3459
8 JGI24737J22298_10068087 3300001990 Bacteria 1065
9 JGI24737J22298_10199592 3300001990 Bacteria 590
10 JGI24735J21928_10207666 3300002067 Bacteria 568
11 JGI24735J21928_10214264 3300002067 Bacteria 559
12 JGI24735J21928_10218798 3300002067 Bacteria 553
13 JGI24034J26672_10032666 3300002239 Bacteria 853
14 JGI24034J26672_10054980 3300002239 Bacteria 690
15 JGI24751J29686_10095965 3300002459 Bacteria 618
16 rootH1_10001525 3300003316 Bacteria 2658
17 Ga0058862_12611823 3300004803 Bacteria 766
18 Ga0065712_10207738 3300005290 Bacteria 1072
19 Ga0065712_10458315 3300005290 Bacteria 680
20 Ga0065715_10092131 3300005293 Bacteria 5314
21 Ga0065715_10131708 3300005293 Bacteria 2003
22 Ga0070658_10030850 3300005327 Bacteria 4306
23 Ga0070658_10037846 3300005327 Bacteria 3890
24 Ga0070658_10063302 3300005327 Bacteria 3015
25 Ga0070658_10091055 3300005327 Bacteria 2513
26 Ga0070658_10122268 3300005327 Bacteria 2164
27 Ga0070658_10258034 3300005327 Bacteria 1480
28 Ga0070658_10675067 3300005327 Bacteria 897
29 Ga0070658_10756552 3300005327 Bacteria 844
30 Ga0070658_11401586 3300005327 Bacteria 606
31 Ga0070658_11693121 3300005327 Bacteria 547
32 Ga0070676_10059833 3300005328 Bacteria 2260
33 Ga0070676_10366775 3300005328 Bacteria 994
34 Ga0070676_10643588 3300005328 Bacteria 769
35 Ga0070683_100033170 3300005329 Bacteria 4706
36 Ga0070683_100052133 3300005329 Bacteria 3789
37 Ga0070683_100488632 3300005329 Bacteria 1176
38 Ga0070683_100574053 3300005329 Bacteria 1079
39 Ga0070683_101234021 3300005329 Bacteria 718
40 Ga0070683_101492593 3300005329 Bacteria 650
41 Ga0070690_100006147 3300005330 Bacteria 6799
42 Ga0070690_100007602 3300005330 Bacteria 6206
43 Ga0070670_100000517 3300005331 Bacteria 30886
44 Ga0070670_100522385 3300005331 Bacteria 1057
45 Ga0070670_101064692 3300005331 Bacteria 737
46 Ga0070670_101436670 3300005331 Bacteria 633
47 Ga0070677_10096078 3300005333 Bacteria 1298
48 Ga0070677_10572081 3300005333 Bacteria 622
49 Ga0068869_100930651 3300005334 Bacteria 753
50 Ga0070666_10000689 3300005335 Bacteria 20498
51 Ga0070666_10216911 3300005335 Bacteria 1349
52 Ga0070666_10299718 3300005335 Bacteria 1144
53 Ga0070666_11319299 3300005335 Bacteria 538
54 Ga0070680_100042647 3300005336 Bacteria 3682
55 Ga0070680_100421661 3300005336 Bacteria 1138
56 Ga0070680_101104077 3300005336 Bacteria 685
57 Ga0070682_100013063 3300005337 Bacteria 4769
58 Ga0070682_100083220 3300005337 Bacteria 2076
59 Ga0068868_100001006 3300005338 Bacteria 19279
60 Ga0068868_100019614 3300005338 Bacteria 5068
61 Ga0068868_100920576 3300005338 Bacteria 796
62 Ga0070660_100050726 3300005339 Bacteria 3193
63 Ga0070660_100055074 3300005339 Bacteria 3073
64 Ga0070660_100067349 3300005339 Bacteria 2789
65 Ga0070660_100107892 3300005339 Bacteria 2212
66 Ga0070660_100132641 3300005339 Bacteria 1994
67 Ga0070660_100331448 3300005339 Bacteria 1251
68 Ga0070660_100350032 3300005339 Bacteria 1216
69 Ga0070660_100429327 3300005339 Bacteria 1095
70 Ga0070660_100755015 3300005339 Bacteria 817
71 Ga0070660_101842351 3300005339 Bacteria 516
72 Ga0070687_100110030 3300005343 Bacteria 1557
73 Ga0070661_100022271 3300005344 Bacteria 4536
74 Ga0070661_100023696 3300005344 Bacteria 4402
75 Ga0070661_100039730 3300005344 Bacteria 3429
76 Ga0070661_100056091 3300005344 Bacteria 2885
77 Ga0070661_100062025 3300005344 Bacteria 2744
78 Ga0070661_100142237 3300005344 Bacteria 1809
79 Ga0070661_100155080 3300005344 Bacteria 1733
80 Ga0070661_100178990 3300005344 Bacteria 1612
81 Ga0070661_100733758 3300005344 Bacteria 807
82 Ga0070661_101139474 3300005344 Bacteria 651
83 Ga0070692_10075677 3300005345 Bacteria 1803
84 Ga0070692_10116312 3300005345 Bacteria 1485
85 Ga0070692_10500180 3300005345 Bacteria 787
86 Ga0070692_10794210 3300005345 Bacteria 646
87 Ga0070692_10916659 3300005345 Bacteria 607
88 Ga0070668_100224488 3300005347 Bacteria 1551
89 Ga0070668_100670495 3300005347 Bacteria 912
90 Ga0070668_100706228 3300005347 Bacteria 890
91 Ga0070668_101373614 3300005347 Bacteria 643
92 Ga0070669_100352759 3300005353 Bacteria 1195
93 Ga0070669_100885775 3300005353 Bacteria 762
94 Ga0070669_101216953 3300005353 Bacteria 651
95 Ga0070669_101330091 3300005353 Bacteria 623
96 Ga0070669_101922786 3300005353 Bacteria 517
97 Ga0070675_100002493 3300005354 Bacteria 13777
98 Ga0070675_100366902 3300005354 Bacteria 1279
99 Ga0070671_100001205 3300005355 Bacteria 19357
100 Ga0070671_100033554 3300005355 Bacteria 4246
101 Ga0070671_100052674 3300005355 Bacteria 3383
102 Ga0070671_100097521 3300005355 Bacteria 2465
103 Ga0070671_100103784 3300005355 Bacteria 2385
104 Ga0070671_101525775 3300005355 Bacteria 591
105 Ga0070674_100017466 3300005356 Bacteria 4515
106 Ga0070674_100029872 3300005356 Bacteria 3597
107 Ga0070674_100124076 3300005356 Bacteria 1916
108 Ga0070674_100287402 3300005356 Bacteria 1306
109 Ga0070673_100008046 3300005364 Bacteria 6986
110 Ga0070673_100047431 3300005364 Bacteria 3343
111 Ga0070673_101910568 3300005364 Bacteria 563
112 Ga0070659_100032952 3300005366 Bacteria 4023
113 Ga0070659_100034648 3300005366 Bacteria 3927
114 Ga0070659_100082181 3300005366 Bacteria 2574
115 Ga0070659_100116006 3300005366 Bacteria 2165
116 Ga0070659_100275567 3300005366 Bacteria 1399
117 Ga0070659_100320500 3300005366 Bacteria 1296
118 Ga0070659_101974710 3300005366 Bacteria 524
119 Ga0070667_100001851 3300005367 Bacteria 18782
120 Ga0070667_100025141 3300005367 Bacteria 4950
121 Ga0070667_100029582 3300005367 Bacteria 4566
122 Ga0070667_100038765 3300005367 Bacteria 3995
123 Ga0070709_10967358 3300005434 Bacteria 676
124 Ga0070714_100078814 3300005435 Bacteria 2864
125 Ga0070714_100438194 3300005435 Bacteria 1240
126 Ga0070714_100963314 3300005435 Bacteria 830
127 Ga0070713_100361071 3300005436 Bacteria 1349
128 Ga0070663_100015686 3300005455 Bacteria 4899
129 Ga0070663_100045970 3300005455 Bacteria 3086
130 Ga0070663_100083553 3300005455 Bacteria 2352
131 Ga0070663_100196658 3300005455 Bacteria 1571
132 Ga0070663_100351561 3300005455 Bacteria 1193
133 Ga0070663_100578790 3300005455 Bacteria 942
134 Ga0070663_100614694 3300005455 Bacteria 915
135 Ga0070663_101163026 3300005455 Bacteria 677
136 Ga0070678_100082868 3300005456 Bacteria 2436
137 Ga0070678_100103312 3300005456 Bacteria 2214
138 Ga0070678_100314371 3300005456 Bacteria 1335
139 Ga0070662_100001007 3300005457 Bacteria 17226
140 Ga0070662_100058069 3300005457 Bacteria 2814
141 Ga0070662_100090788 3300005457 Bacteria 2293
142 Ga0070662_100471978 3300005457 Bacteria 1044
143 Ga0070662_100525152 3300005457 Bacteria 989
144 Ga0070662_100583698 3300005457 Bacteria 939
145 Ga0070662_101209369 3300005457 Bacteria 650
146 Ga0070662_102000824 3300005457 Bacteria 501
147 Ga0070681_10194347 3300005458 Bacteria 1948
148 Ga0070681_10337532 3300005458 Bacteria 1416
149 Ga0070681_10378392 3300005458 Bacteria 1326
150 Ga0070681_10581511 3300005458 Bacteria 1034
151 Ga0070681_10595667 3300005458 Bacteria 1020
152 Ga0070681_10669937 3300005458 Bacteria 953
153 Ga0070681_10764494 3300005458 Bacteria 883
154 Ga0068867_100012769 3300005459 Bacteria 5941
155 Ga0070685_11071934 3300005466 Bacteria 608
156 Ga0070685_11601877 3300005466 Bacteria 504
157 Ga0074259_10468590 3300005507 Bacteria 525
158 Ga0070679_100077847 3300005530 Bacteria 3305
159 Ga0070679_100437543 3300005530 Bacteria 1253
160 Ga0070679_100833011 3300005530 Bacteria 866
161 Ga0070679_101384656 3300005530 Bacteria 649
162 Ga0070679_101682034 3300005530 Bacteria 582
163 Ga0070684_100042751 3300005535 Bacteria 3913
164 Ga0070684_100161651 3300005535 Bacteria 2032
165 Ga0070684_101066794 3300005535 Bacteria 759
166 Ga0070684_101249706 3300005535 Bacteria 699
167 Ga0068853_100084591 3300005539 Bacteria 2780
168 Ga0068853_100397208 3300005539 Bacteria 1290
169 Ga0068853_100411191 3300005539 Bacteria 1268
170 Ga0068853_100958493 3300005539 Bacteria 823
171 Ga0068853_101910358 3300005539 Bacteria 576
172 Ga0068853_102256556 3300005539 Bacteria 527
173 Ga0070672_100026944 3300005543 Bacteria 4284
174 Ga0070672_100198610 3300005543 Bacteria 1677
175 Ga0070672_100453528 3300005543 Bacteria 1105
176 Ga0070672_100682745 3300005543 Bacteria 898
177 Ga0070672_101222131 3300005543 Bacteria 670
178 Ga0070672_101555966 3300005543 Bacteria 593
179 Ga0070686_100637346 3300005544 Bacteria 844
180 Ga0070686_101045620 3300005544 Bacteria 672
181 Ga0070696_100205483 3300005546 Bacteria 1472
182 Ga0070693_100340389 3300005547 Bacteria 1024
183 Ga0070693_100454319 3300005547 Bacteria 900
184 Ga0070693_100456722 3300005547 Bacteria 898
185 Ga0070665_100709925 3300005548 Bacteria 1019
186 Ga0068855_100062897 3300005563 Bacteria 4332
187 Ga0068855_100099272 3300005563 Bacteria 3354
188 Ga0068855_100166726 3300005563 Bacteria 2496
189 Ga0068855_100417081 3300005563 Bacteria 1469
190 Ga0068855_100679474 3300005563 Bacteria 1103
191 Ga0068855_101032033 3300005563 Bacteria 863
192 Ga0068855_101374996 3300005563 Bacteria 728
193 Ga0068855_102077792 3300005563 Bacteria 572
194 Ga0068855_102314275 3300005563 Bacteria 537
195 Ga0068855_102388310 3300005563 Bacteria 528
196 Ga0070664_100011866 3300005564 Bacteria 7072
197 Ga0070664_100071792 3300005564 Bacteria 2967
198 Ga0070664_100280691 3300005564 Bacteria 1502
199 Ga0070664_100387342 3300005564 Bacteria 1277
200 Ga0070664_101033767 3300005564 Bacteria 773
201 Ga0070664_101052762 3300005564 Bacteria 765
202 Ga0070664_101552865 3300005564 Bacteria 627
203 Ga0070664_101825545 3300005564 Bacteria 577
204 Ga0070664_101870017 3300005564 Bacteria 569
205 Ga0068857_100022900 3300005577 Bacteria 5496
206 Ga0068857_100223766 3300005577 Bacteria 1719
207 Ga0068857_101026177 3300005577 Bacteria 794
208 Ga0068854_100004571 3300005578 Bacteria 8723
209 Ga0068854_100067648 3300005578 Bacteria 2603
210 Ga0068854_100178617 3300005578 Bacteria 1657
211 Ga0068854_100562858 3300005578 Bacteria 968
212 Ga0068854_100638647 3300005578 Bacteria 913
213 Ga0068854_100697969 3300005578 Bacteria 876
214 Ga0068854_101588878 3300005578 Bacteria 596
215 Ga0068854_101708405 3300005578 Bacteria 575
216 Ga0068856_100017948 3300005614 Bacteria 6860
217 Ga0068856_100030169 3300005614 Bacteria 5300
218 Ga0068856_100053171 3300005614 Bacteria 3993
219 Ga0068856_100252187 3300005614 Bacteria 1780
220 Ga0068856_100273755 3300005614 Bacteria 1704
221 Ga0068856_100357345 3300005614 Bacteria 1479
222 Ga0068856_100528007 3300005614 Bacteria 1201
223 Ga0068856_100532919 3300005614 Bacteria 1195
224 Ga0068856_100560628 3300005614 Bacteria 1164
225 Ga0068856_100795371 3300005614 Bacteria 965
226 Ga0068856_101255178 3300005614 Bacteria 757
227 Ga0068856_101632458 3300005614 Bacteria 657
228 Ga0070702_101451017 3300005615 Bacteria 563
229 Ga0068852_100005313 3300005616 Bacteria 9195
230 Ga0068852_100008862 3300005616 Bacteria 7444
231 Ga0068852_100014694 3300005616 Bacteria 6038
232 Ga0068852_100122444 3300005616 Bacteria 2384
233 Ga0068852_100151187 3300005616 Bacteria 2159
234 Ga0068852_100173205 3300005616 Bacteria 2024
235 Ga0068852_100215145 3300005616 Bacteria 1825
236 Ga0068852_100286155 3300005616 Bacteria 1591
237 Ga0068852_100316920 3300005616 Bacteria 1513
238 Ga0068852_100375597 3300005616 Bacteria 1393
239 Ga0068852_100503382 3300005616 Bacteria 1206
240 Ga0068852_101225486 3300005616 Bacteria 772
241 Ga0068852_101322089 3300005616 Bacteria 743
242 Ga0068852_102094380 3300005616 Bacteria 588
243 Ga0068852_102240563 3300005616 Bacteria 568
244 Ga0068859_100092804 3300005617 Bacteria 3070
245 Ga0068859_100122399 3300005617 Bacteria 2669
246 Ga0068859_100216351 3300005617 Bacteria 2003
247 Ga0068864_100000078 3300005618 Bacteria 103622
248 Ga0068864_100073572 3300005618 Bacteria 2980
249 Ga0068864_100099314 3300005618 Bacteria 2578
250 Ga0068864_100123001 3300005618 Bacteria 2322
251 Ga0068864_100494560 3300005618 Bacteria 1176
252 Ga0068866_10646105 3300005718 Bacteria 720
253 Ga0068861_101100565 3300005719 Bacteria 764
254 Ga0068851_10046902 3300005834 Bacteria 2186
255 Ga0068851_10189467 3300005834 Bacteria 1143
256 Ga0068851_10577935 3300005834 Bacteria 682
257 Ga0068851_10579996 3300005834 Bacteria 680
258 Ga0068851_10883966 3300005834 Bacteria 559
259 Ga0068870_10336661 3300005840 Bacteria 964
260 Ga0068863_100000882 3300005841 Bacteria 30167
261 Ga0068863_100003860 3300005841 Bacteria 14823
262 Ga0068863_100055222 3300005841 Bacteria 3761
263 Ga0068863_100728530 3300005841 Bacteria 987
264 Ga0068863_101849518 3300005841 Bacteria 614
265 Ga0068858_100002977 3300005842 Bacteria 17000
266 Ga0068858_100146150 3300005842 Bacteria 2220
267 Ga0068858_100268683 3300005842 Bacteria 1622
268 Ga0068860_100044105 3300005843 Bacteria 4251
269 Ga0068860_100290793 3300005843 Bacteria 1599
270 Ga0068860_102089211 3300005843 Bacteria 588
271 Ga0068862_100123090 3300005844 Bacteria 2288
272 Ga0068862_100859518 3300005844 Bacteria 889
273 Ga0081539_10039955 3300005985 Bacteria 2761
274 Ga0097621_100006668 3300006237 Bacteria 8204
275 Ga0068865_100032587 3300006881 Bacteria 3482
276 Ga0068865_100400904 3300006881 Bacteria 1124
277 Ga0068865_101700701 3300006881 Bacteria 569
278 Ga0097620_100092808 3300006931 Bacteria 3070
279 Ga0097620_100122393 3300006931 Bacteria 2669
280 Ga0097620_100216352 3300006931 Bacteria 2003
281 Ga0105240_10073834 3300009093 Bacteria 4211
282 Ga0105240_11117749 3300009093 Bacteria 838
283 Ga0105240_11286289 3300009093 Bacteria 772
284 Ga0105240_11290525 3300009093 Bacteria 770
285 Ga0105240_12140769 3300009093 Bacteria 580
286 Ga0105245_10015587 3300009098 Bacteria 6628
287 Ga0105245_10165956 3300009098 Bacteria 2099
288 Ga0105245_10959756 3300009098 Bacteria 898
289 Ga0105247_10119681 3300009101 Bacteria 1705
290 Ga0105247_10661799 3300009101 Bacteria 781
291 Ga0105243_10668607 3300009148 Bacteria 1009
292 Ga0105243_11417304 3300009148 Bacteria 716
293 Ga0105242_10041698 3300009176 Bacteria 3703
294 Ga0105242_12175500 3300009176 Bacteria 599
295 Ga0105248_10000413 3300009177 Bacteria 49136
296 Ga0105248_10001367 3300009177 Bacteria 27254
297 Ga0105248_10110274 3300009177 Bacteria 3103
298 Ga0105248_10522838 3300009177 Bacteria 1338
299 Ga0105237_12307712 3300009545 Bacteria 548
300 Ga0105238_10035588 3300009551 Bacteria 5061
301 Ga0105249_10052009 3300009553 Bacteria 3739
302 Ga0105249_12007885 3300009553 Bacteria 651
303 Ga0105032_106692 3300009979 Bacteria 961
304 Ga0105239_10872246 3300010375 Bacteria 1032
305 Ga0105239_11302119 3300010375 Bacteria 838
306 Ga0157319_1031856 3300012497 Bacteria 574
307 Ga0157373_10019925 3300013100 Bacteria 4879
308 Ga0157373_10113356 3300013100 Bacteria 1905
309 Ga0157373_10130807 3300013100 Bacteria 1765
310 Ga0157373_10228659 3300013100 Bacteria 1313
311 Ga0157373_10290875 3300013100 Bacteria 1159
312 Ga0157373_10323863 3300013100 Bacteria 1097
313 Ga0157373_10476106 3300013100 Bacteria 900
314 Ga0157373_11490641 3300013100 Bacteria 516
315 Ga0157371_10006674 3300013102 Bacteria 9441
316 Ga0157371_10014871 3300013102 Bacteria 5857
317 Ga0157371_10073654 3300013102 Bacteria 2419
318 Ga0157371_10108303 3300013102 Bacteria 1972
319 Ga0157371_10169987 3300013102 Bacteria 1558
320 Ga0157371_10179477 3300013102 Bacteria 1514
321 Ga0157371_10216730 3300013102 Bacteria 1374
322 Ga0157371_10399438 3300013102 Bacteria 1006
323 Ga0157371_10492610 3300013102 Bacteria 904
324 Ga0157371_11642373 3300013102 Bacteria 504
325 Ga0157370_10001258 3300013104 Bacteria 31653
326 Ga0157370_10018005 3300013104 Bacteria 7110
327 Ga0157370_10336512 3300013104 Bacteria 1391
328 Ga0157370_10461993 3300013104 Bacteria 1167
329 Ga0157370_10539541 3300013104 Bacteria 1070
330 Ga0157370_10818132 3300013104 Bacteria 847
331 Ga0157370_10897749 3300013104 Bacteria 804
332 Ga0157369_10002111 3300013105 Bacteria 23970
333 Ga0157369_10025444 3300013105 Bacteria 6572
334 Ga0157369_10030510 3300013105 Bacteria 5946
335 Ga0157369_10049218 3300013105 Bacteria 4570
336 Ga0157369_10068579 3300013105 Bacteria 3811
337 Ga0157369_10159994 3300013105 Bacteria 2377
338 Ga0157369_10390290 3300013105 Bacteria 1444
339 Ga0157369_10533824 3300013105 Bacteria 1213
340 Ga0157369_10615173 3300013105 Bacteria 1121
341 Ga0157369_11892535 3300013105 Bacteria 606
342 Ga0157369_11916126 3300013105 Bacteria 602
343 Ga0157369_12016411 3300013105 Bacteria 585
344 Ga0157369_12063192 3300013105 Bacteria 578
345 Ga0157369_12095141 3300013105 Bacteria 574
346 Ga0157369_12396625 3300013105 Bacteria 535
347 Ga0157369_12634449 3300013105 Bacteria 508
348 Ga0157374_10457554 3300013296 Bacteria 1278
349 Ga0157374_10698822 3300013296 Bacteria 1027
350 Ga0157378_10050293 3300013297 Bacteria 3709
351 Ga0157378_10157837 3300013297 Bacteria 2119
352 Ga0157378_10245047 3300013297 Bacteria 1714
353 Ga0163162_10250362 3300013306 Bacteria 1904
354 Ga0163162_11253969 3300013306 Bacteria 842
355 Ga0163162_11661680 3300013306 Bacteria 729
356 Ga0163162_11974669 3300013306 Bacteria 668
357 Ga0157372_10223700 3300013307 Bacteria 2182
358 Ga0157372_10312769 3300013307 Bacteria 1828
359 Ga0157372_11123959 3300013307 Bacteria 909
360 Ga0157372_11774091 3300013307 Bacteria 710
361 Ga0157375_10019033 3300013308 Bacteria 6234
362 Ga0157375_10052322 3300013308 Bacteria 4014
363 Ga0157375_10179664 3300013308 Bacteria 2267
364 Ga0157375_12534504 3300013308 Bacteria 612
365 Ga0163163_10000355 3300014325 Bacteria 44183
366 Ga0163163_10093032 3300014325 Bacteria 3031
367 Ga0163163_10341668 3300014325 Bacteria 1552
368 Ga0157380_11555126 3300014326 Bacteria 716
369 Ga0157379_10027693 3300014968 Bacteria 5046
370 Ga0157379_10138263 3300014968 Bacteria 2196
371 Ga0157376_10123750 3300014969 Bacteria 2296
372 Ga0163161_10246386 3300017792 Bacteria 1391
373 Ga0163161_10734726 3300017792 Bacteria 824
374 Ga0206355_1136578 3300020076 Bacteria 521
375 Ga0206353_10511543 3300020082 Bacteria 1714
376 Ga0213875_10608710 3300021388 Bacteria 528
377 Ga0224712_10013622 3300022467 Bacteria 2595
378 Ga0207656_10031575 3300025321 Bacteria 2195
379 Ga0207656_10291149 3300025321 Bacteria 807
380 Ga0207656_10603873 3300025321 Bacteria 560
381 Ga0207682_10068919 3300025893 Bacteria 1495
382 Ga0207642_10171029 3300025899 Bacteria 1176
383 Ga0207710_10093860 3300025900 Bacteria 1408
384 Ga0207688_10132448 3300025901 Bacteria 1462
385 Ga0207688_10452067 3300025901 Bacteria 801
386 Ga0207680_10000377 3300025903 Bacteria 21333
387 Ga0207680_10034537 3300025903 Bacteria 2894
388 Ga0207680_10776829 3300025903 Bacteria 687
389 Ga0207647_10023796 3300025904 Bacteria 4047
390 Ga0207647_10026492 3300025904 Bacteria 3793
391 Ga0207645_10122665 3300025907 Bacteria 1687
392 Ga0207645_10160086 3300025907 Bacteria 1472
393 Ga0207645_10942732 3300025907 Bacteria 586
394 Ga0207643_10195440 3300025908 Bacteria 1230
395 Ga0207705_10000320 3300025909 Bacteria 43763
396 Ga0207705_10001992 3300025909 Bacteria 15882
397 Ga0207705_10017634 3300025909 Bacteria 5110
398 Ga0207705_10024172 3300025909 Bacteria 4336
399 Ga0207705_10086633 3300025909 Bacteria 2289
400 Ga0207705_10088443 3300025909 Bacteria 2266
401 Ga0207705_10156983 3300025909 Bacteria 1707
402 Ga0207705_10160165 3300025909 Bacteria 1690
403 Ga0207705_10436295 3300025909 Bacteria 1015
404 Ga0207705_10479096 3300025909 Bacteria 966
405 Ga0207705_10553405 3300025909 Bacteria 894
406 Ga0207705_11208863 3300025909 Bacteria 580
407 Ga0207705_11432211 3300025909 Bacteria 525
408 Ga0207705_11487147 3300025909 Bacteria 513
409 Ga0207654_10932223 3300025911 Bacteria 630
410 Ga0207707_10050007 3300025912 Bacteria 3642
411 Ga0207707_10057432 3300025912 Bacteria 3387
412 Ga0207707_10080709 3300025912 Bacteria 2840
413 Ga0207707_10209426 3300025912 Bacteria 1699
414 Ga0207707_10421038 3300025912 Bacteria 1145
415 Ga0207707_10847219 3300025912 Bacteria 759
416 Ga0207695_10006489 3300025913 Bacteria 15170
417 Ga0207695_10764251 3300025913 Bacteria 847
418 Ga0207660_10000433 3300025917 Bacteria 27598
419 Ga0207660_10023209 3300025917 Bacteria 4188
420 Ga0207660_10036365 3300025917 Bacteria 3423
421 Ga0207660_10309009 3300025917 Bacteria 1260
422 Ga0207662_10107736 3300025918 Bacteria 1734
423 Ga0207662_10684489 3300025918 Bacteria 718
424 Ga0207657_10002110 3300025919 Bacteria 21508
425 Ga0207657_10014944 3300025919 Bacteria 7544
426 Ga0207657_10062443 3300025919 Bacteria 3189
427 Ga0207657_10118179 3300025919 Bacteria 2183
428 Ga0207657_10120769 3300025919 Bacteria 2156
429 Ga0207657_10139586 3300025919 Bacteria 1981
430 Ga0207657_10176335 3300025919 Bacteria 1730
431 Ga0207657_10213583 3300025919 Bacteria 1547
432 Ga0207657_10228995 3300025919 Bacteria 1487
433 Ga0207657_10437035 3300025919 Bacteria 1027
434 Ga0207657_10772433 3300025919 Bacteria 744
435 Ga0207657_11477948 3300025919 Bacteria 508
436 Ga0207649_10011552 3300025920 Bacteria 4871
437 Ga0207649_10043874 3300025920 Bacteria 2736
438 Ga0207649_10087869 3300025920 Bacteria 2029
439 Ga0207649_10267193 3300025920 Bacteria 1238
440 Ga0207649_10274519 3300025920 Bacteria 1223
441 Ga0207649_10298394 3300025920 Bacteria 1177
442 Ga0207649_10377285 3300025920 Bacteria 1056
443 Ga0207649_10519430 3300025920 Bacteria 908
444 Ga0207649_10605065 3300025920 Bacteria 843
445 Ga0207649_10638096 3300025920 Bacteria 822
446 Ga0207652_10035110 3300025921 Bacteria 4230
447 Ga0207652_10044519 3300025921 Bacteria 3781
448 Ga0207652_10323953 3300025921 Bacteria 1391
449 Ga0207652_10747608 3300025921 Bacteria 870
450 Ga0207652_11120006 3300025921 Bacteria 688
451 Ga0207681_10063164 3300025923 Bacteria 2553
452 Ga0207650_10000683 3300025925 Bacteria 26649
453 Ga0207650_10063876 3300025925 Bacteria 2754
454 Ga0207650_10511918 3300025925 Bacteria 1004
455 Ga0207650_10609268 3300025925 Bacteria 919
456 Ga0207659_10000886 3300025926 Bacteria 17785
457 Ga0207659_10305885 3300025926 Bacteria 1307
458 Ga0207659_11075394 3300025926 Bacteria 692
459 Ga0207687_10013221 3300025927 Bacteria 5391
460 Ga0207687_10565102 3300025927 Bacteria 956
461 Ga0207687_10727565 3300025927 Bacteria 843
462 Ga0207700_10180435 3300025928 Bacteria 1767
463 Ga0207664_10017441 3300025929 Bacteria 5264
464 Ga0207664_10045122 3300025929 Bacteria 3455
465 Ga0207664_10073933 3300025929 Bacteria 2752
466 Ga0207664_10364751 3300025929 Bacteria 1280
467 Ga0207664_11208105 3300025929 Bacteria 674
468 Ga0207664_11672184 3300025929 Bacteria 559
469 Ga0207644_10000214 3300025931 Bacteria 39975
470 Ga0207644_10006240 3300025931 Bacteria 7769
471 Ga0207644_10037070 3300025931 Bacteria 3428
472 Ga0207644_10080169 3300025931 Bacteria 2410
473 Ga0207644_10091139 3300025931 Bacteria 2272
474 Ga0207644_10531208 3300025931 Bacteria 972
475 Ga0207690_10068656 3300025932 Bacteria 2436
476 Ga0207690_10119503 3300025932 Bacteria 1912
477 Ga0207690_10134213 3300025932 Bacteria 1816
478 Ga0207690_10170869 3300025932 Bacteria 1628
479 Ga0207690_10194831 3300025932 Bacteria 1535
480 Ga0207690_10261021 3300025932 Bacteria 1342
481 Ga0207690_10506886 3300025932 Bacteria 977
482 Ga0207690_10613353 3300025932 Bacteria 889
483 Ga0207690_10675036 3300025932 Bacteria 848
484 Ga0207690_11271292 3300025932 Bacteria 615
485 Ga0207706_10006707 3300025933 Bacteria 10641
486 Ga0207706_10012508 3300025933 Bacteria 7730
487 Ga0207706_10038725 3300025933 Bacteria 4229
488 Ga0207706_10169519 3300025933 Bacteria 1918
489 Ga0207706_10384731 3300025933 Bacteria 1217
490 Ga0207706_11601495 3300025933 Bacteria 528
491 Ga0207686_10064418 3300025934 Bacteria 2334
492 Ga0207709_10435068 3300025935 Bacteria 1010
493 Ga0207709_10475563 3300025935 Bacteria 970
494 Ga0207669_10013096 3300025937 Bacteria 4106
495 Ga0207669_10441479 3300025937 Bacteria 1029
496 Ga0207669_10484724 3300025937 Bacteria 986
497 Ga0207669_10580429 3300025937 Bacteria 908
498 Ga0207704_10711734 3300025938 Bacteria 832
499 Ga0207704_11756434 3300025938 Bacteria 533
500 Ga0207704_11866155 3300025938 Bacteria 517
501 Ga0207665_11183231 3300025939 Bacteria 610
502 Ga0207691_10002944 3300025940 Bacteria 16622
503 Ga0207691_10018366 3300025940 Bacteria 6626
504 Ga0207691_10188057 3300025940 Bacteria 1802
505 Ga0207691_10215054 3300025940 Bacteria 1668
506 Ga0207691_10387070 3300025940 Bacteria 1193
507 Ga0207691_11192148 3300025940 Bacteria 631
508 Ga0207691_11232263 3300025940 Bacteria 620
509 Ga0207691_11482809 3300025940 Bacteria 555
510 Ga0207711_10000218 3300025941 Bacteria 61467
511 Ga0207711_10000534 3300025941 Bacteria 38916
512 Ga0207711_10015482 3300025941 Bacteria 6329
513 Ga0207711_10077807 3300025941 Bacteria 2892
514 Ga0207689_11142883 3300025942 Bacteria 656
515 Ga0207661_10005354 3300025944 Bacteria 9037
516 Ga0207661_10031030 3300025944 Bacteria 4123
517 Ga0207661_10117982 3300025944 Bacteria 2255
518 Ga0207661_10411556 3300025944 Bacteria 1227
519 Ga0207661_10562742 3300025944 Bacteria 1045
520 Ga0207661_10600794 3300025944 Bacteria 1010
521 Ga0207661_10972076 3300025944 Bacteria 782
522 Ga0207661_11011974 3300025944 Bacteria 765
523 Ga0207661_11935046 3300025944 Bacteria 535
524 Ga0207679_10004385 3300025945 Bacteria 8785
525 Ga0207679_10023505 3300025945 Bacteria 4216
526 Ga0207679_10064817 3300025945 Bacteria 2732
527 Ga0207679_10238283 3300025945 Bacteria 1540
528 Ga0207679_11328793 3300025945 Bacteria 660
529 Ga0207679_11527066 3300025945 Bacteria 612
530 Ga0207667_10018132 3300025949 Bacteria 7902
531 Ga0207667_10146880 3300025949 Bacteria 2427
532 Ga0207667_10191550 3300025949 Bacteria 2098
533 Ga0207667_10228698 3300025949 Bacteria 1905
534 Ga0207667_10228826 3300025949 Bacteria 1904
535 Ga0207667_10233254 3300025949 Bacteria 1884
536 Ga0207667_10407508 3300025949 Bacteria 1384
537 Ga0207667_10789972 3300025949 Bacteria 947
538 Ga0207667_10803113 3300025949 Bacteria 937
539 Ga0207667_11118222 3300025949 Bacteria 770
540 Ga0207667_11796827 3300025949 Bacteria 577
541 Ga0207667_11930855 3300025949 Bacteria 552
542 Ga0207651_10002561 3300025960 Bacteria 8691
543 Ga0207651_10008201 3300025960 Bacteria 5625
544 Ga0207651_10021875 3300025960 Bacteria 3896
545 Ga0207651_10127379 3300025960 Bacteria 1942
546 Ga0207651_11489744 3300025960 Bacteria 609
547 Ga0207712_10036768 3300025961 Bacteria 3337
548 Ga0207668_10331944 3300025972 Bacteria 1265
549 Ga0207668_10387311 3300025972 Bacteria 1178
550 Ga0207668_10915644 3300025972 Bacteria 781
551 Ga0207668_12070702 3300025972 Bacteria 512
552 Ga0207640_10003284 3300025981 Bacteria 8716
553 Ga0207640_10087406 3300025981 Bacteria 2149
554 Ga0207640_10115051 3300025981 Bacteria 1915
555 Ga0207640_10399962 3300025981 Bacteria 1118
556 Ga0207658_10005215 3300025986 Bacteria 8943
557 Ga0207658_10012543 3300025986 Bacteria 5787
558 Ga0207658_10067323 3300025986 Bacteria 2697
559 Ga0207677_10026942 3300026023 Bacteria 3612
560 Ga0207677_10250432 3300026023 Bacteria 1438
561 Ga0207703_10000960 3300026035 Bacteria 27866
562 Ga0207703_10004308 3300026035 Bacteria 11701
563 Ga0207703_10136573 3300026035 Bacteria 2123
564 Ga0207639_10084693 3300026041 Bacteria 2519
565 Ga0207639_10089470 3300026041 Bacteria 2460
566 Ga0207639_10192614 3300026041 Bacteria 1742
567 Ga0207639_10494658 3300026041 Bacteria 1116
568 Ga0207639_10592120 3300026041 Bacteria 1022
569 Ga0207639_10704435 3300026041 Bacteria 937
570 Ga0207639_11031751 3300026041 Bacteria 770
571 Ga0207639_12138660 3300026041 Bacteria 521
572 Ga0207678_10021776 3300026067 Bacteria 5623
573 Ga0207678_10023979 3300026067 Bacteria 5333
574 Ga0207678_10089573 3300026067 Bacteria 2630
575 Ga0207678_10212730 3300026067 Bacteria 1654
576 Ga0207678_10419948 3300026067 Bacteria 1160
577 Ga0207678_10597378 3300026067 Bacteria 967
578 Ga0207678_10734906 3300026067 Bacteria 870
579 Ga0207678_10917061 3300026067 Bacteria 775
580 Ga0207678_11430317 3300026067 Bacteria 611
581 Ga0207678_11557252 3300026067 Bacteria 583
582 Ga0207678_11707157 3300026067 Bacteria 553
583 Ga0207702_10007331 3300026078 Bacteria 9421
584 Ga0207702_10018782 3300026078 Bacteria 5717
585 Ga0207702_10074415 3300026078 Bacteria 2931
586 Ga0207702_10263308 3300026078 Bacteria 1624
587 Ga0207702_10704205 3300026078 Bacteria 995
588 Ga0207702_10895261 3300026078 Bacteria 879
589 Ga0207702_10993371 3300026078 Bacteria 832
590 Ga0207702_11158655 3300026078 Bacteria 767
591 Ga0207702_11161679 3300026078 Bacteria 766
592 Ga0207702_12012122 3300026078 Bacteria 568
593 Ga0207641_10000626 3300026088 Bacteria 38602
594 Ga0207641_10046963 3300026088 Bacteria 3640
595 Ga0207641_10052978 3300026088 Bacteria 3438
596 Ga0207641_10106682 3300026088 Bacteria 2476
597 Ga0207641_11653982 3300026088 Bacteria 642
598 Ga0207648_10084971 3300026089 Bacteria 2760
599 Ga0207648_10708594 3300026089 Bacteria 933
600 Ga0207676_10001354 3300026095 Bacteria 18221
601 Ga0207676_10012363 3300026095 Bacteria 6114
602 Ga0207676_10033887 3300026095 Bacteria 3863
603 Ga0207676_10306557 3300026095 Bacteria 1452
604 Ga0207676_10642439 3300026095 Bacteria 1023
605 Ga0207674_10009048 3300026116 Bacteria 11438
606 Ga0207674_10027797 3300026116 Bacteria 5976
607 Ga0207674_10516048 3300026116 Bacteria 1154
608 Ga0207674_10776608 3300026116 Bacteria 925
609 Ga0207674_12024395 3300026116 Bacteria 541
610 Ga0207674_12024513 3300026116 Bacteria 541
611 Ga0207675_101589228 3300026118 Bacteria 674
612 Ga0207675_102702980 3300026118 Bacteria 505
613 Ga0207683_10116159 3300026121 Bacteria 2399
614 Ga0207698_10007624 3300026142 Bacteria 6785
615 Ga0207698_10013552 3300026142 Bacteria 5385
616 Ga0207698_10021748 3300026142 Bacteria 4442
617 Ga0207698_10032426 3300026142 Bacteria 3784
618 Ga0207698_10162472 3300026142 Bacteria 1955
619 Ga0207698_10171276 3300026142 Bacteria 1912
620 Ga0207698_10281450 3300026142 Bacteria 1539
621 Ga0207698_10397055 3300026142 Bacteria 1317
622 Ga0207698_10499168 3300026142 Bacteria 1184
623 Ga0207698_10508592 3300026142 Bacteria 1173
624 Ga0207698_10536046 3300026142 Bacteria 1145
625 Ga0207698_10806305 3300026142 Bacteria 941
626 Ga0207698_11780520 3300026142 Bacteria 631
627 Ga0207698_12041815 3300026142 Bacteria 587
628 Ga0207698_12586584 3300026142 Bacteria 517
629 Ga0209967_1013652 3300027364 Bacteria 1154
630 Ga0209982_1058274 3300027552 Bacteria 627
631 Ga0209982_1083238 3300027552 Bacteria 528
632 Ga0210002_1090587 3300027617 Bacteria 549
633 Ga0209983_1026545 3300027665 Bacteria 1225
634 Ga0209974_10001863 3300027876 Bacteria 7698
635 Ga0268266_10139341 3300028379 Bacteria 2176
636 Ga0268266_11844570 3300028379 Bacteria 579
637 Ga0268265_10253831 3300028380 Bacteria 1559
638 Ga0268265_11315096 3300028380 Bacteria 723
639 Ga0268264_10001633 3300028381 Bacteria 20703
640 Ga0268264_10158897 3300028381 Bacteria 2034
641 Ga0268264_10228109 3300028381 Bacteria 1718
642 Ga0268264_10455432 3300028381 Bacteria 1240
643 Ga0316182_1157471 3300030745 Bacteria 869
644 Ga0307408_100071690 3300031548 Bacteria 2562
645 Ga0307408_100083694 3300031548 Bacteria 2391
646 Ga0307408_100173250 3300031548 Bacteria 1724
647 Ga0307408_100300418 3300031548 Bacteria 1344
648 Ga0307408_100539657 3300031548 Bacteria 1027
649 Ga0307408_101208129 3300031548 Bacteria 705
650 Ga0307405_10007679 3300031731 Bacteria 5416
651 Ga0307405_10023534 3300031731 Bacteria 3502
652 Ga0307405_10027974 3300031731 Bacteria 3277
653 Ga0307405_10108823 3300031731 Bacteria 1873
654 Ga0307405_10270758 3300031731 Bacteria 1273
655 Ga0307405_10288164 3300031731 Bacteria 1240
656 Ga0307405_10441353 3300031731 Bacteria 1029
657 Ga0307405_10871634 3300031731 Bacteria 759
658 Ga0307405_10981765 3300031731 Bacteria 719
659 Ga0307405_11836563 3300031731 Bacteria 539
660 Ga0307413_10005584 3300031824 Bacteria 5634
661 Ga0307413_10008527 3300031824 Bacteria 4846
662 Ga0307413_10012064 3300031824 Bacteria 4283
663 Ga0307413_10041263 3300031824 Bacteria 2701
664 Ga0307413_10127671 3300031824 Bacteria 1734
665 Ga0307413_10145147 3300031824 Bacteria 1646
666 Ga0307413_10184459 3300031824 Bacteria 1491
667 Ga0307413_10208393 3300031824 Bacteria 1417
668 Ga0307413_10463745 3300031824 Bacteria 1008
669 Ga0307413_11388245 3300031824 Bacteria 617
670 Ga0307410_10009713 3300031852 Bacteria 5410
671 Ga0307410_10023187 3300031852 Bacteria 3853
672 Ga0307410_10071812 3300031852 Bacteria 2401
673 Ga0307410_10087826 3300031852 Bacteria 2200
674 Ga0307410_10104591 3300031852 Bacteria 2036
675 Ga0307410_10141158 3300031852 Bacteria 1782
676 Ga0307410_10145864 3300031852 Bacteria 1756
677 Ga0307410_10280014 3300031852 Bacteria 1308
678 Ga0307410_10280056 3300031852 Bacteria 1308
679 Ga0307410_10521657 3300031852 Bacteria 980
680 Ga0307410_10997293 3300031852 Bacteria 722
681 Ga0307410_11007541 3300031852 Bacteria 718
682 Ga0307410_11029867 3300031852 Bacteria 711
683 Ga0307406_10010988 3300031901 Bacteria 5124
684 Ga0307406_10021395 3300031901 Bacteria 3824
685 Ga0307406_10088748 3300031901 Bacteria 2075
686 Ga0307406_10119022 3300031901 Bacteria 1832
687 Ga0307406_10440076 3300031901 Bacteria 1043
688 Ga0307406_10846671 3300031901 Bacteria 775
689 Ga0307406_11123792 3300031901 Bacteria 679
690 Ga0307406_11769399 3300031901 Bacteria 549
691 Ga0307407_10014872 3300031903 Bacteria 3825
692 Ga0307407_10096787 3300031903 Bacteria 1822
693 Ga0307407_10124376 3300031903 Bacteria 1640
694 Ga0307407_10154674 3300031903 Bacteria 1494
695 Ga0307407_10184411 3300031903 Bacteria 1385
696 Ga0307407_10423687 3300031903 Bacteria 960
697 Ga0307407_10525518 3300031903 Bacteria 871
698 Ga0307407_10734119 3300031903 Bacteria 746
699 Ga0307407_11310251 3300031903 Bacteria 568
700 Ga0307412_10008559 3300031911 Bacteria 5846
701 Ga0307412_10012800 3300031911 Bacteria 4897
702 Ga0307412_10082491 3300031911 Bacteria 2226
703 Ga0307412_10107071 3300031911 Bacteria 1989
704 Ga0307412_10415345 3300031911 Bacteria 1099
705 Ga0307412_10641731 3300031911 Bacteria 904
706 Ga0307412_10665790 3300031911 Bacteria 890
707 Ga0307412_10975482 3300031911 Bacteria 747
708 Ga0307412_11105525 3300031911 Bacteria 705
709 Ga0307412_11322899 3300031911 Bacteria 649
710 Ga0307412_11411008 3300031911 Bacteria 630
711 Ga0307409_100004225 3300031995 Bacteria 8013
712 Ga0307409_100023593 3300031995 Bacteria 4267
713 Ga0307409_100047624 3300031995 Bacteria 3255
714 Ga0307409_100073632 3300031995 Bacteria 2725
715 Ga0307409_100111849 3300031995 Bacteria 2291
716 Ga0307409_100306719 3300031995 Bacteria 1479
717 Ga0307409_100402794 3300031995 Bacteria 1307
718 Ga0307409_100515286 3300031995 Bacteria 1167
719 Ga0307409_100648368 3300031995 Bacteria 1049
720 Ga0307409_100867486 3300031995 Bacteria 914
721 Ga0307409_101197205 3300031995 Bacteria 783
722 Ga0307409_101373773 3300031995 Bacteria 732
723 Ga0307409_101691859 3300031995 Bacteria 661
724 Ga0307409_101891648 3300031995 Bacteria 626
725 Ga0307416_100030793 3300032002 Bacteria 4030
726 Ga0307416_100123806 3300032002 Bacteria 2311
727 Ga0307416_100128074 3300032002 Bacteria 2278
728 Ga0307416_100135486 3300032002 Bacteria 2226
729 Ga0307416_100198676 3300032002 Bacteria 1900
730 Ga0307416_100245224 3300032002 Bacteria 1739
731 Ga0307416_100280288 3300032002 Bacteria 1643
732 Ga0307416_100443869 3300032002 Bacteria 1348
733 Ga0307416_100449156 3300032002 Bacteria 1341
734 Ga0307416_100560427 3300032002 Bacteria 1217
735 Ga0307416_100616055 3300032002 Bacteria 1167
736 Ga0307416_100688680 3300032002 Bacteria 1110
737 Ga0307416_100814146 3300032002 Bacteria 1030
738 Ga0307414_10008027 3300032004 Bacteria 5967
739 Ga0307414_10015954 3300032004 Bacteria 4551
740 Ga0307414_10037132 3300032004 Bacteria 3259
741 Ga0307414_10061861 3300032004 Bacteria 2653
742 Ga0307414_10084170 3300032004 Bacteria 2338
743 Ga0307414_10099888 3300032004 Bacteria 2181
744 Ga0307414_10233138 3300032004 Bacteria 1519
745 Ga0307414_10304612 3300032004 Bacteria 1349
746 Ga0307414_10310289 3300032004 Bacteria 1338
747 Ga0307414_10564414 3300032004 Bacteria 1016
748 Ga0307414_10611549 3300032004 Bacteria 978
749 Ga0307414_10746275 3300032004 Bacteria 889
750 Ga0307414_10910977 3300032004 Bacteria 806
751 Ga0307414_11120371 3300032004 Bacteria 727
752 Ga0307414_11542947 3300032004 Bacteria 618
753 Ga0307414_11990779 3300032004 Bacteria 542
754 Ga0307411_10003295 3300032005 Bacteria 7460
755 Ga0307411_10008730 3300032005 Bacteria 5270
756 Ga0307411_10051973 3300032005 Bacteria 2676
757 Ga0307411_10088742 3300032005 Bacteria 2151
758 Ga0307411_10092410 3300032005 Bacteria 2116
759 Ga0307411_10372623 3300032005 Bacteria 1171
760 Ga0307411_10549459 3300032005 Bacteria 985
761 Ga0307411_10726792 3300032005 Bacteria 867
762 Ga0307411_10795190 3300032005 Bacteria 832
763 Ga0307411_10816523 3300032005 Bacteria 822
764 Ga0307411_11063514 3300032005 Bacteria 727
765 Ga0307411_11312839 3300032005 Bacteria 659
766 Ga0307411_11325573 3300032005 Bacteria 656
767 Ga0307411_11495990 3300032005 Bacteria 620
768 Ga0307411_11582577 3300032005 Bacteria 604
769 Ga0307411_11694355 3300032005 Bacteria 585
770 Ga0307411_11732131 3300032005 Bacteria 579
771 Ga0307415_100006277 3300032126 Bacteria 6387
772 Ga0307415_100033223 3300032126 Bacteria 3348
773 Ga0307415_100083125 3300032126 Bacteria 2293
774 Ga0307415_100099867 3300032126 Bacteria 2125
775 Ga0307415_100112531 3300032126 Bacteria 2023
776 Ga0307415_100162416 3300032126 Bacteria 1733
777 Ga0307415_100361089 3300032126 Bacteria 1226
778 Ga0307415_100427582 3300032126 Bacteria 1138
779 Ga0307415_100434395 3300032126 Bacteria 1130
780 Ga0307415_100496235 3300032126 Bacteria 1066
781 Ga0307415_100855166 3300032126 Bacteria 835
782 Ga0307415_102092401 3300032126 Bacteria 552
783 Ga0373944_0353046 3300035089 Bacteria 560
784 Ga0373923_0685881 3300035111 Bacteria 508
785 Ga0373941_0274823 3300035115 Bacteria 665
786 Ga0373945_0191182 3300035116 Bacteria 846
787 Ga0373960_0054324 3300035121 Bacteria 1198
788 Ga0373960_0117575 3300035121 Bacteria 879
789 Ga0373943_0288644 3300035170 Bacteria 929
790 Ga0373946_0358259 3300035171 Bacteria 730
791 Ga0373931_0207272 3300035691 Bacteria 1174
792 Ga0373931_0308362 3300035691 Bacteria 979
793 Ga0373935_0064670 3300035692 Bacteria 2346
794 Ga0373927_0465069 3300035695 Unclassified 835
795 Ga0373947_0101943 3300035725 Bacteria 1805
796 Ga0373925_0010817 3300037068 Bacteria 6616
797 Ga0395899_0001221 3300037312 Bacteria 22495
798 Ga0395899_0017715 3300037312 Bacteria 5425
799 Ga0395899_0046975 3300037312 Bacteria 3214
800 Ga0395899_0063347 3300037312 Bacteria 2720
801 Ga0395899_0079543 3300037312 Bacteria 2387
802 Ga0395899_0082239 3300037312 Bacteria 2342
803 Ga0395899_0097052 3300037312 Bacteria 2131
804 Ga0395899_0108199 3300037312 Bacteria 2000
805 Ga0395899_0229750 3300037312 Bacteria 1281
806 Ga0395900_0000240 3300037418 Bacteria 86222
807 Ga0395900_0001580 3300037418 Bacteria 26952
808 Ga0395900_0005640 3300037418 Bacteria 13093
809 Ga0395900_0032652 3300037418 Bacteria 5353
810 Ga0395900_0043017 3300037418 Bacteria 4653
811 Ga0395900_0075190 3300037418 Bacteria 3472
812 Ga0395900_0123739 3300037418 Bacteria 2653
813 Ga0395900_0135130 3300037418 Bacteria 2526
814 Ga0395900_0298063 3300037418 Bacteria 1599
815 Ga0395900_0304548 3300037418 Bacteria 1578
816 Ga0395900_0353096 3300037418 Bacteria 1443
817 Ga0395900_0403520 3300037418 Bacteria 1330
818 Ga0395900_0573641 3300037418 Bacteria 1071
819 Ga0395900_0625008 3300037418 Bacteria 1015
820 Ga0395900_0638426 3300037418 Bacteria 1002
821 Ga0395900_0702589 3300037418 Bacteria 944
822 Ga0395900_1134482 3300037418 Bacteria 698
823 Ga0395900_1615510 3300037418 Bacteria 559
824 Ga0395898_0002338 3300037466 Bacteria 22624
825 Ga0395898_0108927 3300037466 Bacteria 2656
826 Ga0395898_0126675 3300037466 Bacteria 2446
827 Ga0395898_0154469 3300037466 Bacteria 2195
828 Ga0395898_0249340 3300037466 Bacteria 1693
829 Ga0395898_0283435 3300037466 Bacteria 1580
830 Ga0395898_0379875 3300037466 Bacteria 1347
831 Ga0395898_0444349 3300037466 Bacteria 1235
832 Ga0395898_0556224 3300037466 Bacteria 1089
833 Ga0395898_0610447 3300037466 Bacteria 1033
834 Ga0395898_0614694 3300037466 Bacteria 1029
835 Ga0395898_1227303 3300037466 Bacteria 680
836 Ga0395905_0000219 3300037471 Bacteria 87705
837 Ga0395905_0020646 3300037471 Bacteria 6236
838 Ga0395905_0026536 3300037471 Bacteria 5461
839 Ga0395905_0028108 3300037471 Bacteria 5302
840 Ga0395905_0036498 3300037471 Bacteria 4616
841 Ga0395905_0052129 3300037471 Bacteria 3831
842 Ga0395905_0099861 3300037471 Bacteria 2725
843 Ga0395905_0110068 3300037471 Bacteria 2586
844 Ga0395905_0180707 3300037471 Bacteria 1981
845 Ga0395905_0185522 3300037471 Bacteria 1952
846 Ga0395905_0191427 3300037471 Bacteria 1918
847 Ga0395905_0228885 3300037471 Bacteria 1738
848 Ga0395905_0282656 3300037471 Bacteria 1545
849 Ga0395905_0373580 3300037471 Bacteria 1319
850 Ga0395905_0454067 3300037471 Bacteria 1179
851 Ga0395905_0567579 3300037471 Bacteria 1036
852 Ga0395905_0653402 3300037471 Bacteria 953
853 Ga0395905_0675135 3300037471 Bacteria 935
854 Ga0395905_0701214 3300037471 Bacteria 915
855 Ga0395905_1346077 3300037471 Bacteria 618
856 Ga0395905_1440498 3300037471 Bacteria 593
857 Ga0395905_1522252 3300037471 Bacteria 573
858 Ga0395905_1653002 3300037471 Bacteria 545
859 Ga0436364_0122821 3300037853 Bacteria 620
860 Ga0395901_0001664 3300038443 Bacteria 22942
861 Ga0395901_0002717 3300038443 Bacteria 17820
862 Ga0395901_0003111 3300038443 Bacteria 16674
863 Ga0395901_0012290 3300038443 Bacteria 8689
864 Ga0395901_0033864 3300038443 Bacteria 5275
865 Ga0395901_0035599 3300038443 Bacteria 5144
866 Ga0395901_0124415 3300038443 Bacteria 2709
867 Ga0395901_0132738 3300038443 Bacteria 2616
868 Ga0395901_0181433 3300038443 Bacteria 2208
869 Ga0395901_0294771 3300038443 Bacteria 1682
870 Ga0395901_0407817 3300038443 Bacteria 1395
871 Ga0395901_0420760 3300038443 Bacteria 1370
872 Ga0395901_0482235 3300038443 Bacteria 1264
873 Ga0395901_0720266 3300038443 Bacteria 993
874 Ga0395901_1708037 3300038443 Bacteria 580
875 Ga0400483_213855 3300039062 Bacteria 20702
876 Ga0439439_0128832 3300041406 Bacteria 710
877 Ga0439465_0067126 3300041413 Bacteria 1197
878 Ga0451807_0319441 3300041486 Bacteria 690
879 Ga0439432_038885 3300042006 Bacteria 1514
880 Ga0439432_045033 3300042006 Bacteria 1389
881 Ga0439432_067070 3300042006 Bacteria 1098
882 Ga0439449_0018454 3300042007 Bacteria 2619
883 Ga0450914_051536 3300042118 Bacteria 543
884 Ga0450914_055220 3300042118 Bacteria 530
885 Ga0450889_008186 3300042144 Bacteria 1060
886 Ga0450916_049206 3300042530 Bacteria 661
887 Ga0451577_0948360 3300042876 Bacteria 774
888 Ga0466969_0403256 3300044656 Bacteria 621
889 Ga0466972_0095840 3300044658 Bacteria 1406
890 Ga0466972_0382099 3300044658 Bacteria 659
891 Ga0466965_0133071 3300044683 Bacteria 1291
892 Ga0466966_0333619 3300044684 Bacteria 911
893 Ga0466966_0469921 3300044684 Bacteria 756
894 Ga0466966_0891241 3300044684 Bacteria 536
895 Ga0466961_0477682 3300044693 Bacteria 753
896 Ga0466963_0013195 3300044694 Bacteria 5070
897 Ga0466963_0133164 3300044694 Bacteria 1718
898 Ga0466963_1239243 3300044694 Bacteria 524
899 Ga0466964_0036729 3300044706 Bacteria 1966
900 Ga0466964_0151677 3300044706 Bacteria 1075
901 Ga0466964_0454725 3300044706 Bacteria 680
902 Ga0453684_0840979 3300044712 Bacteria 987
903 Ga0466971_0513127 3300044719 Bacteria 592
904 Ga0466968_0041552 3300044735 Bacteria 1941
905 Ga0466970_0103235 3300044765 Bacteria 1553
906 Ga0466957_0244784 3300044842 Bacteria 1191
907 Ga0466957_0921435 3300044842 Bacteria 625
908 Ga0466960_0123104 3300044901 Bacteria 1360
909 Ga0466959_0452288 3300045049 Bacteria 870
910 Ga0466959_0462683 3300045049 Bacteria 859
911 Ga0466959_0756589 3300045049 Bacteria 650
912 Ga0466959_1122816 3300045049 Bacteria 523
913 Ga0466958_0231549 3300045836 Bacteria 1180
914 Ga0466967_0066845 3300045976 Bacteria 3204
915 Ga0466967_0091946 3300045976 Bacteria 2758
916 Ga0466967_0323123 3300045976 Bacteria 1488
917 Ga0466967_0580686 3300045976 Bacteria 1105
918 Ga0466967_0985681 3300045976 Bacteria 839
919 Ga0466967_1799955 3300045976 Bacteria 610
920 Ga0466967_2488717 3300045976 Bacteria 513
921 Ga0495585_0223842 3300046492 Bacteria 948
922 Ga0495610_0401197 3300046512 Bacteria 506
923 Ga0495644_0130916 3300046523 Bacteria 956
924 Ga0495663_0005051 3300046525 Bacteria 3686
925 Ga0495642_0310858 3300046528 Bacteria 691
926 Ga0495598_0003259 3300046537 Bacteria 3430
927 Ga0495598_0066547 3300046537 Bacteria 1124
928 Ga0495621_0000142 3300046539 Bacteria 15328
929 Ga0495621_0001134 3300046539 Bacteria 6882
930 Ga0495633_0157870 3300046558 Bacteria 1046
931 Ga0495635_0853194 3300046663 Bacteria 585
932 Ga0495669_0493224 3300046684 Bacteria 595
933 Ga0495670_0002922 3300046691 Bacteria 8419
934 Ga0495670_0044104 3300046691 Bacteria 2226
935 Ga0495636_0555306 3300047318 Bacteria 559
936 Ga0495677_0013003 3300047445 Bacteria 3030
937 Ga0495677_0240482 3300047445 Bacteria 707
938 Ga0496100_0003854 3300048903 Bacteria 7863
939 Ga0496100_0486808 3300048903 Bacteria 949
940 Ga0496101_0007193 3300048904 Bacteria 7202
941 Ga0496102_0507690 3300048905 Bacteria 1128
942 Ga0496102_0621157 3300048905 Bacteria 1004
943 Ga0496103_0011241 3300048906 Bacteria 5303
944 Ga0496103_0478866 3300048906 Bacteria 797
945 Ga0496104_0078870 3300048907 Bacteria 3138
946 Ga0496104_1835581 3300048907 Bacteria 508
947 Ga0496106_0012827 3300048909 Bacteria 6186
948 Ga0496106_0547343 3300048909 Bacteria 929
949 Ga0496107_0013443 3300048910 Bacteria 5721
950 Ga0496107_1165411 3300048910 Bacteria 555
951 Ga0496108_0061400 3300048911 Bacteria 3162
952 Ga0496108_0411611 3300048911 Bacteria 1181
953 Ga0496109_0171959 3300048912 Bacteria 2033
954 Ga0496109_0363847 3300048912 Bacteria 1366
955 Ga0496109_0732418 3300048912 Bacteria 926
956 Ga0496109_1411527 3300048912 Bacteria 632
957 Ga0496109_2025584 3300048912 Bacteria 508
958 Ga0496110_0003099 3300048913 Bacteria 12613
959 Ga0496110_0030888 3300048913 Bacteria 4620
960 Ga0496111_0001919 3300048914 Bacteria 12293
961 Ga0496111_0014827 3300048914 Bacteria 5335
962 Ga0496111_0251843 3300048914 Bacteria 1311
963 Ga0496112_0017665 3300048915 Bacteria 6709
964 Ga0496113_0008833 3300048916 Bacteria 6584
965 Ga0496113_0334366 3300048916 Bacteria 1215
966 Ga0496114_0697500 3300048917 Bacteria 890
967 Ga0496114_1058373 3300048917 Bacteria 695
968 Ga0501292_134728 3300049515 Bacteria 513
969 Ga0501335_024139 3300049551 Bacteria 662
970 Ga0501067_0304319 3300049583 Bacteria 888
971 Ga0501069_0403521 3300049585 Bacteria 809
972 Ga0501075_0771465 3300049591 Bacteria 732
973 Ga0501273_014504 3300049770 Bacteria 1015
974 nmdc:mga0k408_583371_c1 3300050493 Bacteria 660
975 Ga0587079_098288 3300059647 Bacteria 695
976 Ga0587071_183479 3300060344 Bacteria 539
977 Ga0501082_1923600 3300060353 Bacteria 516
978 Ga0466962_0167751 3300061719 Bacteria 1068
979 2917555894 2917554339 Bacteria 4987857
980 Ga0207683_10074673
981 CNBas_1014164
982 JGI24736J21556_1000511
983 JGI24736J21556_1070596
984 JGI24741J21665_1000332
985 JGI24740J21852_10007157
986 JGI24737J22298_10008394
987 JGI24737J22298_10068087
988 JGI24737J22298_10199592
989 JGI24735J21928_10207666
990 JGI24735J21928_10214264
991 JGI24735J21928_10218798
992 JGI24034J26672_10032666
993 JGI24034J26672_10054980
994 JGI24751J29686_10095965
995 rootH1_10001525
996 Ga0058862_12611823
997 Ga0065712_10207738
998 Ga0065712_10458315
999 Ga0065715_10092131
1000 Ga0065715_10131708
1001 Ga0070658_10030850
1002 Ga0070658_10037846
1003 Ga0070658_10063302
1004 Ga0070658_10091055
1005 Ga0070658_10122268
1006 Ga0070658_10258034
1007 Ga0070658_10675067
1008 Ga0070658_10756552
1009 Ga0070658_11401586
1010 Ga0070658_11693121
1011 Ga0070676_10059833
1012 Ga0070676_10366775
1013 Ga0070676_10643588
1014 Ga0070683_100033170
1015 Ga0070683_100052133
1016 Ga0070683_100488632
1017 Ga0070683_100574053
1018 Ga0070683_101234021
1019 Ga0070683_101492593
1020 Ga0070690_100006147
1021 Ga0070690_100007602
1022 Ga0070670_100000517
1023 Ga0070670_100522385
1024 Ga0070670_101064692
1025 Ga0070670_101436670
1026 Ga0070677_10096078
1027 Ga0070677_10572081
1028 Ga0068869_100930651
1029 Ga0070666_10000689
1030 Ga0070666_10216911
1031 Ga0070666_10299718
1032 Ga0070666_11319299
1033 Ga0070680_100042647
1034 Ga0070680_100421661
1035 Ga0070680_101104077
1036 Ga0070682_100013063
1037 Ga0070682_100083220
1038 Ga0068868_100001006
1039 Ga0068868_100019614
1040 Ga0068868_100920576
1041 Ga0070660_100050726
1042 Ga0070660_100055074
1043 Ga0070660_100067349
1044 Ga0070660_100107892
1045 Ga0070660_100132641
1046 Ga0070660_100331448
1047 Ga0070660_100350032
1048 Ga0070660_100429327
1049 Ga0070660_100755015
1050 Ga0070660_101842351
1051 Ga0070687_100110030
1052 Ga0070661_100022271
1053 Ga0070661_100023696
1054 Ga0070661_100039730
1055 Ga0070661_100056091
1056 Ga0070661_100062025
1057 Ga0070661_100142237
1058 Ga0070661_100155080
1059 Ga0070661_100178990
1060 Ga0070661_100733758
1061 Ga0070661_101139474
1062 Ga0070692_10075677
1063 Ga0070692_10116312
1064 Ga0070692_10500180
1065 Ga0070692_10794210
1066 Ga0070692_10916659
1067 Ga0070668_100224488
1068 Ga0070668_100670495
1069 Ga0070668_100706228
1070 Ga0070668_101373614
1071 Ga0070669_100352759
1072 Ga0070669_100885775
1073 Ga0070669_101216953
1074 Ga0070669_101330091
1075 Ga0070669_101922786
1076 Ga0070675_100002493
1077 Ga0070675_100366902
1078 Ga0070671_100001205
1079 Ga0070671_100033554
1080 Ga0070671_100052674
1081 Ga0070671_100097521
1082 Ga0070671_100103784
1083 Ga0070671_101525775
1084 Ga0070674_100017466
1085 Ga0070674_100029872
1086 Ga0070674_100124076
1087 Ga0070674_100287402
1088 Ga0070673_100008046
1089 Ga0070673_100047431
1090 Ga0070673_101910568
1091 Ga0070659_100032952
1092 Ga0070659_100034648
1093 Ga0070659_100082181
1094 Ga0070659_100116006
1095 Ga0070659_100275567
1096 Ga0070659_100320500
1097 Ga0070659_101974710
1098 Ga0070667_100001851
1099 Ga0070667_100025141
1100 Ga0070667_100029582
1101 Ga0070667_100038765
1102 Ga0070709_10967358
1103 Ga0070714_100078814
1104 Ga0070714_100438194
1105 Ga0070714_100963314
1106 Ga0070713_100361071
1107 Ga0070663_100015686
1108 Ga0070663_100045970
1109 Ga0070663_100083553
1110 Ga0070663_100196658
1111 Ga0070663_100351561
1112 Ga0070663_100578790
1113 Ga0070663_100614694
1114 Ga0070663_101163026
1115 Ga0070678_100082868
1116 Ga0070678_100103312
1117 Ga0070678_100314371
1118 Ga0070662_100001007
1119 Ga0070662_100058069
1120 Ga0070662_100090788
1121 Ga0070662_100471978
1122 Ga0070662_100525152
1123 Ga0070662_100583698
1124 Ga0070662_101209369
1125 Ga0070662_102000824
1126 Ga0070681_10194347
1127 Ga0070681_10337532
1128 Ga0070681_10378392
1129 Ga0070681_10581511
1130 Ga0070681_10595667
1131 Ga0070681_10669937
1132 Ga0070681_10764494
1133 Ga0068867_100012769
1134 Ga0070685_11071934
1135 Ga0070685_11601877
1136 Ga0074259_10468590
1137 Ga0070679_100077847
1138 Ga0070679_100437543
1139 Ga0070679_100833011
1140 Ga0070679_101384656
1141 Ga0070679_101682034
1142 Ga0070684_100042751
1143 Ga0070684_100161651
1144 Ga0070684_101066794
1145 Ga0070684_101249706
1146 Ga0068853_100084591
1147 Ga0068853_100397208
1148 Ga0068853_100411191
1149 Ga0068853_100958493
1150 Ga0068853_101910358
1151 Ga0068853_102256556
1152 Ga0070672_100026944
1153 Ga0070672_100198610
1154 Ga0070672_100453528
1155 Ga0070672_100682745
1156 Ga0070672_101222131
1157 Ga0070672_101555966
1158 Ga0070686_100637346
1159 Ga0070686_101045620
1160 Ga0070696_100205483
1161 Ga0070693_100340389
1162 Ga0070693_100454319
1163 Ga0070693_100456722
1164 Ga0070665_100709925
1165 Ga0068855_100062897
1166 Ga0068855_100099272
1167 Ga0068855_100166726
1168 Ga0068855_100417081
1169 Ga0068855_100679474
1170 Ga0068855_101032033
1171 Ga0068855_101374996
1172 Ga0068855_102077792
1173 Ga0068855_102314275
1174 Ga0068855_102388310
1175 Ga0070664_100011866
1176 Ga0070664_100071792
1177 Ga0070664_100280691
1178 Ga0070664_100387342
1179 Ga0070664_101033767
1180 Ga0070664_101052762
1181 Ga0070664_101552865
1182 Ga0070664_101825545
1183 Ga0070664_101870017
1184 Ga0068857_100022900
1185 Ga0068857_100223766
1186 Ga0068857_101026177
1187 Ga0068854_100004571
1188 Ga0068854_100067648
1189 Ga0068854_100178617
1190 Ga0068854_100562858
1191 Ga0068854_100638647
1192 Ga0068854_100697969
1193 Ga0068854_101588878
1194 Ga0068854_101708405
1195 Ga0068856_100017948
1196 Ga0068856_100030169
1197 Ga0068856_100053171
1198 Ga0068856_100252187
1199 Ga0068856_100273755
1200 Ga0068856_100357345
1201 Ga0068856_100528007
1202 Ga0068856_100532919
1203 Ga0068856_100560628
1204 Ga0068856_100795371
1205 Ga0068856_101255178
1206 Ga0068856_101632458
1207 Ga0070702_101451017
1208 Ga0068852_100005313
1209 Ga0068852_100008862
1210 Ga0068852_100014694
1211 Ga0068852_100122444
1212 Ga0068852_100151187
1213 Ga0068852_100173205
1214 Ga0068852_100215145
1215 Ga0068852_100286155
1216 Ga0068852_100316920
1217 Ga0068852_100375597
1218 Ga0068852_100503382
1219 Ga0068852_101225486
1220 Ga0068852_101322089
1221 Ga0068852_102094380
1222 Ga0068852_102240563
1223 Ga0068859_100092804
1224 Ga0068859_100122399
1225 Ga0068859_100216351
1226 Ga0068864_100000078
1227 Ga0068864_100073572
1228 Ga0068864_100099314
1229 Ga0068864_100123001
1230 Ga0068864_100494560
1231 Ga0068866_10646105
1232 Ga0068861_101100565
1233 Ga0068851_10046902
1234 Ga0068851_10189467
1235 Ga0068851_10577935
1236 Ga0068851_10579996
1237 Ga0068851_10883966
1238 Ga0068870_10336661
1239 Ga0068863_100000882
1240 Ga0068863_100003860
1241 Ga0068863_100055222
1242 Ga0068863_100728530
1243 Ga0068863_101849518
1244 Ga0068858_100002977
1245 Ga0068858_100146150
1246 Ga0068858_100268683
1247 Ga0068860_100044105
1248 Ga0068860_100290793
1249 Ga0068860_102089211
1250 Ga0068862_100123090
1251 Ga0068862_100859518
1252 Ga0081539_10039955
1253 Ga0097621_100006668
1254 Ga0068865_100032587
1255 Ga0068865_100400904
1256 Ga0068865_101700701
1257 Ga0097620_100092808
1258 Ga0097620_100122393
1259 Ga0097620_100216352
1260 Ga0105240_10073834
1261 Ga0105240_11117749
1262 Ga0105240_11286289
1263 Ga0105240_11290525
1264 Ga0105240_12140769
1265 Ga0105245_10015587
1266 Ga0105245_10165956
1267 Ga0105245_10959756
1268 Ga0105247_10119681
1269 Ga0105247_10661799
1270 Ga0105243_10668607
1271 Ga0105243_11417304
1272 Ga0105242_10041698
1273 Ga0105242_12175500
1274 Ga0105248_10000413
1275 Ga0105248_10001367
1276 Ga0105248_10110274
1277 Ga0105248_10522838
1278 Ga0105237_12307712
1279 Ga0105238_10035588
1280 Ga0105249_10052009
1281 Ga0105249_12007885
1282 Ga0105032_106692
1283 Ga0105239_10872246
1284 Ga0105239_11302119
1285 Ga0157319_1031856
1286 Ga0157373_10019925
1287 Ga0157373_10113356
1288 Ga0157373_10130807
1289 Ga0157373_10228659
1290 Ga0157373_10290875
1291 Ga0157373_10323863
1292 Ga0157373_10476106
1293 Ga0157373_11490641
1294 Ga0157371_10006674
1295 Ga0157371_10014871
1296 Ga0157371_10073654
1297 Ga0157371_10108303
1298 Ga0157371_10169987
1299 Ga0157371_10179477
1300 Ga0157371_10216730
1301 Ga0157371_10399438
1302 Ga0157371_10492610
1303 Ga0157371_11642373
1304 Ga0157370_10001258
1305 Ga0157370_10018005
1306 Ga0157370_10336512
1307 Ga0157370_10461993
1308 Ga0157370_10539541
1309 Ga0157370_10818132
1310 Ga0157370_10897749
1311 Ga0157369_10002111
1312 Ga0157369_10025444
1313 Ga0157369_10030510
1314 Ga0157369_10049218
1315 Ga0157369_10068579
1316 Ga0157369_10159994
1317 Ga0157369_10390290
1318 Ga0157369_10533824
1319 Ga0157369_10615173
1320 Ga0157369_11892535
1321 Ga0157369_11916126
1322 Ga0157369_12016411
1323 Ga0157369_12063192
1324 Ga0157369_12095141
1325 Ga0157369_12396625
1326 Ga0157369_12634449
1327 Ga0157374_10457554
1328 Ga0157374_10698822
1329 Ga0157378_10050293
1330 Ga0157378_10157837
1331 Ga0157378_10245047
1332 Ga0163162_10250362
1333 Ga0163162_11253969
1334 Ga0163162_11661680
1335 Ga0163162_11974669
1336 Ga0157372_10223700
1337 Ga0157372_10312769
1338 Ga0157372_11123959
1339 Ga0157372_11774091
1340 Ga0157375_10019033
1341 Ga0157375_10052322
1342 Ga0157375_10179664
1343 Ga0157375_12534504
1344 Ga0163163_10000355
1345 Ga0163163_10093032
1346 Ga0163163_10341668
1347 Ga0157380_11555126
1348 Ga0157379_10027693
1349 Ga0157379_10138263
1350 Ga0157376_10123750
1351 Ga0163161_10246386
1352 Ga0163161_10734726
1353 Ga0206355_1136578
1354 Ga0206353_10511543
1355 Ga0213875_10608710
1356 Ga0224712_10013622
1357 Ga0207656_10031575
1358 Ga0207656_10291149
1359 Ga0207656_10603873
1360 Ga0207682_10068919
1361 Ga0207642_10171029
1362 Ga0207710_10093860
1363 Ga0207688_10132448
1364 Ga0207688_10452067
1365 Ga0207680_10000377
1366 Ga0207680_10034537
1367 Ga0207680_10776829
1368 Ga0207647_10023796
1369 Ga0207647_10026492
1370 Ga0207645_10122665
1371 Ga0207645_10160086
1372 Ga0207645_10942732
1373 Ga0207643_10195440
1374 Ga0207705_10000320
1375 Ga0207705_10001992
1376 Ga0207705_10017634
1377 Ga0207705_10024172
1378 Ga0207705_10086633
1379 Ga0207705_10088443
1380 Ga0207705_10156983
1381 Ga0207705_10160165
1382 Ga0207705_10436295
1383 Ga0207705_10479096
1384 Ga0207705_10553405
1385 Ga0207705_11208863
1386 Ga0207705_11432211
1387 Ga0207705_11487147
1388 Ga0207654_10932223
1389 Ga0207707_10050007
1390 Ga0207707_10057432
1391 Ga0207707_10080709
1392 Ga0207707_10209426
1393 Ga0207707_10421038
1394 Ga0207707_10847219
1395 Ga0207695_10006489
1396 Ga0207695_10764251
1397 Ga0207660_10000433
1398 Ga0207660_10023209
1399 Ga0207660_10036365
1400 Ga0207660_10309009
1401 Ga0207662_10107736
1402 Ga0207662_10684489
1403 Ga0207657_10002110
1404 Ga0207657_10014944
1405 Ga0207657_10062443
1406 Ga0207657_10118179
1407 Ga0207657_10120769
1408 Ga0207657_10139586
1409 Ga0207657_10176335
1410 Ga0207657_10213583
1411 Ga0207657_10228995
1412 Ga0207657_10437035
1413 Ga0207657_10772433
1414 Ga0207657_11477948
1415 Ga0207649_10011552
1416 Ga0207649_10043874
1417 Ga0207649_10087869
1418 Ga0207649_10267193
1419 Ga0207649_10274519
1420 Ga0207649_10298394
1421 Ga0207649_10377285
1422 Ga0207649_10519430
1423 Ga0207649_10605065
1424 Ga0207649_10638096
1425 Ga0207652_10035110
1426 Ga0207652_10044519
1427 Ga0207652_10323953
1428 Ga0207652_10747608
1429 Ga0207652_11120006
1430 Ga0207681_10063164
1431 Ga0207650_10000683
1432 Ga0207650_10063876
1433 Ga0207650_10511918
1434 Ga0207650_10609268
1435 Ga0207659_10000886
1436 Ga0207659_10305885
1437 Ga0207659_11075394
1438 Ga0207687_10013221
1439 Ga0207687_10565102
1440 Ga0207687_10727565
1441 Ga0207700_10180435
1442 Ga0207664_10017441
1443 Ga0207664_10045122
1444 Ga0207664_10073933
1445 Ga0207664_10364751
1446 Ga0207664_11208105
1447 Ga0207664_11672184
1448 Ga0207644_10000214
1449 Ga0207644_10006240
1450 Ga0207644_10037070
1451 Ga0207644_10080169
1452 Ga0207644_10091139
1453 Ga0207644_10531208
1454 Ga0207690_10068656
1455 Ga0207690_10119503
1456 Ga0207690_10134213
1457 Ga0207690_10170869
1458 Ga0207690_10194831
1459 Ga0207690_10261021
1460 Ga0207690_10506886
1461 Ga0207690_10613353
1462 Ga0207690_10675036
1463 Ga0207690_11271292
1464 Ga0207706_10006707
1465 Ga0207706_10012508
1466 Ga0207706_10038725
1467 Ga0207706_10169519
1468 Ga0207706_10384731
1469 Ga0207706_11601495
1470 Ga0207686_10064418
1471 Ga0207709_10435068
1472 Ga0207709_10475563
1473 Ga0207669_10013096
1474 Ga0207669_10441479
1475 Ga0207669_10484724
1476 Ga0207669_10580429
1477 Ga0207704_10711734
1478 Ga0207704_11756434
1479 Ga0207704_11866155
1480 Ga0207665_11183231
1481 Ga0207691_10002944
1482 Ga0207691_10018366
1483 Ga0207691_10188057
1484 Ga0207691_10215054
1485 Ga0207691_10387070
1486 Ga0207691_11192148
1487 Ga0207691_11232263
1488 Ga0207691_11482809
1489 Ga0207711_10000218
1490 Ga0207711_10000534
1491 Ga0207711_10015482
1492 Ga0207711_10077807
1493 Ga0207689_11142883
1494 Ga0207661_10005354
1495 Ga0207661_10031030
1496 Ga0207661_10117982
1497 Ga0207661_10411556
1498 Ga0207661_10562742
1499 Ga0207661_10600794
1500 Ga0207661_10972076
1501 Ga0207661_11011974
1502 Ga0207661_11935046
1503 Ga0207679_10004385
1504 Ga0207679_10023505
1505 Ga0207679_10064817
1506 Ga0207679_10238283
1507 Ga0207679_11328793
1508 Ga0207679_11527066
1509 Ga0207667_10018132
1510 Ga0207667_10146880
1511 Ga0207667_10191550
1512 Ga0207667_10228698
1513 Ga0207667_10228826
1514 Ga0207667_10233254
1515 Ga0207667_10407508
1516 Ga0207667_10789972
1517 Ga0207667_10803113
1518 Ga0207667_11118222
1519 Ga0207667_11796827
1520 Ga0207667_11930855
1521 Ga0207651_10002561
1522 Ga0207651_10008201
1523 Ga0207651_10021875
1524 Ga0207651_10127379
1525 Ga0207651_11489744
1526 Ga0207712_10036768
1527 Ga0207668_10331944
1528 Ga0207668_10387311
1529 Ga0207668_10915644
1530 Ga0207668_12070702
1531 Ga0207640_10003284
1532 Ga0207640_10087406
1533 Ga0207640_10115051
1534 Ga0207640_10399962
1535 Ga0207658_10005215
1536 Ga0207658_10012543
1537 Ga0207658_10067323
1538 Ga0207677_10026942
1539 Ga0207677_10250432
1540 Ga0207703_10000960
1541 Ga0207703_10004308
1542 Ga0207703_10136573
1543 Ga0207639_10084693
1544 Ga0207639_10089470
1545 Ga0207639_10192614
1546 Ga0207639_10494658
1547 Ga0207639_10592120
1548 Ga0207639_10704435
1549 Ga0207639_11031751
1550 Ga0207639_12138660
1551 Ga0207678_10021776
1552 Ga0207678_10023979
1553 Ga0207678_10089573
1554 Ga0207678_10212730
1555 Ga0207678_10419948
1556 Ga0207678_10597378
1557 Ga0207678_10734906
1558 Ga0207678_10917061
1559 Ga0207678_11430317
1560 Ga0207678_11557252
1561 Ga0207678_11707157
1562 Ga0207702_10007331
1563 Ga0207702_10018782
1564 Ga0207702_10074415
1565 Ga0207702_10263308
1566 Ga0207702_10704205
1567 Ga0207702_10895261
1568 Ga0207702_10993371
1569 Ga0207702_11158655
1570 Ga0207702_11161679
1571 Ga0207702_12012122
1572 Ga0207641_10000626
1573 Ga0207641_10046963
1574 Ga0207641_10052978
1575 Ga0207641_10106682
1576 Ga0207641_11653982
1577 Ga0207648_10084971
1578 Ga0207648_10708594
1579 Ga0207676_10001354
1580 Ga0207676_10012363
1581 Ga0207676_10033887
1582 Ga0207676_10306557
1583 Ga0207676_10642439
1584 Ga0207674_10009048
1585 Ga0207674_10027797
1586 Ga0207674_10516048
1587 Ga0207674_10776608
1588 Ga0207674_12024395
1589 Ga0207674_12024513
1590 Ga0207675_101589228
1591 Ga0207675_102702980
1592 Ga0207683_10116159
1593 Ga0207698_10007624
1594 Ga0207698_10013552
1595 Ga0207698_10021748
1596 Ga0207698_10032426
1597 Ga0207698_10162472
1598 Ga0207698_10171276
1599 Ga0207698_10281450
1600 Ga0207698_10397055
1601 Ga0207698_10499168
1602 Ga0207698_10508592
1603 Ga0207698_10536046
1604 Ga0207698_10806305
1605 Ga0207698_11780520
1606 Ga0207698_12041815
1607 Ga0207698_12586584
1608 Ga0209967_1013652
1609 Ga0209982_1058274
1610 Ga0209982_1083238
1611 Ga0210002_1090587
1612 Ga0209983_1026545
1613 Ga0209974_10001863
1614 Ga0268266_10139341
1615 Ga0268266_11844570
1616 Ga0268265_10253831
1617 Ga0268265_11315096
1618 Ga0268264_10001633
1619 Ga0268264_10158897
1620 Ga0268264_10228109
1621 Ga0268264_10455432
1622 Ga0316182_1157471
1623 Ga0307408_100071690
1624 Ga0307408_100083694
1625 Ga0307408_100173250
1626 Ga0307408_100300418
1627 Ga0307408_100539657
1628 Ga0307408_101208129
1629 Ga0307405_10007679
1630 Ga0307405_10023534
1631 Ga0307405_10027974
1632 Ga0307405_10108823
1633 Ga0307405_10270758
1634 Ga0307405_10288164
1635 Ga0307405_10441353
1636 Ga0307405_10871634
1637 Ga0307405_10981765
1638 Ga0307405_11836563
1639 Ga0307413_10005584
1640 Ga0307413_10008527
1641 Ga0307413_10012064
1642 Ga0307413_10041263
1643 Ga0307413_10127671
1644 Ga0307413_10145147
1645 Ga0307413_10184459
1646 Ga0307413_10208393
1647 Ga0307413_10463745
1648 Ga0307413_11388245
1649 Ga0307410_10009713
1650 Ga0307410_10023187
1651 Ga0307410_10071812
1652 Ga0307410_10087826
1653 Ga0307410_10104591
1654 Ga0307410_10141158
1655 Ga0307410_10145864
1656 Ga0307410_10280014
1657 Ga0307410_10280056
1658 Ga0307410_10521657
1659 Ga0307410_10997293
1660 Ga0307410_11007541
1661 Ga0307410_11029867
1662 Ga0307406_10010988
1663 Ga0307406_10021395
1664 Ga0307406_10088748
1665 Ga0307406_10119022
1666 Ga0307406_10440076
1667 Ga0307406_10846671
1668 Ga0307406_11123792
1669 Ga0307406_11769399
1670 Ga0307407_10014872
1671 Ga0307407_10096787
1672 Ga0307407_10124376
1673 Ga0307407_10154674
1674 Ga0307407_10184411
1675 Ga0307407_10423687
1676 Ga0307407_10525518
1677 Ga0307407_10734119
1678 Ga0307407_11310251
1679 Ga0307412_10008559
1680 Ga0307412_10012800
1681 Ga0307412_10082491
1682 Ga0307412_10107071
1683 Ga0307412_10415345
1684 Ga0307412_10641731
1685 Ga0307412_10665790
1686 Ga0307412_10975482
1687 Ga0307412_11105525
1688 Ga0307412_11322899
1689 Ga0307412_11411008
1690 Ga0307409_100004225
1691 Ga0307409_100023593
1692 Ga0307409_100047624
1693 Ga0307409_100073632
1694 Ga0307409_100111849
1695 Ga0307409_100306719
1696 Ga0307409_100402794
1697 Ga0307409_100515286
1698 Ga0307409_100648368
1699 Ga0307409_100867486
1700 Ga0307409_101197205
1701 Ga0307409_101373773
1702 Ga0307409_101691859
1703 Ga0307409_101891648
1704 Ga0307416_100030793
1705 Ga0307416_100123806
1706 Ga0307416_100128074
1707 Ga0307416_100135486
1708 Ga0307416_100198676
1709 Ga0307416_100245224
1710 Ga0307416_100280288
1711 Ga0307416_100443869
1712 Ga0307416_100449156
1713 Ga0307416_100560427
1714 Ga0307416_100616055
1715 Ga0307416_100688680
1716 Ga0307416_100814146
1717 Ga0307414_10008027
1718 Ga0307414_10015954
1719 Ga0307414_10037132
1720 Ga0307414_10061861
1721 Ga0307414_10084170
1722 Ga0307414_10099888
1723 Ga0307414_10233138
1724 Ga0307414_10304612
1725 Ga0307414_10310289
1726 Ga0307414_10564414
1727 Ga0307414_10611549
1728 Ga0307414_10746275
1729 Ga0307414_10910977
1730 Ga0307414_11120371
1731 Ga0307414_11542947
1732 Ga0307414_11990779
1733 Ga0307411_10003295
1734 Ga0307411_10008730
1735 Ga0307411_10051973
1736 Ga0307411_10088742
1737 Ga0307411_10092410
1738 Ga0307411_10372623
1739 Ga0307411_10549459
1740 Ga0307411_10726792
1741 Ga0307411_10795190
1742 Ga0307411_10816523
1743 Ga0307411_11063514
1744 Ga0307411_11312839
1745 Ga0307411_11325573
1746 Ga0307411_11495990
1747 Ga0307411_11582577
1748 Ga0307411_11694355
1749 Ga0307411_11732131
1750 Ga0307415_100006277
1751 Ga0307415_100033223
1752 Ga0307415_100083125
1753 Ga0307415_100099867
1754 Ga0307415_100112531
1755 Ga0307415_100162416
1756 Ga0307415_100361089
1757 Ga0307415_100427582
1758 Ga0307415_100434395
1759 Ga0307415_100496235
1760 Ga0307415_100855166
1761 Ga0307415_102092401
1762 Ga0373944_0353046
1763 Ga0373923_0685881
1764 Ga0373941_0274823
1765 Ga0373945_0191182
1766 Ga0373960_0054324
1767 Ga0373960_0117575
1768 Ga0373943_0288644
1769 Ga0373946_0358259
1770 Ga0373931_0207272
1771 Ga0373931_0308362
1772 Ga0373935_0064670
1773 Ga0373927_0465069
1774 Ga0373947_0101943
1775 Ga0373925_0010817
1776 Ga0395899_0001221
1777 Ga0395899_0017715
1778 Ga0395899_0046975
1779 Ga0395899_0063347
1780 Ga0395899_0079543
1781 Ga0395899_0082239
1782 Ga0395899_0097052
1783 Ga0395899_0108199
1784 Ga0395899_0229750
1785 Ga0395900_0000240
1786 Ga0395900_0001580
1787 Ga0395900_0005640
1788 Ga0395900_0032652
1789 Ga0395900_0043017
1790 Ga0395900_0075190
1791 Ga0395900_0123739
1792 Ga0395900_0135130
1793 Ga0395900_0298063
1794 Ga0395900_0304548
1795 Ga0395900_0353096
1796 Ga0395900_0403520
1797 Ga0395900_0573641
1798 Ga0395900_0625008
1799 Ga0395900_0638426
1800 Ga0395900_0702589
1801 Ga0395900_1134482
1802 Ga0395900_1615510
1803 Ga0395898_0002338
1804 Ga0395898_0108927
1805 Ga0395898_0126675
1806 Ga0395898_0154469
1807 Ga0395898_0249340
1808 Ga0395898_0283435
1809 Ga0395898_0379875
1810 Ga0395898_0444349
1811 Ga0395898_0556224
1812 Ga0395898_0610447
1813 Ga0395898_0614694
1814 Ga0395898_1227303
1815 Ga0395905_0000219
1816 Ga0395905_0020646
1817 Ga0395905_0026536
1818 Ga0395905_0028108
1819 Ga0395905_0036498
1820 Ga0395905_0052129
1821 Ga0395905_0099861
1822 Ga0395905_0110068
1823 Ga0395905_0180707
1824 Ga0395905_0185522
1825 Ga0395905_0191427
1826 Ga0395905_0228885
1827 Ga0395905_0282656
1828 Ga0395905_0373580
1829 Ga0395905_0454067
1830 Ga0395905_0567579
1831 Ga0395905_0653402
1832 Ga0395905_0675135
1833 Ga0395905_0701214
1834 Ga0395905_1346077
1835 Ga0395905_1440498
1836 Ga0395905_1522252
1837 Ga0395905_1653002
1838 Ga0436364_0122821
1839 Ga0395901_0001664
1840 Ga0395901_0002717
1841 Ga0395901_0003111
1842 Ga0395901_0012290
1843 Ga0395901_0033864
1844 Ga0395901_0035599
1845 Ga0395901_0124415
1846 Ga0395901_0132738
1847 Ga0395901_0181433
1848 Ga0395901_0294771
1849 Ga0395901_0407817
1850 Ga0395901_0420760
1851 Ga0395901_0482235
1852 Ga0395901_0720266
1853 Ga0395901_1708037
1854 Ga0400483_213855
1855 Ga0439439_0128832
1856 Ga0439465_0067126
1857 Ga0451807_0319441
1858 Ga0439432_038885
1859 Ga0439432_045033
1860 Ga0439432_067070
1861 Ga0439449_0018454
1862 Ga0450914_051536
1863 Ga0450914_055220
1864 Ga0450889_008186
1865 Ga0450916_049206
1866 Ga0451577_0948360
1867 Ga0466969_0403256
1868 Ga0466972_0095840
1869 Ga0466972_0382099
1870 Ga0466965_0133071
1871 Ga0466966_0333619
1872 Ga0466966_0469921
1873 Ga0466966_0891241
1874 Ga0466961_0477682
1875 Ga0466963_0013195
1876 Ga0466963_0133164
1877 Ga0466963_1239243
1878 Ga0466964_0036729
1879 Ga0466964_0151677
1880 Ga0466964_0454725
1881 Ga0453684_0840979
1882 Ga0466971_0513127
1883 Ga0466968_0041552
1884 Ga0466970_0103235
1885 Ga0466957_0244784
1886 Ga0466957_0921435
1887 Ga0466960_0123104
1888 Ga0466959_0452288
1889 Ga0466959_0462683
1890 Ga0466959_0756589
1891 Ga0466959_1122816
1892 Ga0466958_0231549
1893 Ga0466967_0066845
1894 Ga0466967_0091946
1895 Ga0466967_0323123
1896 Ga0466967_0580686
1897 Ga0466967_0985681
1898 Ga0466967_1799955
1899 Ga0466967_2488717
1900 Ga0495585_0223842
1901 Ga0495610_0401197
1902 Ga0495644_0130916
1903 Ga0495663_0005051
1904 Ga0495642_0310858
1905 Ga0495598_0003259
1906 Ga0495598_0066547
1907 Ga0495621_0000142
1908 Ga0495621_0001134
1909 Ga0495633_0157870
1910 Ga0495635_0853194
1911 Ga0495669_0493224
1912 Ga0495670_0002922
1913 Ga0495670_0044104
1914 Ga0495636_0555306
1915 Ga0495677_0013003
1916 Ga0495677_0240482
1917 Ga0496100_0003854
1918 Ga0496100_0486808
1919 Ga0496101_0007193
1920 Ga0496102_0507690
1921 Ga0496102_0621157
1922 Ga0496103_0011241
1923 Ga0496103_0478866
1924 Ga0496104_0078870
1925 Ga0496104_1835581
1926 Ga0496106_0012827
1927 Ga0496106_0547343
1928 Ga0496107_0013443
1929 Ga0496107_1165411
1930 Ga0496108_0061400
1931 Ga0496108_0411611
1932 Ga0496109_0171959
1933 Ga0496109_0363847
1934 Ga0496109_0732418
1935 Ga0496109_1411527
1936 Ga0496109_2025584
1937 Ga0496110_0003099
1938 Ga0496110_0030888
1939 Ga0496111_0001919
1940 Ga0496111_0014827
1941 Ga0496111_0251843
1942 Ga0496112_0017665
1943 Ga0496113_0008833
1944 Ga0496113_0334366
1945 Ga0496114_0697500
1946 Ga0496114_1058373
1947 Ga0501292_134728
1948 Ga0501335_024139
1949 Ga0501067_0304319
1950 Ga0501069_0403521
1951 Ga0501075_0771465
1952 Ga0501273_014504
1953 nmdc:mga0k408_583371_c1
1954 Ga0587079_098288
1955 Ga0587071_183479
1956 Ga0501082_1923600
1957 Ga0466962_0167751
1958 2917555894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x0g-assembly1.cif.gz_A crystal structure of isca with the [2fe-2s] cluster 0.8828 27 37
3n1y-assembly1.cif.gz_A-1 x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201g mutant 0.8363 27 52
3n20-assembly1.cif.gz_A-1 x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201v mutant 0.8348 27 52
3rnf-assembly1.cif.gz_A structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant 0.8326 27 52
2inc-assembly1.cif.gz_A native toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure 0.8297 27 52
ID Description Score Start End Superfamily
af_P39205_517_593_2.40.340.10 Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV 0.9479 26 37 2.40.340.10
4joiB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8951 27 37 2.40.50.140
af_Q69PA8_270_446_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.8838 26 37 3.40.220.10
1x0gA00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8828 27 37 2.60.300.12
af_A0A1D6ND27_154_295_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8708 27 37 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A496BGK6-F1-model_v4 Glutathione S-transferase 1.01 4 57 GO:0016740
AF-A0A2G2G794-F1-model_v4 Glutathione S-transferase 1.008 5 57 GO:0016740
AF-A0A7Y2FTK9-F1-model_v4 Glutathione S-transferase 1.007 3 60 GO:0016740
AF-A0A1H0KJ72-F1-model_v4 deleted 1.002 3 39
AF-A0A6N6MXR1-F1-model_v4 Glutathione S-transferase 1 2 60 GO:0016740

Map