F487149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 355 | 1944 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10328543|Ga0157372_103285432 |
| Length | 181 |
| Sequence | MQAGRVHVELSIILILAACFNQNPYKLKHMDFKQIQELIKMINKSQIGEVTIEQKDFRTQVVSHAMPVNAPMPVQQMLPQSAGAPAAQEQKGTSQGGSDTSNYITIKSPMIGTFYRRPSPDKPNFVEVGDEVSTGKVVCIIEAMKLFNEIESEISGKVVKILVEDSMPVEYDQPLFLVDPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 207 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 208 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 209 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 210 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 211 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 212 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 262 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 282 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 283 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 284 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 285 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 286 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 287 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 288 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 293 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 295 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 296 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 298 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 304 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 305 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 317 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 318 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 320 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 321 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 322 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 328 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 331 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 333 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 334 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 340 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 341 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 342 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 343 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 344 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 345 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 346 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 347 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 348 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 349 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 350 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 351 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 352 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 353 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 354 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 355 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.63 |
| Metatranscriptomes | 0.72 |
| Isolates | 1.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.22 |
| Nodule | 0 |
| Rhizoplane | 1.95 |
| Rhizosphere | 91.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10328543 | 3300013307 | Bacteria | 1781 |
| 2 | JGI24744J21845_10031041 | 3300002077 | Bacteria | 1022 |
| 3 | rootH2_10078230 | 3300003320 | Bacteria | 1922 |
| 4 | rootL2_10077383 | 3300003322 | Bacteria | 5923 |
| 5 | rootH1_10048038 | 3300003323 | Bacteria | 2974 |
| 6 | rootH1_10276362 | 3300003323 | Bacteria | 5240 |
| 7 | JGI25160J50197_1004577 | 3300003354 | Bacteria | 5957 |
| 8 | JGI25404J52841_10038704 | 3300003659 | Bacteria | 1011 |
| 9 | Ga0055535_1016499 | 3300003761 | Bacteria | 1006 |
| 10 | Ga0055542_1005505 | 3300003762 | Bacteria | 2851 |
| 11 | Ga0065714_10071198 | 3300005288 | Bacteria | 3607 |
| 12 | Ga0065712_10010481 | 3300005290 | Bacteria | 2317 |
| 13 | Ga0065712_10027404 | 3300005290 | Bacteria | 1245 |
| 14 | Ga0065715_10192633 | 3300005293 | Bacteria | 1406 |
| 15 | Ga0065715_10600200 | 3300005293 | Unclassified | 708 |
| 16 | Ga0065707_10156427 | 3300005295 | Bacteria | 1604 |
| 17 | Ga0070658_10000230 | 3300005327 | Bacteria | 49640 |
| 18 | Ga0070658_10084107 | 3300005327 | Bacteria | 2616 |
| 19 | Ga0070676_10000156 | 3300005328 | Bacteria | 27179 |
| 20 | Ga0070676_10006420 | 3300005328 | Bacteria | 6282 |
| 21 | Ga0070676_10076070 | 3300005328 | Bacteria | 2026 |
| 22 | Ga0070676_10104429 | 3300005328 | Bacteria | 1756 |
| 23 | Ga0070676_10238602 | 3300005328 | Bacteria | 1208 |
| 24 | Ga0070676_10811797 | 3300005328 | Bacteria | 691 |
| 25 | Ga0070683_100001255 | 3300005329 | Bacteria | 19307 |
| 26 | Ga0070683_100003401 | 3300005329 | Bacteria | 12900 |
| 27 | Ga0070683_100308834 | 3300005329 | Bacteria | 1505 |
| 28 | Ga0070683_100363408 | 3300005329 | Bacteria | 1378 |
| 29 | Ga0070683_100481078 | 3300005329 | Bacteria | 1185 |
| 30 | Ga0070683_100487734 | 3300005329 | Bacteria | 1177 |
| 31 | Ga0070690_100040185 | 3300005330 | Bacteria | 2957 |
| 32 | Ga0070670_100016632 | 3300005331 | Bacteria | 6312 |
| 33 | Ga0070670_100185745 | 3300005331 | Bacteria | 1805 |
| 34 | Ga0070670_100699705 | 3300005331 | Bacteria | 911 |
| 35 | Ga0070670_100992879 | 3300005331 | Bacteria | 763 |
| 36 | Ga0070677_10020168 | 3300005333 | Bacteria | 2425 |
| 37 | Ga0070677_10021285 | 3300005333 | Bacteria | 2377 |
| 38 | Ga0068869_100002522 | 3300005334 | Bacteria | 11052 |
| 39 | Ga0068869_100003133 | 3300005334 | Bacteria | 10092 |
| 40 | Ga0068869_100004775 | 3300005334 | Bacteria | 8462 |
| 41 | Ga0068869_100065302 | 3300005334 | Bacteria | 2678 |
| 42 | Ga0068869_100138598 | 3300005334 | Bacteria | 1876 |
| 43 | Ga0068869_100250645 | 3300005334 | Bacteria | 1414 |
| 44 | Ga0068869_100279426 | 3300005334 | Bacteria | 1342 |
| 45 | Ga0068869_100761054 | 3300005334 | Bacteria | 830 |
| 46 | Ga0070666_10038780 | 3300005335 | Bacteria | 3172 |
| 47 | Ga0070666_10288405 | 3300005335 | Unclassified | 1167 |
| 48 | Ga0070666_10983346 | 3300005335 | Bacteria | 626 |
| 49 | Ga0070680_100000390 | 3300005336 | Bacteria | 29749 |
| 50 | Ga0070680_100094647 | 3300005336 | Bacteria | 2476 |
| 51 | Ga0070682_100000101 | 3300005337 | Bacteria | 76535 |
| 52 | Ga0070682_100002004 | 3300005337 | Bacteria | 11372 |
| 53 | Ga0070682_100099625 | 3300005337 | Bacteria | 1916 |
| 54 | Ga0070682_101001335 | 3300005337 | Bacteria | 694 |
| 55 | Ga0070682_101422621 | 3300005337 | Bacteria | 593 |
| 56 | Ga0068868_100005139 | 3300005338 | Bacteria | 9190 |
| 57 | Ga0068868_100065448 | 3300005338 | Bacteria | 2888 |
| 58 | Ga0068868_100074011 | 3300005338 | Bacteria | 2720 |
| 59 | Ga0068868_100135226 | 3300005338 | Bacteria | 2020 |
| 60 | Ga0068868_100458063 | 3300005338 | Bacteria | 1110 |
| 61 | Ga0070660_100420382 | 3300005339 | Bacteria | 1107 |
| 62 | Ga0070660_100534966 | 3300005339 | Bacteria | 977 |
| 63 | Ga0070660_101101499 | 3300005339 | Unclassified | 672 |
| 64 | Ga0070689_100035619 | 3300005340 | Bacteria | 3803 |
| 65 | Ga0070689_100191717 | 3300005340 | Bacteria | 1664 |
| 66 | Ga0070689_100192671 | 3300005340 | Bacteria | 1660 |
| 67 | Ga0070691_10000447 | 3300005341 | Bacteria | 15259 |
| 68 | Ga0070691_10201387 | 3300005341 | Unclassified | 1046 |
| 69 | Ga0070687_100074067 | 3300005343 | Bacteria | 1837 |
| 70 | Ga0070687_100114385 | 3300005343 | Bacteria | 1533 |
| 71 | Ga0070687_100173514 | 3300005343 | Bacteria | 1285 |
| 72 | Ga0070687_100221678 | 3300005343 | Bacteria | 1159 |
| 73 | Ga0070687_100460809 | 3300005343 | Bacteria | 848 |
| 74 | Ga0070661_100008622 | 3300005344 | Bacteria | 7051 |
| 75 | Ga0070661_100702748 | 3300005344 | Bacteria | 824 |
| 76 | Ga0070661_101122497 | 3300005344 | Unclassified | 656 |
| 77 | Ga0070661_101254790 | 3300005344 | Bacteria | 621 |
| 78 | Ga0070668_100000872 | 3300005347 | Bacteria | 20984 |
| 79 | Ga0070668_100286127 | 3300005347 | Bacteria | 1378 |
| 80 | Ga0070669_100208077 | 3300005353 | Bacteria | 1542 |
| 81 | Ga0070669_100299179 | 3300005353 | Bacteria | 1293 |
| 82 | Ga0070669_100440900 | 3300005353 | Bacteria | 1072 |
| 83 | Ga0070669_100540466 | 3300005353 | Bacteria | 970 |
| 84 | Ga0070669_100577193 | 3300005353 | Bacteria | 940 |
| 85 | Ga0070669_100655115 | 3300005353 | Bacteria | 884 |
| 86 | Ga0070675_100086876 | 3300005354 | Bacteria | 2615 |
| 87 | Ga0070675_100102002 | 3300005354 | Bacteria | 2418 |
| 88 | Ga0070675_100124513 | 3300005354 | Bacteria | 2192 |
| 89 | Ga0070675_100192327 | 3300005354 | Bacteria | 1768 |
| 90 | Ga0070675_100998240 | 3300005354 | Bacteria | 768 |
| 91 | Ga0070671_100007722 | 3300005355 | Bacteria | 8593 |
| 92 | Ga0070671_100139444 | 3300005355 | Bacteria | 2046 |
| 93 | Ga0070671_100303829 | 3300005355 | Bacteria | 1359 |
| 94 | Ga0070671_100538731 | 3300005355 | Bacteria | 1006 |
| 95 | Ga0070671_100575259 | 3300005355 | Bacteria | 972 |
| 96 | Ga0070671_101153640 | 3300005355 | Unclassified | 681 |
| 97 | Ga0070671_101621669 | 3300005355 | Bacteria | 574 |
| 98 | Ga0070674_100022902 | 3300005356 | Bacteria | 4033 |
| 99 | Ga0070674_100037115 | 3300005356 | Bacteria | 3275 |
| 100 | Ga0070674_100366303 | 3300005356 | Bacteria | 1168 |
| 101 | Ga0070674_100639903 | 3300005356 | Bacteria | 903 |
| 102 | Ga0070673_100000096 | 3300005364 | Bacteria | 39184 |
| 103 | Ga0070673_100021393 | 3300005364 | Bacteria | 4688 |
| 104 | Ga0070673_100043128 | 3300005364 | Bacteria | 3483 |
| 105 | Ga0070673_100095994 | 3300005364 | Bacteria | 2432 |
| 106 | Ga0070673_100318855 | 3300005364 | Bacteria | 1372 |
| 107 | Ga0070673_100613989 | 3300005364 | Bacteria | 993 |
| 108 | Ga0070673_101423730 | 3300005364 | Unclassified | 653 |
| 109 | Ga0070688_100013814 | 3300005365 | Bacteria | 4565 |
| 110 | Ga0070688_100059691 | 3300005365 | Bacteria | 2406 |
| 111 | Ga0070688_100126468 | 3300005365 | Bacteria | 1719 |
| 112 | Ga0070688_100150256 | 3300005365 | Bacteria | 1591 |
| 113 | Ga0070688_100152971 | 3300005365 | Bacteria | 1578 |
| 114 | Ga0070688_100476254 | 3300005365 | Unclassified | 938 |
| 115 | Ga0070659_100062931 | 3300005366 | Bacteria | 2934 |
| 116 | Ga0070659_100328631 | 3300005366 | Bacteria | 1279 |
| 117 | Ga0070667_100000248 | 3300005367 | Bacteria | 61183 |
| 118 | Ga0070667_100009195 | 3300005367 | Bacteria | 8181 |
| 119 | Ga0070667_100081998 | 3300005367 | Bacteria | 2760 |
| 120 | Ga0070667_100265955 | 3300005367 | Bacteria | 1536 |
| 121 | Ga0070667_100332972 | 3300005367 | Bacteria | 1372 |
| 122 | Ga0070667_100424617 | 3300005367 | Bacteria | 1212 |
| 123 | Ga0070701_10439358 | 3300005438 | Bacteria | 835 |
| 124 | Ga0070700_100024994 | 3300005441 | Bacteria | 3514 |
| 125 | Ga0070700_100331459 | 3300005441 | Bacteria | 1122 |
| 126 | Ga0070700_100491908 | 3300005441 | Bacteria | 942 |
| 127 | Ga0070694_101630973 | 3300005444 | Bacteria | 548 |
| 128 | Ga0070663_100285100 | 3300005455 | Bacteria | 1317 |
| 129 | Ga0070663_100923314 | 3300005455 | Bacteria | 755 |
| 130 | Ga0070663_101308484 | 3300005455 | Bacteria | 640 |
| 131 | Ga0070678_100044179 | 3300005456 | Bacteria | 3180 |
| 132 | Ga0070678_100106688 | 3300005456 | Bacteria | 2183 |
| 133 | Ga0070678_100289604 | 3300005456 | Bacteria | 1388 |
| 134 | Ga0070678_100472367 | 3300005456 | Bacteria | 1102 |
| 135 | Ga0070662_100104599 | 3300005457 | Bacteria | 2148 |
| 136 | Ga0070681_10011420 | 3300005458 | Bacteria | 8791 |
| 137 | Ga0070681_10926605 | 3300005458 | Bacteria | 790 |
| 138 | Ga0068867_100015569 | 3300005459 | Bacteria | 5396 |
| 139 | Ga0068867_100120228 | 3300005459 | Bacteria | 2029 |
| 140 | Ga0068867_100122509 | 3300005459 | Bacteria | 2011 |
| 141 | Ga0068867_101231336 | 3300005459 | Bacteria | 689 |
| 142 | Ga0068867_101358801 | 3300005459 | Bacteria | 657 |
| 143 | Ga0068867_101437124 | 3300005459 | Bacteria | 640 |
| 144 | Ga0070685_10033012 | 3300005466 | Bacteria | 2904 |
| 145 | Ga0070685_10033794 | 3300005466 | Bacteria | 2876 |
| 146 | Ga0070685_10048439 | 3300005466 | Bacteria | 2447 |
| 147 | Ga0070685_10326662 | 3300005466 | Bacteria | 1042 |
| 148 | Ga0070685_10730222 | 3300005466 | Bacteria | 724 |
| 149 | Ga0070707_101620644 | 3300005468 | Bacteria | 614 |
| 150 | Ga0070698_100007455 | 3300005471 | Bacteria | 11839 |
| 151 | Ga0070699_101327587 | 3300005518 | Bacteria | 660 |
| 152 | Ga0070679_100000656 | 3300005530 | Bacteria | 29462 |
| 153 | Ga0070679_100180157 | 3300005530 | Bacteria | 2086 |
| 154 | Ga0070684_100000646 | 3300005535 | Bacteria | 23997 |
| 155 | Ga0070684_100034182 | 3300005535 | Bacteria | 4345 |
| 156 | Ga0070684_100122051 | 3300005535 | Bacteria | 2344 |
| 157 | Ga0070684_100679247 | 3300005535 | Bacteria | 959 |
| 158 | Ga0070684_101232456 | 3300005535 | Bacteria | 704 |
| 159 | Ga0068853_100013448 | 3300005539 | Bacteria | 6682 |
| 160 | Ga0068853_100031011 | 3300005539 | Bacteria | 4519 |
| 161 | Ga0068853_100047223 | 3300005539 | Bacteria | 3695 |
| 162 | Ga0068853_100417778 | 3300005539 | Bacteria | 1257 |
| 163 | Ga0068853_100537150 | 3300005539 | Bacteria | 1107 |
| 164 | Ga0070672_100000033 | 3300005543 | Bacteria | 61516 |
| 165 | Ga0070672_100039137 | 3300005543 | Bacteria | 3630 |
| 166 | Ga0070672_100048173 | 3300005543 | Bacteria | 3310 |
| 167 | Ga0070672_100268017 | 3300005543 | Bacteria | 1441 |
| 168 | Ga0070672_100499992 | 3300005543 | Bacteria | 1052 |
| 169 | Ga0070672_100593033 | 3300005543 | Bacteria | 964 |
| 170 | Ga0070672_100621406 | 3300005543 | Bacteria | 942 |
| 171 | Ga0070672_101224954 | 3300005543 | Bacteria | 669 |
| 172 | Ga0070686_100012657 | 3300005544 | Bacteria | 4811 |
| 173 | Ga0070686_100051454 | 3300005544 | Bacteria | 2622 |
| 174 | Ga0070686_100179752 | 3300005544 | Bacteria | 1502 |
| 175 | Ga0070686_100192741 | 3300005544 | Bacteria | 1456 |
| 176 | Ga0070665_100000013 | 3300005548 | Bacteria | 484927 |
| 177 | Ga0070665_100000641 | 3300005548 | Bacteria | 47468 |
| 178 | Ga0070665_100004098 | 3300005548 | Bacteria | 15327 |
| 179 | Ga0070665_100113486 | 3300005548 | Bacteria | 2712 |
| 180 | Ga0070665_100264111 | 3300005548 | Bacteria | 1723 |
| 181 | Ga0070704_100382230 | 3300005549 | Bacteria | 1197 |
| 182 | Ga0068855_100002469 | 3300005563 | Bacteria | 22826 |
| 183 | Ga0068855_100015914 | 3300005563 | Bacteria | 9049 |
| 184 | Ga0068855_100221532 | 3300005563 | Bacteria | 2121 |
| 185 | Ga0068855_100269817 | 3300005563 | Unclassified | 1892 |
| 186 | Ga0070664_100032938 | 3300005564 | Bacteria | 4336 |
| 187 | Ga0070664_100077370 | 3300005564 | Bacteria | 2860 |
| 188 | Ga0070664_100079634 | 3300005564 | Bacteria | 2821 |
| 189 | Ga0070664_100140839 | 3300005564 | Bacteria | 2124 |
| 190 | Ga0070664_100186212 | 3300005564 | Bacteria | 1847 |
| 191 | Ga0070664_100707088 | 3300005564 | Bacteria | 939 |
| 192 | Ga0070664_101050427 | 3300005564 | Unclassified | 766 |
| 193 | Ga0068857_100042210 | 3300005577 | Unclassified | 4045 |
| 194 | Ga0068857_100069696 | 3300005577 | Bacteria | 3131 |
| 195 | Ga0068857_100139293 | 3300005577 | Bacteria | 2192 |
| 196 | Ga0068857_100167393 | 3300005577 | Bacteria | 1997 |
| 197 | Ga0068857_100319895 | 3300005577 | Bacteria | 1433 |
| 198 | Ga0068857_100785336 | 3300005577 | Bacteria | 909 |
| 199 | Ga0068854_100008737 | 3300005578 | Bacteria | 6521 |
| 200 | Ga0068854_100042061 | 3300005578 | Bacteria | 3232 |
| 201 | Ga0068854_100106635 | 3300005578 | Bacteria | 2108 |
| 202 | Ga0068854_100261291 | 3300005578 | Bacteria | 1386 |
| 203 | Ga0068856_100022888 | 3300005614 | Bacteria | 6077 |
| 204 | Ga0070702_100043622 | 3300005615 | Bacteria | 2528 |
| 205 | Ga0070702_100820185 | 3300005615 | Bacteria | 721 |
| 206 | Ga0068852_100022404 | 3300005616 | Bacteria | 5066 |
| 207 | Ga0068852_100214645 | 3300005616 | Bacteria | 1827 |
| 208 | Ga0068852_100392100 | 3300005616 | Bacteria | 1364 |
| 209 | Ga0068852_100415079 | 3300005616 | Bacteria | 1327 |
| 210 | Ga0068852_100583392 | 3300005616 | Bacteria | 1121 |
| 211 | Ga0068852_100837233 | 3300005616 | Bacteria | 935 |
| 212 | Ga0068859_100001757 | 3300005617 | Bacteria | 22069 |
| 213 | Ga0068859_100040962 | 3300005617 | Bacteria | 4653 |
| 214 | Ga0068859_100053730 | 3300005617 | Bacteria | 4051 |
| 215 | Ga0068859_100136737 | 3300005617 | Bacteria | 2524 |
| 216 | Ga0068859_100473589 | 3300005617 | Bacteria | 1348 |
| 217 | Ga0068859_101239839 | 3300005617 | Bacteria | 821 |
| 218 | Ga0068864_100001018 | 3300005618 | Bacteria | 23447 |
| 219 | Ga0068864_100008778 | 3300005618 | Bacteria | 8332 |
| 220 | Ga0068864_100048173 | 3300005618 | Bacteria | 3662 |
| 221 | Ga0068864_100065608 | 3300005618 | Bacteria | 3149 |
| 222 | Ga0068864_100152006 | 3300005618 | Bacteria | 2098 |
| 223 | Ga0068864_100368074 | 3300005618 | Bacteria | 1360 |
| 224 | Ga0068864_100430604 | 3300005618 | Bacteria | 1258 |
| 225 | Ga0068864_101129415 | 3300005618 | Bacteria | 781 |
| 226 | Ga0068866_10529193 | 3300005718 | Bacteria | 785 |
| 227 | Ga0068861_100007743 | 3300005719 | Bacteria | 7379 |
| 228 | Ga0068861_100074274 | 3300005719 | Bacteria | 2644 |
| 229 | Ga0068861_100572798 | 3300005719 | Bacteria | 1032 |
| 230 | Ga0068851_10021291 | 3300005834 | Bacteria | 3148 |
| 231 | Ga0068851_10180169 | 3300005834 | Bacteria | 1170 |
| 232 | Ga0068870_10020859 | 3300005840 | Bacteria | 3197 |
| 233 | Ga0068870_10038408 | 3300005840 | Bacteria | 2472 |
| 234 | Ga0068870_10708970 | 3300005840 | Bacteria | 695 |
| 235 | Ga0068863_100002172 | 3300005841 | Bacteria | 19439 |
| 236 | Ga0068863_100107269 | 3300005841 | Bacteria | 2658 |
| 237 | Ga0068863_100383159 | 3300005841 | Bacteria | 1373 |
| 238 | Ga0068863_100536798 | 3300005841 | Bacteria | 1154 |
| 239 | Ga0068863_100826713 | 3300005841 | Bacteria | 924 |
| 240 | Ga0068863_100828427 | 3300005841 | Bacteria | 923 |
| 241 | Ga0068863_101271249 | 3300005841 | Bacteria | 742 |
| 242 | Ga0068858_100000596 | 3300005842 | Bacteria | 37696 |
| 243 | Ga0068858_100157996 | 3300005842 | Bacteria | 2134 |
| 244 | Ga0068858_100176060 | 3300005842 | Bacteria | 2019 |
| 245 | Ga0068858_100262879 | 3300005842 | Bacteria | 1641 |
| 246 | Ga0068858_100308589 | 3300005842 | Bacteria | 1510 |
| 247 | Ga0068858_100432528 | 3300005842 | Bacteria | 1266 |
| 248 | Ga0068860_100000060 | 3300005843 | Bacteria | 195631 |
| 249 | Ga0068860_100001437 | 3300005843 | Bacteria | 25781 |
| 250 | Ga0068860_100009018 | 3300005843 | Bacteria | 9928 |
| 251 | Ga0068860_100508357 | 3300005843 | Bacteria | 1203 |
| 252 | Ga0068860_100651305 | 3300005843 | Bacteria | 1061 |
| 253 | Ga0068860_101107300 | 3300005843 | Bacteria | 811 |
| 254 | Ga0068862_100011742 | 3300005844 | Bacteria | 7228 |
| 255 | Ga0068862_100169571 | 3300005844 | Bacteria | 1953 |
| 256 | Ga0068862_100237441 | 3300005844 | Bacteria | 1656 |
| 257 | Ga0068862_100359909 | 3300005844 | Bacteria | 1352 |
| 258 | Ga0068862_101206967 | 3300005844 | Bacteria | 755 |
| 259 | Ga0068862_101560517 | 3300005844 | Bacteria | 666 |
| 260 | Ga0081540_1006219 | 3300005983 | Bacteria | 8750 |
| 261 | Ga0081539_10031111 | 3300005985 | Bacteria | 3297 |
| 262 | Ga0081539_10080809 | 3300005985 | Bacteria | 1709 |
| 263 | Ga0070715_10219437 | 3300006163 | Bacteria | 977 |
| 264 | Ga0075367_10708810 | 3300006178 | Unclassified | 640 |
| 265 | Ga0075366_10081695 | 3300006195 | Bacteria | 1931 |
| 266 | Ga0075366_10150741 | 3300006195 | Bacteria | 1408 |
| 267 | Ga0075366_10301416 | 3300006195 | Bacteria | 980 |
| 268 | Ga0097621_100000582 | 3300006237 | Bacteria | 25730 |
| 269 | Ga0097621_100015035 | 3300006237 | Bacteria | 5811 |
| 270 | Ga0097621_100015580 | 3300006237 | Bacteria | 5725 |
| 271 | Ga0097621_100529089 | 3300006237 | Bacteria | 1071 |
| 272 | Ga0097621_101194898 | 3300006237 | Bacteria | 716 |
| 273 | Ga0068871_100000764 | 3300006358 | Bacteria | 21686 |
| 274 | Ga0068871_100002439 | 3300006358 | Bacteria | 12701 |
| 275 | Ga0068871_100068788 | 3300006358 | Bacteria | 2908 |
| 276 | Ga0068871_100079404 | 3300006358 | Bacteria | 2715 |
| 277 | Ga0068871_100407004 | 3300006358 | Bacteria | 1212 |
| 278 | Ga0075428_100178166 | 3300006844 | Bacteria | 2302 |
| 279 | Ga0075430_100020946 | 3300006846 | Bacteria | 5558 |
| 280 | Ga0068865_100112445 | 3300006881 | Bacteria | 2011 |
| 281 | Ga0068865_100255760 | 3300006881 | Bacteria | 1384 |
| 282 | Ga0068865_100290128 | 3300006881 | Bacteria | 1306 |
| 283 | Ga0068865_100345541 | 3300006881 | Bacteria | 1204 |
| 284 | Ga0068865_100490788 | 3300006881 | Bacteria | 1022 |
| 285 | Ga0068865_101139898 | 3300006881 | Bacteria | 688 |
| 286 | Ga0097620_100001757 | 3300006931 | Bacteria | 22069 |
| 287 | Ga0097620_100040961 | 3300006931 | Bacteria | 4653 |
| 288 | Ga0097620_100053730 | 3300006931 | Bacteria | 4051 |
| 289 | Ga0097620_100136742 | 3300006931 | Bacteria | 2524 |
| 290 | Ga0097620_100473595 | 3300006931 | Bacteria | 1348 |
| 291 | Ga0097620_100755027 | 3300006931 | Unclassified | 1061 |
| 292 | Ga0097620_101239845 | 3300006931 | Bacteria | 821 |
| 293 | Ga0105240_10000716 | 3300009093 | Bacteria | 60717 |
| 294 | Ga0105240_10001832 | 3300009093 | Bacteria | 35593 |
| 295 | Ga0105240_10002222 | 3300009093 | Bacteria | 31574 |
| 296 | Ga0105240_10002441 | 3300009093 | Bacteria | 29891 |
| 297 | Ga0105240_10003315 | 3300009093 | Bacteria | 25162 |
| 298 | Ga0105240_10056738 | 3300009093 | Bacteria | 4898 |
| 299 | Ga0105240_10073470 | 3300009093 | Bacteria | 4222 |
| 300 | Ga0105240_10118862 | 3300009093 | Bacteria | 3185 |
| 301 | Ga0105240_10640435 | 3300009093 | Bacteria | 1166 |
| 302 | Ga0105240_11159186 | 3300009093 | Bacteria | 820 |
| 303 | Ga0111539_10126346 | 3300009094 | Bacteria | 2996 |
| 304 | Ga0111539_10229668 | 3300009094 | Bacteria | 2161 |
| 305 | Ga0111539_10263841 | 3300009094 | Bacteria | 2005 |
| 306 | Ga0111539_10776900 | 3300009094 | Bacteria | 1115 |
| 307 | Ga0111539_11053826 | 3300009094 | Bacteria | 945 |
| 308 | Ga0111539_11490367 | 3300009094 | Bacteria | 785 |
| 309 | Ga0105245_10037818 | 3300009098 | Bacteria | 4291 |
| 310 | Ga0105247_10360470 | 3300009101 | Bacteria | 1025 |
| 311 | Ga0105247_10368045 | 3300009101 | Bacteria | 1015 |
| 312 | Ga0114129_10022888 | 3300009147 | Bacteria | 8863 |
| 313 | Ga0114129_10062353 | 3300009147 | Bacteria | 5208 |
| 314 | Ga0105241_10000638 | 3300009174 | Bacteria | 26414 |
| 315 | Ga0105241_10000951 | 3300009174 | Bacteria | 21901 |
| 316 | Ga0105241_10044054 | 3300009174 | Bacteria | 3381 |
| 317 | Ga0105241_10126331 | 3300009174 | Bacteria | 2066 |
| 318 | Ga0105241_10165509 | 3300009174 | Bacteria | 1822 |
| 319 | Ga0105241_10234508 | 3300009174 | Bacteria | 1548 |
| 320 | Ga0105241_10358228 | 3300009174 | Bacteria | 1269 |
| 321 | Ga0105241_10683292 | 3300009174 | Bacteria | 935 |
| 322 | Ga0105241_11121544 | 3300009174 | Bacteria | 742 |
| 323 | Ga0105242_10038646 | 3300009176 | Bacteria | 3839 |
| 324 | Ga0105242_10123033 | 3300009176 | Bacteria | 2229 |
| 325 | Ga0105242_10819652 | 3300009176 | Bacteria | 923 |
| 326 | Ga0105242_10927377 | 3300009176 | Bacteria | 873 |
| 327 | Ga0105248_10181231 | 3300009177 | Bacteria | 2373 |
| 328 | Ga0105248_10328539 | 3300009177 | Bacteria | 1722 |
| 329 | Ga0105237_10004721 | 3300009545 | Bacteria | 15673 |
| 330 | Ga0105237_10028791 | 3300009545 | Bacteria | 5653 |
| 331 | Ga0105237_10035731 | 3300009545 | Bacteria | 5027 |
| 332 | Ga0105237_10038393 | 3300009545 | Bacteria | 4835 |
| 333 | Ga0105237_10073217 | 3300009545 | Bacteria | 3418 |
| 334 | Ga0105237_10079005 | 3300009545 | Bacteria | 3280 |
| 335 | Ga0105237_10091224 | 3300009545 | Bacteria | 3036 |
| 336 | Ga0105237_10106296 | 3300009545 | Bacteria | 2798 |
| 337 | Ga0105237_10224500 | 3300009545 | Bacteria | 1879 |
| 338 | Ga0105237_10865937 | 3300009545 | Bacteria | 910 |
| 339 | Ga0105237_11938065 | 3300009545 | Bacteria | 597 |
| 340 | Ga0105238_10001000 | 3300009551 | Bacteria | 28850 |
| 341 | Ga0105238_10023465 | 3300009551 | Bacteria | 6288 |
| 342 | Ga0105238_10670185 | 3300009551 | Bacteria | 1048 |
| 343 | Ga0105249_10003003 | 3300009553 | Bacteria | 14553 |
| 344 | Ga0105249_10006053 | 3300009553 | Bacteria | 10483 |
| 345 | Ga0105249_10146223 | 3300009553 | Bacteria | 2271 |
| 346 | Ga0105249_10205830 | 3300009553 | Bacteria | 1928 |
| 347 | Ga0105249_10416943 | 3300009553 | Bacteria | 1376 |
| 348 | Ga0105249_11539037 | 3300009553 | Bacteria | 737 |
| 349 | Ga0105239_10001821 | 3300010375 | Bacteria | 27926 |
| 350 | Ga0105239_10007877 | 3300010375 | Bacteria | 12177 |
| 351 | Ga0105239_10025404 | 3300010375 | Bacteria | 6522 |
| 352 | Ga0105239_10027514 | 3300010375 | Bacteria | 6258 |
| 353 | Ga0105239_10113563 | 3300010375 | Bacteria | 3004 |
| 354 | Ga0105239_10292576 | 3300010375 | Bacteria | 1834 |
| 355 | Ga0105246_10441639 | 3300011119 | Bacteria | 1091 |
| 356 | Ga0105246_10525400 | 3300011119 | Bacteria | 1009 |
| 357 | Ga0105246_10583305 | 3300011119 | Bacteria | 963 |
| 358 | Ga0105246_10709751 | 3300011119 | Bacteria | 882 |
| 359 | Ga0157373_10002835 | 3300013100 | Bacteria | 13111 |
| 360 | Ga0157373_10025126 | 3300013100 | Bacteria | 4312 |
| 361 | Ga0157373_10337129 | 3300013100 | Bacteria | 1074 |
| 362 | Ga0157371_10001448 | 3300013102 | Bacteria | 24636 |
| 363 | Ga0157371_10003113 | 3300013102 | Bacteria | 15341 |
| 364 | Ga0157371_10094621 | 3300013102 | Bacteria | 2117 |
| 365 | Ga0157371_10411292 | 3300013102 | Bacteria | 991 |
| 366 | Ga0157370_10001290 | 3300013104 | Bacteria | 31329 |
| 367 | Ga0157370_10001459 | 3300013104 | Bacteria | 29237 |
| 368 | Ga0157370_10005908 | 3300013104 | Bacteria | 13644 |
| 369 | Ga0157370_10013052 | 3300013104 | Bacteria | 8579 |
| 370 | Ga0157370_10025903 | 3300013104 | Bacteria | 5799 |
| 371 | Ga0157370_10074596 | 3300013104 | Bacteria | 3200 |
| 372 | Ga0157370_10092862 | 3300013104 | Bacteria | 2832 |
| 373 | Ga0157370_10487068 | 3300013104 | Bacteria | 1133 |
| 374 | Ga0157370_10957438 | 3300013104 | Bacteria | 776 |
| 375 | Ga0157370_11403034 | 3300013104 | Bacteria | 629 |
| 376 | Ga0157369_10010084 | 3300013105 | Bacteria | 10789 |
| 377 | Ga0157369_10042043 | 3300013105 | Bacteria | 4987 |
| 378 | Ga0157369_10133629 | 3300013105 | Bacteria | 2628 |
| 379 | Ga0157369_10306992 | 3300013105 | Bacteria | 1650 |
| 380 | Ga0157374_10000007 | 3300013296 | Bacteria | 595643 |
| 381 | Ga0157374_10000266 | 3300013296 | Bacteria | 48468 |
| 382 | Ga0157374_10005639 | 3300013296 | Bacteria | 10552 |
| 383 | Ga0157374_10126120 | 3300013296 | Bacteria | 2475 |
| 384 | Ga0157374_10501211 | 3300013296 | Bacteria | 1219 |
| 385 | Ga0157374_10938873 | 3300013296 | Bacteria | 883 |
| 386 | Ga0157378_10002479 | 3300013297 | Bacteria | 16428 |
| 387 | Ga0157378_10008516 | 3300013297 | Bacteria | 8928 |
| 388 | Ga0157378_10020629 | 3300013297 | Bacteria | 5796 |
| 389 | Ga0157378_10099260 | 3300013297 | Bacteria | 2656 |
| 390 | Ga0157378_10220435 | 3300013297 | Bacteria | 1803 |
| 391 | Ga0157378_10368270 | 3300013297 | Bacteria | 1408 |
| 392 | Ga0157378_10421892 | 3300013297 | Bacteria | 1319 |
| 393 | Ga0157378_10448251 | 3300013297 | Bacteria | 1280 |
| 394 | Ga0157378_10525970 | 3300013297 | Bacteria | 1185 |
| 395 | Ga0157378_10678976 | 3300013297 | Bacteria | 1048 |
| 396 | Ga0157378_10804968 | 3300013297 | Bacteria | 966 |
| 397 | Ga0157378_11016333 | 3300013297 | Bacteria | 864 |
| 398 | Ga0163162_10000037 | 3300013306 | Bacteria | 138420 |
| 399 | Ga0163162_10000397 | 3300013306 | Bacteria | 39878 |
| 400 | Ga0163162_10000934 | 3300013306 | Bacteria | 27147 |
| 401 | Ga0163162_10006744 | 3300013306 | Bacteria | 11141 |
| 402 | Ga0163162_10010199 | 3300013306 | Bacteria | 9126 |
| 403 | Ga0163162_10060891 | 3300013306 | Bacteria | 3811 |
| 404 | Ga0163162_10087258 | 3300013306 | Bacteria | 3198 |
| 405 | Ga0163162_10130797 | 3300013306 | Bacteria | 2618 |
| 406 | Ga0163162_10286830 | 3300013306 | Bacteria | 1778 |
| 407 | Ga0163162_10769676 | 3300013306 | Bacteria | 1081 |
| 408 | Ga0163162_10777646 | 3300013306 | Bacteria | 1076 |
| 409 | Ga0163162_10924714 | 3300013306 | Bacteria | 984 |
| 410 | Ga0163162_11786196 | 3300013306 | Bacteria | 703 |
| 411 | Ga0163162_12494935 | 3300013306 | Bacteria | 594 |
| 412 | Ga0157372_10001489 | 3300013307 | Bacteria | 25446 |
| 413 | Ga0157372_10234137 | 3300013307 | Bacteria | 2130 |
| 414 | Ga0157372_10301812 | 3300013307 | Bacteria | 1863 |
| 415 | Ga0157372_10508516 | 3300013307 | Bacteria | 1404 |
| 416 | Ga0157372_10854084 | 3300013307 | Bacteria | 1057 |
| 417 | Ga0157372_11124226 | 3300013307 | Bacteria | 909 |
| 418 | Ga0157372_12111019 | 3300013307 | Bacteria | 647 |
| 419 | Ga0157375_10000346 | 3300013308 | Bacteria | 41874 |
| 420 | Ga0157375_10005834 | 3300013308 | Bacteria | 10714 |
| 421 | Ga0157375_10149947 | 3300013308 | Bacteria | 2466 |
| 422 | Ga0157375_10165750 | 3300013308 | Bacteria | 2354 |
| 423 | Ga0157375_10233807 | 3300013308 | Bacteria | 1997 |
| 424 | Ga0157375_10428440 | 3300013308 | Bacteria | 1489 |
| 425 | Ga0157375_10455675 | 3300013308 | Bacteria | 1444 |
| 426 | Ga0157375_10512479 | 3300013308 | Bacteria | 1363 |
| 427 | Ga0157375_10801570 | 3300013308 | Bacteria | 1090 |
| 428 | Ga0163163_10003157 | 3300014325 | Bacteria | 13961 |
| 429 | Ga0163163_10143265 | 3300014325 | Bacteria | 2432 |
| 430 | Ga0163163_10191663 | 3300014325 | Bacteria | 2093 |
| 431 | Ga0163163_10207011 | 3300014325 | Bacteria | 2010 |
| 432 | Ga0163163_10258750 | 3300014325 | Bacteria | 1791 |
| 433 | Ga0163163_10659660 | 3300014325 | Bacteria | 1110 |
| 434 | Ga0163163_10864005 | 3300014325 | Bacteria | 968 |
| 435 | Ga0163163_11025921 | 3300014325 | Bacteria | 888 |
| 436 | Ga0163163_11109697 | 3300014325 | Bacteria | 854 |
| 437 | Ga0163163_11168471 | 3300014325 | Bacteria | 832 |
| 438 | Ga0157380_10005817 | 3300014326 | Bacteria | 8635 |
| 439 | Ga0157380_10160443 | 3300014326 | Bacteria | 1954 |
| 440 | Ga0157380_10508091 | 3300014326 | Bacteria | 1172 |
| 441 | Ga0157380_10774236 | 3300014326 | Bacteria | 974 |
| 442 | Ga0157380_10929558 | 3300014326 | Bacteria | 898 |
| 443 | Ga0182008_10000668 | 3300014497 | Bacteria | 24875 |
| 444 | Ga0157377_10038906 | 3300014745 | Bacteria | 2628 |
| 445 | Ga0157377_10054477 | 3300014745 | Bacteria | 2264 |
| 446 | Ga0157377_10120692 | 3300014745 | Unclassified | 1588 |
| 447 | Ga0157377_10218741 | 3300014745 | Bacteria | 1218 |
| 448 | Ga0157377_10237609 | 3300014745 | Bacteria | 1175 |
| 449 | Ga0157377_10247791 | 3300014745 | Bacteria | 1153 |
| 450 | Ga0157379_10000229 | 3300014968 | Bacteria | 43909 |
| 451 | Ga0157379_10017277 | 3300014968 | Bacteria | 6355 |
| 452 | Ga0157379_10068586 | 3300014968 | Bacteria | 3170 |
| 453 | Ga0157379_10102107 | 3300014968 | Bacteria | 2574 |
| 454 | Ga0157379_10153165 | 3300014968 | Bacteria | 2080 |
| 455 | Ga0157379_10442320 | 3300014968 | Bacteria | 1199 |
| 456 | Ga0157379_10649605 | 3300014968 | Bacteria | 987 |
| 457 | Ga0157376_10000117 | 3300014969 | Bacteria | 56126 |
| 458 | Ga0157376_10005117 | 3300014969 | Bacteria | 9140 |
| 459 | Ga0157376_10068408 | 3300014969 | Bacteria | 3007 |
| 460 | Ga0157376_10172914 | 3300014969 | Unclassified | 1968 |
| 461 | Ga0157376_10221722 | 3300014969 | Bacteria | 1752 |
| 462 | Ga0157376_10779702 | 3300014969 | Bacteria | 967 |
| 463 | Ga0157376_10812725 | 3300014969 | Bacteria | 948 |
| 464 | Ga0163161_10000019 | 3300017792 | Bacteria | 216758 |
| 465 | Ga0163161_10027837 | 3300017792 | Bacteria | 4010 |
| 466 | Ga0163161_10037360 | 3300017792 | Bacteria | 3482 |
| 467 | Ga0163161_10077415 | 3300017792 | Bacteria | 2443 |
| 468 | Ga0163161_10093388 | 3300017792 | Bacteria | 2229 |
| 469 | Ga0163161_10141132 | 3300017792 | Bacteria | 1824 |
| 470 | Ga0163161_10333225 | 3300017792 | Bacteria | 1202 |
| 471 | Ga0163161_10418895 | 3300017792 | Bacteria | 1077 |
| 472 | Ga0163161_10878794 | 3300017792 | Bacteria | 758 |
| 473 | Ga0206352_10768305 | 3300020078 | Bacteria | 666 |
| 474 | Ga0213876_10024159 | 3300021384 | Bacteria | 3208 |
| 475 | Ga0209258_100041 | 3300025242 | Bacteria | 381381 |
| 476 | Ga0209148_1000090 | 3300025254 | Bacteria | 250982 |
| 477 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 478 | Ga0207697_10162236 | 3300025315 | Bacteria | 975 |
| 479 | Ga0207697_10215228 | 3300025315 | Bacteria | 847 |
| 480 | Ga0207656_10000261 | 3300025321 | Bacteria | 18358 |
| 481 | Ga0207656_10048031 | 3300025321 | Bacteria | 1837 |
| 482 | Ga0207656_10205995 | 3300025321 | Bacteria | 951 |
| 483 | Ga0207713_1189406 | 3300025735 | Bacteria | 637 |
| 484 | Ga0207682_10013673 | 3300025893 | Bacteria | 3160 |
| 485 | Ga0207682_10018427 | 3300025893 | Bacteria | 2730 |
| 486 | Ga0207642_10167277 | 3300025899 | Bacteria | 1186 |
| 487 | Ga0207688_10028997 | 3300025901 | Bacteria | 3044 |
| 488 | Ga0207688_10321476 | 3300025901 | Bacteria | 949 |
| 489 | Ga0207688_10407011 | 3300025901 | Bacteria | 844 |
| 490 | Ga0207680_10103352 | 3300025903 | Bacteria | 1835 |
| 491 | Ga0207647_10012021 | 3300025904 | Bacteria | 6041 |
| 492 | Ga0207647_10042106 | 3300025904 | Bacteria | 2867 |
| 493 | Ga0207685_10029057 | 3300025905 | Bacteria | 1953 |
| 494 | Ga0207685_10439187 | 3300025905 | Unclassified | 676 |
| 495 | Ga0207645_10000836 | 3300025907 | Bacteria | 25657 |
| 496 | Ga0207645_10010983 | 3300025907 | Bacteria | 6195 |
| 497 | Ga0207645_10173890 | 3300025907 | Bacteria | 1412 |
| 498 | Ga0207645_10188255 | 3300025907 | Bacteria | 1356 |
| 499 | Ga0207643_10018006 | 3300025908 | Bacteria | 3868 |
| 500 | Ga0207643_10059071 | 3300025908 | Bacteria | 2187 |
| 501 | Ga0207643_10330463 | 3300025908 | Unclassified | 954 |
| 502 | Ga0207705_10158134 | 3300025909 | Bacteria | 1701 |
| 503 | Ga0207654_10000832 | 3300025911 | Bacteria | 16989 |
| 504 | Ga0207654_10001898 | 3300025911 | Bacteria | 10843 |
| 505 | Ga0207654_10056552 | 3300025911 | Bacteria | 2276 |
| 506 | Ga0207654_10102456 | 3300025911 | Bacteria | 1766 |
| 507 | Ga0207707_10001200 | 3300025912 | Bacteria | 24391 |
| 508 | Ga0207695_10000130 | 3300025913 | Bacteria | 224214 |
| 509 | Ga0207695_10000862 | 3300025913 | Bacteria | 55457 |
| 510 | Ga0207695_10003201 | 3300025913 | Bacteria | 23318 |
| 511 | Ga0207695_10010277 | 3300025913 | Bacteria | 11466 |
| 512 | Ga0207695_10025833 | 3300025913 | Bacteria | 6566 |
| 513 | Ga0207695_10036723 | 3300025913 | Bacteria | 5293 |
| 514 | Ga0207695_10055439 | 3300025913 | Bacteria | 4130 |
| 515 | Ga0207695_10056110 | 3300025913 | Bacteria | 4101 |
| 516 | Ga0207695_10834588 | 3300025913 | Bacteria | 802 |
| 517 | Ga0207671_10001678 | 3300025914 | Bacteria | 25122 |
| 518 | Ga0207671_10030243 | 3300025914 | Unclassified | 4040 |
| 519 | Ga0207671_10073775 | 3300025914 | Bacteria | 2549 |
| 520 | Ga0207660_10000111 | 3300025917 | Bacteria | 46780 |
| 521 | Ga0207662_10009337 | 3300025918 | Bacteria | 5393 |
| 522 | Ga0207662_10063870 | 3300025918 | Bacteria | 2214 |
| 523 | Ga0207662_10110373 | 3300025918 | Bacteria | 1714 |
| 524 | Ga0207662_10190985 | 3300025918 | Bacteria | 1321 |
| 525 | Ga0207662_10612217 | 3300025918 | Bacteria | 758 |
| 526 | Ga0207657_10061731 | 3300025919 | Bacteria | 3212 |
| 527 | Ga0207657_10062510 | 3300025919 | Bacteria | 3187 |
| 528 | Ga0207649_10007630 | 3300025920 | Bacteria | 5882 |
| 529 | Ga0207649_10683650 | 3300025920 | Bacteria | 795 |
| 530 | Ga0207652_10000460 | 3300025921 | Bacteria | 42038 |
| 531 | Ga0207646_11280440 | 3300025922 | Bacteria | 641 |
| 532 | Ga0207681_10064601 | 3300025923 | Bacteria | 2528 |
| 533 | Ga0207650_10030551 | 3300025925 | Bacteria | 3882 |
| 534 | Ga0207650_10092790 | 3300025925 | Bacteria | 2310 |
| 535 | Ga0207650_10111835 | 3300025925 | Bacteria | 2115 |
| 536 | Ga0207650_10208471 | 3300025925 | Bacteria | 1569 |
| 537 | Ga0207650_10400276 | 3300025925 | Bacteria | 1136 |
| 538 | Ga0207650_10811709 | 3300025925 | Bacteria | 793 |
| 539 | Ga0207650_10831640 | 3300025925 | Bacteria | 783 |
| 540 | Ga0207659_10062388 | 3300025926 | Bacteria | 2690 |
| 541 | Ga0207659_10078574 | 3300025926 | Bacteria | 2432 |
| 542 | Ga0207687_10101167 | 3300025927 | Bacteria | 2121 |
| 543 | Ga0207644_10183600 | 3300025931 | Bacteria | 1641 |
| 544 | Ga0207644_10214902 | 3300025931 | Bacteria | 1522 |
| 545 | Ga0207644_10532878 | 3300025931 | Bacteria | 971 |
| 546 | Ga0207644_10550658 | 3300025931 | Bacteria | 955 |
| 547 | Ga0207644_10595348 | 3300025931 | Unclassified | 918 |
| 548 | Ga0207690_10042278 | 3300025932 | Bacteria | 2992 |
| 549 | Ga0207690_10624323 | 3300025932 | Bacteria | 881 |
| 550 | Ga0207706_10012970 | 3300025933 | Bacteria | 7585 |
| 551 | Ga0207706_10094095 | 3300025933 | Bacteria | 2636 |
| 552 | Ga0207706_10444161 | 3300025933 | Bacteria | 1122 |
| 553 | Ga0207706_10659815 | 3300025933 | Bacteria | 895 |
| 554 | Ga0207706_11109468 | 3300025933 | Bacteria | 661 |
| 555 | Ga0207686_10196444 | 3300025934 | Bacteria | 1442 |
| 556 | Ga0207670_10002725 | 3300025936 | Bacteria | 9297 |
| 557 | Ga0207670_10023717 | 3300025936 | Bacteria | 3823 |
| 558 | Ga0207670_10100184 | 3300025936 | Bacteria | 2068 |
| 559 | Ga0207670_10597775 | 3300025936 | Bacteria | 906 |
| 560 | Ga0207669_10061032 | 3300025937 | Bacteria | 2314 |
| 561 | Ga0207669_10076404 | 3300025937 | Bacteria | 2126 |
| 562 | Ga0207669_10587879 | 3300025937 | Bacteria | 903 |
| 563 | Ga0207669_10774412 | 3300025937 | Bacteria | 794 |
| 564 | Ga0207704_10440910 | 3300025938 | Bacteria | 1037 |
| 565 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 566 | Ga0207691_10008281 | 3300025940 | Bacteria | 9983 |
| 567 | Ga0207691_10014883 | 3300025940 | Bacteria | 7413 |
| 568 | Ga0207691_10040431 | 3300025940 | Bacteria | 4308 |
| 569 | Ga0207691_10196770 | 3300025940 | Bacteria | 1756 |
| 570 | Ga0207691_10720557 | 3300025940 | Bacteria | 841 |
| 571 | Ga0207711_10024205 | 3300025941 | Bacteria | 5082 |
| 572 | Ga0207689_10003189 | 3300025942 | Bacteria | 15041 |
| 573 | Ga0207689_10004326 | 3300025942 | Bacteria | 12934 |
| 574 | Ga0207689_10005568 | 3300025942 | Bacteria | 11246 |
| 575 | Ga0207689_10006425 | 3300025942 | Bacteria | 10392 |
| 576 | Ga0207689_10007832 | 3300025942 | Bacteria | 9338 |
| 577 | Ga0207689_10025740 | 3300025942 | Bacteria | 4930 |
| 578 | Ga0207689_10455855 | 3300025942 | Bacteria | 1069 |
| 579 | Ga0207689_10507211 | 3300025942 | Bacteria | 1011 |
| 580 | Ga0207689_10545053 | 3300025942 | Bacteria | 974 |
| 581 | Ga0207661_10002005 | 3300025944 | Bacteria | 14029 |
| 582 | Ga0207661_10005743 | 3300025944 | Bacteria | 8752 |
| 583 | Ga0207661_10646522 | 3300025944 | Bacteria | 972 |
| 584 | Ga0207661_10802450 | 3300025944 | Bacteria | 867 |
| 585 | Ga0207679_10007874 | 3300025945 | Bacteria | 6770 |
| 586 | Ga0207679_10085888 | 3300025945 | Bacteria | 2418 |
| 587 | Ga0207679_10235339 | 3300025945 | Bacteria | 1549 |
| 588 | Ga0207679_10653178 | 3300025945 | Bacteria | 951 |
| 589 | Ga0207679_11115646 | 3300025945 | Bacteria | 724 |
| 590 | Ga0207667_10000131 | 3300025949 | Bacteria | 115088 |
| 591 | Ga0207667_10000915 | 3300025949 | Bacteria | 37602 |
| 592 | Ga0207667_10029805 | 3300025949 | Bacteria | 5912 |
| 593 | Ga0207667_10131183 | 3300025949 | Bacteria | 2581 |
| 594 | Ga0207667_10176469 | 3300025949 | Bacteria | 2195 |
| 595 | Ga0207651_10002426 | 3300025960 | Bacteria | 8910 |
| 596 | Ga0207651_10010285 | 3300025960 | Bacteria | 5177 |
| 597 | Ga0207651_10068688 | 3300025960 | Bacteria | 2499 |
| 598 | Ga0207651_10090083 | 3300025960 | Bacteria | 2241 |
| 599 | Ga0207651_10228644 | 3300025960 | Bacteria | 1508 |
| 600 | Ga0207651_10237200 | 3300025960 | Bacteria | 1484 |
| 601 | Ga0207651_10270498 | 3300025960 | Bacteria | 1399 |
| 602 | Ga0207651_10485438 | 3300025960 | Bacteria | 1066 |
| 603 | Ga0207712_10002527 | 3300025961 | Bacteria | 11765 |
| 604 | Ga0207712_10010105 | 3300025961 | Bacteria | 5984 |
| 605 | Ga0207712_10064097 | 3300025961 | Bacteria | 2619 |
| 606 | Ga0207712_10110548 | 3300025961 | Bacteria | 2061 |
| 607 | Ga0207712_10587762 | 3300025961 | Bacteria | 962 |
| 608 | Ga0207712_10771483 | 3300025961 | Bacteria | 844 |
| 609 | Ga0207712_11112295 | 3300025961 | Bacteria | 703 |
| 610 | Ga0207668_10000263 | 3300025972 | Bacteria | 35099 |
| 611 | Ga0207668_10028862 | 3300025972 | Bacteria | 3632 |
| 612 | Ga0207668_11665666 | 3300025972 | Bacteria | 576 |
| 613 | Ga0207640_10159394 | 3300025981 | Bacteria | 1668 |
| 614 | Ga0207640_10227640 | 3300025981 | Unclassified | 1432 |
| 615 | Ga0207640_10688221 | 3300025981 | Bacteria | 875 |
| 616 | Ga0207640_10742989 | 3300025981 | Bacteria | 845 |
| 617 | Ga0207658_10001591 | 3300025986 | Bacteria | 17504 |
| 618 | Ga0207658_10070645 | 3300025986 | Bacteria | 2642 |
| 619 | Ga0207658_10183781 | 3300025986 | Bacteria | 1732 |
| 620 | Ga0207658_10342972 | 3300025986 | Bacteria | 1299 |
| 621 | Ga0207658_10484722 | 3300025986 | Bacteria | 1099 |
| 622 | Ga0207658_10535027 | 3300025986 | Bacteria | 1047 |
| 623 | Ga0207658_10549260 | 3300025986 | Bacteria | 1033 |
| 624 | Ga0207658_10676222 | 3300025986 | Bacteria | 932 |
| 625 | Ga0207658_10757176 | 3300025986 | Bacteria | 880 |
| 626 | Ga0207658_11311218 | 3300025986 | Bacteria | 662 |
| 627 | Ga0207677_10001832 | 3300026023 | Bacteria | 11222 |
| 628 | Ga0207677_10018283 | 3300026023 | Bacteria | 4202 |
| 629 | Ga0207677_10443891 | 3300026023 | Bacteria | 1110 |
| 630 | Ga0207677_10553346 | 3300026023 | Bacteria | 1003 |
| 631 | Ga0207677_10851475 | 3300026023 | Bacteria | 819 |
| 632 | Ga0207677_11297683 | 3300026023 | Bacteria | 668 |
| 633 | Ga0207703_10003862 | 3300026035 | Bacteria | 12452 |
| 634 | Ga0207703_10023210 | 3300026035 | Bacteria | 4873 |
| 635 | Ga0207639_10009269 | 3300026041 | Bacteria | 6788 |
| 636 | Ga0207639_10025486 | 3300026041 | Bacteria | 4288 |
| 637 | Ga0207639_10311053 | 3300026041 | Bacteria | 1395 |
| 638 | Ga0207678_10103764 | 3300026067 | Bacteria | 2426 |
| 639 | Ga0207678_10945014 | 3300026067 | Bacteria | 763 |
| 640 | Ga0207708_10393150 | 3300026075 | Bacteria | 1145 |
| 641 | Ga0207708_10452445 | 3300026075 | Bacteria | 1070 |
| 642 | Ga0207708_10486031 | 3300026075 | Bacteria | 1033 |
| 643 | Ga0207702_10053631 | 3300026078 | Bacteria | 3414 |
| 644 | Ga0207702_10104747 | 3300026078 | Bacteria | 2504 |
| 645 | Ga0207702_10131310 | 3300026078 | Bacteria | 2254 |
| 646 | Ga0207702_11020443 | 3300026078 | Bacteria | 821 |
| 647 | Ga0207641_10000756 | 3300026088 | Bacteria | 34796 |
| 648 | Ga0207641_10001344 | 3300026088 | Bacteria | 24357 |
| 649 | Ga0207641_10016156 | 3300026088 | Bacteria | 6112 |
| 650 | Ga0207641_10077492 | 3300026088 | Bacteria | 2877 |
| 651 | Ga0207641_10157032 | 3300026088 | Bacteria | 2065 |
| 652 | Ga0207641_10348842 | 3300026088 | Bacteria | 1410 |
| 653 | Ga0207641_10549490 | 3300026088 | Bacteria | 1126 |
| 654 | Ga0207648_10008820 | 3300026089 | Bacteria | 9713 |
| 655 | Ga0207648_10013563 | 3300026089 | Bacteria | 7573 |
| 656 | Ga0207648_10052501 | 3300026089 | Bacteria | 3564 |
| 657 | Ga0207648_10117789 | 3300026089 | Bacteria | 2334 |
| 658 | Ga0207648_10203231 | 3300026089 | Bacteria | 1757 |
| 659 | Ga0207676_10005739 | 3300026095 | Bacteria | 8782 |
| 660 | Ga0207676_10006275 | 3300026095 | Bacteria | 8396 |
| 661 | Ga0207676_10011337 | 3300026095 | Bacteria | 6373 |
| 662 | Ga0207676_10098896 | 3300026095 | Bacteria | 2413 |
| 663 | Ga0207676_10424949 | 3300026095 | Bacteria | 1247 |
| 664 | Ga0207676_10764577 | 3300026095 | Unclassified | 940 |
| 665 | Ga0207676_11114558 | 3300026095 | Bacteria | 780 |
| 666 | Ga0207676_11423860 | 3300026095 | Bacteria | 689 |
| 667 | Ga0207676_11895318 | 3300026095 | Bacteria | 595 |
| 668 | Ga0207674_10001708 | 3300026116 | Bacteria | 28109 |
| 669 | Ga0207674_10009425 | 3300026116 | Bacteria | 11156 |
| 670 | Ga0207674_10058277 | 3300026116 | Bacteria | 3913 |
| 671 | Ga0207674_10128022 | 3300026116 | Bacteria | 2503 |
| 672 | Ga0207674_10141114 | 3300026116 | Bacteria | 2368 |
| 673 | Ga0207674_10248932 | 3300026116 | Bacteria | 1724 |
| 674 | Ga0207674_11009234 | 3300026116 | Bacteria | 801 |
| 675 | Ga0207675_100020739 | 3300026118 | Bacteria | 6127 |
| 676 | Ga0207675_100056045 | 3300026118 | Bacteria | 3677 |
| 677 | Ga0207675_100194729 | 3300026118 | Bacteria | 1945 |
| 678 | Ga0207675_100300594 | 3300026118 | Bacteria | 1563 |
| 679 | Ga0207675_100300727 | 3300026118 | Bacteria | 1563 |
| 680 | Ga0207675_101567698 | 3300026118 | Bacteria | 679 |
| 681 | Ga0207675_101847596 | 3300026118 | Unclassified | 623 |
| 682 | Ga0207683_10018226 | 3300026121 | Bacteria | 5988 |
| 683 | Ga0207683_10039309 | 3300026121 | Bacteria | 4127 |
| 684 | Ga0207683_10193549 | 3300026121 | Bacteria | 1847 |
| 685 | Ga0207683_10250160 | 3300026121 | Bacteria | 1618 |
| 686 | Ga0207698_10004388 | 3300026142 | Bacteria | 8593 |
| 687 | Ga0207698_10088404 | 3300026142 | Bacteria | 2527 |
| 688 | Ga0207698_10194177 | 3300026142 | Bacteria | 1812 |
| 689 | Ga0207698_10723653 | 3300026142 | Bacteria | 992 |
| 690 | Ga0207698_10821970 | 3300026142 | Unclassified | 933 |
| 691 | Ga0207698_10865389 | 3300026142 | Bacteria | 909 |
| 692 | Ga0207698_10990130 | 3300026142 | Bacteria | 851 |
| 693 | Ga0207698_11364486 | 3300026142 | Bacteria | 724 |
| 694 | Ga0207698_11365210 | 3300026142 | Bacteria | 724 |
| 695 | Ga0207428_10066121 | 3300027907 | Bacteria | 2849 |
| 696 | Ga0207428_10102899 | 3300027907 | Bacteria | 2205 |
| 697 | Ga0207428_10232171 | 3300027907 | Bacteria | 1380 |
| 698 | Ga0268266_10000024 | 3300028379 | Bacteria | 490820 |
| 699 | Ga0268266_10001506 | 3300028379 | Bacteria | 27540 |
| 700 | Ga0268266_10003844 | 3300028379 | Bacteria | 14659 |
| 701 | Ga0268266_10534527 | 3300028379 | Bacteria | 1122 |
| 702 | Ga0268265_10109775 | 3300028380 | Bacteria | 2249 |
| 703 | Ga0268265_10438788 | 3300028380 | Bacteria | 1217 |
| 704 | Ga0268265_10513354 | 3300028380 | Bacteria | 1131 |
| 705 | Ga0268265_10624636 | 3300028380 | Bacteria | 1033 |
| 706 | Ga0268265_10694665 | 3300028380 | Bacteria | 982 |
| 707 | Ga0268265_11223007 | 3300028380 | Bacteria | 749 |
| 708 | Ga0268265_11536993 | 3300028380 | Bacteria | 670 |
| 709 | Ga0268264_10000915 | 3300028381 | Bacteria | 30897 |
| 710 | Ga0268264_10027244 | 3300028381 | Bacteria | 4667 |
| 711 | Ga0268264_10027327 | 3300028381 | Bacteria | 4661 |
| 712 | Ga0268264_10043221 | 3300028381 | Bacteria | 3733 |
| 713 | Ga0268264_10094548 | 3300028381 | Bacteria | 2584 |
| 714 | Ga0268264_10215744 | 3300028381 | Bacteria | 1764 |
| 715 | Ga0268264_10258000 | 3300028381 | Bacteria | 1622 |
| 716 | Ga0268264_10425039 | 3300028381 | Bacteria | 1282 |
| 717 | Ga0268264_10602124 | 3300028381 | Bacteria | 1083 |
| 718 | Ga0268264_10851076 | 3300028381 | Bacteria | 913 |
| 719 | Ga0268264_11342751 | 3300028381 | Unclassified | 725 |
| 720 | Ga0307517_10002909 | 3300028786 | Bacteria | 27119 |
| 721 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 722 | Ga0307515_10072791 | 3300028794 | Bacteria | 4630 |
| 723 | Ga0307511_10000680 | 3300030521 | Bacteria | 36246 |
| 724 | Ga0265327_10000009 | 3300031251 | Bacteria | 616360 |
| 725 | Ga0265327_10000191 | 3300031251 | Bacteria | 130083 |
| 726 | Ga0307513_10116829 | 3300031456 | Bacteria | 2646 |
| 727 | Ga0307513_10219513 | 3300031456 | Bacteria | 1724 |
| 728 | Ga0307513_10445803 | 3300031456 | Bacteria | 1020 |
| 729 | Ga0307509_10133581 | 3300031507 | Bacteria | 2432 |
| 730 | Ga0307509_10418288 | 3300031507 | Unclassified | 1042 |
| 731 | Ga0307413_10081837 | 3300031824 | Bacteria | 2072 |
| 732 | Ga0307413_10215995 | 3300031824 | Bacteria | 1397 |
| 733 | Ga0307413_11112420 | 3300031824 | Bacteria | 683 |
| 734 | Ga0307410_10863834 | 3300031852 | Bacteria | 773 |
| 735 | Ga0307407_10345016 | 3300031903 | Bacteria | 1053 |
| 736 | Ga0307412_10513322 | 3300031911 | Bacteria | 1000 |
| 737 | Ga0307414_10000268 | 3300032004 | Bacteria | 32688 |
| 738 | Ga0307414_10378258 | 3300032004 | Bacteria | 1223 |
| 739 | Ga0307414_11249214 | 3300032004 | Bacteria | 688 |
| 740 | Ga0307414_11431005 | 3300032004 | Unclassified | 643 |
| 741 | Ga0307414_11648976 | 3300032004 | Bacteria | 598 |
| 742 | Ga0307411_10165014 | 3300032005 | Bacteria | 1664 |
| 743 | Ga0307411_10283123 | 3300032005 | Bacteria | 1320 |
| 744 | Ga0307415_101242997 | 3300032126 | Bacteria | 703 |
| 745 | Ga0373943_0623808 | 3300035170 | Bacteria | 636 |
| 746 | Ga0373943_0642583 | 3300035170 | Bacteria | 627 |
| 747 | Ga0373955_0125081 | 3300035172 | Bacteria | 1497 |
| 748 | Ga0373955_0354307 | 3300035172 | Bacteria | 889 |
| 749 | Ga0373955_0562774 | 3300035172 | Bacteria | 698 |
| 750 | Ga0373924_0135494 | 3300035410 | Bacteria | 1073 |
| 751 | Ga0373935_1261187 | 3300035692 | Bacteria | 551 |
| 752 | Ga0373933_0450106 | 3300035724 | Bacteria | 842 |
| 753 | Ga0373947_0066714 | 3300035725 | Bacteria | 2197 |
| 754 | Ga0373937_0014633 | 3300036401 | Bacteria | 6928 |
| 755 | Ga0316584_0580607 | 3300036712 | Bacteria | 779 |
| 756 | Ga0373925_0044251 | 3300037068 | Bacteria | 3306 |
| 757 | Ga0395900_0731230 | 3300037418 | Bacteria | 921 |
| 758 | Ga0436365_0373370 | 3300039437 | Bacteria | 18775 |
| 759 | Ga0436365_1440691 | 3300039437 | Bacteria | 713 |
| 760 | Ga0451791_0419064 | 3300041451 | Bacteria | 613 |
| 761 | Ga0451807_1080023 | 3300041486 | Bacteria | 754 |
| 762 | Ga0451807_1086769 | 3300041486 | Bacteria | 549 |
| 763 | Ga0451843_0283103 | 3300041509 | Bacteria | 614 |
| 764 | Ga0439441_011478 | 3300042001 | Bacteria | 1503 |
| 765 | Ga0439450_221238 | 3300042008 | Bacteria | 510 |
| 766 | Ga0450921_003691 | 3300042123 | Bacteria | 1089 |
| 767 | Ga0450923_130288 | 3300042125 | Bacteria | 598 |
| 768 | Ga0439444_0020382 | 3300042437 | Bacteria | 1166 |
| 769 | Ga0450893_0054898 | 3300042532 | Bacteria | 752 |
| 770 | Ga0451577_0000213 | 3300042876 | Bacteria | 121176 |
| 771 | Ga0451577_0032736 | 3300042876 | Bacteria | 4685 |
| 772 | Ga0466972_0133411 | 3300044658 | Bacteria | 1169 |
| 773 | Ga0466961_0146090 | 3300044693 | Bacteria | 1479 |
| 774 | Ga0453684_0064971 | 3300044712 | Bacteria | 4657 |
| 775 | Ga0453684_0102824 | 3300044712 | Bacteria | 3492 |
| 776 | Ga0453684_0481203 | 3300044712 | Bacteria | 1377 |
| 777 | Ga0466957_0000776 | 3300044842 | Bacteria | 16313 |
| 778 | Ga0466957_0007665 | 3300044842 | Bacteria | 6106 |
| 779 | Ga0466957_0210564 | 3300044842 | Bacteria | 1280 |
| 780 | Ga0466957_0325055 | 3300044842 | Bacteria | 1039 |
| 781 | Ga0451576_0191556 | 3300045051 | Bacteria | 2136 |
| 782 | Ga0495629_0052891 | 3300046459 | Bacteria | 2842 |
| 783 | Ga0495638_0166984 | 3300046460 | Bacteria | 1265 |
| 784 | Ga0495638_0329382 | 3300046460 | Bacteria | 813 |
| 785 | Ga0495580_0179895 | 3300046472 | Bacteria | 1460 |
| 786 | Ga0495639_0023369 | 3300046475 | Bacteria | 2717 |
| 787 | Ga0495639_0409964 | 3300046475 | Bacteria | 685 |
| 788 | Ga0495585_0371432 | 3300046492 | Bacteria | 692 |
| 789 | Ga0495607_0160503 | 3300046501 | Bacteria | 1143 |
| 790 | Ga0495610_0259766 | 3300046512 | Bacteria | 684 |
| 791 | Ga0495630_0089663 | 3300046517 | Bacteria | 2323 |
| 792 | Ga0495632_0129002 | 3300046519 | Bacteria | 1178 |
| 793 | Ga0495648_0004199 | 3300046524 | Bacteria | 12371 |
| 794 | Ga0495652_0098214 | 3300046529 | Bacteria | 2381 |
| 795 | Ga0495652_1095954 | 3300046529 | Bacteria | 517 |
| 796 | Ga0495665_0066441 | 3300046531 | Bacteria | 1903 |
| 797 | Ga0495587_0424456 | 3300046536 | Bacteria | 738 |
| 798 | Ga0495598_0105235 | 3300046537 | Bacteria | 939 |
| 799 | Ga0495598_0165928 | 3300046537 | Bacteria | 780 |
| 800 | Ga0495645_0323083 | 3300046543 | Bacteria | 1001 |
| 801 | Ga0495645_0775995 | 3300046543 | Bacteria | 577 |
| 802 | Ga0495622_0059676 | 3300046557 | Bacteria | 1766 |
| 803 | Ga0495668_0001416 | 3300046616 | Bacteria | 23342 |
| 804 | Ga0495668_0001567 | 3300046616 | Bacteria | 21672 |
| 805 | Ga0495625_0205359 | 3300046660 | Bacteria | 1298 |
| 806 | Ga0495635_0039725 | 3300046663 | Bacteria | 3254 |
| 807 | Ga0495657_0313640 | 3300046675 | Bacteria | 933 |
| 808 | Ga0495647_0272755 | 3300046681 | Bacteria | 757 |
| 809 | Ga0495658_0183159 | 3300046683 | Bacteria | 1300 |
| 810 | Ga0495649_0398571 | 3300046694 | Bacteria | 691 |
| 811 | Ga0495600_0048383 | 3300046809 | Bacteria | 2774 |
| 812 | Ga0495604_0227780 | 3300047317 | Unclassified | 1280 |
| 813 | Ga0495636_0264430 | 3300047318 | Bacteria | 798 |
| 814 | Ga0495674_0166410 | 3300047319 | Bacteria | 1842 |
| 815 | Ga0495674_0183898 | 3300047319 | Bacteria | 1739 |
| 816 | Ga0495674_0728174 | 3300047319 | Bacteria | 776 |
| 817 | Ga0495672_0011842 | 3300047320 | Bacteria | 6125 |
| 818 | Ga0495672_0035492 | 3300047320 | Bacteria | 3071 |
| 819 | Ga0495672_0309549 | 3300047320 | Bacteria | 745 |
| 820 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 821 | Ga0495686_0000034 | 3300047472 | Bacteria | 325038 |
| 822 | Ga0495686_0042904 | 3300047472 | Bacteria | 2872 |
| 823 | Ga0496104_0262147 | 3300048907 | Bacteria | 1641 |
| 824 | Ga0496104_0566379 | 3300048907 | Bacteria | 1047 |
| 825 | Ga0496104_0590328 | 3300048907 | Bacteria | 1021 |
| 826 | Ga0496105_0126827 | 3300048908 | Bacteria | 2104 |
| 827 | Ga0496108_0169857 | 3300048911 | Bacteria | 1887 |
| 828 | Ga0496108_0384570 | 3300048911 | Bacteria | 1225 |
| 829 | Ga0496109_0018089 | 3300048912 | Bacteria | 6189 |
| 830 | Ga0496109_0441181 | 3300048912 | Bacteria | 1230 |
| 831 | Ga0496109_0638213 | 3300048912 | Bacteria | 1002 |
| 832 | Ga0496109_0785594 | 3300048912 | Bacteria | 890 |
| 833 | Ga0496110_0597437 | 3300048913 | Bacteria | 1001 |
| 834 | Ga0496110_0628824 | 3300048913 | Bacteria | 972 |
| 835 | Ga0496111_0737091 | 3300048914 | Bacteria | 715 |
| 836 | Ga0496113_0788716 | 3300048916 | Bacteria | 755 |
| 837 | Ga0496114_0000244 | 3300048917 | Bacteria | 39586 |
| 838 | Ga0496115_0165551 | 3300048918 | Bacteria | 1828 |
| 839 | Ga0496121_0000030 | 3300048924 | Bacteria | 412079 |
| 840 | Ga0496126_0159142 | 3300048929 | Bacteria | 1931 |
| 841 | Ga0501306_036021 | 3300049127 | Bacteria | 753 |
| 842 | Ga0501290_023394 | 3300049513 | Bacteria | 857 |
| 843 | Ga0501325_003931 | 3300049541 | Bacteria | 1110 |
| 844 | Ga0501334_05371 | 3300049550 | Bacteria | 844 |
| 845 | Ga0501335_008302 | 3300049551 | Bacteria | 974 |
| 846 | Ga0501032_0033239 | 3300049569 | Bacteria | 3534 |
| 847 | Ga0501032_0036067 | 3300049569 | Bacteria | 3377 |
| 848 | Ga0501034_0000115 | 3300049571 | Bacteria | 146825 |
| 849 | Ga0501034_0016612 | 3300049571 | Bacteria | 7547 |
| 850 | Ga0501034_0766499 | 3300049571 | Bacteria | 859 |
| 851 | Ga0501036_0054893 | 3300049572 | Bacteria | 3375 |
| 852 | Ga0501036_0169801 | 3300049572 | Bacteria | 1838 |
| 853 | Ga0501037_0070902 | 3300049573 | Bacteria | 2535 |
| 854 | Ga0501037_0249668 | 3300049573 | Bacteria | 1242 |
| 855 | Ga0501039_0022511 | 3300049575 | Bacteria | 4838 |
| 856 | Ga0501043_0052847 | 3300049579 | Bacteria | 3191 |
| 857 | Ga0501043_0082468 | 3300049579 | Bacteria | 2527 |
| 858 | Ga0501047_0052554 | 3300049581 | Bacteria | 3938 |
| 859 | Ga0501047_0260193 | 3300049581 | Bacteria | 1583 |
| 860 | Ga0501047_0612894 | 3300049581 | Bacteria | 909 |
| 861 | Ga0501048_0180655 | 3300049582 | Bacteria | 1495 |
| 862 | Ga0501067_0017414 | 3300049583 | Bacteria | 3972 |
| 863 | Ga0501068_0011805 | 3300049584 | Bacteria | 4940 |
| 864 | Ga0501068_0079484 | 3300049584 | Bacteria | 2011 |
| 865 | Ga0501070_0131781 | 3300049586 | Bacteria | 2064 |
| 866 | Ga0501070_0732102 | 3300049586 | Bacteria | 780 |
| 867 | Ga0501071_1288973 | 3300049587 | Bacteria | 564 |
| 868 | Ga0501072_0245996 | 3300049588 | Bacteria | 1425 |
| 869 | Ga0501073_0033387 | 3300049589 | Bacteria | 3664 |
| 870 | Ga0501074_0016318 | 3300049590 | Bacteria | 5392 |
| 871 | Ga0501074_0176414 | 3300049590 | Unclassified | 1525 |
| 872 | Ga0501198_029237 | 3300049649 | Bacteria | 912 |
| 873 | Ga0501199_066127 | 3300049650 | Bacteria | 512 |
| 874 | Ga0501201_003522 | 3300049651 | Bacteria | 1438 |
| 875 | Ga0501202_001365 | 3300049652 | Bacteria | 3895 |
| 876 | Ga0501207_012482 | 3300049654 | Bacteria | 1277 |
| 877 | Ga0501211_021155 | 3300049658 | Bacteria | 684 |
| 878 | Ga0501217_001386 | 3300049661 | Bacteria | 4523 |
| 879 | Ga0501217_015616 | 3300049661 | Bacteria | 1732 |
| 880 | Ga0501222_008357 | 3300049662 | Bacteria | 1373 |
| 881 | Ga0501224_001167 | 3300049664 | Bacteria | 3445 |
| 882 | Ga0501233_002195 | 3300049668 | Bacteria | 3419 |
| 883 | Ga0501235_000159 | 3300049669 | Bacteria | 11662 |
| 884 | Ga0501239_036527 | 3300049672 | Bacteria | 665 |
| 885 | Ga0501243_001150 | 3300049675 | Bacteria | 3763 |
| 886 | Ga0501250_026987 | 3300049680 | Bacteria | 777 |
| 887 | Ga0501257_016868 | 3300049686 | Bacteria | 1696 |
| 888 | Ga0501257_017951 | 3300049686 | Bacteria | 1648 |
| 889 | Ga0501259_000917 | 3300049688 | Bacteria | 4862 |
| 890 | Ga0501261_001131 | 3300049690 | Bacteria | 3269 |
| 891 | Ga0501221_000734 | 3300049704 | Bacteria | 5280 |
| 892 | Ga0501221_062756 | 3300049704 | Bacteria | 862 |
| 893 | Ga0501225_0001133 | 3300049705 | Bacteria | 8334 |
| 894 | Ga0501225_0018502 | 3300049705 | Bacteria | 1931 |
| 895 | Ga0501234_000165 | 3300049707 | Bacteria | 9013 |
| 896 | Ga0501234_033909 | 3300049707 | Bacteria | 828 |
| 897 | Ga0501245_000740 | 3300049708 | Bacteria | 4052 |
| 898 | Ga0501079_0150892 | 3300049741 | Unclassified | 1812 |
| 899 | Ga0501083_0061959 | 3300049744 | Unclassified | 2497 |
| 900 | Ga0501083_0187638 | 3300049744 | Bacteria | 1349 |
| 901 | Ga0501264_025660 | 3300049761 | Bacteria | 651 |
| 902 | Ga0501280_013073 | 3300049776 | Bacteria | 1171 |
| 903 | Ga0501281_02851 | 3300049777 | Bacteria | 1246 |
| 904 | Ga0501035_0034909 | 3300049822 | Bacteria | 4568 |
| 905 | Ga0501035_0106263 | 3300049822 | Bacteria | 2461 |
| 906 | Ga0501035_0352653 | 3300049822 | Bacteria | 1231 |
| 907 | Ga0501044_0050433 | 3300049823 | Bacteria | 4294 |
| 908 | Ga0501044_0120671 | 3300049823 | Bacteria | 2623 |
| 909 | Ga0501044_0204649 | 3300049823 | Bacteria | 1931 |
| 910 | Ga0501045_0281164 | 3300049824 | Bacteria | 1239 |
| 911 | nmdc:mga0k408_208189_c1 | 3300050493 | Bacteria | 1168 |
| 912 | nmdc:mga05p37_55467_c1 | 3300050507 | Bacteria | 4876 |
| 913 | nmdc:mga09592_1443825_c1 | 3300050508 | Unclassified | 561 |
| 914 | nmdc:mga09592_671555_c1 | 3300050508 | Bacteria | 883 |
| 915 | nmdc:mga0qj67_12847_c1 | 3300050509 | Bacteria | 6318 |
| 916 | nmdc:mga08y16_126655_c1 | 3300050511 | Bacteria | 2656 |
| 917 | nmdc:mga08y16_230301_c1 | 3300050511 | Bacteria | 1916 |
| 918 | nmdc:mga08y16_505937_c1 | 3300050511 | Bacteria | 1227 |
| 919 | nmdc:mga08y16_579613_c1 | 3300050511 | Bacteria | 1133 |
| 920 | nmdc:mga08y16_67495_c1 | 3300050511 | Bacteria | 3730 |
| 921 | Ga0495619_0089505 | 3300053085 | Bacteria | 2083 |
| 922 | Ga0500578_0000131 | 3300053086 | Bacteria | 89434 |
| 923 | Ga0500646_0002639 | 3300053090 | Bacteria | 4641 |
| 924 | Ga0500646_0002704 | 3300053090 | Bacteria | 4581 |
| 925 | Ga0500583_0004642 | 3300053092 | Bacteria | 4508 |
| 926 | Ga0500583_0344858 | 3300053092 | Bacteria | 722 |
| 927 | Ga0500583_0347232 | 3300053092 | Bacteria | 719 |
| 928 | Ga0500641_0000103 | 3300053096 | Bacteria | 32996 |
| 929 | Ga0500556_0139200 | 3300053104 | Bacteria | 954 |
| 930 | Ga0500556_0218819 | 3300053104 | Bacteria | 751 |
| 931 | Ga0500562_040325 | 3300053108 | Bacteria | 1241 |
| 932 | Ga0500569_003697 | 3300053109 | Bacteria | 3152 |
| 933 | Ga0500642_0002513 | 3300053130 | Bacteria | 5396 |
| 934 | Ga0500642_0112302 | 3300053130 | Bacteria | 1273 |
| 935 | Ga0500652_042156 | 3300053131 | Bacteria | 1840 |
| 936 | Ga0500658_0006229 | 3300053134 | Bacteria | 4433 |
| 937 | Ga0500658_0089540 | 3300053134 | Bacteria | 1329 |
| 938 | Ga0500658_0116742 | 3300053134 | Bacteria | 1180 |
| 939 | Ga0500559_0055124 | 3300053136 | Bacteria | 1762 |
| 940 | Ga0500568_0040912 | 3300053139 | Bacteria | 1864 |
| 941 | Ga0500573_0208608 | 3300053140 | Bacteria | 1032 |
| 942 | Ga0500577_0022548 | 3300053142 | Bacteria | 2091 |
| 943 | Ga0500588_0048845 | 3300053146 | Bacteria | 1310 |
| 944 | Ga0500588_0222399 | 3300053146 | Bacteria | 704 |
| 945 | Ga0500589_027701 | 3300053147 | Bacteria | 2632 |
| 946 | Ga0500616_0051262 | 3300053153 | Bacteria | 2175 |
| 947 | Ga0500616_0172214 | 3300053153 | Bacteria | 982 |
| 948 | Ga0500622_0001805 | 3300053156 | Bacteria | 16320 |
| 949 | Ga0500634_0144562 | 3300053161 | Bacteria | 1121 |
| 950 | Ga0500639_017758 | 3300053163 | Bacteria | 3755 |
| 951 | Ga0500636_0027949 | 3300053177 | Bacteria | 3332 |
| 952 | Ga0501084_0050027 | 3300054114 | Bacteria | 3499 |
| 953 | Ga0501084_0775906 | 3300054114 | Bacteria | 807 |
| 954 | Ga0587073_0095123 | 3300059492 | Bacteria | 764 |
| 955 | Ga0587077_036024 | 3300059493 | Bacteria | 970 |
| 956 | Ga0466962_0123321 | 3300061719 | Bacteria | 1251 |
| 957 | 2513233638 | 2513020052 | Bacteria | 5120511 |
| 958 | 2738727010 | 2738541278 | Bacteria | 9755573 |
| 959 | 2738735522 | 2738541279 | Bacteria | 6149495 |
| 960 | 2738768099 | 2738541285 | Bacteria | 6150075 |
| 961 | 2739217104 | 2738543007 | Bacteria | 6149845 |
| 962 | 2739303836 | 2738543023 | Bacteria | 6767879 |
| 963 | 2739648054 | 2739367663 | Bacteria | 5040914 |
| 964 | 2849283584 | 2849281842 | Bacteria | 6065644 |
| 965 | 2852629665 | 2852627209 | Bacteria | 5896285 |
| 966 | 2883072490 | 2883068021 | Bacteria | 6192739 |
| 967 | 2896112655 | 2896109856 | Bacteria | 7140722 |
| 968 | 2904448056 | 2904445276 | Bacteria | 5310396 |
| 969 | 2929178632 | 2929177148 | Bacteria | 7883697 |
| 970 | 2945981041 | 2945977869 | Bacteria | 7777518 |
| 971 | 2946019557 | 2946013367 | Bacteria | 7766675 |
| 972 | 8055590080 | 8055588893 | Bacteria | 3619545 |
| 973 | Ga0157372_10328543 | |||
| 974 | JGI24744J21845_10031041 | |||
| 975 | rootH2_10078230 | |||
| 976 | rootL2_10077383 | |||
| 977 | rootH1_10048038 | |||
| 978 | rootH1_10276362 | |||
| 979 | JGI25160J50197_1004577 | |||
| 980 | JGI25404J52841_10038704 | |||
| 981 | Ga0055535_1016499 | |||
| 982 | Ga0055542_1005505 | |||
| 983 | Ga0065714_10071198 | |||
| 984 | Ga0065712_10010481 | |||
| 985 | Ga0065712_10027404 | |||
| 986 | Ga0065715_10192633 | |||
| 987 | Ga0065715_10600200 | |||
| 988 | Ga0065707_10156427 | |||
| 989 | Ga0070658_10000230 | |||
| 990 | Ga0070658_10084107 | |||
| 991 | Ga0070676_10000156 | |||
| 992 | Ga0070676_10006420 | |||
| 993 | Ga0070676_10076070 | |||
| 994 | Ga0070676_10104429 | |||
| 995 | Ga0070676_10238602 | |||
| 996 | Ga0070676_10811797 | |||
| 997 | Ga0070683_100001255 | |||
| 998 | Ga0070683_100003401 | |||
| 999 | Ga0070683_100308834 | |||
| 1000 | Ga0070683_100363408 | |||
| 1001 | Ga0070683_100481078 | |||
| 1002 | Ga0070683_100487734 | |||
| 1003 | Ga0070690_100040185 | |||
| 1004 | Ga0070670_100016632 | |||
| 1005 | Ga0070670_100185745 | |||
| 1006 | Ga0070670_100699705 | |||
| 1007 | Ga0070670_100992879 | |||
| 1008 | Ga0070677_10020168 | |||
| 1009 | Ga0070677_10021285 | |||
| 1010 | Ga0068869_100002522 | |||
| 1011 | Ga0068869_100003133 | |||
| 1012 | Ga0068869_100004775 | |||
| 1013 | Ga0068869_100065302 | |||
| 1014 | Ga0068869_100138598 | |||
| 1015 | Ga0068869_100250645 | |||
| 1016 | Ga0068869_100279426 | |||
| 1017 | Ga0068869_100761054 | |||
| 1018 | Ga0070666_10038780 | |||
| 1019 | Ga0070666_10288405 | |||
| 1020 | Ga0070666_10983346 | |||
| 1021 | Ga0070680_100000390 | |||
| 1022 | Ga0070680_100094647 | |||
| 1023 | Ga0070682_100000101 | |||
| 1024 | Ga0070682_100002004 | |||
| 1025 | Ga0070682_100099625 | |||
| 1026 | Ga0070682_101001335 | |||
| 1027 | Ga0070682_101422621 | |||
| 1028 | Ga0068868_100005139 | |||
| 1029 | Ga0068868_100065448 | |||
| 1030 | Ga0068868_100074011 | |||
| 1031 | Ga0068868_100135226 | |||
| 1032 | Ga0068868_100458063 | |||
| 1033 | Ga0070660_100420382 | |||
| 1034 | Ga0070660_100534966 | |||
| 1035 | Ga0070660_101101499 | |||
| 1036 | Ga0070689_100035619 | |||
| 1037 | Ga0070689_100191717 | |||
| 1038 | Ga0070689_100192671 | |||
| 1039 | Ga0070691_10000447 | |||
| 1040 | Ga0070691_10201387 | |||
| 1041 | Ga0070687_100074067 | |||
| 1042 | Ga0070687_100114385 | |||
| 1043 | Ga0070687_100173514 | |||
| 1044 | Ga0070687_100221678 | |||
| 1045 | Ga0070687_100460809 | |||
| 1046 | Ga0070661_100008622 | |||
| 1047 | Ga0070661_100702748 | |||
| 1048 | Ga0070661_101122497 | |||
| 1049 | Ga0070661_101254790 | |||
| 1050 | Ga0070668_100000872 | |||
| 1051 | Ga0070668_100286127 | |||
| 1052 | Ga0070669_100208077 | |||
| 1053 | Ga0070669_100299179 | |||
| 1054 | Ga0070669_100440900 | |||
| 1055 | Ga0070669_100540466 | |||
| 1056 | Ga0070669_100577193 | |||
| 1057 | Ga0070669_100655115 | |||
| 1058 | Ga0070675_100086876 | |||
| 1059 | Ga0070675_100102002 | |||
| 1060 | Ga0070675_100124513 | |||
| 1061 | Ga0070675_100192327 | |||
| 1062 | Ga0070675_100998240 | |||
| 1063 | Ga0070671_100007722 | |||
| 1064 | Ga0070671_100139444 | |||
| 1065 | Ga0070671_100303829 | |||
| 1066 | Ga0070671_100538731 | |||
| 1067 | Ga0070671_100575259 | |||
| 1068 | Ga0070671_101153640 | |||
| 1069 | Ga0070671_101621669 | |||
| 1070 | Ga0070674_100022902 | |||
| 1071 | Ga0070674_100037115 | |||
| 1072 | Ga0070674_100366303 | |||
| 1073 | Ga0070674_100639903 | |||
| 1074 | Ga0070673_100000096 | |||
| 1075 | Ga0070673_100021393 | |||
| 1076 | Ga0070673_100043128 | |||
| 1077 | Ga0070673_100095994 | |||
| 1078 | Ga0070673_100318855 | |||
| 1079 | Ga0070673_100613989 | |||
| 1080 | Ga0070673_101423730 | |||
| 1081 | Ga0070688_100013814 | |||
| 1082 | Ga0070688_100059691 | |||
| 1083 | Ga0070688_100126468 | |||
| 1084 | Ga0070688_100150256 | |||
| 1085 | Ga0070688_100152971 | |||
| 1086 | Ga0070688_100476254 | |||
| 1087 | Ga0070659_100062931 | |||
| 1088 | Ga0070659_100328631 | |||
| 1089 | Ga0070667_100000248 | |||
| 1090 | Ga0070667_100009195 | |||
| 1091 | Ga0070667_100081998 | |||
| 1092 | Ga0070667_100265955 | |||
| 1093 | Ga0070667_100332972 | |||
| 1094 | Ga0070667_100424617 | |||
| 1095 | Ga0070701_10439358 | |||
| 1096 | Ga0070700_100024994 | |||
| 1097 | Ga0070700_100331459 | |||
| 1098 | Ga0070700_100491908 | |||
| 1099 | Ga0070694_101630973 | |||
| 1100 | Ga0070663_100285100 | |||
| 1101 | Ga0070663_100923314 | |||
| 1102 | Ga0070663_101308484 | |||
| 1103 | Ga0070678_100044179 | |||
| 1104 | Ga0070678_100106688 | |||
| 1105 | Ga0070678_100289604 | |||
| 1106 | Ga0070678_100472367 | |||
| 1107 | Ga0070662_100104599 | |||
| 1108 | Ga0070681_10011420 | |||
| 1109 | Ga0070681_10926605 | |||
| 1110 | Ga0068867_100015569 | |||
| 1111 | Ga0068867_100120228 | |||
| 1112 | Ga0068867_100122509 | |||
| 1113 | Ga0068867_101231336 | |||
| 1114 | Ga0068867_101358801 | |||
| 1115 | Ga0068867_101437124 | |||
| 1116 | Ga0070685_10033012 | |||
| 1117 | Ga0070685_10033794 | |||
| 1118 | Ga0070685_10048439 | |||
| 1119 | Ga0070685_10326662 | |||
| 1120 | Ga0070685_10730222 | |||
| 1121 | Ga0070707_101620644 | |||
| 1122 | Ga0070698_100007455 | |||
| 1123 | Ga0070699_101327587 | |||
| 1124 | Ga0070679_100000656 | |||
| 1125 | Ga0070679_100180157 | |||
| 1126 | Ga0070684_100000646 | |||
| 1127 | Ga0070684_100034182 | |||
| 1128 | Ga0070684_100122051 | |||
| 1129 | Ga0070684_100679247 | |||
| 1130 | Ga0070684_101232456 | |||
| 1131 | Ga0068853_100013448 | |||
| 1132 | Ga0068853_100031011 | |||
| 1133 | Ga0068853_100047223 | |||
| 1134 | Ga0068853_100417778 | |||
| 1135 | Ga0068853_100537150 | |||
| 1136 | Ga0070672_100000033 | |||
| 1137 | Ga0070672_100039137 | |||
| 1138 | Ga0070672_100048173 | |||
| 1139 | Ga0070672_100268017 | |||
| 1140 | Ga0070672_100499992 | |||
| 1141 | Ga0070672_100593033 | |||
| 1142 | Ga0070672_100621406 | |||
| 1143 | Ga0070672_101224954 | |||
| 1144 | Ga0070686_100012657 | |||
| 1145 | Ga0070686_100051454 | |||
| 1146 | Ga0070686_100179752 | |||
| 1147 | Ga0070686_100192741 | |||
| 1148 | Ga0070665_100000013 | |||
| 1149 | Ga0070665_100000641 | |||
| 1150 | Ga0070665_100004098 | |||
| 1151 | Ga0070665_100113486 | |||
| 1152 | Ga0070665_100264111 | |||
| 1153 | Ga0070704_100382230 | |||
| 1154 | Ga0068855_100002469 | |||
| 1155 | Ga0068855_100015914 | |||
| 1156 | Ga0068855_100221532 | |||
| 1157 | Ga0068855_100269817 | |||
| 1158 | Ga0070664_100032938 | |||
| 1159 | Ga0070664_100077370 | |||
| 1160 | Ga0070664_100079634 | |||
| 1161 | Ga0070664_100140839 | |||
| 1162 | Ga0070664_100186212 | |||
| 1163 | Ga0070664_100707088 | |||
| 1164 | Ga0070664_101050427 | |||
| 1165 | Ga0068857_100042210 | |||
| 1166 | Ga0068857_100069696 | |||
| 1167 | Ga0068857_100139293 | |||
| 1168 | Ga0068857_100167393 | |||
| 1169 | Ga0068857_100319895 | |||
| 1170 | Ga0068857_100785336 | |||
| 1171 | Ga0068854_100008737 | |||
| 1172 | Ga0068854_100042061 | |||
| 1173 | Ga0068854_100106635 | |||
| 1174 | Ga0068854_100261291 | |||
| 1175 | Ga0068856_100022888 | |||
| 1176 | Ga0070702_100043622 | |||
| 1177 | Ga0070702_100820185 | |||
| 1178 | Ga0068852_100022404 | |||
| 1179 | Ga0068852_100214645 | |||
| 1180 | Ga0068852_100392100 | |||
| 1181 | Ga0068852_100415079 | |||
| 1182 | Ga0068852_100583392 | |||
| 1183 | Ga0068852_100837233 | |||
| 1184 | Ga0068859_100001757 | |||
| 1185 | Ga0068859_100040962 | |||
| 1186 | Ga0068859_100053730 | |||
| 1187 | Ga0068859_100136737 | |||
| 1188 | Ga0068859_100473589 | |||
| 1189 | Ga0068859_101239839 | |||
| 1190 | Ga0068864_100001018 | |||
| 1191 | Ga0068864_100008778 | |||
| 1192 | Ga0068864_100048173 | |||
| 1193 | Ga0068864_100065608 | |||
| 1194 | Ga0068864_100152006 | |||
| 1195 | Ga0068864_100368074 | |||
| 1196 | Ga0068864_100430604 | |||
| 1197 | Ga0068864_101129415 | |||
| 1198 | Ga0068866_10529193 | |||
| 1199 | Ga0068861_100007743 | |||
| 1200 | Ga0068861_100074274 | |||
| 1201 | Ga0068861_100572798 | |||
| 1202 | Ga0068851_10021291 | |||
| 1203 | Ga0068851_10180169 | |||
| 1204 | Ga0068870_10020859 | |||
| 1205 | Ga0068870_10038408 | |||
| 1206 | Ga0068870_10708970 | |||
| 1207 | Ga0068863_100002172 | |||
| 1208 | Ga0068863_100107269 | |||
| 1209 | Ga0068863_100383159 | |||
| 1210 | Ga0068863_100536798 | |||
| 1211 | Ga0068863_100826713 | |||
| 1212 | Ga0068863_100828427 | |||
| 1213 | Ga0068863_101271249 | |||
| 1214 | Ga0068858_100000596 | |||
| 1215 | Ga0068858_100157996 | |||
| 1216 | Ga0068858_100176060 | |||
| 1217 | Ga0068858_100262879 | |||
| 1218 | Ga0068858_100308589 | |||
| 1219 | Ga0068858_100432528 | |||
| 1220 | Ga0068860_100000060 | |||
| 1221 | Ga0068860_100001437 | |||
| 1222 | Ga0068860_100009018 | |||
| 1223 | Ga0068860_100508357 | |||
| 1224 | Ga0068860_100651305 | |||
| 1225 | Ga0068860_101107300 | |||
| 1226 | Ga0068862_100011742 | |||
| 1227 | Ga0068862_100169571 | |||
| 1228 | Ga0068862_100237441 | |||
| 1229 | Ga0068862_100359909 | |||
| 1230 | Ga0068862_101206967 | |||
| 1231 | Ga0068862_101560517 | |||
| 1232 | Ga0081540_1006219 | |||
| 1233 | Ga0081539_10031111 | |||
| 1234 | Ga0081539_10080809 | |||
| 1235 | Ga0070715_10219437 | |||
| 1236 | Ga0075367_10708810 | |||
| 1237 | Ga0075366_10081695 | |||
| 1238 | Ga0075366_10150741 | |||
| 1239 | Ga0075366_10301416 | |||
| 1240 | Ga0097621_100000582 | |||
| 1241 | Ga0097621_100015035 | |||
| 1242 | Ga0097621_100015580 | |||
| 1243 | Ga0097621_100529089 | |||
| 1244 | Ga0097621_101194898 | |||
| 1245 | Ga0068871_100000764 | |||
| 1246 | Ga0068871_100002439 | |||
| 1247 | Ga0068871_100068788 | |||
| 1248 | Ga0068871_100079404 | |||
| 1249 | Ga0068871_100407004 | |||
| 1250 | Ga0075428_100178166 | |||
| 1251 | Ga0075430_100020946 | |||
| 1252 | Ga0068865_100112445 | |||
| 1253 | Ga0068865_100255760 | |||
| 1254 | Ga0068865_100290128 | |||
| 1255 | Ga0068865_100345541 | |||
| 1256 | Ga0068865_100490788 | |||
| 1257 | Ga0068865_101139898 | |||
| 1258 | Ga0097620_100001757 | |||
| 1259 | Ga0097620_100040961 | |||
| 1260 | Ga0097620_100053730 | |||
| 1261 | Ga0097620_100136742 | |||
| 1262 | Ga0097620_100473595 | |||
| 1263 | Ga0097620_100755027 | |||
| 1264 | Ga0097620_101239845 | |||
| 1265 | Ga0105240_10000716 | |||
| 1266 | Ga0105240_10001832 | |||
| 1267 | Ga0105240_10002222 | |||
| 1268 | Ga0105240_10002441 | |||
| 1269 | Ga0105240_10003315 | |||
| 1270 | Ga0105240_10056738 | |||
| 1271 | Ga0105240_10073470 | |||
| 1272 | Ga0105240_10118862 | |||
| 1273 | Ga0105240_10640435 | |||
| 1274 | Ga0105240_11159186 | |||
| 1275 | Ga0111539_10126346 | |||
| 1276 | Ga0111539_10229668 | |||
| 1277 | Ga0111539_10263841 | |||
| 1278 | Ga0111539_10776900 | |||
| 1279 | Ga0111539_11053826 | |||
| 1280 | Ga0111539_11490367 | |||
| 1281 | Ga0105245_10037818 | |||
| 1282 | Ga0105247_10360470 | |||
| 1283 | Ga0105247_10368045 | |||
| 1284 | Ga0114129_10022888 | |||
| 1285 | Ga0114129_10062353 | |||
| 1286 | Ga0105241_10000638 | |||
| 1287 | Ga0105241_10000951 | |||
| 1288 | Ga0105241_10044054 | |||
| 1289 | Ga0105241_10126331 | |||
| 1290 | Ga0105241_10165509 | |||
| 1291 | Ga0105241_10234508 | |||
| 1292 | Ga0105241_10358228 | |||
| 1293 | Ga0105241_10683292 | |||
| 1294 | Ga0105241_11121544 | |||
| 1295 | Ga0105242_10038646 | |||
| 1296 | Ga0105242_10123033 | |||
| 1297 | Ga0105242_10819652 | |||
| 1298 | Ga0105242_10927377 | |||
| 1299 | Ga0105248_10181231 | |||
| 1300 | Ga0105248_10328539 | |||
| 1301 | Ga0105237_10004721 | |||
| 1302 | Ga0105237_10028791 | |||
| 1303 | Ga0105237_10035731 | |||
| 1304 | Ga0105237_10038393 | |||
| 1305 | Ga0105237_10073217 | |||
| 1306 | Ga0105237_10079005 | |||
| 1307 | Ga0105237_10091224 | |||
| 1308 | Ga0105237_10106296 | |||
| 1309 | Ga0105237_10224500 | |||
| 1310 | Ga0105237_10865937 | |||
| 1311 | Ga0105237_11938065 | |||
| 1312 | Ga0105238_10001000 | |||
| 1313 | Ga0105238_10023465 | |||
| 1314 | Ga0105238_10670185 | |||
| 1315 | Ga0105249_10003003 | |||
| 1316 | Ga0105249_10006053 | |||
| 1317 | Ga0105249_10146223 | |||
| 1318 | Ga0105249_10205830 | |||
| 1319 | Ga0105249_10416943 | |||
| 1320 | Ga0105249_11539037 | |||
| 1321 | Ga0105239_10001821 | |||
| 1322 | Ga0105239_10007877 | |||
| 1323 | Ga0105239_10025404 | |||
| 1324 | Ga0105239_10027514 | |||
| 1325 | Ga0105239_10113563 | |||
| 1326 | Ga0105239_10292576 | |||
| 1327 | Ga0105246_10441639 | |||
| 1328 | Ga0105246_10525400 | |||
| 1329 | Ga0105246_10583305 | |||
| 1330 | Ga0105246_10709751 | |||
| 1331 | Ga0157373_10002835 | |||
| 1332 | Ga0157373_10025126 | |||
| 1333 | Ga0157373_10337129 | |||
| 1334 | Ga0157371_10001448 | |||
| 1335 | Ga0157371_10003113 | |||
| 1336 | Ga0157371_10094621 | |||
| 1337 | Ga0157371_10411292 | |||
| 1338 | Ga0157370_10001290 | |||
| 1339 | Ga0157370_10001459 | |||
| 1340 | Ga0157370_10005908 | |||
| 1341 | Ga0157370_10013052 | |||
| 1342 | Ga0157370_10025903 | |||
| 1343 | Ga0157370_10074596 | |||
| 1344 | Ga0157370_10092862 | |||
| 1345 | Ga0157370_10487068 | |||
| 1346 | Ga0157370_10957438 | |||
| 1347 | Ga0157370_11403034 | |||
| 1348 | Ga0157369_10010084 | |||
| 1349 | Ga0157369_10042043 | |||
| 1350 | Ga0157369_10133629 | |||
| 1351 | Ga0157369_10306992 | |||
| 1352 | Ga0157374_10000007 | |||
| 1353 | Ga0157374_10000266 | |||
| 1354 | Ga0157374_10005639 | |||
| 1355 | Ga0157374_10126120 | |||
| 1356 | Ga0157374_10501211 | |||
| 1357 | Ga0157374_10938873 | |||
| 1358 | Ga0157378_10002479 | |||
| 1359 | Ga0157378_10008516 | |||
| 1360 | Ga0157378_10020629 | |||
| 1361 | Ga0157378_10099260 | |||
| 1362 | Ga0157378_10220435 | |||
| 1363 | Ga0157378_10368270 | |||
| 1364 | Ga0157378_10421892 | |||
| 1365 | Ga0157378_10448251 | |||
| 1366 | Ga0157378_10525970 | |||
| 1367 | Ga0157378_10678976 | |||
| 1368 | Ga0157378_10804968 | |||
| 1369 | Ga0157378_11016333 | |||
| 1370 | Ga0163162_10000037 | |||
| 1371 | Ga0163162_10000397 | |||
| 1372 | Ga0163162_10000934 | |||
| 1373 | Ga0163162_10006744 | |||
| 1374 | Ga0163162_10010199 | |||
| 1375 | Ga0163162_10060891 | |||
| 1376 | Ga0163162_10087258 | |||
| 1377 | Ga0163162_10130797 | |||
| 1378 | Ga0163162_10286830 | |||
| 1379 | Ga0163162_10769676 | |||
| 1380 | Ga0163162_10777646 | |||
| 1381 | Ga0163162_10924714 | |||
| 1382 | Ga0163162_11786196 | |||
| 1383 | Ga0163162_12494935 | |||
| 1384 | Ga0157372_10001489 | |||
| 1385 | Ga0157372_10234137 | |||
| 1386 | Ga0157372_10301812 | |||
| 1387 | Ga0157372_10508516 | |||
| 1388 | Ga0157372_10854084 | |||
| 1389 | Ga0157372_11124226 | |||
| 1390 | Ga0157372_12111019 | |||
| 1391 | Ga0157375_10000346 | |||
| 1392 | Ga0157375_10005834 | |||
| 1393 | Ga0157375_10149947 | |||
| 1394 | Ga0157375_10165750 | |||
| 1395 | Ga0157375_10233807 | |||
| 1396 | Ga0157375_10428440 | |||
| 1397 | Ga0157375_10455675 | |||
| 1398 | Ga0157375_10512479 | |||
| 1399 | Ga0157375_10801570 | |||
| 1400 | Ga0163163_10003157 | |||
| 1401 | Ga0163163_10143265 | |||
| 1402 | Ga0163163_10191663 | |||
| 1403 | Ga0163163_10207011 | |||
| 1404 | Ga0163163_10258750 | |||
| 1405 | Ga0163163_10659660 | |||
| 1406 | Ga0163163_10864005 | |||
| 1407 | Ga0163163_11025921 | |||
| 1408 | Ga0163163_11109697 | |||
| 1409 | Ga0163163_11168471 | |||
| 1410 | Ga0157380_10005817 | |||
| 1411 | Ga0157380_10160443 | |||
| 1412 | Ga0157380_10508091 | |||
| 1413 | Ga0157380_10774236 | |||
| 1414 | Ga0157380_10929558 | |||
| 1415 | Ga0182008_10000668 | |||
| 1416 | Ga0157377_10038906 | |||
| 1417 | Ga0157377_10054477 | |||
| 1418 | Ga0157377_10120692 | |||
| 1419 | Ga0157377_10218741 | |||
| 1420 | Ga0157377_10237609 | |||
| 1421 | Ga0157377_10247791 | |||
| 1422 | Ga0157379_10000229 | |||
| 1423 | Ga0157379_10017277 | |||
| 1424 | Ga0157379_10068586 | |||
| 1425 | Ga0157379_10102107 | |||
| 1426 | Ga0157379_10153165 | |||
| 1427 | Ga0157379_10442320 | |||
| 1428 | Ga0157379_10649605 | |||
| 1429 | Ga0157376_10000117 | |||
| 1430 | Ga0157376_10005117 | |||
| 1431 | Ga0157376_10068408 | |||
| 1432 | Ga0157376_10172914 | |||
| 1433 | Ga0157376_10221722 | |||
| 1434 | Ga0157376_10779702 | |||
| 1435 | Ga0157376_10812725 | |||
| 1436 | Ga0163161_10000019 | |||
| 1437 | Ga0163161_10027837 | |||
| 1438 | Ga0163161_10037360 | |||
| 1439 | Ga0163161_10077415 | |||
| 1440 | Ga0163161_10093388 | |||
| 1441 | Ga0163161_10141132 | |||
| 1442 | Ga0163161_10333225 | |||
| 1443 | Ga0163161_10418895 | |||
| 1444 | Ga0163161_10878794 | |||
| 1445 | Ga0206352_10768305 | |||
| 1446 | Ga0213876_10024159 | |||
| 1447 | Ga0209258_100041 | |||
| 1448 | Ga0209148_1000090 | |||
| 1449 | Ga0207426_1000023 | |||
| 1450 | Ga0207697_10162236 | |||
| 1451 | Ga0207697_10215228 | |||
| 1452 | Ga0207656_10000261 | |||
| 1453 | Ga0207656_10048031 | |||
| 1454 | Ga0207656_10205995 | |||
| 1455 | Ga0207713_1189406 | |||
| 1456 | Ga0207682_10013673 | |||
| 1457 | Ga0207682_10018427 | |||
| 1458 | Ga0207642_10167277 | |||
| 1459 | Ga0207688_10028997 | |||
| 1460 | Ga0207688_10321476 | |||
| 1461 | Ga0207688_10407011 | |||
| 1462 | Ga0207680_10103352 | |||
| 1463 | Ga0207647_10012021 | |||
| 1464 | Ga0207647_10042106 | |||
| 1465 | Ga0207685_10029057 | |||
| 1466 | Ga0207685_10439187 | |||
| 1467 | Ga0207645_10000836 | |||
| 1468 | Ga0207645_10010983 | |||
| 1469 | Ga0207645_10173890 | |||
| 1470 | Ga0207645_10188255 | |||
| 1471 | Ga0207643_10018006 | |||
| 1472 | Ga0207643_10059071 | |||
| 1473 | Ga0207643_10330463 | |||
| 1474 | Ga0207705_10158134 | |||
| 1475 | Ga0207654_10000832 | |||
| 1476 | Ga0207654_10001898 | |||
| 1477 | Ga0207654_10056552 | |||
| 1478 | Ga0207654_10102456 | |||
| 1479 | Ga0207707_10001200 | |||
| 1480 | Ga0207695_10000130 | |||
| 1481 | Ga0207695_10000862 | |||
| 1482 | Ga0207695_10003201 | |||
| 1483 | Ga0207695_10010277 | |||
| 1484 | Ga0207695_10025833 | |||
| 1485 | Ga0207695_10036723 | |||
| 1486 | Ga0207695_10055439 | |||
| 1487 | Ga0207695_10056110 | |||
| 1488 | Ga0207695_10834588 | |||
| 1489 | Ga0207671_10001678 | |||
| 1490 | Ga0207671_10030243 | |||
| 1491 | Ga0207671_10073775 | |||
| 1492 | Ga0207660_10000111 | |||
| 1493 | Ga0207662_10009337 | |||
| 1494 | Ga0207662_10063870 | |||
| 1495 | Ga0207662_10110373 | |||
| 1496 | Ga0207662_10190985 | |||
| 1497 | Ga0207662_10612217 | |||
| 1498 | Ga0207657_10061731 | |||
| 1499 | Ga0207657_10062510 | |||
| 1500 | Ga0207649_10007630 | |||
| 1501 | Ga0207649_10683650 | |||
| 1502 | Ga0207652_10000460 | |||
| 1503 | Ga0207646_11280440 | |||
| 1504 | Ga0207681_10064601 | |||
| 1505 | Ga0207650_10030551 | |||
| 1506 | Ga0207650_10092790 | |||
| 1507 | Ga0207650_10111835 | |||
| 1508 | Ga0207650_10208471 | |||
| 1509 | Ga0207650_10400276 | |||
| 1510 | Ga0207650_10811709 | |||
| 1511 | Ga0207650_10831640 | |||
| 1512 | Ga0207659_10062388 | |||
| 1513 | Ga0207659_10078574 | |||
| 1514 | Ga0207687_10101167 | |||
| 1515 | Ga0207644_10183600 | |||
| 1516 | Ga0207644_10214902 | |||
| 1517 | Ga0207644_10532878 | |||
| 1518 | Ga0207644_10550658 | |||
| 1519 | Ga0207644_10595348 | |||
| 1520 | Ga0207690_10042278 | |||
| 1521 | Ga0207690_10624323 | |||
| 1522 | Ga0207706_10012970 | |||
| 1523 | Ga0207706_10094095 | |||
| 1524 | Ga0207706_10444161 | |||
| 1525 | Ga0207706_10659815 | |||
| 1526 | Ga0207706_11109468 | |||
| 1527 | Ga0207686_10196444 | |||
| 1528 | Ga0207670_10002725 | |||
| 1529 | Ga0207670_10023717 | |||
| 1530 | Ga0207670_10100184 | |||
| 1531 | Ga0207670_10597775 | |||
| 1532 | Ga0207669_10061032 | |||
| 1533 | Ga0207669_10076404 | |||
| 1534 | Ga0207669_10587879 | |||
| 1535 | Ga0207669_10774412 | |||
| 1536 | Ga0207704_10440910 | |||
| 1537 | Ga0207691_10000001 | |||
| 1538 | Ga0207691_10008281 | |||
| 1539 | Ga0207691_10014883 | |||
| 1540 | Ga0207691_10040431 | |||
| 1541 | Ga0207691_10196770 | |||
| 1542 | Ga0207691_10720557 | |||
| 1543 | Ga0207711_10024205 | |||
| 1544 | Ga0207689_10003189 | |||
| 1545 | Ga0207689_10004326 | |||
| 1546 | Ga0207689_10005568 | |||
| 1547 | Ga0207689_10006425 | |||
| 1548 | Ga0207689_10007832 | |||
| 1549 | Ga0207689_10025740 | |||
| 1550 | Ga0207689_10455855 | |||
| 1551 | Ga0207689_10507211 | |||
| 1552 | Ga0207689_10545053 | |||
| 1553 | Ga0207661_10002005 | |||
| 1554 | Ga0207661_10005743 | |||
| 1555 | Ga0207661_10646522 | |||
| 1556 | Ga0207661_10802450 | |||
| 1557 | Ga0207679_10007874 | |||
| 1558 | Ga0207679_10085888 | |||
| 1559 | Ga0207679_10235339 | |||
| 1560 | Ga0207679_10653178 | |||
| 1561 | Ga0207679_11115646 | |||
| 1562 | Ga0207667_10000131 | |||
| 1563 | Ga0207667_10000915 | |||
| 1564 | Ga0207667_10029805 | |||
| 1565 | Ga0207667_10131183 | |||
| 1566 | Ga0207667_10176469 | |||
| 1567 | Ga0207651_10002426 | |||
| 1568 | Ga0207651_10010285 | |||
| 1569 | Ga0207651_10068688 | |||
| 1570 | Ga0207651_10090083 | |||
| 1571 | Ga0207651_10228644 | |||
| 1572 | Ga0207651_10237200 | |||
| 1573 | Ga0207651_10270498 | |||
| 1574 | Ga0207651_10485438 | |||
| 1575 | Ga0207712_10002527 | |||
| 1576 | Ga0207712_10010105 | |||
| 1577 | Ga0207712_10064097 | |||
| 1578 | Ga0207712_10110548 | |||
| 1579 | Ga0207712_10587762 | |||
| 1580 | Ga0207712_10771483 | |||
| 1581 | Ga0207712_11112295 | |||
| 1582 | Ga0207668_10000263 | |||
| 1583 | Ga0207668_10028862 | |||
| 1584 | Ga0207668_11665666 | |||
| 1585 | Ga0207640_10159394 | |||
| 1586 | Ga0207640_10227640 | |||
| 1587 | Ga0207640_10688221 | |||
| 1588 | Ga0207640_10742989 | |||
| 1589 | Ga0207658_10001591 | |||
| 1590 | Ga0207658_10070645 | |||
| 1591 | Ga0207658_10183781 | |||
| 1592 | Ga0207658_10342972 | |||
| 1593 | Ga0207658_10484722 | |||
| 1594 | Ga0207658_10535027 | |||
| 1595 | Ga0207658_10549260 | |||
| 1596 | Ga0207658_10676222 | |||
| 1597 | Ga0207658_10757176 | |||
| 1598 | Ga0207658_11311218 | |||
| 1599 | Ga0207677_10001832 | |||
| 1600 | Ga0207677_10018283 | |||
| 1601 | Ga0207677_10443891 | |||
| 1602 | Ga0207677_10553346 | |||
| 1603 | Ga0207677_10851475 | |||
| 1604 | Ga0207677_11297683 | |||
| 1605 | Ga0207703_10003862 | |||
| 1606 | Ga0207703_10023210 | |||
| 1607 | Ga0207639_10009269 | |||
| 1608 | Ga0207639_10025486 | |||
| 1609 | Ga0207639_10311053 | |||
| 1610 | Ga0207678_10103764 | |||
| 1611 | Ga0207678_10945014 | |||
| 1612 | Ga0207708_10393150 | |||
| 1613 | Ga0207708_10452445 | |||
| 1614 | Ga0207708_10486031 | |||
| 1615 | Ga0207702_10053631 | |||
| 1616 | Ga0207702_10104747 | |||
| 1617 | Ga0207702_10131310 | |||
| 1618 | Ga0207702_11020443 | |||
| 1619 | Ga0207641_10000756 | |||
| 1620 | Ga0207641_10001344 | |||
| 1621 | Ga0207641_10016156 | |||
| 1622 | Ga0207641_10077492 | |||
| 1623 | Ga0207641_10157032 | |||
| 1624 | Ga0207641_10348842 | |||
| 1625 | Ga0207641_10549490 | |||
| 1626 | Ga0207648_10008820 | |||
| 1627 | Ga0207648_10013563 | |||
| 1628 | Ga0207648_10052501 | |||
| 1629 | Ga0207648_10117789 | |||
| 1630 | Ga0207648_10203231 | |||
| 1631 | Ga0207676_10005739 | |||
| 1632 | Ga0207676_10006275 | |||
| 1633 | Ga0207676_10011337 | |||
| 1634 | Ga0207676_10098896 | |||
| 1635 | Ga0207676_10424949 | |||
| 1636 | Ga0207676_10764577 | |||
| 1637 | Ga0207676_11114558 | |||
| 1638 | Ga0207676_11423860 | |||
| 1639 | Ga0207676_11895318 | |||
| 1640 | Ga0207674_10001708 | |||
| 1641 | Ga0207674_10009425 | |||
| 1642 | Ga0207674_10058277 | |||
| 1643 | Ga0207674_10128022 | |||
| 1644 | Ga0207674_10141114 | |||
| 1645 | Ga0207674_10248932 | |||
| 1646 | Ga0207674_11009234 | |||
| 1647 | Ga0207675_100020739 | |||
| 1648 | Ga0207675_100056045 | |||
| 1649 | Ga0207675_100194729 | |||
| 1650 | Ga0207675_100300594 | |||
| 1651 | Ga0207675_100300727 | |||
| 1652 | Ga0207675_101567698 | |||
| 1653 | Ga0207675_101847596 | |||
| 1654 | Ga0207683_10018226 | |||
| 1655 | Ga0207683_10039309 | |||
| 1656 | Ga0207683_10193549 | |||
| 1657 | Ga0207683_10250160 | |||
| 1658 | Ga0207698_10004388 | |||
| 1659 | Ga0207698_10088404 | |||
| 1660 | Ga0207698_10194177 | |||
| 1661 | Ga0207698_10723653 | |||
| 1662 | Ga0207698_10821970 | |||
| 1663 | Ga0207698_10865389 | |||
| 1664 | Ga0207698_10990130 | |||
| 1665 | Ga0207698_11364486 | |||
| 1666 | Ga0207698_11365210 | |||
| 1667 | Ga0207428_10066121 | |||
| 1668 | Ga0207428_10102899 | |||
| 1669 | Ga0207428_10232171 | |||
| 1670 | Ga0268266_10000024 | |||
| 1671 | Ga0268266_10001506 | |||
| 1672 | Ga0268266_10003844 | |||
| 1673 | Ga0268266_10534527 | |||
| 1674 | Ga0268265_10109775 | |||
| 1675 | Ga0268265_10438788 | |||
| 1676 | Ga0268265_10513354 | |||
| 1677 | Ga0268265_10624636 | |||
| 1678 | Ga0268265_10694665 | |||
| 1679 | Ga0268265_11223007 | |||
| 1680 | Ga0268265_11536993 | |||
| 1681 | Ga0268264_10000915 | |||
| 1682 | Ga0268264_10027244 | |||
| 1683 | Ga0268264_10027327 | |||
| 1684 | Ga0268264_10043221 | |||
| 1685 | Ga0268264_10094548 | |||
| 1686 | Ga0268264_10215744 | |||
| 1687 | Ga0268264_10258000 | |||
| 1688 | Ga0268264_10425039 | |||
| 1689 | Ga0268264_10602124 | |||
| 1690 | Ga0268264_10851076 | |||
| 1691 | Ga0268264_11342751 | |||
| 1692 | Ga0307517_10002909 | |||
| 1693 | Ga0307515_10000001 | |||
| 1694 | Ga0307515_10072791 | |||
| 1695 | Ga0307511_10000680 | |||
| 1696 | Ga0265327_10000009 | |||
| 1697 | Ga0265327_10000191 | |||
| 1698 | Ga0307513_10116829 | |||
| 1699 | Ga0307513_10219513 | |||
| 1700 | Ga0307513_10445803 | |||
| 1701 | Ga0307509_10133581 | |||
| 1702 | Ga0307509_10418288 | |||
| 1703 | Ga0307413_10081837 | |||
| 1704 | Ga0307413_10215995 | |||
| 1705 | Ga0307413_11112420 | |||
| 1706 | Ga0307410_10863834 | |||
| 1707 | Ga0307407_10345016 | |||
| 1708 | Ga0307412_10513322 | |||
| 1709 | Ga0307414_10000268 | |||
| 1710 | Ga0307414_10378258 | |||
| 1711 | Ga0307414_11249214 | |||
| 1712 | Ga0307414_11431005 | |||
| 1713 | Ga0307414_11648976 | |||
| 1714 | Ga0307411_10165014 | |||
| 1715 | Ga0307411_10283123 | |||
| 1716 | Ga0307415_101242997 | |||
| 1717 | Ga0373943_0623808 | |||
| 1718 | Ga0373943_0642583 | |||
| 1719 | Ga0373955_0125081 | |||
| 1720 | Ga0373955_0354307 | |||
| 1721 | Ga0373955_0562774 | |||
| 1722 | Ga0373924_0135494 | |||
| 1723 | Ga0373935_1261187 | |||
| 1724 | Ga0373933_0450106 | |||
| 1725 | Ga0373947_0066714 | |||
| 1726 | Ga0373937_0014633 | |||
| 1727 | Ga0316584_0580607 | |||
| 1728 | Ga0373925_0044251 | |||
| 1729 | Ga0395900_0731230 | |||
| 1730 | Ga0436365_0373370 | |||
| 1731 | Ga0436365_1440691 | |||
| 1732 | Ga0451791_0419064 | |||
| 1733 | Ga0451807_1080023 | |||
| 1734 | Ga0451807_1086769 | |||
| 1735 | Ga0451843_0283103 | |||
| 1736 | Ga0439441_011478 | |||
| 1737 | Ga0439450_221238 | |||
| 1738 | Ga0450921_003691 | |||
| 1739 | Ga0450923_130288 | |||
| 1740 | Ga0439444_0020382 | |||
| 1741 | Ga0450893_0054898 | |||
| 1742 | Ga0451577_0000213 | |||
| 1743 | Ga0451577_0032736 | |||
| 1744 | Ga0466972_0133411 | |||
| 1745 | Ga0466961_0146090 | |||
| 1746 | Ga0453684_0064971 | |||
| 1747 | Ga0453684_0102824 | |||
| 1748 | Ga0453684_0481203 | |||
| 1749 | Ga0466957_0000776 | |||
| 1750 | Ga0466957_0007665 | |||
| 1751 | Ga0466957_0210564 | |||
| 1752 | Ga0466957_0325055 | |||
| 1753 | Ga0451576_0191556 | |||
| 1754 | Ga0495629_0052891 | |||
| 1755 | Ga0495638_0166984 | |||
| 1756 | Ga0495638_0329382 | |||
| 1757 | Ga0495580_0179895 | |||
| 1758 | Ga0495639_0023369 | |||
| 1759 | Ga0495639_0409964 | |||
| 1760 | Ga0495585_0371432 | |||
| 1761 | Ga0495607_0160503 | |||
| 1762 | Ga0495610_0259766 | |||
| 1763 | Ga0495630_0089663 | |||
| 1764 | Ga0495632_0129002 | |||
| 1765 | Ga0495648_0004199 | |||
| 1766 | Ga0495652_0098214 | |||
| 1767 | Ga0495652_1095954 | |||
| 1768 | Ga0495665_0066441 | |||
| 1769 | Ga0495587_0424456 | |||
| 1770 | Ga0495598_0105235 | |||
| 1771 | Ga0495598_0165928 | |||
| 1772 | Ga0495645_0323083 | |||
| 1773 | Ga0495645_0775995 | |||
| 1774 | Ga0495622_0059676 | |||
| 1775 | Ga0495668_0001416 | |||
| 1776 | Ga0495668_0001567 | |||
| 1777 | Ga0495625_0205359 | |||
| 1778 | Ga0495635_0039725 | |||
| 1779 | Ga0495657_0313640 | |||
| 1780 | Ga0495647_0272755 | |||
| 1781 | Ga0495658_0183159 | |||
| 1782 | Ga0495649_0398571 | |||
| 1783 | Ga0495600_0048383 | |||
| 1784 | Ga0495604_0227780 | |||
| 1785 | Ga0495636_0264430 | |||
| 1786 | Ga0495674_0166410 | |||
| 1787 | Ga0495674_0183898 | |||
| 1788 | Ga0495674_0728174 | |||
| 1789 | Ga0495672_0011842 | |||
| 1790 | Ga0495672_0035492 | |||
| 1791 | Ga0495672_0309549 | |||
| 1792 | Ga0495687_000014 | |||
| 1793 | Ga0495686_0000034 | |||
| 1794 | Ga0495686_0042904 | |||
| 1795 | Ga0496104_0262147 | |||
| 1796 | Ga0496104_0566379 | |||
| 1797 | Ga0496104_0590328 | |||
| 1798 | Ga0496105_0126827 | |||
| 1799 | Ga0496108_0169857 | |||
| 1800 | Ga0496108_0384570 | |||
| 1801 | Ga0496109_0018089 | |||
| 1802 | Ga0496109_0441181 | |||
| 1803 | Ga0496109_0638213 | |||
| 1804 | Ga0496109_0785594 | |||
| 1805 | Ga0496110_0597437 | |||
| 1806 | Ga0496110_0628824 | |||
| 1807 | Ga0496111_0737091 | |||
| 1808 | Ga0496113_0788716 | |||
| 1809 | Ga0496114_0000244 | |||
| 1810 | Ga0496115_0165551 | |||
| 1811 | Ga0496121_0000030 | |||
| 1812 | Ga0496126_0159142 | |||
| 1813 | Ga0501306_036021 | |||
| 1814 | Ga0501290_023394 | |||
| 1815 | Ga0501325_003931 | |||
| 1816 | Ga0501334_05371 | |||
| 1817 | Ga0501335_008302 | |||
| 1818 | Ga0501032_0033239 | |||
| 1819 | Ga0501032_0036067 | |||
| 1820 | Ga0501034_0000115 | |||
| 1821 | Ga0501034_0016612 | |||
| 1822 | Ga0501034_0766499 | |||
| 1823 | Ga0501036_0054893 | |||
| 1824 | Ga0501036_0169801 | |||
| 1825 | Ga0501037_0070902 | |||
| 1826 | Ga0501037_0249668 | |||
| 1827 | Ga0501039_0022511 | |||
| 1828 | Ga0501043_0052847 | |||
| 1829 | Ga0501043_0082468 | |||
| 1830 | Ga0501047_0052554 | |||
| 1831 | Ga0501047_0260193 | |||
| 1832 | Ga0501047_0612894 | |||
| 1833 | Ga0501048_0180655 | |||
| 1834 | Ga0501067_0017414 | |||
| 1835 | Ga0501068_0011805 | |||
| 1836 | Ga0501068_0079484 | |||
| 1837 | Ga0501070_0131781 | |||
| 1838 | Ga0501070_0732102 | |||
| 1839 | Ga0501071_1288973 | |||
| 1840 | Ga0501072_0245996 | |||
| 1841 | Ga0501073_0033387 | |||
| 1842 | Ga0501074_0016318 | |||
| 1843 | Ga0501074_0176414 | |||
| 1844 | Ga0501198_029237 | |||
| 1845 | Ga0501199_066127 | |||
| 1846 | Ga0501201_003522 | |||
| 1847 | Ga0501202_001365 | |||
| 1848 | Ga0501207_012482 | |||
| 1849 | Ga0501211_021155 | |||
| 1850 | Ga0501217_001386 | |||
| 1851 | Ga0501217_015616 | |||
| 1852 | Ga0501222_008357 | |||
| 1853 | Ga0501224_001167 | |||
| 1854 | Ga0501233_002195 | |||
| 1855 | Ga0501235_000159 | |||
| 1856 | Ga0501239_036527 | |||
| 1857 | Ga0501243_001150 | |||
| 1858 | Ga0501250_026987 | |||
| 1859 | Ga0501257_016868 | |||
| 1860 | Ga0501257_017951 | |||
| 1861 | Ga0501259_000917 | |||
| 1862 | Ga0501261_001131 | |||
| 1863 | Ga0501221_000734 | |||
| 1864 | Ga0501221_062756 | |||
| 1865 | Ga0501225_0001133 | |||
| 1866 | Ga0501225_0018502 | |||
| 1867 | Ga0501234_000165 | |||
| 1868 | Ga0501234_033909 | |||
| 1869 | Ga0501245_000740 | |||
| 1870 | Ga0501079_0150892 | |||
| 1871 | Ga0501083_0061959 | |||
| 1872 | Ga0501083_0187638 | |||
| 1873 | Ga0501264_025660 | |||
| 1874 | Ga0501280_013073 | |||
| 1875 | Ga0501281_02851 | |||
| 1876 | Ga0501035_0034909 | |||
| 1877 | Ga0501035_0106263 | |||
| 1878 | Ga0501035_0352653 | |||
| 1879 | Ga0501044_0050433 | |||
| 1880 | Ga0501044_0120671 | |||
| 1881 | Ga0501044_0204649 | |||
| 1882 | Ga0501045_0281164 | |||
| 1883 | nmdc:mga0k408_208189_c1 | |||
| 1884 | nmdc:mga05p37_55467_c1 | |||
| 1885 | nmdc:mga09592_1443825_c1 | |||
| 1886 | nmdc:mga09592_671555_c1 | |||
| 1887 | nmdc:mga0qj67_12847_c1 | |||
| 1888 | nmdc:mga08y16_126655_c1 | |||
| 1889 | nmdc:mga08y16_230301_c1 | |||
| 1890 | nmdc:mga08y16_505937_c1 | |||
| 1891 | nmdc:mga08y16_579613_c1 | |||
| 1892 | nmdc:mga08y16_67495_c1 | |||
| 1893 | Ga0495619_0089505 | |||
| 1894 | Ga0500578_0000131 | |||
| 1895 | Ga0500646_0002639 | |||
| 1896 | Ga0500646_0002704 | |||
| 1897 | Ga0500583_0004642 | |||
| 1898 | Ga0500583_0344858 | |||
| 1899 | Ga0500583_0347232 | |||
| 1900 | Ga0500641_0000103 | |||
| 1901 | Ga0500556_0139200 | |||
| 1902 | Ga0500556_0218819 | |||
| 1903 | Ga0500562_040325 | |||
| 1904 | Ga0500569_003697 | |||
| 1905 | Ga0500642_0002513 | |||
| 1906 | Ga0500642_0112302 | |||
| 1907 | Ga0500652_042156 | |||
| 1908 | Ga0500658_0006229 | |||
| 1909 | Ga0500658_0089540 | |||
| 1910 | Ga0500658_0116742 | |||
| 1911 | Ga0500559_0055124 | |||
| 1912 | Ga0500568_0040912 | |||
| 1913 | Ga0500573_0208608 | |||
| 1914 | Ga0500577_0022548 | |||
| 1915 | Ga0500588_0048845 | |||
| 1916 | Ga0500588_0222399 | |||
| 1917 | Ga0500589_027701 | |||
| 1918 | Ga0500616_0051262 | |||
| 1919 | Ga0500616_0172214 | |||
| 1920 | Ga0500622_0001805 | |||
| 1921 | Ga0500634_0144562 | |||
| 1922 | Ga0500639_017758 | |||
| 1923 | Ga0500636_0027949 | |||
| 1924 | Ga0501084_0050027 | |||
| 1925 | Ga0501084_0775906 | |||
| 1926 | Ga0587073_0095123 | |||
| 1927 | Ga0587077_036024 | |||
| 1928 | Ga0466962_0123321 | |||
| 1929 | 2513233638 | |||
| 1930 | 2738727010 | |||
| 1931 | 2738735522 | |||
| 1932 | 2738768099 | |||
| 1933 | 2739217104 | |||
| 1934 | 2739303836 | |||
| 1935 | 2739648054 | |||
| 1936 | 2849283584 | |||
| 1937 | 2852629665 | |||
| 1938 | 2883072490 | |||
| 1939 | 2896112655 | |||
| 1940 | 2904448056 | |||
| 1941 | 2929178632 | |||
| 1942 | 2945981041 | |||
| 1943 | 2946019557 | |||
| 1944 | 8055590080 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy