F487149

General Info

Members Datasets Scaffolds Average Seq Length
972 355 1944 146

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10328543|Ga0157372_103285432
Length 181
Sequence MQAGRVHVELSIILILAACFNQNPYKLKHMDFKQIQELIKMINKSQIGEVTIEQKDFRTQVVSHAMPVNAPMPVQQMLPQSAGAPAAQEQKGTSQGGSDTSNYITIKSPMIGTFYRRPSPDKPNFVEVGDEVSTGKVVCIIEAMKLFNEIESEISGKVVKILVEDSMPVEYDQPLFLVDPS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
207 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
208 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
209 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
212 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
262 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
281 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
282 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
283 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
284 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
285 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
286 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
287 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
288 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
291 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
292 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
293 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
294 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
295 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
296 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
297 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
298 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
299 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
300 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
304 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
305 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
316 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
320 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
321 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
322 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
323 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
328 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
329 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
330 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
334 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
341 2738541278 Niastella sp. CF465 Isolate Unclassified
342 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
343 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
344 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
345 2738543023 Pedobacter sp. OK628 Isolate Unclassified
346 2739367663 Pedobacter sp. YR510 Isolate Unclassified
347 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
348 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
349 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
350 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
351 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
352 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
353 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
354 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
355 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.72
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0
Rhizoplane 1.95
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10328543 3300013307 Bacteria 1781
2 JGI24744J21845_10031041 3300002077 Bacteria 1022
3 rootH2_10078230 3300003320 Bacteria 1922
4 rootL2_10077383 3300003322 Bacteria 5923
5 rootH1_10048038 3300003323 Bacteria 2974
6 rootH1_10276362 3300003323 Bacteria 5240
7 JGI25160J50197_1004577 3300003354 Bacteria 5957
8 JGI25404J52841_10038704 3300003659 Bacteria 1011
9 Ga0055535_1016499 3300003761 Bacteria 1006
10 Ga0055542_1005505 3300003762 Bacteria 2851
11 Ga0065714_10071198 3300005288 Bacteria 3607
12 Ga0065712_10010481 3300005290 Bacteria 2317
13 Ga0065712_10027404 3300005290 Bacteria 1245
14 Ga0065715_10192633 3300005293 Bacteria 1406
15 Ga0065715_10600200 3300005293 Unclassified 708
16 Ga0065707_10156427 3300005295 Bacteria 1604
17 Ga0070658_10000230 3300005327 Bacteria 49640
18 Ga0070658_10084107 3300005327 Bacteria 2616
19 Ga0070676_10000156 3300005328 Bacteria 27179
20 Ga0070676_10006420 3300005328 Bacteria 6282
21 Ga0070676_10076070 3300005328 Bacteria 2026
22 Ga0070676_10104429 3300005328 Bacteria 1756
23 Ga0070676_10238602 3300005328 Bacteria 1208
24 Ga0070676_10811797 3300005328 Bacteria 691
25 Ga0070683_100001255 3300005329 Bacteria 19307
26 Ga0070683_100003401 3300005329 Bacteria 12900
27 Ga0070683_100308834 3300005329 Bacteria 1505
28 Ga0070683_100363408 3300005329 Bacteria 1378
29 Ga0070683_100481078 3300005329 Bacteria 1185
30 Ga0070683_100487734 3300005329 Bacteria 1177
31 Ga0070690_100040185 3300005330 Bacteria 2957
32 Ga0070670_100016632 3300005331 Bacteria 6312
33 Ga0070670_100185745 3300005331 Bacteria 1805
34 Ga0070670_100699705 3300005331 Bacteria 911
35 Ga0070670_100992879 3300005331 Bacteria 763
36 Ga0070677_10020168 3300005333 Bacteria 2425
37 Ga0070677_10021285 3300005333 Bacteria 2377
38 Ga0068869_100002522 3300005334 Bacteria 11052
39 Ga0068869_100003133 3300005334 Bacteria 10092
40 Ga0068869_100004775 3300005334 Bacteria 8462
41 Ga0068869_100065302 3300005334 Bacteria 2678
42 Ga0068869_100138598 3300005334 Bacteria 1876
43 Ga0068869_100250645 3300005334 Bacteria 1414
44 Ga0068869_100279426 3300005334 Bacteria 1342
45 Ga0068869_100761054 3300005334 Bacteria 830
46 Ga0070666_10038780 3300005335 Bacteria 3172
47 Ga0070666_10288405 3300005335 Unclassified 1167
48 Ga0070666_10983346 3300005335 Bacteria 626
49 Ga0070680_100000390 3300005336 Bacteria 29749
50 Ga0070680_100094647 3300005336 Bacteria 2476
51 Ga0070682_100000101 3300005337 Bacteria 76535
52 Ga0070682_100002004 3300005337 Bacteria 11372
53 Ga0070682_100099625 3300005337 Bacteria 1916
54 Ga0070682_101001335 3300005337 Bacteria 694
55 Ga0070682_101422621 3300005337 Bacteria 593
56 Ga0068868_100005139 3300005338 Bacteria 9190
57 Ga0068868_100065448 3300005338 Bacteria 2888
58 Ga0068868_100074011 3300005338 Bacteria 2720
59 Ga0068868_100135226 3300005338 Bacteria 2020
60 Ga0068868_100458063 3300005338 Bacteria 1110
61 Ga0070660_100420382 3300005339 Bacteria 1107
62 Ga0070660_100534966 3300005339 Bacteria 977
63 Ga0070660_101101499 3300005339 Unclassified 672
64 Ga0070689_100035619 3300005340 Bacteria 3803
65 Ga0070689_100191717 3300005340 Bacteria 1664
66 Ga0070689_100192671 3300005340 Bacteria 1660
67 Ga0070691_10000447 3300005341 Bacteria 15259
68 Ga0070691_10201387 3300005341 Unclassified 1046
69 Ga0070687_100074067 3300005343 Bacteria 1837
70 Ga0070687_100114385 3300005343 Bacteria 1533
71 Ga0070687_100173514 3300005343 Bacteria 1285
72 Ga0070687_100221678 3300005343 Bacteria 1159
73 Ga0070687_100460809 3300005343 Bacteria 848
74 Ga0070661_100008622 3300005344 Bacteria 7051
75 Ga0070661_100702748 3300005344 Bacteria 824
76 Ga0070661_101122497 3300005344 Unclassified 656
77 Ga0070661_101254790 3300005344 Bacteria 621
78 Ga0070668_100000872 3300005347 Bacteria 20984
79 Ga0070668_100286127 3300005347 Bacteria 1378
80 Ga0070669_100208077 3300005353 Bacteria 1542
81 Ga0070669_100299179 3300005353 Bacteria 1293
82 Ga0070669_100440900 3300005353 Bacteria 1072
83 Ga0070669_100540466 3300005353 Bacteria 970
84 Ga0070669_100577193 3300005353 Bacteria 940
85 Ga0070669_100655115 3300005353 Bacteria 884
86 Ga0070675_100086876 3300005354 Bacteria 2615
87 Ga0070675_100102002 3300005354 Bacteria 2418
88 Ga0070675_100124513 3300005354 Bacteria 2192
89 Ga0070675_100192327 3300005354 Bacteria 1768
90 Ga0070675_100998240 3300005354 Bacteria 768
91 Ga0070671_100007722 3300005355 Bacteria 8593
92 Ga0070671_100139444 3300005355 Bacteria 2046
93 Ga0070671_100303829 3300005355 Bacteria 1359
94 Ga0070671_100538731 3300005355 Bacteria 1006
95 Ga0070671_100575259 3300005355 Bacteria 972
96 Ga0070671_101153640 3300005355 Unclassified 681
97 Ga0070671_101621669 3300005355 Bacteria 574
98 Ga0070674_100022902 3300005356 Bacteria 4033
99 Ga0070674_100037115 3300005356 Bacteria 3275
100 Ga0070674_100366303 3300005356 Bacteria 1168
101 Ga0070674_100639903 3300005356 Bacteria 903
102 Ga0070673_100000096 3300005364 Bacteria 39184
103 Ga0070673_100021393 3300005364 Bacteria 4688
104 Ga0070673_100043128 3300005364 Bacteria 3483
105 Ga0070673_100095994 3300005364 Bacteria 2432
106 Ga0070673_100318855 3300005364 Bacteria 1372
107 Ga0070673_100613989 3300005364 Bacteria 993
108 Ga0070673_101423730 3300005364 Unclassified 653
109 Ga0070688_100013814 3300005365 Bacteria 4565
110 Ga0070688_100059691 3300005365 Bacteria 2406
111 Ga0070688_100126468 3300005365 Bacteria 1719
112 Ga0070688_100150256 3300005365 Bacteria 1591
113 Ga0070688_100152971 3300005365 Bacteria 1578
114 Ga0070688_100476254 3300005365 Unclassified 938
115 Ga0070659_100062931 3300005366 Bacteria 2934
116 Ga0070659_100328631 3300005366 Bacteria 1279
117 Ga0070667_100000248 3300005367 Bacteria 61183
118 Ga0070667_100009195 3300005367 Bacteria 8181
119 Ga0070667_100081998 3300005367 Bacteria 2760
120 Ga0070667_100265955 3300005367 Bacteria 1536
121 Ga0070667_100332972 3300005367 Bacteria 1372
122 Ga0070667_100424617 3300005367 Bacteria 1212
123 Ga0070701_10439358 3300005438 Bacteria 835
124 Ga0070700_100024994 3300005441 Bacteria 3514
125 Ga0070700_100331459 3300005441 Bacteria 1122
126 Ga0070700_100491908 3300005441 Bacteria 942
127 Ga0070694_101630973 3300005444 Bacteria 548
128 Ga0070663_100285100 3300005455 Bacteria 1317
129 Ga0070663_100923314 3300005455 Bacteria 755
130 Ga0070663_101308484 3300005455 Bacteria 640
131 Ga0070678_100044179 3300005456 Bacteria 3180
132 Ga0070678_100106688 3300005456 Bacteria 2183
133 Ga0070678_100289604 3300005456 Bacteria 1388
134 Ga0070678_100472367 3300005456 Bacteria 1102
135 Ga0070662_100104599 3300005457 Bacteria 2148
136 Ga0070681_10011420 3300005458 Bacteria 8791
137 Ga0070681_10926605 3300005458 Bacteria 790
138 Ga0068867_100015569 3300005459 Bacteria 5396
139 Ga0068867_100120228 3300005459 Bacteria 2029
140 Ga0068867_100122509 3300005459 Bacteria 2011
141 Ga0068867_101231336 3300005459 Bacteria 689
142 Ga0068867_101358801 3300005459 Bacteria 657
143 Ga0068867_101437124 3300005459 Bacteria 640
144 Ga0070685_10033012 3300005466 Bacteria 2904
145 Ga0070685_10033794 3300005466 Bacteria 2876
146 Ga0070685_10048439 3300005466 Bacteria 2447
147 Ga0070685_10326662 3300005466 Bacteria 1042
148 Ga0070685_10730222 3300005466 Bacteria 724
149 Ga0070707_101620644 3300005468 Bacteria 614
150 Ga0070698_100007455 3300005471 Bacteria 11839
151 Ga0070699_101327587 3300005518 Bacteria 660
152 Ga0070679_100000656 3300005530 Bacteria 29462
153 Ga0070679_100180157 3300005530 Bacteria 2086
154 Ga0070684_100000646 3300005535 Bacteria 23997
155 Ga0070684_100034182 3300005535 Bacteria 4345
156 Ga0070684_100122051 3300005535 Bacteria 2344
157 Ga0070684_100679247 3300005535 Bacteria 959
158 Ga0070684_101232456 3300005535 Bacteria 704
159 Ga0068853_100013448 3300005539 Bacteria 6682
160 Ga0068853_100031011 3300005539 Bacteria 4519
161 Ga0068853_100047223 3300005539 Bacteria 3695
162 Ga0068853_100417778 3300005539 Bacteria 1257
163 Ga0068853_100537150 3300005539 Bacteria 1107
164 Ga0070672_100000033 3300005543 Bacteria 61516
165 Ga0070672_100039137 3300005543 Bacteria 3630
166 Ga0070672_100048173 3300005543 Bacteria 3310
167 Ga0070672_100268017 3300005543 Bacteria 1441
168 Ga0070672_100499992 3300005543 Bacteria 1052
169 Ga0070672_100593033 3300005543 Bacteria 964
170 Ga0070672_100621406 3300005543 Bacteria 942
171 Ga0070672_101224954 3300005543 Bacteria 669
172 Ga0070686_100012657 3300005544 Bacteria 4811
173 Ga0070686_100051454 3300005544 Bacteria 2622
174 Ga0070686_100179752 3300005544 Bacteria 1502
175 Ga0070686_100192741 3300005544 Bacteria 1456
176 Ga0070665_100000013 3300005548 Bacteria 484927
177 Ga0070665_100000641 3300005548 Bacteria 47468
178 Ga0070665_100004098 3300005548 Bacteria 15327
179 Ga0070665_100113486 3300005548 Bacteria 2712
180 Ga0070665_100264111 3300005548 Bacteria 1723
181 Ga0070704_100382230 3300005549 Bacteria 1197
182 Ga0068855_100002469 3300005563 Bacteria 22826
183 Ga0068855_100015914 3300005563 Bacteria 9049
184 Ga0068855_100221532 3300005563 Bacteria 2121
185 Ga0068855_100269817 3300005563 Unclassified 1892
186 Ga0070664_100032938 3300005564 Bacteria 4336
187 Ga0070664_100077370 3300005564 Bacteria 2860
188 Ga0070664_100079634 3300005564 Bacteria 2821
189 Ga0070664_100140839 3300005564 Bacteria 2124
190 Ga0070664_100186212 3300005564 Bacteria 1847
191 Ga0070664_100707088 3300005564 Bacteria 939
192 Ga0070664_101050427 3300005564 Unclassified 766
193 Ga0068857_100042210 3300005577 Unclassified 4045
194 Ga0068857_100069696 3300005577 Bacteria 3131
195 Ga0068857_100139293 3300005577 Bacteria 2192
196 Ga0068857_100167393 3300005577 Bacteria 1997
197 Ga0068857_100319895 3300005577 Bacteria 1433
198 Ga0068857_100785336 3300005577 Bacteria 909
199 Ga0068854_100008737 3300005578 Bacteria 6521
200 Ga0068854_100042061 3300005578 Bacteria 3232
201 Ga0068854_100106635 3300005578 Bacteria 2108
202 Ga0068854_100261291 3300005578 Bacteria 1386
203 Ga0068856_100022888 3300005614 Bacteria 6077
204 Ga0070702_100043622 3300005615 Bacteria 2528
205 Ga0070702_100820185 3300005615 Bacteria 721
206 Ga0068852_100022404 3300005616 Bacteria 5066
207 Ga0068852_100214645 3300005616 Bacteria 1827
208 Ga0068852_100392100 3300005616 Bacteria 1364
209 Ga0068852_100415079 3300005616 Bacteria 1327
210 Ga0068852_100583392 3300005616 Bacteria 1121
211 Ga0068852_100837233 3300005616 Bacteria 935
212 Ga0068859_100001757 3300005617 Bacteria 22069
213 Ga0068859_100040962 3300005617 Bacteria 4653
214 Ga0068859_100053730 3300005617 Bacteria 4051
215 Ga0068859_100136737 3300005617 Bacteria 2524
216 Ga0068859_100473589 3300005617 Bacteria 1348
217 Ga0068859_101239839 3300005617 Bacteria 821
218 Ga0068864_100001018 3300005618 Bacteria 23447
219 Ga0068864_100008778 3300005618 Bacteria 8332
220 Ga0068864_100048173 3300005618 Bacteria 3662
221 Ga0068864_100065608 3300005618 Bacteria 3149
222 Ga0068864_100152006 3300005618 Bacteria 2098
223 Ga0068864_100368074 3300005618 Bacteria 1360
224 Ga0068864_100430604 3300005618 Bacteria 1258
225 Ga0068864_101129415 3300005618 Bacteria 781
226 Ga0068866_10529193 3300005718 Bacteria 785
227 Ga0068861_100007743 3300005719 Bacteria 7379
228 Ga0068861_100074274 3300005719 Bacteria 2644
229 Ga0068861_100572798 3300005719 Bacteria 1032
230 Ga0068851_10021291 3300005834 Bacteria 3148
231 Ga0068851_10180169 3300005834 Bacteria 1170
232 Ga0068870_10020859 3300005840 Bacteria 3197
233 Ga0068870_10038408 3300005840 Bacteria 2472
234 Ga0068870_10708970 3300005840 Bacteria 695
235 Ga0068863_100002172 3300005841 Bacteria 19439
236 Ga0068863_100107269 3300005841 Bacteria 2658
237 Ga0068863_100383159 3300005841 Bacteria 1373
238 Ga0068863_100536798 3300005841 Bacteria 1154
239 Ga0068863_100826713 3300005841 Bacteria 924
240 Ga0068863_100828427 3300005841 Bacteria 923
241 Ga0068863_101271249 3300005841 Bacteria 742
242 Ga0068858_100000596 3300005842 Bacteria 37696
243 Ga0068858_100157996 3300005842 Bacteria 2134
244 Ga0068858_100176060 3300005842 Bacteria 2019
245 Ga0068858_100262879 3300005842 Bacteria 1641
246 Ga0068858_100308589 3300005842 Bacteria 1510
247 Ga0068858_100432528 3300005842 Bacteria 1266
248 Ga0068860_100000060 3300005843 Bacteria 195631
249 Ga0068860_100001437 3300005843 Bacteria 25781
250 Ga0068860_100009018 3300005843 Bacteria 9928
251 Ga0068860_100508357 3300005843 Bacteria 1203
252 Ga0068860_100651305 3300005843 Bacteria 1061
253 Ga0068860_101107300 3300005843 Bacteria 811
254 Ga0068862_100011742 3300005844 Bacteria 7228
255 Ga0068862_100169571 3300005844 Bacteria 1953
256 Ga0068862_100237441 3300005844 Bacteria 1656
257 Ga0068862_100359909 3300005844 Bacteria 1352
258 Ga0068862_101206967 3300005844 Bacteria 755
259 Ga0068862_101560517 3300005844 Bacteria 666
260 Ga0081540_1006219 3300005983 Bacteria 8750
261 Ga0081539_10031111 3300005985 Bacteria 3297
262 Ga0081539_10080809 3300005985 Bacteria 1709
263 Ga0070715_10219437 3300006163 Bacteria 977
264 Ga0075367_10708810 3300006178 Unclassified 640
265 Ga0075366_10081695 3300006195 Bacteria 1931
266 Ga0075366_10150741 3300006195 Bacteria 1408
267 Ga0075366_10301416 3300006195 Bacteria 980
268 Ga0097621_100000582 3300006237 Bacteria 25730
269 Ga0097621_100015035 3300006237 Bacteria 5811
270 Ga0097621_100015580 3300006237 Bacteria 5725
271 Ga0097621_100529089 3300006237 Bacteria 1071
272 Ga0097621_101194898 3300006237 Bacteria 716
273 Ga0068871_100000764 3300006358 Bacteria 21686
274 Ga0068871_100002439 3300006358 Bacteria 12701
275 Ga0068871_100068788 3300006358 Bacteria 2908
276 Ga0068871_100079404 3300006358 Bacteria 2715
277 Ga0068871_100407004 3300006358 Bacteria 1212
278 Ga0075428_100178166 3300006844 Bacteria 2302
279 Ga0075430_100020946 3300006846 Bacteria 5558
280 Ga0068865_100112445 3300006881 Bacteria 2011
281 Ga0068865_100255760 3300006881 Bacteria 1384
282 Ga0068865_100290128 3300006881 Bacteria 1306
283 Ga0068865_100345541 3300006881 Bacteria 1204
284 Ga0068865_100490788 3300006881 Bacteria 1022
285 Ga0068865_101139898 3300006881 Bacteria 688
286 Ga0097620_100001757 3300006931 Bacteria 22069
287 Ga0097620_100040961 3300006931 Bacteria 4653
288 Ga0097620_100053730 3300006931 Bacteria 4051
289 Ga0097620_100136742 3300006931 Bacteria 2524
290 Ga0097620_100473595 3300006931 Bacteria 1348
291 Ga0097620_100755027 3300006931 Unclassified 1061
292 Ga0097620_101239845 3300006931 Bacteria 821
293 Ga0105240_10000716 3300009093 Bacteria 60717
294 Ga0105240_10001832 3300009093 Bacteria 35593
295 Ga0105240_10002222 3300009093 Bacteria 31574
296 Ga0105240_10002441 3300009093 Bacteria 29891
297 Ga0105240_10003315 3300009093 Bacteria 25162
298 Ga0105240_10056738 3300009093 Bacteria 4898
299 Ga0105240_10073470 3300009093 Bacteria 4222
300 Ga0105240_10118862 3300009093 Bacteria 3185
301 Ga0105240_10640435 3300009093 Bacteria 1166
302 Ga0105240_11159186 3300009093 Bacteria 820
303 Ga0111539_10126346 3300009094 Bacteria 2996
304 Ga0111539_10229668 3300009094 Bacteria 2161
305 Ga0111539_10263841 3300009094 Bacteria 2005
306 Ga0111539_10776900 3300009094 Bacteria 1115
307 Ga0111539_11053826 3300009094 Bacteria 945
308 Ga0111539_11490367 3300009094 Bacteria 785
309 Ga0105245_10037818 3300009098 Bacteria 4291
310 Ga0105247_10360470 3300009101 Bacteria 1025
311 Ga0105247_10368045 3300009101 Bacteria 1015
312 Ga0114129_10022888 3300009147 Bacteria 8863
313 Ga0114129_10062353 3300009147 Bacteria 5208
314 Ga0105241_10000638 3300009174 Bacteria 26414
315 Ga0105241_10000951 3300009174 Bacteria 21901
316 Ga0105241_10044054 3300009174 Bacteria 3381
317 Ga0105241_10126331 3300009174 Bacteria 2066
318 Ga0105241_10165509 3300009174 Bacteria 1822
319 Ga0105241_10234508 3300009174 Bacteria 1548
320 Ga0105241_10358228 3300009174 Bacteria 1269
321 Ga0105241_10683292 3300009174 Bacteria 935
322 Ga0105241_11121544 3300009174 Bacteria 742
323 Ga0105242_10038646 3300009176 Bacteria 3839
324 Ga0105242_10123033 3300009176 Bacteria 2229
325 Ga0105242_10819652 3300009176 Bacteria 923
326 Ga0105242_10927377 3300009176 Bacteria 873
327 Ga0105248_10181231 3300009177 Bacteria 2373
328 Ga0105248_10328539 3300009177 Bacteria 1722
329 Ga0105237_10004721 3300009545 Bacteria 15673
330 Ga0105237_10028791 3300009545 Bacteria 5653
331 Ga0105237_10035731 3300009545 Bacteria 5027
332 Ga0105237_10038393 3300009545 Bacteria 4835
333 Ga0105237_10073217 3300009545 Bacteria 3418
334 Ga0105237_10079005 3300009545 Bacteria 3280
335 Ga0105237_10091224 3300009545 Bacteria 3036
336 Ga0105237_10106296 3300009545 Bacteria 2798
337 Ga0105237_10224500 3300009545 Bacteria 1879
338 Ga0105237_10865937 3300009545 Bacteria 910
339 Ga0105237_11938065 3300009545 Bacteria 597
340 Ga0105238_10001000 3300009551 Bacteria 28850
341 Ga0105238_10023465 3300009551 Bacteria 6288
342 Ga0105238_10670185 3300009551 Bacteria 1048
343 Ga0105249_10003003 3300009553 Bacteria 14553
344 Ga0105249_10006053 3300009553 Bacteria 10483
345 Ga0105249_10146223 3300009553 Bacteria 2271
346 Ga0105249_10205830 3300009553 Bacteria 1928
347 Ga0105249_10416943 3300009553 Bacteria 1376
348 Ga0105249_11539037 3300009553 Bacteria 737
349 Ga0105239_10001821 3300010375 Bacteria 27926
350 Ga0105239_10007877 3300010375 Bacteria 12177
351 Ga0105239_10025404 3300010375 Bacteria 6522
352 Ga0105239_10027514 3300010375 Bacteria 6258
353 Ga0105239_10113563 3300010375 Bacteria 3004
354 Ga0105239_10292576 3300010375 Bacteria 1834
355 Ga0105246_10441639 3300011119 Bacteria 1091
356 Ga0105246_10525400 3300011119 Bacteria 1009
357 Ga0105246_10583305 3300011119 Bacteria 963
358 Ga0105246_10709751 3300011119 Bacteria 882
359 Ga0157373_10002835 3300013100 Bacteria 13111
360 Ga0157373_10025126 3300013100 Bacteria 4312
361 Ga0157373_10337129 3300013100 Bacteria 1074
362 Ga0157371_10001448 3300013102 Bacteria 24636
363 Ga0157371_10003113 3300013102 Bacteria 15341
364 Ga0157371_10094621 3300013102 Bacteria 2117
365 Ga0157371_10411292 3300013102 Bacteria 991
366 Ga0157370_10001290 3300013104 Bacteria 31329
367 Ga0157370_10001459 3300013104 Bacteria 29237
368 Ga0157370_10005908 3300013104 Bacteria 13644
369 Ga0157370_10013052 3300013104 Bacteria 8579
370 Ga0157370_10025903 3300013104 Bacteria 5799
371 Ga0157370_10074596 3300013104 Bacteria 3200
372 Ga0157370_10092862 3300013104 Bacteria 2832
373 Ga0157370_10487068 3300013104 Bacteria 1133
374 Ga0157370_10957438 3300013104 Bacteria 776
375 Ga0157370_11403034 3300013104 Bacteria 629
376 Ga0157369_10010084 3300013105 Bacteria 10789
377 Ga0157369_10042043 3300013105 Bacteria 4987
378 Ga0157369_10133629 3300013105 Bacteria 2628
379 Ga0157369_10306992 3300013105 Bacteria 1650
380 Ga0157374_10000007 3300013296 Bacteria 595643
381 Ga0157374_10000266 3300013296 Bacteria 48468
382 Ga0157374_10005639 3300013296 Bacteria 10552
383 Ga0157374_10126120 3300013296 Bacteria 2475
384 Ga0157374_10501211 3300013296 Bacteria 1219
385 Ga0157374_10938873 3300013296 Bacteria 883
386 Ga0157378_10002479 3300013297 Bacteria 16428
387 Ga0157378_10008516 3300013297 Bacteria 8928
388 Ga0157378_10020629 3300013297 Bacteria 5796
389 Ga0157378_10099260 3300013297 Bacteria 2656
390 Ga0157378_10220435 3300013297 Bacteria 1803
391 Ga0157378_10368270 3300013297 Bacteria 1408
392 Ga0157378_10421892 3300013297 Bacteria 1319
393 Ga0157378_10448251 3300013297 Bacteria 1280
394 Ga0157378_10525970 3300013297 Bacteria 1185
395 Ga0157378_10678976 3300013297 Bacteria 1048
396 Ga0157378_10804968 3300013297 Bacteria 966
397 Ga0157378_11016333 3300013297 Bacteria 864
398 Ga0163162_10000037 3300013306 Bacteria 138420
399 Ga0163162_10000397 3300013306 Bacteria 39878
400 Ga0163162_10000934 3300013306 Bacteria 27147
401 Ga0163162_10006744 3300013306 Bacteria 11141
402 Ga0163162_10010199 3300013306 Bacteria 9126
403 Ga0163162_10060891 3300013306 Bacteria 3811
404 Ga0163162_10087258 3300013306 Bacteria 3198
405 Ga0163162_10130797 3300013306 Bacteria 2618
406 Ga0163162_10286830 3300013306 Bacteria 1778
407 Ga0163162_10769676 3300013306 Bacteria 1081
408 Ga0163162_10777646 3300013306 Bacteria 1076
409 Ga0163162_10924714 3300013306 Bacteria 984
410 Ga0163162_11786196 3300013306 Bacteria 703
411 Ga0163162_12494935 3300013306 Bacteria 594
412 Ga0157372_10001489 3300013307 Bacteria 25446
413 Ga0157372_10234137 3300013307 Bacteria 2130
414 Ga0157372_10301812 3300013307 Bacteria 1863
415 Ga0157372_10508516 3300013307 Bacteria 1404
416 Ga0157372_10854084 3300013307 Bacteria 1057
417 Ga0157372_11124226 3300013307 Bacteria 909
418 Ga0157372_12111019 3300013307 Bacteria 647
419 Ga0157375_10000346 3300013308 Bacteria 41874
420 Ga0157375_10005834 3300013308 Bacteria 10714
421 Ga0157375_10149947 3300013308 Bacteria 2466
422 Ga0157375_10165750 3300013308 Bacteria 2354
423 Ga0157375_10233807 3300013308 Bacteria 1997
424 Ga0157375_10428440 3300013308 Bacteria 1489
425 Ga0157375_10455675 3300013308 Bacteria 1444
426 Ga0157375_10512479 3300013308 Bacteria 1363
427 Ga0157375_10801570 3300013308 Bacteria 1090
428 Ga0163163_10003157 3300014325 Bacteria 13961
429 Ga0163163_10143265 3300014325 Bacteria 2432
430 Ga0163163_10191663 3300014325 Bacteria 2093
431 Ga0163163_10207011 3300014325 Bacteria 2010
432 Ga0163163_10258750 3300014325 Bacteria 1791
433 Ga0163163_10659660 3300014325 Bacteria 1110
434 Ga0163163_10864005 3300014325 Bacteria 968
435 Ga0163163_11025921 3300014325 Bacteria 888
436 Ga0163163_11109697 3300014325 Bacteria 854
437 Ga0163163_11168471 3300014325 Bacteria 832
438 Ga0157380_10005817 3300014326 Bacteria 8635
439 Ga0157380_10160443 3300014326 Bacteria 1954
440 Ga0157380_10508091 3300014326 Bacteria 1172
441 Ga0157380_10774236 3300014326 Bacteria 974
442 Ga0157380_10929558 3300014326 Bacteria 898
443 Ga0182008_10000668 3300014497 Bacteria 24875
444 Ga0157377_10038906 3300014745 Bacteria 2628
445 Ga0157377_10054477 3300014745 Bacteria 2264
446 Ga0157377_10120692 3300014745 Unclassified 1588
447 Ga0157377_10218741 3300014745 Bacteria 1218
448 Ga0157377_10237609 3300014745 Bacteria 1175
449 Ga0157377_10247791 3300014745 Bacteria 1153
450 Ga0157379_10000229 3300014968 Bacteria 43909
451 Ga0157379_10017277 3300014968 Bacteria 6355
452 Ga0157379_10068586 3300014968 Bacteria 3170
453 Ga0157379_10102107 3300014968 Bacteria 2574
454 Ga0157379_10153165 3300014968 Bacteria 2080
455 Ga0157379_10442320 3300014968 Bacteria 1199
456 Ga0157379_10649605 3300014968 Bacteria 987
457 Ga0157376_10000117 3300014969 Bacteria 56126
458 Ga0157376_10005117 3300014969 Bacteria 9140
459 Ga0157376_10068408 3300014969 Bacteria 3007
460 Ga0157376_10172914 3300014969 Unclassified 1968
461 Ga0157376_10221722 3300014969 Bacteria 1752
462 Ga0157376_10779702 3300014969 Bacteria 967
463 Ga0157376_10812725 3300014969 Bacteria 948
464 Ga0163161_10000019 3300017792 Bacteria 216758
465 Ga0163161_10027837 3300017792 Bacteria 4010
466 Ga0163161_10037360 3300017792 Bacteria 3482
467 Ga0163161_10077415 3300017792 Bacteria 2443
468 Ga0163161_10093388 3300017792 Bacteria 2229
469 Ga0163161_10141132 3300017792 Bacteria 1824
470 Ga0163161_10333225 3300017792 Bacteria 1202
471 Ga0163161_10418895 3300017792 Bacteria 1077
472 Ga0163161_10878794 3300017792 Bacteria 758
473 Ga0206352_10768305 3300020078 Bacteria 666
474 Ga0213876_10024159 3300021384 Bacteria 3208
475 Ga0209258_100041 3300025242 Bacteria 381381
476 Ga0209148_1000090 3300025254 Bacteria 250982
477 Ga0207426_1000023 3300025302 Bacteria 545465
478 Ga0207697_10162236 3300025315 Bacteria 975
479 Ga0207697_10215228 3300025315 Bacteria 847
480 Ga0207656_10000261 3300025321 Bacteria 18358
481 Ga0207656_10048031 3300025321 Bacteria 1837
482 Ga0207656_10205995 3300025321 Bacteria 951
483 Ga0207713_1189406 3300025735 Bacteria 637
484 Ga0207682_10013673 3300025893 Bacteria 3160
485 Ga0207682_10018427 3300025893 Bacteria 2730
486 Ga0207642_10167277 3300025899 Bacteria 1186
487 Ga0207688_10028997 3300025901 Bacteria 3044
488 Ga0207688_10321476 3300025901 Bacteria 949
489 Ga0207688_10407011 3300025901 Bacteria 844
490 Ga0207680_10103352 3300025903 Bacteria 1835
491 Ga0207647_10012021 3300025904 Bacteria 6041
492 Ga0207647_10042106 3300025904 Bacteria 2867
493 Ga0207685_10029057 3300025905 Bacteria 1953
494 Ga0207685_10439187 3300025905 Unclassified 676
495 Ga0207645_10000836 3300025907 Bacteria 25657
496 Ga0207645_10010983 3300025907 Bacteria 6195
497 Ga0207645_10173890 3300025907 Bacteria 1412
498 Ga0207645_10188255 3300025907 Bacteria 1356
499 Ga0207643_10018006 3300025908 Bacteria 3868
500 Ga0207643_10059071 3300025908 Bacteria 2187
501 Ga0207643_10330463 3300025908 Unclassified 954
502 Ga0207705_10158134 3300025909 Bacteria 1701
503 Ga0207654_10000832 3300025911 Bacteria 16989
504 Ga0207654_10001898 3300025911 Bacteria 10843
505 Ga0207654_10056552 3300025911 Bacteria 2276
506 Ga0207654_10102456 3300025911 Bacteria 1766
507 Ga0207707_10001200 3300025912 Bacteria 24391
508 Ga0207695_10000130 3300025913 Bacteria 224214
509 Ga0207695_10000862 3300025913 Bacteria 55457
510 Ga0207695_10003201 3300025913 Bacteria 23318
511 Ga0207695_10010277 3300025913 Bacteria 11466
512 Ga0207695_10025833 3300025913 Bacteria 6566
513 Ga0207695_10036723 3300025913 Bacteria 5293
514 Ga0207695_10055439 3300025913 Bacteria 4130
515 Ga0207695_10056110 3300025913 Bacteria 4101
516 Ga0207695_10834588 3300025913 Bacteria 802
517 Ga0207671_10001678 3300025914 Bacteria 25122
518 Ga0207671_10030243 3300025914 Unclassified 4040
519 Ga0207671_10073775 3300025914 Bacteria 2549
520 Ga0207660_10000111 3300025917 Bacteria 46780
521 Ga0207662_10009337 3300025918 Bacteria 5393
522 Ga0207662_10063870 3300025918 Bacteria 2214
523 Ga0207662_10110373 3300025918 Bacteria 1714
524 Ga0207662_10190985 3300025918 Bacteria 1321
525 Ga0207662_10612217 3300025918 Bacteria 758
526 Ga0207657_10061731 3300025919 Bacteria 3212
527 Ga0207657_10062510 3300025919 Bacteria 3187
528 Ga0207649_10007630 3300025920 Bacteria 5882
529 Ga0207649_10683650 3300025920 Bacteria 795
530 Ga0207652_10000460 3300025921 Bacteria 42038
531 Ga0207646_11280440 3300025922 Bacteria 641
532 Ga0207681_10064601 3300025923 Bacteria 2528
533 Ga0207650_10030551 3300025925 Bacteria 3882
534 Ga0207650_10092790 3300025925 Bacteria 2310
535 Ga0207650_10111835 3300025925 Bacteria 2115
536 Ga0207650_10208471 3300025925 Bacteria 1569
537 Ga0207650_10400276 3300025925 Bacteria 1136
538 Ga0207650_10811709 3300025925 Bacteria 793
539 Ga0207650_10831640 3300025925 Bacteria 783
540 Ga0207659_10062388 3300025926 Bacteria 2690
541 Ga0207659_10078574 3300025926 Bacteria 2432
542 Ga0207687_10101167 3300025927 Bacteria 2121
543 Ga0207644_10183600 3300025931 Bacteria 1641
544 Ga0207644_10214902 3300025931 Bacteria 1522
545 Ga0207644_10532878 3300025931 Bacteria 971
546 Ga0207644_10550658 3300025931 Bacteria 955
547 Ga0207644_10595348 3300025931 Unclassified 918
548 Ga0207690_10042278 3300025932 Bacteria 2992
549 Ga0207690_10624323 3300025932 Bacteria 881
550 Ga0207706_10012970 3300025933 Bacteria 7585
551 Ga0207706_10094095 3300025933 Bacteria 2636
552 Ga0207706_10444161 3300025933 Bacteria 1122
553 Ga0207706_10659815 3300025933 Bacteria 895
554 Ga0207706_11109468 3300025933 Bacteria 661
555 Ga0207686_10196444 3300025934 Bacteria 1442
556 Ga0207670_10002725 3300025936 Bacteria 9297
557 Ga0207670_10023717 3300025936 Bacteria 3823
558 Ga0207670_10100184 3300025936 Bacteria 2068
559 Ga0207670_10597775 3300025936 Bacteria 906
560 Ga0207669_10061032 3300025937 Bacteria 2314
561 Ga0207669_10076404 3300025937 Bacteria 2126
562 Ga0207669_10587879 3300025937 Bacteria 903
563 Ga0207669_10774412 3300025937 Bacteria 794
564 Ga0207704_10440910 3300025938 Bacteria 1037
565 Ga0207691_10000001 3300025940 Bacteria 220829
566 Ga0207691_10008281 3300025940 Bacteria 9983
567 Ga0207691_10014883 3300025940 Bacteria 7413
568 Ga0207691_10040431 3300025940 Bacteria 4308
569 Ga0207691_10196770 3300025940 Bacteria 1756
570 Ga0207691_10720557 3300025940 Bacteria 841
571 Ga0207711_10024205 3300025941 Bacteria 5082
572 Ga0207689_10003189 3300025942 Bacteria 15041
573 Ga0207689_10004326 3300025942 Bacteria 12934
574 Ga0207689_10005568 3300025942 Bacteria 11246
575 Ga0207689_10006425 3300025942 Bacteria 10392
576 Ga0207689_10007832 3300025942 Bacteria 9338
577 Ga0207689_10025740 3300025942 Bacteria 4930
578 Ga0207689_10455855 3300025942 Bacteria 1069
579 Ga0207689_10507211 3300025942 Bacteria 1011
580 Ga0207689_10545053 3300025942 Bacteria 974
581 Ga0207661_10002005 3300025944 Bacteria 14029
582 Ga0207661_10005743 3300025944 Bacteria 8752
583 Ga0207661_10646522 3300025944 Bacteria 972
584 Ga0207661_10802450 3300025944 Bacteria 867
585 Ga0207679_10007874 3300025945 Bacteria 6770
586 Ga0207679_10085888 3300025945 Bacteria 2418
587 Ga0207679_10235339 3300025945 Bacteria 1549
588 Ga0207679_10653178 3300025945 Bacteria 951
589 Ga0207679_11115646 3300025945 Bacteria 724
590 Ga0207667_10000131 3300025949 Bacteria 115088
591 Ga0207667_10000915 3300025949 Bacteria 37602
592 Ga0207667_10029805 3300025949 Bacteria 5912
593 Ga0207667_10131183 3300025949 Bacteria 2581
594 Ga0207667_10176469 3300025949 Bacteria 2195
595 Ga0207651_10002426 3300025960 Bacteria 8910
596 Ga0207651_10010285 3300025960 Bacteria 5177
597 Ga0207651_10068688 3300025960 Bacteria 2499
598 Ga0207651_10090083 3300025960 Bacteria 2241
599 Ga0207651_10228644 3300025960 Bacteria 1508
600 Ga0207651_10237200 3300025960 Bacteria 1484
601 Ga0207651_10270498 3300025960 Bacteria 1399
602 Ga0207651_10485438 3300025960 Bacteria 1066
603 Ga0207712_10002527 3300025961 Bacteria 11765
604 Ga0207712_10010105 3300025961 Bacteria 5984
605 Ga0207712_10064097 3300025961 Bacteria 2619
606 Ga0207712_10110548 3300025961 Bacteria 2061
607 Ga0207712_10587762 3300025961 Bacteria 962
608 Ga0207712_10771483 3300025961 Bacteria 844
609 Ga0207712_11112295 3300025961 Bacteria 703
610 Ga0207668_10000263 3300025972 Bacteria 35099
611 Ga0207668_10028862 3300025972 Bacteria 3632
612 Ga0207668_11665666 3300025972 Bacteria 576
613 Ga0207640_10159394 3300025981 Bacteria 1668
614 Ga0207640_10227640 3300025981 Unclassified 1432
615 Ga0207640_10688221 3300025981 Bacteria 875
616 Ga0207640_10742989 3300025981 Bacteria 845
617 Ga0207658_10001591 3300025986 Bacteria 17504
618 Ga0207658_10070645 3300025986 Bacteria 2642
619 Ga0207658_10183781 3300025986 Bacteria 1732
620 Ga0207658_10342972 3300025986 Bacteria 1299
621 Ga0207658_10484722 3300025986 Bacteria 1099
622 Ga0207658_10535027 3300025986 Bacteria 1047
623 Ga0207658_10549260 3300025986 Bacteria 1033
624 Ga0207658_10676222 3300025986 Bacteria 932
625 Ga0207658_10757176 3300025986 Bacteria 880
626 Ga0207658_11311218 3300025986 Bacteria 662
627 Ga0207677_10001832 3300026023 Bacteria 11222
628 Ga0207677_10018283 3300026023 Bacteria 4202
629 Ga0207677_10443891 3300026023 Bacteria 1110
630 Ga0207677_10553346 3300026023 Bacteria 1003
631 Ga0207677_10851475 3300026023 Bacteria 819
632 Ga0207677_11297683 3300026023 Bacteria 668
633 Ga0207703_10003862 3300026035 Bacteria 12452
634 Ga0207703_10023210 3300026035 Bacteria 4873
635 Ga0207639_10009269 3300026041 Bacteria 6788
636 Ga0207639_10025486 3300026041 Bacteria 4288
637 Ga0207639_10311053 3300026041 Bacteria 1395
638 Ga0207678_10103764 3300026067 Bacteria 2426
639 Ga0207678_10945014 3300026067 Bacteria 763
640 Ga0207708_10393150 3300026075 Bacteria 1145
641 Ga0207708_10452445 3300026075 Bacteria 1070
642 Ga0207708_10486031 3300026075 Bacteria 1033
643 Ga0207702_10053631 3300026078 Bacteria 3414
644 Ga0207702_10104747 3300026078 Bacteria 2504
645 Ga0207702_10131310 3300026078 Bacteria 2254
646 Ga0207702_11020443 3300026078 Bacteria 821
647 Ga0207641_10000756 3300026088 Bacteria 34796
648 Ga0207641_10001344 3300026088 Bacteria 24357
649 Ga0207641_10016156 3300026088 Bacteria 6112
650 Ga0207641_10077492 3300026088 Bacteria 2877
651 Ga0207641_10157032 3300026088 Bacteria 2065
652 Ga0207641_10348842 3300026088 Bacteria 1410
653 Ga0207641_10549490 3300026088 Bacteria 1126
654 Ga0207648_10008820 3300026089 Bacteria 9713
655 Ga0207648_10013563 3300026089 Bacteria 7573
656 Ga0207648_10052501 3300026089 Bacteria 3564
657 Ga0207648_10117789 3300026089 Bacteria 2334
658 Ga0207648_10203231 3300026089 Bacteria 1757
659 Ga0207676_10005739 3300026095 Bacteria 8782
660 Ga0207676_10006275 3300026095 Bacteria 8396
661 Ga0207676_10011337 3300026095 Bacteria 6373
662 Ga0207676_10098896 3300026095 Bacteria 2413
663 Ga0207676_10424949 3300026095 Bacteria 1247
664 Ga0207676_10764577 3300026095 Unclassified 940
665 Ga0207676_11114558 3300026095 Bacteria 780
666 Ga0207676_11423860 3300026095 Bacteria 689
667 Ga0207676_11895318 3300026095 Bacteria 595
668 Ga0207674_10001708 3300026116 Bacteria 28109
669 Ga0207674_10009425 3300026116 Bacteria 11156
670 Ga0207674_10058277 3300026116 Bacteria 3913
671 Ga0207674_10128022 3300026116 Bacteria 2503
672 Ga0207674_10141114 3300026116 Bacteria 2368
673 Ga0207674_10248932 3300026116 Bacteria 1724
674 Ga0207674_11009234 3300026116 Bacteria 801
675 Ga0207675_100020739 3300026118 Bacteria 6127
676 Ga0207675_100056045 3300026118 Bacteria 3677
677 Ga0207675_100194729 3300026118 Bacteria 1945
678 Ga0207675_100300594 3300026118 Bacteria 1563
679 Ga0207675_100300727 3300026118 Bacteria 1563
680 Ga0207675_101567698 3300026118 Bacteria 679
681 Ga0207675_101847596 3300026118 Unclassified 623
682 Ga0207683_10018226 3300026121 Bacteria 5988
683 Ga0207683_10039309 3300026121 Bacteria 4127
684 Ga0207683_10193549 3300026121 Bacteria 1847
685 Ga0207683_10250160 3300026121 Bacteria 1618
686 Ga0207698_10004388 3300026142 Bacteria 8593
687 Ga0207698_10088404 3300026142 Bacteria 2527
688 Ga0207698_10194177 3300026142 Bacteria 1812
689 Ga0207698_10723653 3300026142 Bacteria 992
690 Ga0207698_10821970 3300026142 Unclassified 933
691 Ga0207698_10865389 3300026142 Bacteria 909
692 Ga0207698_10990130 3300026142 Bacteria 851
693 Ga0207698_11364486 3300026142 Bacteria 724
694 Ga0207698_11365210 3300026142 Bacteria 724
695 Ga0207428_10066121 3300027907 Bacteria 2849
696 Ga0207428_10102899 3300027907 Bacteria 2205
697 Ga0207428_10232171 3300027907 Bacteria 1380
698 Ga0268266_10000024 3300028379 Bacteria 490820
699 Ga0268266_10001506 3300028379 Bacteria 27540
700 Ga0268266_10003844 3300028379 Bacteria 14659
701 Ga0268266_10534527 3300028379 Bacteria 1122
702 Ga0268265_10109775 3300028380 Bacteria 2249
703 Ga0268265_10438788 3300028380 Bacteria 1217
704 Ga0268265_10513354 3300028380 Bacteria 1131
705 Ga0268265_10624636 3300028380 Bacteria 1033
706 Ga0268265_10694665 3300028380 Bacteria 982
707 Ga0268265_11223007 3300028380 Bacteria 749
708 Ga0268265_11536993 3300028380 Bacteria 670
709 Ga0268264_10000915 3300028381 Bacteria 30897
710 Ga0268264_10027244 3300028381 Bacteria 4667
711 Ga0268264_10027327 3300028381 Bacteria 4661
712 Ga0268264_10043221 3300028381 Bacteria 3733
713 Ga0268264_10094548 3300028381 Bacteria 2584
714 Ga0268264_10215744 3300028381 Bacteria 1764
715 Ga0268264_10258000 3300028381 Bacteria 1622
716 Ga0268264_10425039 3300028381 Bacteria 1282
717 Ga0268264_10602124 3300028381 Bacteria 1083
718 Ga0268264_10851076 3300028381 Bacteria 913
719 Ga0268264_11342751 3300028381 Unclassified 725
720 Ga0307517_10002909 3300028786 Bacteria 27119
721 Ga0307515_10000001 3300028794 Bacteria 4259510
722 Ga0307515_10072791 3300028794 Bacteria 4630
723 Ga0307511_10000680 3300030521 Bacteria 36246
724 Ga0265327_10000009 3300031251 Bacteria 616360
725 Ga0265327_10000191 3300031251 Bacteria 130083
726 Ga0307513_10116829 3300031456 Bacteria 2646
727 Ga0307513_10219513 3300031456 Bacteria 1724
728 Ga0307513_10445803 3300031456 Bacteria 1020
729 Ga0307509_10133581 3300031507 Bacteria 2432
730 Ga0307509_10418288 3300031507 Unclassified 1042
731 Ga0307413_10081837 3300031824 Bacteria 2072
732 Ga0307413_10215995 3300031824 Bacteria 1397
733 Ga0307413_11112420 3300031824 Bacteria 683
734 Ga0307410_10863834 3300031852 Bacteria 773
735 Ga0307407_10345016 3300031903 Bacteria 1053
736 Ga0307412_10513322 3300031911 Bacteria 1000
737 Ga0307414_10000268 3300032004 Bacteria 32688
738 Ga0307414_10378258 3300032004 Bacteria 1223
739 Ga0307414_11249214 3300032004 Bacteria 688
740 Ga0307414_11431005 3300032004 Unclassified 643
741 Ga0307414_11648976 3300032004 Bacteria 598
742 Ga0307411_10165014 3300032005 Bacteria 1664
743 Ga0307411_10283123 3300032005 Bacteria 1320
744 Ga0307415_101242997 3300032126 Bacteria 703
745 Ga0373943_0623808 3300035170 Bacteria 636
746 Ga0373943_0642583 3300035170 Bacteria 627
747 Ga0373955_0125081 3300035172 Bacteria 1497
748 Ga0373955_0354307 3300035172 Bacteria 889
749 Ga0373955_0562774 3300035172 Bacteria 698
750 Ga0373924_0135494 3300035410 Bacteria 1073
751 Ga0373935_1261187 3300035692 Bacteria 551
752 Ga0373933_0450106 3300035724 Bacteria 842
753 Ga0373947_0066714 3300035725 Bacteria 2197
754 Ga0373937_0014633 3300036401 Bacteria 6928
755 Ga0316584_0580607 3300036712 Bacteria 779
756 Ga0373925_0044251 3300037068 Bacteria 3306
757 Ga0395900_0731230 3300037418 Bacteria 921
758 Ga0436365_0373370 3300039437 Bacteria 18775
759 Ga0436365_1440691 3300039437 Bacteria 713
760 Ga0451791_0419064 3300041451 Bacteria 613
761 Ga0451807_1080023 3300041486 Bacteria 754
762 Ga0451807_1086769 3300041486 Bacteria 549
763 Ga0451843_0283103 3300041509 Bacteria 614
764 Ga0439441_011478 3300042001 Bacteria 1503
765 Ga0439450_221238 3300042008 Bacteria 510
766 Ga0450921_003691 3300042123 Bacteria 1089
767 Ga0450923_130288 3300042125 Bacteria 598
768 Ga0439444_0020382 3300042437 Bacteria 1166
769 Ga0450893_0054898 3300042532 Bacteria 752
770 Ga0451577_0000213 3300042876 Bacteria 121176
771 Ga0451577_0032736 3300042876 Bacteria 4685
772 Ga0466972_0133411 3300044658 Bacteria 1169
773 Ga0466961_0146090 3300044693 Bacteria 1479
774 Ga0453684_0064971 3300044712 Bacteria 4657
775 Ga0453684_0102824 3300044712 Bacteria 3492
776 Ga0453684_0481203 3300044712 Bacteria 1377
777 Ga0466957_0000776 3300044842 Bacteria 16313
778 Ga0466957_0007665 3300044842 Bacteria 6106
779 Ga0466957_0210564 3300044842 Bacteria 1280
780 Ga0466957_0325055 3300044842 Bacteria 1039
781 Ga0451576_0191556 3300045051 Bacteria 2136
782 Ga0495629_0052891 3300046459 Bacteria 2842
783 Ga0495638_0166984 3300046460 Bacteria 1265
784 Ga0495638_0329382 3300046460 Bacteria 813
785 Ga0495580_0179895 3300046472 Bacteria 1460
786 Ga0495639_0023369 3300046475 Bacteria 2717
787 Ga0495639_0409964 3300046475 Bacteria 685
788 Ga0495585_0371432 3300046492 Bacteria 692
789 Ga0495607_0160503 3300046501 Bacteria 1143
790 Ga0495610_0259766 3300046512 Bacteria 684
791 Ga0495630_0089663 3300046517 Bacteria 2323
792 Ga0495632_0129002 3300046519 Bacteria 1178
793 Ga0495648_0004199 3300046524 Bacteria 12371
794 Ga0495652_0098214 3300046529 Bacteria 2381
795 Ga0495652_1095954 3300046529 Bacteria 517
796 Ga0495665_0066441 3300046531 Bacteria 1903
797 Ga0495587_0424456 3300046536 Bacteria 738
798 Ga0495598_0105235 3300046537 Bacteria 939
799 Ga0495598_0165928 3300046537 Bacteria 780
800 Ga0495645_0323083 3300046543 Bacteria 1001
801 Ga0495645_0775995 3300046543 Bacteria 577
802 Ga0495622_0059676 3300046557 Bacteria 1766
803 Ga0495668_0001416 3300046616 Bacteria 23342
804 Ga0495668_0001567 3300046616 Bacteria 21672
805 Ga0495625_0205359 3300046660 Bacteria 1298
806 Ga0495635_0039725 3300046663 Bacteria 3254
807 Ga0495657_0313640 3300046675 Bacteria 933
808 Ga0495647_0272755 3300046681 Bacteria 757
809 Ga0495658_0183159 3300046683 Bacteria 1300
810 Ga0495649_0398571 3300046694 Bacteria 691
811 Ga0495600_0048383 3300046809 Bacteria 2774
812 Ga0495604_0227780 3300047317 Unclassified 1280
813 Ga0495636_0264430 3300047318 Bacteria 798
814 Ga0495674_0166410 3300047319 Bacteria 1842
815 Ga0495674_0183898 3300047319 Bacteria 1739
816 Ga0495674_0728174 3300047319 Bacteria 776
817 Ga0495672_0011842 3300047320 Bacteria 6125
818 Ga0495672_0035492 3300047320 Bacteria 3071
819 Ga0495672_0309549 3300047320 Bacteria 745
820 Ga0495687_000014 3300047443 Bacteria 366896
821 Ga0495686_0000034 3300047472 Bacteria 325038
822 Ga0495686_0042904 3300047472 Bacteria 2872
823 Ga0496104_0262147 3300048907 Bacteria 1641
824 Ga0496104_0566379 3300048907 Bacteria 1047
825 Ga0496104_0590328 3300048907 Bacteria 1021
826 Ga0496105_0126827 3300048908 Bacteria 2104
827 Ga0496108_0169857 3300048911 Bacteria 1887
828 Ga0496108_0384570 3300048911 Bacteria 1225
829 Ga0496109_0018089 3300048912 Bacteria 6189
830 Ga0496109_0441181 3300048912 Bacteria 1230
831 Ga0496109_0638213 3300048912 Bacteria 1002
832 Ga0496109_0785594 3300048912 Bacteria 890
833 Ga0496110_0597437 3300048913 Bacteria 1001
834 Ga0496110_0628824 3300048913 Bacteria 972
835 Ga0496111_0737091 3300048914 Bacteria 715
836 Ga0496113_0788716 3300048916 Bacteria 755
837 Ga0496114_0000244 3300048917 Bacteria 39586
838 Ga0496115_0165551 3300048918 Bacteria 1828
839 Ga0496121_0000030 3300048924 Bacteria 412079
840 Ga0496126_0159142 3300048929 Bacteria 1931
841 Ga0501306_036021 3300049127 Bacteria 753
842 Ga0501290_023394 3300049513 Bacteria 857
843 Ga0501325_003931 3300049541 Bacteria 1110
844 Ga0501334_05371 3300049550 Bacteria 844
845 Ga0501335_008302 3300049551 Bacteria 974
846 Ga0501032_0033239 3300049569 Bacteria 3534
847 Ga0501032_0036067 3300049569 Bacteria 3377
848 Ga0501034_0000115 3300049571 Bacteria 146825
849 Ga0501034_0016612 3300049571 Bacteria 7547
850 Ga0501034_0766499 3300049571 Bacteria 859
851 Ga0501036_0054893 3300049572 Bacteria 3375
852 Ga0501036_0169801 3300049572 Bacteria 1838
853 Ga0501037_0070902 3300049573 Bacteria 2535
854 Ga0501037_0249668 3300049573 Bacteria 1242
855 Ga0501039_0022511 3300049575 Bacteria 4838
856 Ga0501043_0052847 3300049579 Bacteria 3191
857 Ga0501043_0082468 3300049579 Bacteria 2527
858 Ga0501047_0052554 3300049581 Bacteria 3938
859 Ga0501047_0260193 3300049581 Bacteria 1583
860 Ga0501047_0612894 3300049581 Bacteria 909
861 Ga0501048_0180655 3300049582 Bacteria 1495
862 Ga0501067_0017414 3300049583 Bacteria 3972
863 Ga0501068_0011805 3300049584 Bacteria 4940
864 Ga0501068_0079484 3300049584 Bacteria 2011
865 Ga0501070_0131781 3300049586 Bacteria 2064
866 Ga0501070_0732102 3300049586 Bacteria 780
867 Ga0501071_1288973 3300049587 Bacteria 564
868 Ga0501072_0245996 3300049588 Bacteria 1425
869 Ga0501073_0033387 3300049589 Bacteria 3664
870 Ga0501074_0016318 3300049590 Bacteria 5392
871 Ga0501074_0176414 3300049590 Unclassified 1525
872 Ga0501198_029237 3300049649 Bacteria 912
873 Ga0501199_066127 3300049650 Bacteria 512
874 Ga0501201_003522 3300049651 Bacteria 1438
875 Ga0501202_001365 3300049652 Bacteria 3895
876 Ga0501207_012482 3300049654 Bacteria 1277
877 Ga0501211_021155 3300049658 Bacteria 684
878 Ga0501217_001386 3300049661 Bacteria 4523
879 Ga0501217_015616 3300049661 Bacteria 1732
880 Ga0501222_008357 3300049662 Bacteria 1373
881 Ga0501224_001167 3300049664 Bacteria 3445
882 Ga0501233_002195 3300049668 Bacteria 3419
883 Ga0501235_000159 3300049669 Bacteria 11662
884 Ga0501239_036527 3300049672 Bacteria 665
885 Ga0501243_001150 3300049675 Bacteria 3763
886 Ga0501250_026987 3300049680 Bacteria 777
887 Ga0501257_016868 3300049686 Bacteria 1696
888 Ga0501257_017951 3300049686 Bacteria 1648
889 Ga0501259_000917 3300049688 Bacteria 4862
890 Ga0501261_001131 3300049690 Bacteria 3269
891 Ga0501221_000734 3300049704 Bacteria 5280
892 Ga0501221_062756 3300049704 Bacteria 862
893 Ga0501225_0001133 3300049705 Bacteria 8334
894 Ga0501225_0018502 3300049705 Bacteria 1931
895 Ga0501234_000165 3300049707 Bacteria 9013
896 Ga0501234_033909 3300049707 Bacteria 828
897 Ga0501245_000740 3300049708 Bacteria 4052
898 Ga0501079_0150892 3300049741 Unclassified 1812
899 Ga0501083_0061959 3300049744 Unclassified 2497
900 Ga0501083_0187638 3300049744 Bacteria 1349
901 Ga0501264_025660 3300049761 Bacteria 651
902 Ga0501280_013073 3300049776 Bacteria 1171
903 Ga0501281_02851 3300049777 Bacteria 1246
904 Ga0501035_0034909 3300049822 Bacteria 4568
905 Ga0501035_0106263 3300049822 Bacteria 2461
906 Ga0501035_0352653 3300049822 Bacteria 1231
907 Ga0501044_0050433 3300049823 Bacteria 4294
908 Ga0501044_0120671 3300049823 Bacteria 2623
909 Ga0501044_0204649 3300049823 Bacteria 1931
910 Ga0501045_0281164 3300049824 Bacteria 1239
911 nmdc:mga0k408_208189_c1 3300050493 Bacteria 1168
912 nmdc:mga05p37_55467_c1 3300050507 Bacteria 4876
913 nmdc:mga09592_1443825_c1 3300050508 Unclassified 561
914 nmdc:mga09592_671555_c1 3300050508 Bacteria 883
915 nmdc:mga0qj67_12847_c1 3300050509 Bacteria 6318
916 nmdc:mga08y16_126655_c1 3300050511 Bacteria 2656
917 nmdc:mga08y16_230301_c1 3300050511 Bacteria 1916
918 nmdc:mga08y16_505937_c1 3300050511 Bacteria 1227
919 nmdc:mga08y16_579613_c1 3300050511 Bacteria 1133
920 nmdc:mga08y16_67495_c1 3300050511 Bacteria 3730
921 Ga0495619_0089505 3300053085 Bacteria 2083
922 Ga0500578_0000131 3300053086 Bacteria 89434
923 Ga0500646_0002639 3300053090 Bacteria 4641
924 Ga0500646_0002704 3300053090 Bacteria 4581
925 Ga0500583_0004642 3300053092 Bacteria 4508
926 Ga0500583_0344858 3300053092 Bacteria 722
927 Ga0500583_0347232 3300053092 Bacteria 719
928 Ga0500641_0000103 3300053096 Bacteria 32996
929 Ga0500556_0139200 3300053104 Bacteria 954
930 Ga0500556_0218819 3300053104 Bacteria 751
931 Ga0500562_040325 3300053108 Bacteria 1241
932 Ga0500569_003697 3300053109 Bacteria 3152
933 Ga0500642_0002513 3300053130 Bacteria 5396
934 Ga0500642_0112302 3300053130 Bacteria 1273
935 Ga0500652_042156 3300053131 Bacteria 1840
936 Ga0500658_0006229 3300053134 Bacteria 4433
937 Ga0500658_0089540 3300053134 Bacteria 1329
938 Ga0500658_0116742 3300053134 Bacteria 1180
939 Ga0500559_0055124 3300053136 Bacteria 1762
940 Ga0500568_0040912 3300053139 Bacteria 1864
941 Ga0500573_0208608 3300053140 Bacteria 1032
942 Ga0500577_0022548 3300053142 Bacteria 2091
943 Ga0500588_0048845 3300053146 Bacteria 1310
944 Ga0500588_0222399 3300053146 Bacteria 704
945 Ga0500589_027701 3300053147 Bacteria 2632
946 Ga0500616_0051262 3300053153 Bacteria 2175
947 Ga0500616_0172214 3300053153 Bacteria 982
948 Ga0500622_0001805 3300053156 Bacteria 16320
949 Ga0500634_0144562 3300053161 Bacteria 1121
950 Ga0500639_017758 3300053163 Bacteria 3755
951 Ga0500636_0027949 3300053177 Bacteria 3332
952 Ga0501084_0050027 3300054114 Bacteria 3499
953 Ga0501084_0775906 3300054114 Bacteria 807
954 Ga0587073_0095123 3300059492 Bacteria 764
955 Ga0587077_036024 3300059493 Bacteria 970
956 Ga0466962_0123321 3300061719 Bacteria 1251
957 2513233638 2513020052 Bacteria 5120511
958 2738727010 2738541278 Bacteria 9755573
959 2738735522 2738541279 Bacteria 6149495
960 2738768099 2738541285 Bacteria 6150075
961 2739217104 2738543007 Bacteria 6149845
962 2739303836 2738543023 Bacteria 6767879
963 2739648054 2739367663 Bacteria 5040914
964 2849283584 2849281842 Bacteria 6065644
965 2852629665 2852627209 Bacteria 5896285
966 2883072490 2883068021 Bacteria 6192739
967 2896112655 2896109856 Bacteria 7140722
968 2904448056 2904445276 Bacteria 5310396
969 2929178632 2929177148 Bacteria 7883697
970 2945981041 2945977869 Bacteria 7777518
971 2946019557 2946013367 Bacteria 7766675
972 8055590080 8055588893 Bacteria 3619545
973 Ga0157372_10328543
974 JGI24744J21845_10031041
975 rootH2_10078230
976 rootL2_10077383
977 rootH1_10048038
978 rootH1_10276362
979 JGI25160J50197_1004577
980 JGI25404J52841_10038704
981 Ga0055535_1016499
982 Ga0055542_1005505
983 Ga0065714_10071198
984 Ga0065712_10010481
985 Ga0065712_10027404
986 Ga0065715_10192633
987 Ga0065715_10600200
988 Ga0065707_10156427
989 Ga0070658_10000230
990 Ga0070658_10084107
991 Ga0070676_10000156
992 Ga0070676_10006420
993 Ga0070676_10076070
994 Ga0070676_10104429
995 Ga0070676_10238602
996 Ga0070676_10811797
997 Ga0070683_100001255
998 Ga0070683_100003401
999 Ga0070683_100308834
1000 Ga0070683_100363408
1001 Ga0070683_100481078
1002 Ga0070683_100487734
1003 Ga0070690_100040185
1004 Ga0070670_100016632
1005 Ga0070670_100185745
1006 Ga0070670_100699705
1007 Ga0070670_100992879
1008 Ga0070677_10020168
1009 Ga0070677_10021285
1010 Ga0068869_100002522
1011 Ga0068869_100003133
1012 Ga0068869_100004775
1013 Ga0068869_100065302
1014 Ga0068869_100138598
1015 Ga0068869_100250645
1016 Ga0068869_100279426
1017 Ga0068869_100761054
1018 Ga0070666_10038780
1019 Ga0070666_10288405
1020 Ga0070666_10983346
1021 Ga0070680_100000390
1022 Ga0070680_100094647
1023 Ga0070682_100000101
1024 Ga0070682_100002004
1025 Ga0070682_100099625
1026 Ga0070682_101001335
1027 Ga0070682_101422621
1028 Ga0068868_100005139
1029 Ga0068868_100065448
1030 Ga0068868_100074011
1031 Ga0068868_100135226
1032 Ga0068868_100458063
1033 Ga0070660_100420382
1034 Ga0070660_100534966
1035 Ga0070660_101101499
1036 Ga0070689_100035619
1037 Ga0070689_100191717
1038 Ga0070689_100192671
1039 Ga0070691_10000447
1040 Ga0070691_10201387
1041 Ga0070687_100074067
1042 Ga0070687_100114385
1043 Ga0070687_100173514
1044 Ga0070687_100221678
1045 Ga0070687_100460809
1046 Ga0070661_100008622
1047 Ga0070661_100702748
1048 Ga0070661_101122497
1049 Ga0070661_101254790
1050 Ga0070668_100000872
1051 Ga0070668_100286127
1052 Ga0070669_100208077
1053 Ga0070669_100299179
1054 Ga0070669_100440900
1055 Ga0070669_100540466
1056 Ga0070669_100577193
1057 Ga0070669_100655115
1058 Ga0070675_100086876
1059 Ga0070675_100102002
1060 Ga0070675_100124513
1061 Ga0070675_100192327
1062 Ga0070675_100998240
1063 Ga0070671_100007722
1064 Ga0070671_100139444
1065 Ga0070671_100303829
1066 Ga0070671_100538731
1067 Ga0070671_100575259
1068 Ga0070671_101153640
1069 Ga0070671_101621669
1070 Ga0070674_100022902
1071 Ga0070674_100037115
1072 Ga0070674_100366303
1073 Ga0070674_100639903
1074 Ga0070673_100000096
1075 Ga0070673_100021393
1076 Ga0070673_100043128
1077 Ga0070673_100095994
1078 Ga0070673_100318855
1079 Ga0070673_100613989
1080 Ga0070673_101423730
1081 Ga0070688_100013814
1082 Ga0070688_100059691
1083 Ga0070688_100126468
1084 Ga0070688_100150256
1085 Ga0070688_100152971
1086 Ga0070688_100476254
1087 Ga0070659_100062931
1088 Ga0070659_100328631
1089 Ga0070667_100000248
1090 Ga0070667_100009195
1091 Ga0070667_100081998
1092 Ga0070667_100265955
1093 Ga0070667_100332972
1094 Ga0070667_100424617
1095 Ga0070701_10439358
1096 Ga0070700_100024994
1097 Ga0070700_100331459
1098 Ga0070700_100491908
1099 Ga0070694_101630973
1100 Ga0070663_100285100
1101 Ga0070663_100923314
1102 Ga0070663_101308484
1103 Ga0070678_100044179
1104 Ga0070678_100106688
1105 Ga0070678_100289604
1106 Ga0070678_100472367
1107 Ga0070662_100104599
1108 Ga0070681_10011420
1109 Ga0070681_10926605
1110 Ga0068867_100015569
1111 Ga0068867_100120228
1112 Ga0068867_100122509
1113 Ga0068867_101231336
1114 Ga0068867_101358801
1115 Ga0068867_101437124
1116 Ga0070685_10033012
1117 Ga0070685_10033794
1118 Ga0070685_10048439
1119 Ga0070685_10326662
1120 Ga0070685_10730222
1121 Ga0070707_101620644
1122 Ga0070698_100007455
1123 Ga0070699_101327587
1124 Ga0070679_100000656
1125 Ga0070679_100180157
1126 Ga0070684_100000646
1127 Ga0070684_100034182
1128 Ga0070684_100122051
1129 Ga0070684_100679247
1130 Ga0070684_101232456
1131 Ga0068853_100013448
1132 Ga0068853_100031011
1133 Ga0068853_100047223
1134 Ga0068853_100417778
1135 Ga0068853_100537150
1136 Ga0070672_100000033
1137 Ga0070672_100039137
1138 Ga0070672_100048173
1139 Ga0070672_100268017
1140 Ga0070672_100499992
1141 Ga0070672_100593033
1142 Ga0070672_100621406
1143 Ga0070672_101224954
1144 Ga0070686_100012657
1145 Ga0070686_100051454
1146 Ga0070686_100179752
1147 Ga0070686_100192741
1148 Ga0070665_100000013
1149 Ga0070665_100000641
1150 Ga0070665_100004098
1151 Ga0070665_100113486
1152 Ga0070665_100264111
1153 Ga0070704_100382230
1154 Ga0068855_100002469
1155 Ga0068855_100015914
1156 Ga0068855_100221532
1157 Ga0068855_100269817
1158 Ga0070664_100032938
1159 Ga0070664_100077370
1160 Ga0070664_100079634
1161 Ga0070664_100140839
1162 Ga0070664_100186212
1163 Ga0070664_100707088
1164 Ga0070664_101050427
1165 Ga0068857_100042210
1166 Ga0068857_100069696
1167 Ga0068857_100139293
1168 Ga0068857_100167393
1169 Ga0068857_100319895
1170 Ga0068857_100785336
1171 Ga0068854_100008737
1172 Ga0068854_100042061
1173 Ga0068854_100106635
1174 Ga0068854_100261291
1175 Ga0068856_100022888
1176 Ga0070702_100043622
1177 Ga0070702_100820185
1178 Ga0068852_100022404
1179 Ga0068852_100214645
1180 Ga0068852_100392100
1181 Ga0068852_100415079
1182 Ga0068852_100583392
1183 Ga0068852_100837233
1184 Ga0068859_100001757
1185 Ga0068859_100040962
1186 Ga0068859_100053730
1187 Ga0068859_100136737
1188 Ga0068859_100473589
1189 Ga0068859_101239839
1190 Ga0068864_100001018
1191 Ga0068864_100008778
1192 Ga0068864_100048173
1193 Ga0068864_100065608
1194 Ga0068864_100152006
1195 Ga0068864_100368074
1196 Ga0068864_100430604
1197 Ga0068864_101129415
1198 Ga0068866_10529193
1199 Ga0068861_100007743
1200 Ga0068861_100074274
1201 Ga0068861_100572798
1202 Ga0068851_10021291
1203 Ga0068851_10180169
1204 Ga0068870_10020859
1205 Ga0068870_10038408
1206 Ga0068870_10708970
1207 Ga0068863_100002172
1208 Ga0068863_100107269
1209 Ga0068863_100383159
1210 Ga0068863_100536798
1211 Ga0068863_100826713
1212 Ga0068863_100828427
1213 Ga0068863_101271249
1214 Ga0068858_100000596
1215 Ga0068858_100157996
1216 Ga0068858_100176060
1217 Ga0068858_100262879
1218 Ga0068858_100308589
1219 Ga0068858_100432528
1220 Ga0068860_100000060
1221 Ga0068860_100001437
1222 Ga0068860_100009018
1223 Ga0068860_100508357
1224 Ga0068860_100651305
1225 Ga0068860_101107300
1226 Ga0068862_100011742
1227 Ga0068862_100169571
1228 Ga0068862_100237441
1229 Ga0068862_100359909
1230 Ga0068862_101206967
1231 Ga0068862_101560517
1232 Ga0081540_1006219
1233 Ga0081539_10031111
1234 Ga0081539_10080809
1235 Ga0070715_10219437
1236 Ga0075367_10708810
1237 Ga0075366_10081695
1238 Ga0075366_10150741
1239 Ga0075366_10301416
1240 Ga0097621_100000582
1241 Ga0097621_100015035
1242 Ga0097621_100015580
1243 Ga0097621_100529089
1244 Ga0097621_101194898
1245 Ga0068871_100000764
1246 Ga0068871_100002439
1247 Ga0068871_100068788
1248 Ga0068871_100079404
1249 Ga0068871_100407004
1250 Ga0075428_100178166
1251 Ga0075430_100020946
1252 Ga0068865_100112445
1253 Ga0068865_100255760
1254 Ga0068865_100290128
1255 Ga0068865_100345541
1256 Ga0068865_100490788
1257 Ga0068865_101139898
1258 Ga0097620_100001757
1259 Ga0097620_100040961
1260 Ga0097620_100053730
1261 Ga0097620_100136742
1262 Ga0097620_100473595
1263 Ga0097620_100755027
1264 Ga0097620_101239845
1265 Ga0105240_10000716
1266 Ga0105240_10001832
1267 Ga0105240_10002222
1268 Ga0105240_10002441
1269 Ga0105240_10003315
1270 Ga0105240_10056738
1271 Ga0105240_10073470
1272 Ga0105240_10118862
1273 Ga0105240_10640435
1274 Ga0105240_11159186
1275 Ga0111539_10126346
1276 Ga0111539_10229668
1277 Ga0111539_10263841
1278 Ga0111539_10776900
1279 Ga0111539_11053826
1280 Ga0111539_11490367
1281 Ga0105245_10037818
1282 Ga0105247_10360470
1283 Ga0105247_10368045
1284 Ga0114129_10022888
1285 Ga0114129_10062353
1286 Ga0105241_10000638
1287 Ga0105241_10000951
1288 Ga0105241_10044054
1289 Ga0105241_10126331
1290 Ga0105241_10165509
1291 Ga0105241_10234508
1292 Ga0105241_10358228
1293 Ga0105241_10683292
1294 Ga0105241_11121544
1295 Ga0105242_10038646
1296 Ga0105242_10123033
1297 Ga0105242_10819652
1298 Ga0105242_10927377
1299 Ga0105248_10181231
1300 Ga0105248_10328539
1301 Ga0105237_10004721
1302 Ga0105237_10028791
1303 Ga0105237_10035731
1304 Ga0105237_10038393
1305 Ga0105237_10073217
1306 Ga0105237_10079005
1307 Ga0105237_10091224
1308 Ga0105237_10106296
1309 Ga0105237_10224500
1310 Ga0105237_10865937
1311 Ga0105237_11938065
1312 Ga0105238_10001000
1313 Ga0105238_10023465
1314 Ga0105238_10670185
1315 Ga0105249_10003003
1316 Ga0105249_10006053
1317 Ga0105249_10146223
1318 Ga0105249_10205830
1319 Ga0105249_10416943
1320 Ga0105249_11539037
1321 Ga0105239_10001821
1322 Ga0105239_10007877
1323 Ga0105239_10025404
1324 Ga0105239_10027514
1325 Ga0105239_10113563
1326 Ga0105239_10292576
1327 Ga0105246_10441639
1328 Ga0105246_10525400
1329 Ga0105246_10583305
1330 Ga0105246_10709751
1331 Ga0157373_10002835
1332 Ga0157373_10025126
1333 Ga0157373_10337129
1334 Ga0157371_10001448
1335 Ga0157371_10003113
1336 Ga0157371_10094621
1337 Ga0157371_10411292
1338 Ga0157370_10001290
1339 Ga0157370_10001459
1340 Ga0157370_10005908
1341 Ga0157370_10013052
1342 Ga0157370_10025903
1343 Ga0157370_10074596
1344 Ga0157370_10092862
1345 Ga0157370_10487068
1346 Ga0157370_10957438
1347 Ga0157370_11403034
1348 Ga0157369_10010084
1349 Ga0157369_10042043
1350 Ga0157369_10133629
1351 Ga0157369_10306992
1352 Ga0157374_10000007
1353 Ga0157374_10000266
1354 Ga0157374_10005639
1355 Ga0157374_10126120
1356 Ga0157374_10501211
1357 Ga0157374_10938873
1358 Ga0157378_10002479
1359 Ga0157378_10008516
1360 Ga0157378_10020629
1361 Ga0157378_10099260
1362 Ga0157378_10220435
1363 Ga0157378_10368270
1364 Ga0157378_10421892
1365 Ga0157378_10448251
1366 Ga0157378_10525970
1367 Ga0157378_10678976
1368 Ga0157378_10804968
1369 Ga0157378_11016333
1370 Ga0163162_10000037
1371 Ga0163162_10000397
1372 Ga0163162_10000934
1373 Ga0163162_10006744
1374 Ga0163162_10010199
1375 Ga0163162_10060891
1376 Ga0163162_10087258
1377 Ga0163162_10130797
1378 Ga0163162_10286830
1379 Ga0163162_10769676
1380 Ga0163162_10777646
1381 Ga0163162_10924714
1382 Ga0163162_11786196
1383 Ga0163162_12494935
1384 Ga0157372_10001489
1385 Ga0157372_10234137
1386 Ga0157372_10301812
1387 Ga0157372_10508516
1388 Ga0157372_10854084
1389 Ga0157372_11124226
1390 Ga0157372_12111019
1391 Ga0157375_10000346
1392 Ga0157375_10005834
1393 Ga0157375_10149947
1394 Ga0157375_10165750
1395 Ga0157375_10233807
1396 Ga0157375_10428440
1397 Ga0157375_10455675
1398 Ga0157375_10512479
1399 Ga0157375_10801570
1400 Ga0163163_10003157
1401 Ga0163163_10143265
1402 Ga0163163_10191663
1403 Ga0163163_10207011
1404 Ga0163163_10258750
1405 Ga0163163_10659660
1406 Ga0163163_10864005
1407 Ga0163163_11025921
1408 Ga0163163_11109697
1409 Ga0163163_11168471
1410 Ga0157380_10005817
1411 Ga0157380_10160443
1412 Ga0157380_10508091
1413 Ga0157380_10774236
1414 Ga0157380_10929558
1415 Ga0182008_10000668
1416 Ga0157377_10038906
1417 Ga0157377_10054477
1418 Ga0157377_10120692
1419 Ga0157377_10218741
1420 Ga0157377_10237609
1421 Ga0157377_10247791
1422 Ga0157379_10000229
1423 Ga0157379_10017277
1424 Ga0157379_10068586
1425 Ga0157379_10102107
1426 Ga0157379_10153165
1427 Ga0157379_10442320
1428 Ga0157379_10649605
1429 Ga0157376_10000117
1430 Ga0157376_10005117
1431 Ga0157376_10068408
1432 Ga0157376_10172914
1433 Ga0157376_10221722
1434 Ga0157376_10779702
1435 Ga0157376_10812725
1436 Ga0163161_10000019
1437 Ga0163161_10027837
1438 Ga0163161_10037360
1439 Ga0163161_10077415
1440 Ga0163161_10093388
1441 Ga0163161_10141132
1442 Ga0163161_10333225
1443 Ga0163161_10418895
1444 Ga0163161_10878794
1445 Ga0206352_10768305
1446 Ga0213876_10024159
1447 Ga0209258_100041
1448 Ga0209148_1000090
1449 Ga0207426_1000023
1450 Ga0207697_10162236
1451 Ga0207697_10215228
1452 Ga0207656_10000261
1453 Ga0207656_10048031
1454 Ga0207656_10205995
1455 Ga0207713_1189406
1456 Ga0207682_10013673
1457 Ga0207682_10018427
1458 Ga0207642_10167277
1459 Ga0207688_10028997
1460 Ga0207688_10321476
1461 Ga0207688_10407011
1462 Ga0207680_10103352
1463 Ga0207647_10012021
1464 Ga0207647_10042106
1465 Ga0207685_10029057
1466 Ga0207685_10439187
1467 Ga0207645_10000836
1468 Ga0207645_10010983
1469 Ga0207645_10173890
1470 Ga0207645_10188255
1471 Ga0207643_10018006
1472 Ga0207643_10059071
1473 Ga0207643_10330463
1474 Ga0207705_10158134
1475 Ga0207654_10000832
1476 Ga0207654_10001898
1477 Ga0207654_10056552
1478 Ga0207654_10102456
1479 Ga0207707_10001200
1480 Ga0207695_10000130
1481 Ga0207695_10000862
1482 Ga0207695_10003201
1483 Ga0207695_10010277
1484 Ga0207695_10025833
1485 Ga0207695_10036723
1486 Ga0207695_10055439
1487 Ga0207695_10056110
1488 Ga0207695_10834588
1489 Ga0207671_10001678
1490 Ga0207671_10030243
1491 Ga0207671_10073775
1492 Ga0207660_10000111
1493 Ga0207662_10009337
1494 Ga0207662_10063870
1495 Ga0207662_10110373
1496 Ga0207662_10190985
1497 Ga0207662_10612217
1498 Ga0207657_10061731
1499 Ga0207657_10062510
1500 Ga0207649_10007630
1501 Ga0207649_10683650
1502 Ga0207652_10000460
1503 Ga0207646_11280440
1504 Ga0207681_10064601
1505 Ga0207650_10030551
1506 Ga0207650_10092790
1507 Ga0207650_10111835
1508 Ga0207650_10208471
1509 Ga0207650_10400276
1510 Ga0207650_10811709
1511 Ga0207650_10831640
1512 Ga0207659_10062388
1513 Ga0207659_10078574
1514 Ga0207687_10101167
1515 Ga0207644_10183600
1516 Ga0207644_10214902
1517 Ga0207644_10532878
1518 Ga0207644_10550658
1519 Ga0207644_10595348
1520 Ga0207690_10042278
1521 Ga0207690_10624323
1522 Ga0207706_10012970
1523 Ga0207706_10094095
1524 Ga0207706_10444161
1525 Ga0207706_10659815
1526 Ga0207706_11109468
1527 Ga0207686_10196444
1528 Ga0207670_10002725
1529 Ga0207670_10023717
1530 Ga0207670_10100184
1531 Ga0207670_10597775
1532 Ga0207669_10061032
1533 Ga0207669_10076404
1534 Ga0207669_10587879
1535 Ga0207669_10774412
1536 Ga0207704_10440910
1537 Ga0207691_10000001
1538 Ga0207691_10008281
1539 Ga0207691_10014883
1540 Ga0207691_10040431
1541 Ga0207691_10196770
1542 Ga0207691_10720557
1543 Ga0207711_10024205
1544 Ga0207689_10003189
1545 Ga0207689_10004326
1546 Ga0207689_10005568
1547 Ga0207689_10006425
1548 Ga0207689_10007832
1549 Ga0207689_10025740
1550 Ga0207689_10455855
1551 Ga0207689_10507211
1552 Ga0207689_10545053
1553 Ga0207661_10002005
1554 Ga0207661_10005743
1555 Ga0207661_10646522
1556 Ga0207661_10802450
1557 Ga0207679_10007874
1558 Ga0207679_10085888
1559 Ga0207679_10235339
1560 Ga0207679_10653178
1561 Ga0207679_11115646
1562 Ga0207667_10000131
1563 Ga0207667_10000915
1564 Ga0207667_10029805
1565 Ga0207667_10131183
1566 Ga0207667_10176469
1567 Ga0207651_10002426
1568 Ga0207651_10010285
1569 Ga0207651_10068688
1570 Ga0207651_10090083
1571 Ga0207651_10228644
1572 Ga0207651_10237200
1573 Ga0207651_10270498
1574 Ga0207651_10485438
1575 Ga0207712_10002527
1576 Ga0207712_10010105
1577 Ga0207712_10064097
1578 Ga0207712_10110548
1579 Ga0207712_10587762
1580 Ga0207712_10771483
1581 Ga0207712_11112295
1582 Ga0207668_10000263
1583 Ga0207668_10028862
1584 Ga0207668_11665666
1585 Ga0207640_10159394
1586 Ga0207640_10227640
1587 Ga0207640_10688221
1588 Ga0207640_10742989
1589 Ga0207658_10001591
1590 Ga0207658_10070645
1591 Ga0207658_10183781
1592 Ga0207658_10342972
1593 Ga0207658_10484722
1594 Ga0207658_10535027
1595 Ga0207658_10549260
1596 Ga0207658_10676222
1597 Ga0207658_10757176
1598 Ga0207658_11311218
1599 Ga0207677_10001832
1600 Ga0207677_10018283
1601 Ga0207677_10443891
1602 Ga0207677_10553346
1603 Ga0207677_10851475
1604 Ga0207677_11297683
1605 Ga0207703_10003862
1606 Ga0207703_10023210
1607 Ga0207639_10009269
1608 Ga0207639_10025486
1609 Ga0207639_10311053
1610 Ga0207678_10103764
1611 Ga0207678_10945014
1612 Ga0207708_10393150
1613 Ga0207708_10452445
1614 Ga0207708_10486031
1615 Ga0207702_10053631
1616 Ga0207702_10104747
1617 Ga0207702_10131310
1618 Ga0207702_11020443
1619 Ga0207641_10000756
1620 Ga0207641_10001344
1621 Ga0207641_10016156
1622 Ga0207641_10077492
1623 Ga0207641_10157032
1624 Ga0207641_10348842
1625 Ga0207641_10549490
1626 Ga0207648_10008820
1627 Ga0207648_10013563
1628 Ga0207648_10052501
1629 Ga0207648_10117789
1630 Ga0207648_10203231
1631 Ga0207676_10005739
1632 Ga0207676_10006275
1633 Ga0207676_10011337
1634 Ga0207676_10098896
1635 Ga0207676_10424949
1636 Ga0207676_10764577
1637 Ga0207676_11114558
1638 Ga0207676_11423860
1639 Ga0207676_11895318
1640 Ga0207674_10001708
1641 Ga0207674_10009425
1642 Ga0207674_10058277
1643 Ga0207674_10128022
1644 Ga0207674_10141114
1645 Ga0207674_10248932
1646 Ga0207674_11009234
1647 Ga0207675_100020739
1648 Ga0207675_100056045
1649 Ga0207675_100194729
1650 Ga0207675_100300594
1651 Ga0207675_100300727
1652 Ga0207675_101567698
1653 Ga0207675_101847596
1654 Ga0207683_10018226
1655 Ga0207683_10039309
1656 Ga0207683_10193549
1657 Ga0207683_10250160
1658 Ga0207698_10004388
1659 Ga0207698_10088404
1660 Ga0207698_10194177
1661 Ga0207698_10723653
1662 Ga0207698_10821970
1663 Ga0207698_10865389
1664 Ga0207698_10990130
1665 Ga0207698_11364486
1666 Ga0207698_11365210
1667 Ga0207428_10066121
1668 Ga0207428_10102899
1669 Ga0207428_10232171
1670 Ga0268266_10000024
1671 Ga0268266_10001506
1672 Ga0268266_10003844
1673 Ga0268266_10534527
1674 Ga0268265_10109775
1675 Ga0268265_10438788
1676 Ga0268265_10513354
1677 Ga0268265_10624636
1678 Ga0268265_10694665
1679 Ga0268265_11223007
1680 Ga0268265_11536993
1681 Ga0268264_10000915
1682 Ga0268264_10027244
1683 Ga0268264_10027327
1684 Ga0268264_10043221
1685 Ga0268264_10094548
1686 Ga0268264_10215744
1687 Ga0268264_10258000
1688 Ga0268264_10425039
1689 Ga0268264_10602124
1690 Ga0268264_10851076
1691 Ga0268264_11342751
1692 Ga0307517_10002909
1693 Ga0307515_10000001
1694 Ga0307515_10072791
1695 Ga0307511_10000680
1696 Ga0265327_10000009
1697 Ga0265327_10000191
1698 Ga0307513_10116829
1699 Ga0307513_10219513
1700 Ga0307513_10445803
1701 Ga0307509_10133581
1702 Ga0307509_10418288
1703 Ga0307413_10081837
1704 Ga0307413_10215995
1705 Ga0307413_11112420
1706 Ga0307410_10863834
1707 Ga0307407_10345016
1708 Ga0307412_10513322
1709 Ga0307414_10000268
1710 Ga0307414_10378258
1711 Ga0307414_11249214
1712 Ga0307414_11431005
1713 Ga0307414_11648976
1714 Ga0307411_10165014
1715 Ga0307411_10283123
1716 Ga0307415_101242997
1717 Ga0373943_0623808
1718 Ga0373943_0642583
1719 Ga0373955_0125081
1720 Ga0373955_0354307
1721 Ga0373955_0562774
1722 Ga0373924_0135494
1723 Ga0373935_1261187
1724 Ga0373933_0450106
1725 Ga0373947_0066714
1726 Ga0373937_0014633
1727 Ga0316584_0580607
1728 Ga0373925_0044251
1729 Ga0395900_0731230
1730 Ga0436365_0373370
1731 Ga0436365_1440691
1732 Ga0451791_0419064
1733 Ga0451807_1080023
1734 Ga0451807_1086769
1735 Ga0451843_0283103
1736 Ga0439441_011478
1737 Ga0439450_221238
1738 Ga0450921_003691
1739 Ga0450923_130288
1740 Ga0439444_0020382
1741 Ga0450893_0054898
1742 Ga0451577_0000213
1743 Ga0451577_0032736
1744 Ga0466972_0133411
1745 Ga0466961_0146090
1746 Ga0453684_0064971
1747 Ga0453684_0102824
1748 Ga0453684_0481203
1749 Ga0466957_0000776
1750 Ga0466957_0007665
1751 Ga0466957_0210564
1752 Ga0466957_0325055
1753 Ga0451576_0191556
1754 Ga0495629_0052891
1755 Ga0495638_0166984
1756 Ga0495638_0329382
1757 Ga0495580_0179895
1758 Ga0495639_0023369
1759 Ga0495639_0409964
1760 Ga0495585_0371432
1761 Ga0495607_0160503
1762 Ga0495610_0259766
1763 Ga0495630_0089663
1764 Ga0495632_0129002
1765 Ga0495648_0004199
1766 Ga0495652_0098214
1767 Ga0495652_1095954
1768 Ga0495665_0066441
1769 Ga0495587_0424456
1770 Ga0495598_0105235
1771 Ga0495598_0165928
1772 Ga0495645_0323083
1773 Ga0495645_0775995
1774 Ga0495622_0059676
1775 Ga0495668_0001416
1776 Ga0495668_0001567
1777 Ga0495625_0205359
1778 Ga0495635_0039725
1779 Ga0495657_0313640
1780 Ga0495647_0272755
1781 Ga0495658_0183159
1782 Ga0495649_0398571
1783 Ga0495600_0048383
1784 Ga0495604_0227780
1785 Ga0495636_0264430
1786 Ga0495674_0166410
1787 Ga0495674_0183898
1788 Ga0495674_0728174
1789 Ga0495672_0011842
1790 Ga0495672_0035492
1791 Ga0495672_0309549
1792 Ga0495687_000014
1793 Ga0495686_0000034
1794 Ga0495686_0042904
1795 Ga0496104_0262147
1796 Ga0496104_0566379
1797 Ga0496104_0590328
1798 Ga0496105_0126827
1799 Ga0496108_0169857
1800 Ga0496108_0384570
1801 Ga0496109_0018089
1802 Ga0496109_0441181
1803 Ga0496109_0638213
1804 Ga0496109_0785594
1805 Ga0496110_0597437
1806 Ga0496110_0628824
1807 Ga0496111_0737091
1808 Ga0496113_0788716
1809 Ga0496114_0000244
1810 Ga0496115_0165551
1811 Ga0496121_0000030
1812 Ga0496126_0159142
1813 Ga0501306_036021
1814 Ga0501290_023394
1815 Ga0501325_003931
1816 Ga0501334_05371
1817 Ga0501335_008302
1818 Ga0501032_0033239
1819 Ga0501032_0036067
1820 Ga0501034_0000115
1821 Ga0501034_0016612
1822 Ga0501034_0766499
1823 Ga0501036_0054893
1824 Ga0501036_0169801
1825 Ga0501037_0070902
1826 Ga0501037_0249668
1827 Ga0501039_0022511
1828 Ga0501043_0052847
1829 Ga0501043_0082468
1830 Ga0501047_0052554
1831 Ga0501047_0260193
1832 Ga0501047_0612894
1833 Ga0501048_0180655
1834 Ga0501067_0017414
1835 Ga0501068_0011805
1836 Ga0501068_0079484
1837 Ga0501070_0131781
1838 Ga0501070_0732102
1839 Ga0501071_1288973
1840 Ga0501072_0245996
1841 Ga0501073_0033387
1842 Ga0501074_0016318
1843 Ga0501074_0176414
1844 Ga0501198_029237
1845 Ga0501199_066127
1846 Ga0501201_003522
1847 Ga0501202_001365
1848 Ga0501207_012482
1849 Ga0501211_021155
1850 Ga0501217_001386
1851 Ga0501217_015616
1852 Ga0501222_008357
1853 Ga0501224_001167
1854 Ga0501233_002195
1855 Ga0501235_000159
1856 Ga0501239_036527
1857 Ga0501243_001150
1858 Ga0501250_026987
1859 Ga0501257_016868
1860 Ga0501257_017951
1861 Ga0501259_000917
1862 Ga0501261_001131
1863 Ga0501221_000734
1864 Ga0501221_062756
1865 Ga0501225_0001133
1866 Ga0501225_0018502
1867 Ga0501234_000165
1868 Ga0501234_033909
1869 Ga0501245_000740
1870 Ga0501079_0150892
1871 Ga0501083_0061959
1872 Ga0501083_0187638
1873 Ga0501264_025660
1874 Ga0501280_013073
1875 Ga0501281_02851
1876 Ga0501035_0034909
1877 Ga0501035_0106263
1878 Ga0501035_0352653
1879 Ga0501044_0050433
1880 Ga0501044_0120671
1881 Ga0501044_0204649
1882 Ga0501045_0281164
1883 nmdc:mga0k408_208189_c1
1884 nmdc:mga05p37_55467_c1
1885 nmdc:mga09592_1443825_c1
1886 nmdc:mga09592_671555_c1
1887 nmdc:mga0qj67_12847_c1
1888 nmdc:mga08y16_126655_c1
1889 nmdc:mga08y16_230301_c1
1890 nmdc:mga08y16_505937_c1
1891 nmdc:mga08y16_579613_c1
1892 nmdc:mga08y16_67495_c1
1893 Ga0495619_0089505
1894 Ga0500578_0000131
1895 Ga0500646_0002639
1896 Ga0500646_0002704
1897 Ga0500583_0004642
1898 Ga0500583_0344858
1899 Ga0500583_0347232
1900 Ga0500641_0000103
1901 Ga0500556_0139200
1902 Ga0500556_0218819
1903 Ga0500562_040325
1904 Ga0500569_003697
1905 Ga0500642_0002513
1906 Ga0500642_0112302
1907 Ga0500652_042156
1908 Ga0500658_0006229
1909 Ga0500658_0089540
1910 Ga0500658_0116742
1911 Ga0500559_0055124
1912 Ga0500568_0040912
1913 Ga0500573_0208608
1914 Ga0500577_0022548
1915 Ga0500588_0048845
1916 Ga0500588_0222399
1917 Ga0500589_027701
1918 Ga0500616_0051262
1919 Ga0500616_0172214
1920 Ga0500622_0001805
1921 Ga0500634_0144562
1922 Ga0500639_017758
1923 Ga0500636_0027949
1924 Ga0501084_0050027
1925 Ga0501084_0775906
1926 Ga0587073_0095123
1927 Ga0587077_036024
1928 Ga0466962_0123321
1929 2513233638
1930 2738727010
1931 2738735522
1932 2738768099
1933 2739217104
1934 2739303836
1935 2739648054
1936 2849283584
1937 2852629665
1938 2883072490
1939 2896112655
1940 2904448056
1941 2929178632
1942 2945981041
1943 2946019557
1944 8055590080

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

104

178

0.97

Map