F487140

General Info

Members Datasets Scaffolds Average Seq Length
972 359 972 130

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100059102|Ga0070695_1000591022
Length 137
Sequence VSALAETAPETYPENLLYHPEHDWARIDGDEATFGITWYAQDSLGEVVFFDPPEIGASVSANQSYAEVESVKAVSDVIAPLSGEVTAINEAVSETPELINEDPYEAGWLVKVRLTNAGETDSLLDAATYKAQLELGE

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
241 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
244 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
245 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
250 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
323 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
324 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
325 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 8.33
Rhizosphere 86.73
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003359 3300000549 Bacteria 2152
2 JGI24739J22299_10190972 3300001989 Bacteria 602
3 JGI24737J22298_10161390 3300001990 Bacteria 662
4 JGI24743J22301_10016082 3300001991 Bacteria 1393
5 JGI24743J22301_10028122 3300001991 Bacteria 1100
6 JGI24738J21930_10126562 3300002075 Bacteria 557
7 JGI24738J21930_10136050 3300002075 Bacteria 540
8 JGI25407J50210_10003345 3300003373 Bacteria 3823
9 JGI25407J50210_10003751 3300003373 Bacteria 3666
10 JGI25407J50210_10004139 3300003373 Bacteria 3524
11 JGI25407J50210_10045251 3300003373 Bacteria 1122
12 JGI25404J52841_10062149 3300003659 Bacteria 782
13 Ga0058859_11783415 3300004798 Bacteria 814
14 Ga0070658_10042224 3300005327 Bacteria 3682
15 Ga0070676_10107599 3300005328 Bacteria 1732
16 Ga0070676_10357116 3300005328 Unclassified 1006
17 Ga0070683_100048461 3300005329 Bacteria 3928
18 Ga0070690_100182193 3300005330 Bacteria 1452
19 Ga0070690_100946660 3300005330 Bacteria 676
20 Ga0070670_101115124 3300005331 Bacteria 720
21 Ga0068869_100280359 3300005334 Bacteria 1340
22 Ga0070680_100329012 3300005336 Bacteria 1298
23 Ga0070680_101177259 3300005336 Bacteria 663
24 Ga0070682_100013260 3300005337 Bacteria 4739
25 Ga0070682_100034008 3300005337 Bacteria 3100
26 Ga0070682_100188878 3300005337 Bacteria 1445
27 Ga0070682_100926414 3300005337 Bacteria 718
28 Ga0068868_100000026 3300005338 Bacteria 81980
29 Ga0068868_100013771 3300005338 Bacteria 5943
30 Ga0068868_100022497 3300005338 Bacteria 4758
31 Ga0068868_102147364 3300005338 Bacteria 531
32 Ga0070660_100009834 3300005339 Bacteria 6743
33 Ga0070660_100124433 3300005339 Bacteria 2060
34 Ga0070660_100725733 3300005339 Bacteria 834
35 Ga0070660_100772940 3300005339 Bacteria 807
36 Ga0070689_100110622 3300005340 Bacteria 2184
37 Ga0070691_10025637 3300005341 Bacteria 2746
38 Ga0070691_10373969 3300005341 Bacteria 797
39 Ga0070691_10483193 3300005341 Bacteria 713
40 Ga0070691_10524802 3300005341 Bacteria 688
41 Ga0070687_100101359 3300005343 Bacteria 1612
42 Ga0070661_100133458 3300005344 Bacteria 1866
43 Ga0070661_100837222 3300005344 Bacteria 756
44 Ga0070692_10018760 3300005345 Bacteria 3331
45 Ga0070692_10034290 3300005345 Bacteria 2563
46 Ga0070692_10080362 3300005345 Bacteria 1755
47 Ga0070668_100024328 3300005347 Bacteria 4587
48 Ga0070668_100160546 3300005347 Bacteria 1823
49 Ga0070668_100531729 3300005347 Bacteria 1021
50 Ga0070669_100375280 3300005353 Bacteria 1159
51 Ga0070675_100168821 3300005354 Bacteria 1886
52 Ga0070671_100080735 3300005355 Bacteria 2719
53 Ga0070674_100094652 3300005356 Bacteria 2164
54 Ga0070674_100200525 3300005356 Bacteria 1541
55 Ga0070674_100287818 3300005356 Bacteria 1305
56 Ga0070674_101434100 3300005356 Bacteria 619
57 Ga0070673_100774118 3300005364 Bacteria 885
58 Ga0070688_100001123 3300005365 Bacteria 13401
59 Ga0070688_100081740 3300005365 Bacteria 2093
60 Ga0070688_100136059 3300005365 Bacteria 1663
61 Ga0070659_100000450 3300005366 Bacteria 30693
62 Ga0070659_100041398 3300005366 Bacteria 3601
63 Ga0070659_100070835 3300005366 Bacteria 2771
64 Ga0070667_101356301 3300005367 Bacteria 667
65 Ga0070703_10062472 3300005406 Bacteria 1222
66 Ga0070709_10865915 3300005434 Bacteria 713
67 Ga0070714_101535027 3300005435 Bacteria 651
68 Ga0070713_100000079 3300005436 Bacteria 60238
69 Ga0070710_10149835 3300005437 Bacteria 1438
70 Ga0070710_10203644 3300005437 Bacteria 1251
71 Ga0070701_10317038 3300005438 Bacteria 963
72 Ga0070701_10383125 3300005438 Bacteria 887
73 Ga0070701_10699009 3300005438 Bacteria 682
74 Ga0070711_100000497 3300005439 Bacteria 20499
75 Ga0070711_100077432 3300005439 Bacteria 2360
76 Ga0070711_100079258 3300005439 Bacteria 2335
77 Ga0070711_100160723 3300005439 Bacteria 1703
78 Ga0070711_100202219 3300005439 Bacteria 1534
79 Ga0070705_100023460 3300005440 Bacteria 3314
80 Ga0070700_100003638 3300005441 Bacteria 7977
81 Ga0070700_100020787 3300005441 Bacteria 3809
82 Ga0070700_100127548 3300005441 Bacteria 1712
83 Ga0070700_100377555 3300005441 Bacteria 1059
84 Ga0070700_100589910 3300005441 Bacteria 869
85 Ga0070694_100541763 3300005444 Bacteria 931
86 Ga0070694_101250540 3300005444 Bacteria 623
87 Ga0070708_100000127 3300005445 Bacteria 51711
88 Ga0070708_100358285 3300005445 Bacteria 1375
89 Ga0070708_101208313 3300005445 Bacteria 707
90 Ga0070663_100000104 3300005455 Bacteria 38955
91 Ga0070678_100408872 3300005456 Bacteria 1181
92 Ga0070678_100609457 3300005456 Bacteria 976
93 Ga0070678_101546318 3300005456 Bacteria 622
94 Ga0070662_100000009 3300005457 Bacteria 142979
95 Ga0070662_100009106 3300005457 Bacteria 6481
96 Ga0070662_100042278 3300005457 Bacteria 3255
97 Ga0070662_100201190 3300005457 Bacteria 1581
98 Ga0070662_100494912 3300005457 Bacteria 1019
99 Ga0070681_10091087 3300005458 Bacteria 3000
100 Ga0070681_10257061 3300005458 Bacteria 1659
101 Ga0070681_10381672 3300005458 Bacteria 1320
102 Ga0068867_100024074 3300005459 Bacteria 4363
103 Ga0068867_101990744 3300005459 Unclassified 549
104 Ga0070685_10000024 3300005466 Bacteria 101602
105 Ga0070685_10143701 3300005466 Bacteria 1505
106 Ga0070706_100001206 3300005467 Bacteria 27672
107 Ga0070706_100372284 3300005467 Bacteria 1331
108 Ga0070707_100008434 3300005468 Bacteria 9574
109 Ga0070707_100204336 3300005468 Bacteria 1925
110 Ga0070698_100376632 3300005471 Bacteria 1352
111 Ga0070699_100020245 3300005518 Bacteria 5736
112 Ga0070679_100000430 3300005530 Bacteria 35674
113 Ga0070679_100687407 3300005530 Bacteria 966
114 Ga0070679_100953340 3300005530 Bacteria 802
115 Ga0070679_101228673 3300005530 Bacteria 695
116 Ga0070679_102211790 3300005530 Bacteria 500
117 Ga0070684_100087171 3300005535 Bacteria 2771
118 Ga0070684_100216932 3300005535 Bacteria 1745
119 Ga0070684_100461992 3300005535 Bacteria 1174
120 Ga0070684_100669392 3300005535 Bacteria 967
121 Ga0070684_100980860 3300005535 Bacteria 793
122 Ga0070684_102287748 3300005535 Bacteria 510
123 Ga0070697_100000319 3300005536 Bacteria 38314
124 Ga0068853_100040106 3300005539 Bacteria 3994
125 Ga0068853_100377823 3300005539 Bacteria 1323
126 Ga0070672_100000283 3300005543 Bacteria 28861
127 Ga0070672_100013241 3300005543 Bacteria 5818
128 Ga0070672_100241345 3300005543 Bacteria 1520
129 Ga0070686_100013194 3300005544 Bacteria 4723
130 Ga0070686_100021678 3300005544 Bacteria 3824
131 Ga0070686_100141046 3300005544 Bacteria 1678
132 Ga0070695_100059102 3300005545 Bacteria 2481
133 Ga0070695_100167672 3300005545 Bacteria 1547
134 Ga0070696_100122276 3300005546 Bacteria 1885
135 Ga0070696_100193139 3300005546 Bacteria 1516
136 Ga0070696_100700187 3300005546 Bacteria 826
137 Ga0070696_101267759 3300005546 Bacteria 625
138 Ga0070693_100070471 3300005547 Bacteria 2057
139 Ga0070693_100383924 3300005547 Bacteria 970
140 Ga0070665_100895640 3300005548 Bacteria 900
141 Ga0070704_100028087 3300005549 Bacteria 3738
142 Ga0070704_100158818 3300005549 Bacteria 1786
143 Ga0070704_100562242 3300005549 Bacteria 998
144 Ga0070704_100638654 3300005549 Bacteria 939
145 Ga0070704_100733410 3300005549 Bacteria 879
146 Ga0070704_101688469 3300005549 Unclassified 585
147 Ga0068855_100655702 3300005563 Bacteria 1127
148 Ga0070664_100028067 3300005564 Bacteria 4680
149 Ga0068857_100116289 3300005577 Bacteria 2406
150 Ga0068857_100761189 3300005577 Bacteria 923
151 Ga0068857_101572630 3300005577 Bacteria 642
152 Ga0068854_100023641 3300005578 Bacteria 4199
153 Ga0068854_100048335 3300005578 Bacteria 3035
154 Ga0068854_100221019 3300005578 Bacteria 1499
155 Ga0068854_100569150 3300005578 Bacteria 963
156 Ga0068854_100738626 3300005578 Bacteria 853
157 Ga0068854_101151364 3300005578 Bacteria 693
158 Ga0068856_100054015 3300005614 Bacteria 3962
159 Ga0068856_100100076 3300005614 Bacteria 2891
160 Ga0068856_101203770 3300005614 Bacteria 774
161 Ga0068856_101258188 3300005614 Bacteria 756
162 Ga0070702_100016651 3300005615 Bacteria 3775
163 Ga0070702_100095410 3300005615 Bacteria 1813
164 Ga0070702_100100128 3300005615 Bacteria 1776
165 Ga0068852_100066720 3300005616 Bacteria 3143
166 Ga0068852_100271139 3300005616 Bacteria 1633
167 Ga0068859_100028788 3300005617 Bacteria 5570
168 Ga0068864_100363890 3300005618 Bacteria 1367
169 Ga0068864_100514728 3300005618 Bacteria 1153
170 Ga0068864_101214852 3300005618 Bacteria 753
171 Ga0068866_10205505 3300005718 Bacteria 1179
172 Ga0068866_10219342 3300005718 Bacteria 1147
173 Ga0068861_100011706 3300005719 Bacteria 6105
174 Ga0068861_100174527 3300005719 Bacteria 1784
175 Ga0068861_100213684 3300005719 Bacteria 1626
176 Ga0068861_100957270 3300005719 Bacteria 815
177 Ga0068861_101115569 3300005719 Bacteria 759
178 Ga0068851_10161296 3300005834 Bacteria 1232
179 Ga0068851_10462195 3300005834 Bacteria 756
180 Ga0068870_10061404 3300005840 Bacteria 2020
181 Ga0068870_10740057 3300005840 Bacteria 682
182 Ga0068863_100440502 3300005841 Bacteria 1278
183 Ga0068863_101090061 3300005841 Bacteria 803
184 Ga0068858_100083115 3300005842 Bacteria 2977
185 Ga0068858_100160734 3300005842 Bacteria 2115
186 Ga0068860_101836034 3300005843 Bacteria 628
187 Ga0068862_101258074 3300005844 Bacteria 740
188 Ga0068862_101265504 3300005844 Bacteria 738
189 Ga0068862_102036393 3300005844 Bacteria 585
190 Ga0081455_10058384 3300005937 Bacteria 3265
191 Ga0081455_10082841 3300005937 Bacteria 2623
192 Ga0081455_10097913 3300005937 Bacteria 2363
193 Ga0081455_10617615 3300005937 Bacteria 704
194 Ga0081538_10000035 3300005981 Bacteria 120009
195 Ga0081538_10002058 3300005981 Bacteria 20081
196 Ga0081538_10016003 3300005981 Bacteria 5773
197 Ga0081538_10038766 3300005981 Bacteria 3067
198 Ga0081538_10087819 3300005981 Bacteria 1621
199 Ga0081538_10155902 3300005981 Bacteria 1024
200 Ga0081538_10238932 3300005981 Bacteria 702
201 Ga0081540_1005020 3300005983 Bacteria 9939
202 Ga0081540_1009024 3300005983 Bacteria 6891
203 Ga0081540_1050501 3300005983 Bacteria 2065
204 Ga0081539_10116145 3300005985 Bacteria 1337
205 Ga0081539_10183926 3300005985 Bacteria 978
206 Ga0081539_10243597 3300005985 Bacteria 803
207 Ga0075365_10002863 3300006038 Bacteria 8671
208 Ga0075365_10038880 3300006038 Bacteria 3095
209 Ga0075365_10074921 3300006038 Bacteria 2283
210 Ga0075365_10170248 3300006038 Bacteria 1520
211 Ga0075365_10665482 3300006038 Bacteria 736
212 Ga0075368_10216393 3300006042 Bacteria 813
213 Ga0075363_100003547 3300006048 Bacteria 6663
214 Ga0075363_100193973 3300006048 Bacteria 1159
215 Ga0075364_10012604 3300006051 Bacteria 5177
216 Ga0075364_10017734 3300006051 Bacteria 4452
217 Ga0075364_10033710 3300006051 Bacteria 3299
218 Ga0075364_10538871 3300006051 Bacteria 798
219 Ga0075432_10018617 3300006058 Bacteria 2369
220 Ga0075432_10025797 3300006058 Bacteria 2017
221 Ga0070712_100048741 3300006175 Bacteria 2938
222 Ga0070712_100132854 3300006175 Bacteria 1889
223 Ga0070712_100333897 3300006175 Bacteria 1236
224 Ga0075367_10418647 3300006178 Bacteria 848
225 Ga0097621_100627036 3300006237 Bacteria 985
226 Ga0068871_100231571 3300006358 Bacteria 1603
227 Ga0068871_101505215 3300006358 Bacteria 636
228 Ga0075428_100016818 3300006844 Bacteria 8077
229 Ga0075428_100068173 3300006844 Bacteria 3892
230 Ga0075428_100138236 3300006844 Bacteria 2649
231 Ga0075428_100299641 3300006844 Bacteria 1728
232 Ga0075428_100652990 3300006844 Bacteria 1122
233 Ga0075428_101203150 3300006844 Bacteria 799
234 Ga0075428_101303274 3300006844 Bacteria 764
235 Ga0075430_100010387 3300006846 Bacteria 7884
236 Ga0075430_100032438 3300006846 Bacteria 4434
237 Ga0075430_100034598 3300006846 Bacteria 4288
238 Ga0075430_100307128 3300006846 Bacteria 1312
239 Ga0075431_100181290 3300006847 Bacteria 2161
240 Ga0075431_100323459 3300006847 Bacteria 1555
241 Ga0075431_100369503 3300006847 Bacteria 1439
242 Ga0075431_100373663 3300006847 Bacteria 1430
243 Ga0075431_100508849 3300006847 Bacteria 1194
244 Ga0075431_100706412 3300006847 Bacteria 986
245 Ga0075433_10069082 3300006852 Bacteria 3102
246 Ga0075433_10177895 3300006852 Bacteria 1893
247 Ga0075434_100057440 3300006871 Bacteria 3867
248 Ga0075434_100667233 3300006871 Bacteria 1058
249 Ga0075434_100934082 3300006871 Bacteria 882
250 Ga0075434_101075089 3300006871 Bacteria 818
251 Ga0075434_102596508 3300006871 Bacteria 507
252 Ga0075429_100024381 3300006880 Bacteria 5248
253 Ga0075429_100283950 3300006880 Bacteria 1449
254 Ga0075429_100415206 3300006880 Bacteria 1178
255 Ga0075429_100518281 3300006880 Bacteria 1045
256 Ga0068865_100005630 3300006881 Bacteria 7606
257 Ga0068865_101392870 3300006881 Bacteria 626
258 Ga0075436_100858152 3300006914 Bacteria 678
259 Ga0097620_100028786 3300006931 Bacteria 5570
260 Ga0075435_100374339 3300007076 Bacteria 1223
261 Ga0075435_100459793 3300007076 Bacteria 1098
262 Ga0099794_10000317 3300007265 Bacteria 16474
263 Ga0105251_10104591 3300009011 Bacteria 1293
264 Ga0105240_10003665 3300009093 Bacteria 23758
265 Ga0105240_10304470 3300009093 Bacteria 1822
266 Ga0111539_10077902 3300009094 Bacteria 3901
267 Ga0111539_10079936 3300009094 Bacteria 3846
268 Ga0111539_10090862 3300009094 Bacteria 3588
269 Ga0111539_10099470 3300009094 Bacteria 3415
270 Ga0111539_10133033 3300009094 Bacteria 2912
271 Ga0111539_10162982 3300009094 Bacteria 2608
272 Ga0111539_10269372 3300009094 Bacteria 1983
273 Ga0111539_13171834 3300009094 Bacteria 530
274 Ga0105245_10002293 3300009098 Bacteria 17319
275 Ga0105245_10005001 3300009098 Bacteria 11653
276 Ga0105245_10021965 3300009098 Bacteria 5600
277 Ga0105245_10236355 3300009098 Bacteria 1769
278 Ga0105245_10253919 3300009098 Bacteria 1709
279 Ga0105245_10333199 3300009098 Bacteria 1498
280 Ga0105245_10357332 3300009098 Unclassified 1449
281 Ga0105245_11935364 3300009098 Bacteria 643
282 Ga0105245_12688276 3300009098 Bacteria 551
283 Ga0105247_10098886 3300009101 Bacteria 1863
284 Ga0105247_10643460 3300009101 Bacteria 791
285 Ga0114129_10003411 3300009147 Bacteria 22329
286 Ga0114129_10005383 3300009147 Bacteria 18068
287 Ga0114129_10006344 3300009147 Bacteria 16771
288 Ga0114129_10024361 3300009147 Bacteria 8575
289 Ga0114129_10025786 3300009147 Bacteria 8325
290 Ga0114129_10063226 3300009147 Bacteria 5169
291 Ga0114129_10230121 3300009147 Bacteria 2497
292 Ga0114129_10374892 3300009147 Bacteria 1880
293 Ga0114129_10522328 3300009147 Bacteria 1548
294 Ga0114129_10606212 3300009147 Bacteria 1418
295 Ga0114129_11151010 3300009147 Bacteria 969
296 Ga0114129_13283356 3300009147 Bacteria 524
297 Ga0105243_10001579 3300009148 Bacteria 19913
298 Ga0105243_10060424 3300009148 Bacteria 3028
299 Ga0105243_10392824 3300009148 Bacteria 1286
300 Ga0105243_10733590 3300009148 Bacteria 967
301 Ga0105243_11304143 3300009148 Bacteria 743
302 Ga0105243_11797446 3300009148 Bacteria 644
303 Ga0105243_12558535 3300009148 Bacteria 550
304 Ga0105243_12977471 3300009148 Bacteria 514
305 Ga0105241_10688089 3300009174 Bacteria 932
306 Ga0105241_10882218 3300009174 Bacteria 829
307 Ga0105242_10658791 3300009176 Bacteria 1019
308 Ga0105242_11080811 3300009176 Bacteria 815
309 Ga0105242_11133783 3300009176 Archaea 798
310 Ga0105242_11258245 3300009176 Bacteria 762
311 Ga0105248_10000008 3300009177 Bacteria 403910
312 Ga0105248_10198030 3300009177 Bacteria 2263
313 Ga0105248_10412279 3300009177 Bacteria 1521
314 Ga0105237_10314547 3300009545 Bacteria 1569
315 Ga0105237_10720834 3300009545 Bacteria 1004
316 Ga0105237_10914927 3300009545 Bacteria 884
317 Ga0105237_12385692 3300009545 Bacteria 539
318 Ga0105238_10201130 3300009551 Bacteria 1967
319 Ga0105238_10388862 3300009551 Bacteria 1387
320 Ga0105238_10516037 3300009551 Bacteria 1197
321 Ga0105249_10004662 3300009553 Bacteria 11840
322 Ga0105249_10036499 3300009553 Bacteria 4458
323 Ga0105249_10062840 3300009553 Bacteria 3410
324 Ga0105249_10186065 3300009553 Bacteria 2024
325 Ga0105249_10406820 3300009553 Bacteria 1392
326 Ga0105249_11138076 3300009553 Bacteria 851
327 Ga0105249_12089740 3300009553 Unclassified 639
328 Ga0105249_12940483 3300009553 Unclassified 547
329 Ga0105148_123194 3300009978 Bacteria 500
330 Ga0105239_10009680 3300010375 Bacteria 10837
331 Ga0105239_10199135 3300010375 Bacteria 2243
332 Ga0105239_10291479 3300010375 Bacteria 1838
333 Ga0105239_10498189 3300010375 Bacteria 1385
334 Ga0105239_11534687 3300010375 Bacteria 770
335 Ga0105239_11885062 3300010375 Unclassified 693
336 Ga0105246_10103171 3300011119 Bacteria 2080
337 Ga0105246_10281410 3300011119 Bacteria 1334
338 Ga0105246_10852061 3300011119 Bacteria 813
339 Ga0105246_11426980 3300011119 Bacteria 647
340 Ga0157324_1040859 3300012506 Bacteria 567
341 Ga0157373_10858711 3300013100 Bacteria 672
342 Ga0157371_10254600 3300013102 Bacteria 1265
343 Ga0157371_10298410 3300013102 Archaea 1166
344 Ga0157369_10578664 3300013105 Bacteria 1160
345 Ga0157369_10588887 3300013105 Bacteria 1149
346 Ga0157374_10404701 3300013296 Bacteria 1362
347 Ga0157374_10408904 3300013296 Bacteria 1354
348 Ga0157374_10599913 3300013296 Bacteria 1111
349 Ga0157378_10435956 3300013297 Bacteria 1298
350 Ga0157378_10486661 3300013297 Bacteria 1230
351 Ga0157378_10821452 3300013297 Bacteria 956
352 Ga0157378_12850850 3300013297 Bacteria 536
353 Ga0163162_10071093 3300013306 Bacteria 3532
354 Ga0163162_10088029 3300013306 Bacteria 3185
355 Ga0163162_10470168 3300013306 Bacteria 1389
356 Ga0157372_10269173 3300013307 Bacteria 1979
357 Ga0157372_10287044 3300013307 Bacteria 1914
358 Ga0157372_10326295 3300013307 Bacteria 1787
359 Ga0157375_10055287 3300013308 Bacteria 3914
360 Ga0157375_10318580 3300013308 Bacteria 1720
361 Ga0157375_10865425 3300013308 Bacteria 1050
362 Ga0157375_11487420 3300013308 Unclassified 799
363 Ga0157375_12405654 3300013308 Bacteria 628
364 Ga0157375_12591540 3300013308 Bacteria 606
365 Ga0163163_10615414 3300014325 Bacteria 1149
366 Ga0163163_10644957 3300014325 Bacteria 1122
367 Ga0157380_11433390 3300014326 Bacteria 742
368 Ga0182008_10609015 3300014497 Bacteria 614
369 Ga0182008_10735549 3300014497 Bacteria 567
370 Ga0157377_10023806 3300014745 Bacteria 3250
371 Ga0157377_10110244 3300014745 Bacteria 1653
372 Ga0157377_10270898 3300014745 Bacteria 1109
373 Ga0157377_11155193 3300014745 Bacteria 597
374 Ga0157379_10326789 3300014968 Bacteria 1401
375 Ga0157376_10111081 3300014969 Bacteria 2413
376 Ga0157376_10670151 3300014969 Bacteria 1040
377 Ga0197907_11097511 3300020069 Bacteria 891
378 Ga0206356_10483172 3300020070 Bacteria 2419
379 Ga0206351_10176479 3300020077 Bacteria 505
380 Ga0206350_10275672 3300020080 Bacteria 895
381 Ga0206350_10560135 3300020080 Unclassified 804
382 Ga0206354_11057515 3300020081 Bacteria 608
383 Ga0206354_11261973 3300020081 Bacteria 751
384 Ga0206354_11502332 3300020081 Bacteria 722
385 Ga0206353_11195742 3300020082 Bacteria 742
386 Ga0213874_10103837 3300021377 Bacteria 948
387 Ga0213876_10002786 3300021384 Bacteria 10180
388 Ga0213876_10021465 3300021384 Bacteria 3414
389 Ga0213875_10018820 3300021388 Bacteria 3326
390 Ga0213875_10024795 3300021388 Bacteria 2859
391 Ga0207656_10028437 3300025321 Bacteria 2295
392 Ga0207656_10178008 3300025321 Bacteria 1020
393 Ga0207692_10133495 3300025898 Bacteria 1405
394 Ga0207692_10176227 3300025898 Bacteria 1243
395 Ga0207642_10047533 3300025899 Bacteria 1919
396 Ga0207642_10323489 3300025899 Bacteria 901
397 Ga0207642_10605425 3300025899 Unclassified 682
398 Ga0207710_10137187 3300025900 Bacteria 1179
399 Ga0207688_10028678 3300025901 Bacteria 3062
400 Ga0207688_10175358 3300025901 Bacteria 1276
401 Ga0207680_10060775 3300025903 Bacteria 2302
402 Ga0207647_10099475 3300025904 Bacteria 1727
403 Ga0207647_10389681 3300025904 Bacteria 786
404 Ga0207647_10668759 3300025904 Bacteria 568
405 Ga0207645_10253181 3300025907 Bacteria 1165
406 Ga0207645_10563836 3300025907 Bacteria 773
407 Ga0207643_10030222 3300025908 Bacteria 3014
408 Ga0207643_10072603 3300025908 Bacteria 1982
409 Ga0207684_10000047 3300025910 Bacteria 244386
410 Ga0207654_11438856 3300025911 Bacteria 503
411 Ga0207707_10129640 3300025912 Bacteria 2206
412 Ga0207707_10172122 3300025912 Bacteria 1892
413 Ga0207695_10049810 3300025913 Bacteria 4411
414 Ga0207695_10421865 3300025913 Bacteria 1218
415 Ga0207671_10215198 3300025914 Bacteria 1504
416 Ga0207693_10016724 3300025915 Bacteria 5859
417 Ga0207693_10062157 3300025915 Bacteria 2926
418 Ga0207663_10005141 3300025916 Bacteria 6580
419 Ga0207663_10065387 3300025916 Bacteria 2325
420 Ga0207663_10467236 3300025916 Bacteria 975
421 Ga0207663_11688829 3300025916 Bacteria 509
422 Ga0207660_10783540 3300025917 Bacteria 778
423 Ga0207662_10005024 3300025918 Bacteria 7004
424 Ga0207657_10002552 3300025919 Bacteria 19694
425 Ga0207657_10054230 3300025919 Bacteria 3468
426 Ga0207657_10119163 3300025919 Bacteria 2172
427 Ga0207657_10843779 3300025919 Bacteria 707
428 Ga0207649_10018935 3300025920 Bacteria 3927
429 Ga0207649_10340233 3300025920 Bacteria 1108
430 Ga0207649_10519642 3300025920 Bacteria 907
431 Ga0207652_10001888 3300025921 Bacteria 18144
432 Ga0207652_10333537 3300025921 Bacteria 1369
433 Ga0207652_11059668 3300025921 Bacteria 710
434 Ga0207646_10012901 3300025922 Bacteria 8010
435 Ga0207646_10496162 3300025922 Bacteria 1100
436 Ga0207646_10836387 3300025922 Bacteria 819
437 Ga0207681_10363260 3300025923 Bacteria 1162
438 Ga0207681_10537408 3300025923 Bacteria 961
439 Ga0207681_10875072 3300025923 Bacteria 752
440 Ga0207694_10210635 3300025924 Bacteria 1583
441 Ga0207694_11103124 3300025924 Unclassified 672
442 Ga0207659_10052243 3300025926 Bacteria 2910
443 Ga0207659_10526793 3300025926 Bacteria 1002
444 Ga0207687_10034419 3300025927 Bacteria 3440
445 Ga0207687_10269701 3300025927 Bacteria 1360
446 Ga0207687_10320219 3300025927 Unclassified 1255
447 Ga0207687_10533723 3300025927 Bacteria 983
448 Ga0207687_10535322 3300025927 Bacteria 981
449 Ga0207700_10000007 3300025928 Bacteria 345720
450 Ga0207644_10115427 3300025931 Bacteria 2036
451 Ga0207644_10574342 3300025931 Bacteria 935
452 Ga0207644_10940662 3300025931 Bacteria 725
453 Ga0207690_10029154 3300025932 Bacteria 3506
454 Ga0207690_10032974 3300025932 Bacteria 3327
455 Ga0207706_10000001 3300025933 Bacteria 423014
456 Ga0207706_10003250 3300025933 Bacteria 15577
457 Ga0207706_10011806 3300025933 Bacteria 7955
458 Ga0207706_10226661 3300025933 Bacteria 1636
459 Ga0207706_10932796 3300025933 Unclassified 732
460 Ga0207709_10036448 3300025935 Bacteria 2915
461 Ga0207709_10111344 3300025935 Bacteria 1831
462 Ga0207709_10174005 3300025935 Bacteria 1514
463 Ga0207709_10384838 3300025935 Bacteria 1068
464 Ga0207669_10018416 3300025937 Bacteria 3610
465 Ga0207669_10109891 3300025937 Bacteria 1845
466 Ga0207669_10658865 3300025937 Bacteria 857
467 Ga0207669_11293120 3300025937 Bacteria 619
468 Ga0207704_10006431 3300025938 Bacteria 5481
469 Ga0207665_11071266 3300025939 Bacteria 642
470 Ga0207691_10000934 3300025940 Bacteria 28991
471 Ga0207691_10025843 3300025940 Bacteria 5511
472 Ga0207691_10126820 3300025940 Bacteria 2258
473 Ga0207711_10000006 3300025941 Bacteria 792692
474 Ga0207711_10481421 3300025941 Bacteria 1156
475 Ga0207689_10066855 3300025942 Bacteria 2955
476 Ga0207689_10167201 3300025942 Bacteria 1812
477 Ga0207661_10019528 3300025944 Bacteria 5055
478 Ga0207661_10138898 3300025944 Bacteria 2089
479 Ga0207661_10374056 3300025944 Bacteria 1289
480 Ga0207661_11128205 3300025944 Bacteria 722
481 Ga0207679_10401709 3300025945 Bacteria 1205
482 Ga0207667_10719665 3300025949 Bacteria 999
483 Ga0207651_10026571 3300025960 Bacteria 3620
484 Ga0207651_11506213 3300025960 Bacteria 606
485 Ga0207712_10010679 3300025961 Bacteria 5831
486 Ga0207712_10147605 3300025961 Bacteria 1812
487 Ga0207712_10169272 3300025961 Bacteria 1706
488 Ga0207712_10305562 3300025961 Bacteria 1307
489 Ga0207712_10621263 3300025961 Bacteria 937
490 Ga0207712_11345001 3300025961 Bacteria 639
491 Ga0207668_10014261 3300025972 Bacteria 4916
492 Ga0207668_10318815 3300025972 Bacteria 1289
493 Ga0207668_11593592 3300025972 Bacteria 589
494 Ga0207668_12107192 3300025972 Bacteria 508
495 Ga0207640_10029686 3300025981 Bacteria 3359
496 Ga0207640_10235450 3300025981 Bacteria 1411
497 Ga0207640_10382153 3300025981 Unclassified 1141
498 Ga0207658_10663228 3300025986 Bacteria 941
499 Ga0207658_10839912 3300025986 Bacteria 835
500 Ga0207677_10000106 3300026023 Bacteria 68108
501 Ga0207677_10018790 3300026023 Bacteria 4157
502 Ga0207677_10210514 3300026023 Bacteria 1552
503 Ga0207677_11271484 3300026023 Bacteria 675
504 Ga0207703_10133455 3300026035 Bacteria 2147
505 Ga0207639_10050495 3300026041 Bacteria 3159
506 Ga0207678_10000152 3300026067 Bacteria 56873
507 Ga0207678_10006012 3300026067 Bacteria 10798
508 Ga0207678_10296183 3300026067 Bacteria 1390
509 Ga0207708_10000518 3300026075 Bacteria 29755
510 Ga0207708_10001883 3300026075 Bacteria 15485
511 Ga0207708_10206704 3300026075 Bacteria 1568
512 Ga0207708_10349506 3300026075 Bacteria 1213
513 Ga0207708_10667001 3300026075 Bacteria 886
514 Ga0207702_10017839 3300026078 Bacteria 5875
515 Ga0207702_10052231 3300026078 Bacteria 3458
516 Ga0207702_10995014 3300026078 Bacteria 832
517 Ga0207641_10557472 3300026088 Bacteria 1118
518 Ga0207648_10015251 3300026089 Bacteria 7068
519 Ga0207648_10032791 3300026089 Bacteria 4584
520 Ga0207648_10651690 3300026089 Bacteria 973
521 Ga0207648_11800609 3300026089 Unclassified 574
522 Ga0207676_10071048 3300026095 Bacteria 2793
523 Ga0207676_10196557 3300026095 Bacteria 1779
524 Ga0207676_11252395 3300026095 Bacteria 736
525 Ga0207674_10063341 3300026116 Bacteria 3732
526 Ga0207674_10451099 3300026116 Bacteria 1243
527 Ga0207674_10619249 3300026116 Unclassified 1045
528 Ga0207674_10723951 3300026116 Bacteria 960
529 Ga0207674_10984215 3300026116 Bacteria 812
530 Ga0207675_100000091 3300026118 Bacteria 70559
531 Ga0207675_100012493 3300026118 Bacteria 7933
532 Ga0207675_100248908 3300026118 Bacteria 1719
533 Ga0207675_100575891 3300026118 Bacteria 1127
534 Ga0207675_100901786 3300026118 Bacteria 900
535 Ga0207675_101257124 3300026118 Bacteria 761
536 Ga0207675_101259102 3300026118 Bacteria 760
537 Ga0207675_102374337 3300026118 Bacteria 543
538 Ga0207683_10044824 3300026121 Bacteria 3867
539 Ga0207683_11197344 3300026121 Bacteria 704
540 Ga0207683_12011748 3300026121 Bacteria 526
541 Ga0207698_10025692 3300026142 Bacteria 4154
542 Ga0207698_10456873 3300026142 Bacteria 1234
543 Ga0207698_12549727 3300026142 Bacteria 521
544 Ga0209588_1000016 3300027671 Bacteria 128475
545 Ga0207428_10385388 3300027907 Bacteria 1028
546 Ga0207428_10386459 3300027907 Bacteria 1026
547 Ga0207428_10658649 3300027907 Bacteria 751
548 Ga0207428_10671129 3300027907 Bacteria 743
549 Ga0268265_10065021 3300028380 Bacteria 2813
550 Ga0268265_10811010 3300028380 Bacteria 913
551 Ga0268265_11543743 3300028380 Bacteria 668
552 Ga0268264_10270291 3300028381 Bacteria 1588
553 Ga0268264_10363390 3300028381 Bacteria 1381
554 Ga0268264_10470735 3300028381 Bacteria 1221
555 Ga0265316_10084288 3300031344 Bacteria 2434
556 Ga0307408_100058956 3300031548 Bacteria 2793
557 Ga0307408_100290998 3300031548 Bacteria 1364
558 Ga0307408_100368650 3300031548 Bacteria 1224
559 Ga0307408_100787426 3300031548 Bacteria 862
560 Ga0307405_10091008 3300031731 Bacteria 2020
561 Ga0307405_10338654 3300031731 Bacteria 1156
562 Ga0307405_10823444 3300031731 Bacteria 779
563 Ga0307413_10014941 3300031824 Bacteria 3963
564 Ga0307413_10530109 3300031824 Bacteria 951
565 Ga0307413_11056960 3300031824 Bacteria 699
566 Ga0307413_11898350 3300031824 Unclassified 535
567 Ga0307410_10042752 3300031852 Bacteria 2997
568 Ga0307410_10239684 3300031852 Bacteria 1405
569 Ga0307410_10305716 3300031852 Bacteria 1256
570 Ga0307410_10475140 3300031852 Bacteria 1024
571 Ga0307410_10655977 3300031852 Bacteria 881
572 Ga0307410_11371634 3300031852 Bacteria 620
573 Ga0307406_10034550 3300031901 Bacteria 3102
574 Ga0307406_10234201 3300031901 Bacteria 1373
575 Ga0307406_10334196 3300031901 Bacteria 1177
576 Ga0307406_10542362 3300031901 Bacteria 950
577 Ga0307407_10054087 3300031903 Bacteria 2313
578 Ga0307407_10128937 3300031903 Bacteria 1615
579 Ga0307407_10331528 3300031903 Bacteria 1071
580 Ga0307407_11049357 3300031903 Bacteria 632
581 Ga0307412_10064169 3300031911 Bacteria 2481
582 Ga0307412_10247974 3300031911 Bacteria 1381
583 Ga0307412_11078449 3300031911 Bacteria 714
584 Ga0307409_100028997 3300031995 Bacteria 3954
585 Ga0307409_100076991 3300031995 Bacteria 2677
586 Ga0307409_100136227 3300031995 Bacteria 2108
587 Ga0307409_100297346 3300031995 Bacteria 1500
588 Ga0307409_100406829 3300031995 Bacteria 1301
589 Ga0307409_101128739 3300031995 Bacteria 806
590 Ga0307416_100031212 3300032002 Bacteria 4007
591 Ga0307416_100443250 3300032002 Bacteria 1349
592 Ga0307416_100471998 3300032002 Bacteria 1312
593 Ga0307416_100498553 3300032002 Bacteria 1281
594 Ga0307416_100628284 3300032002 Bacteria 1157
595 Ga0307416_101293797 3300032002 Unclassified 835
596 Ga0307414_10974487 3300032004 Bacteria 780
597 Ga0307414_11059575 3300032004 Bacteria 748
598 Ga0307414_11349755 3300032004 Bacteria 662
599 Ga0307411_10567697 3300032005 Bacteria 971
600 Ga0307415_100173401 3300032126 Bacteria 1684
601 Ga0307415_100410655 3300032126 Bacteria 1159
602 Ga0307415_100463062 3300032126 Bacteria 1099
603 Ga0307415_100582147 3300032126 Bacteria 993
604 Ga0373958_0058354 3300034819 Bacteria 831
605 Ga0373944_0328270 3300035089 Bacteria 579
606 Ga0373952_0117729 3300035092 Bacteria 718
607 Ga0373939_0084137 3300035114 Bacteria 1063
608 Ga0373939_0152325 3300035114 Bacteria 843
609 Ga0373941_0018221 3300035115 Bacteria 1937
610 Ga0373941_0410659 3300035115 Bacteria 562
611 Ga0373943_0195358 3300035170 Bacteria 1118
612 Ga0373961_0139904 3300035241 Bacteria 817
613 Ga0316574_0113307 3300035398 Bacteria 1739
614 Ga0373931_0091576 3300035691 Bacteria 1695
615 Ga0373931_0407118 3300035691 Bacteria 862
616 Ga0373925_0251802 3300037068 Bacteria 1417
617 Ga0395899_0113234 3300037312 Bacteria 1949
618 Ga0395900_0003892 3300037418 Bacteria 15948
619 Ga0395900_0214656 3300037418 Bacteria 1942
620 Ga0395900_0227351 3300037418 Bacteria 1878
621 Ga0395900_0319619 3300037418 Bacteria 1533
622 Ga0395900_0406265 3300037418 Bacteria 1325
623 Ga0395898_0003289 3300037466 Bacteria 18160
624 Ga0395898_0013673 3300037466 Bacteria 8350
625 Ga0395898_0027694 3300037466 Bacteria 5684
626 Ga0395898_0769541 3300037466 Bacteria 904
627 Ga0395898_1221621 3300037466 Bacteria 682
628 Ga0395898_1916392 3300037466 Bacteria 513
629 Ga0395905_0009566 3300037471 Bacteria 9463
630 Ga0395905_0157711 3300037471 Bacteria 2134
631 Ga0395905_0295161 3300037471 Bacteria 1508
632 Ga0395905_0443893 3300037471 Bacteria 1195
633 Ga0436364_0528708 3300037853 Bacteria 35377
634 Ga0436364_0994313 3300037853 Bacteria 503
635 Ga0436364_1364766 3300037853 Bacteria 3085
636 Ga0395901_0010061 3300038443 Bacteria 9586
637 Ga0395901_0038792 3300038443 Bacteria 4927
638 Ga0395901_0424117 3300038443 Bacteria 1364
639 Ga0395901_0455313 3300038443 Bacteria 1308
640 Ga0395901_0608243 3300038443 Bacteria 1101
641 Ga0395901_0953274 3300038443 Bacteria 837
642 Ga0395901_1096014 3300038443 Bacteria 767
643 Ga0395901_1207160 3300038443 Bacteria 722
644 Ga0395901_1296917 3300038443 Bacteria 690
645 Ga0395901_1819612 3300038443 Bacteria 558
646 Ga0436365_0279888 3300039437 Bacteria 799
647 Ga0436365_0378539 3300039437 Bacteria 21711
648 Ga0436365_0727247 3300039437 Bacteria 646
649 Ga0436365_0952728 3300039437 Bacteria 564
650 Ga0436365_1727618 3300039437 Bacteria 14282
651 Ga0436365_1868477 3300039437 Bacteria 6327
652 Ga0436363_1470231 3300039450 Bacteria 997
653 Ga0436363_1632579 3300039450 Bacteria 3098
654 Ga0436362_0308584 3300039453 Bacteria 678
655 Ga0436362_0402256 3300039453 Bacteria 617
656 Ga0436362_0527905 3300039453 Bacteria 4707
657 Ga0451791_0013117 3300041451 Bacteria 517
658 Ga0451797_0368693 3300041453 Bacteria 588
659 Ga0451807_2024780 3300041486 Bacteria 1241
660 Ga0451833_0205188 3300041491 Bacteria 644
661 Ga0451841_0618205 3300041498 Bacteria 885
662 Ga0451849_0929619 3300041505 Bacteria 787
663 Ga0451853_3135641 3300041512 Bacteria 1465
664 Ga0439463_040070 3300042016 Bacteria 1190
665 Ga0439464_0047592 3300042439 Bacteria 1234
666 Ga0439460_0056377 3300042461 Bacteria 1190
667 Ga0439440_0162319 3300042993 Bacteria 646
668 Ga0466969_0004458 3300044656 Bacteria 7450
669 Ga0466969_0063251 3300044656 Bacteria 1794
670 Ga0466972_0034144 3300044658 Bacteria 2494
671 Ga0466965_0023873 3300044683 Bacteria 2955
672 Ga0466965_0091914 3300044683 Bacteria 1545
673 Ga0466965_0303241 3300044683 Bacteria 867
674 Ga0466965_0481116 3300044683 Bacteria 694
675 Ga0466966_0190529 3300044684 Bacteria 1242
676 Ga0466966_0285915 3300044684 Bacteria 991
677 Ga0466966_0379460 3300044684 Bacteria 849
678 Ga0466966_0577026 3300044684 Bacteria 677
679 Ga0466966_0957685 3300044684 Bacteria 516
680 Ga0466961_0028695 3300044693 Bacteria 3578
681 Ga0466961_0313052 3300044693 Bacteria 958
682 Ga0466961_0324175 3300044693 Bacteria 939
683 Ga0466963_0012064 3300044694 Bacteria 5280
684 Ga0466963_0184568 3300044694 Bacteria 1457
685 Ga0466963_0295351 3300044694 Bacteria 1139
686 Ga0466963_0311492 3300044694 Bacteria 1107
687 Ga0466963_0503093 3300044694 Bacteria 855
688 Ga0466964_0017949 3300044706 Bacteria 2711
689 Ga0466964_0043347 3300044706 Bacteria 1825
690 Ga0466964_0112139 3300044706 Bacteria 1218
691 Ga0466964_0460099 3300044706 Bacteria 676
692 Ga0466964_0510164 3300044706 Bacteria 647
693 Ga0466971_0404361 3300044719 Bacteria 666
694 Ga0466968_0141625 3300044735 Bacteria 1100
695 Ga0466970_0070305 3300044765 Bacteria 1882
696 Ga0466957_0010702 3300044842 Bacteria 5274
697 Ga0466957_0800724 3300044842 Bacteria 669
698 Ga0466960_0136623 3300044901 Bacteria 1299
699 Ga0466960_0372251 3300044901 Bacteria 819
700 Ga0466959_0038186 3300045049 Bacteria 3548
701 Ga0466959_0042946 3300045049 Bacteria 3334
702 Ga0466959_0355042 3300045049 Bacteria 999
703 Ga0466959_0476319 3300045049 Bacteria 845
704 Ga0466959_0649468 3300045049 Bacteria 708
705 Ga0466958_0025030 3300045836 Bacteria 3515
706 Ga0466958_0066323 3300045836 Bacteria 2204
707 Ga0466958_0077765 3300045836 Bacteria 2038
708 Ga0466958_0100358 3300045836 Bacteria 1799
709 Ga0466958_0136145 3300045836 Bacteria 1544
710 Ga0466958_0256961 3300045836 Bacteria 1118
711 Ga0466967_0015873 3300045976 Bacteria 5919
712 Ga0466967_0043106 3300045976 Bacteria 3905
713 Ga0466967_0051648 3300045976 Bacteria 3604
714 Ga0466967_0252978 3300045976 Bacteria 1683
715 Ga0466967_0433195 3300045976 Bacteria 1283
716 Ga0466967_0687452 3300045976 Bacteria 1013
717 Ga0466967_0692615 3300045976 Bacteria 1009
718 Ga0466967_0708487 3300045976 Bacteria 997
719 Ga0466967_0737988 3300045976 Bacteria 976
720 Ga0466967_2030475 3300045976 Bacteria 571
721 Ga0495603_0117058 3300046455 Bacteria 1554
722 Ga0495629_0105496 3300046459 Bacteria 1966
723 Ga0495641_0037914 3300046461 Bacteria 2255
724 Ga0495605_0388054 3300046474 Bacteria 582
725 Ga0495584_0106485 3300046491 Bacteria 1418
726 Ga0495585_0482224 3300046492 Bacteria 591
727 Ga0495596_0023720 3300046500 Bacteria 2488
728 Ga0495596_0080713 3300046500 Bacteria 1263
729 Ga0495596_0288588 3300046500 Bacteria 638
730 Ga0495596_0351091 3300046500 Bacteria 574
731 Ga0495608_0000023 3300046511 Bacteria 160090
732 Ga0495608_0181040 3300046511 Bacteria 1333
733 Ga0495628_0133196 3300046516 Bacteria 1900
734 Ga0495631_0356389 3300046518 Bacteria 623
735 Ga0495631_0413850 3300046518 Unclassified 574
736 Ga0495656_0159710 3300046615 Bacteria 1095
737 Ga0495656_0334584 3300046615 Bacteria 782
738 Ga0495625_0250896 3300046660 Bacteria 1149
739 Ga0495588_0336136 3300046674 Bacteria 794
740 Ga0495657_0000020 3300046675 Bacteria 160089
741 Ga0495658_0215131 3300046683 Bacteria 1202
742 Ga0495613_0000251 3300046689 Bacteria 50730
743 Ga0495624_0376867 3300046690 Bacteria 853
744 Ga0495670_0168975 3300046691 Bacteria 1151
745 Ga0495589_0336337 3300046794 Bacteria 696
746 Ga0495604_0000158 3300047317 Bacteria 59386
747 Ga0495675_0000561 3300047444 Bacteria 23982
748 Ga0495593_0247261 3300047673 Bacteria 893
749 Ga0495593_0618296 3300047673 Bacteria 544
750 Ga0496100_0100042 3300048903 Bacteria 1996
751 Ga0496100_0174683 3300048903 Bacteria 1550
752 Ga0496100_0179279 3300048903 Bacteria 1531
753 Ga0496100_0187151 3300048903 Bacteria 1501
754 Ga0496100_0541474 3300048903 Bacteria 900
755 Ga0496100_1534716 3300048903 Bacteria 526
756 Ga0496101_0041686 3300048904 Bacteria 3274
757 Ga0496101_0044046 3300048904 Bacteria 3192
758 Ga0496101_0065871 3300048904 Bacteria 2641
759 Ga0496101_0398490 3300048904 Bacteria 1083
760 Ga0496102_0003095 3300048905 Bacteria 14096
761 Ga0496102_0198940 3300048905 Bacteria 1889
762 Ga0496102_0503376 3300048905 Bacteria 1133
763 Ga0496102_0976998 3300048905 Bacteria 767
764 Ga0496102_1080381 3300048905 Bacteria 722
765 Ga0496102_1457173 3300048905 Bacteria 603
766 Ga0496103_0022041 3300048906 Bacteria 3834
767 Ga0496103_0030924 3300048906 Bacteria 3259
768 Ga0496104_0012412 3300048907 Bacteria 7660
769 Ga0496104_0021418 3300048907 Bacteria 5934
770 Ga0496104_0075754 3300048907 Bacteria 3204
771 Ga0496104_0259428 3300048907 Bacteria 1651
772 Ga0496104_1767976 3300048907 Bacteria 520
773 Ga0496105_0070815 3300048908 Bacteria 2882
774 Ga0496105_0154886 3300048908 Bacteria 1882
775 Ga0496105_0353859 3300048908 Bacteria 1172
776 Ga0496105_0778513 3300048908 Bacteria 729
777 Ga0496106_0006523 3300048909 Bacteria 8636
778 Ga0496106_0036277 3300048909 Bacteria 3688
779 Ga0496107_0042362 3300048910 Bacteria 3270
780 Ga0496107_0050430 3300048910 Bacteria 3000
781 Ga0496107_0159475 3300048910 Bacteria 1671
782 Ga0496107_0226511 3300048910 Bacteria 1391
783 Ga0496107_0276299 3300048910 Bacteria 1250
784 Ga0496107_0574043 3300048910 Bacteria 834
785 Ga0496107_0588607 3300048910 Bacteria 823
786 Ga0496107_0637477 3300048910 Bacteria 786
787 Ga0496108_0004449 3300048911 Bacteria 11283
788 Ga0496108_0024711 3300048911 Bacteria 4949
789 Ga0496108_0046338 3300048911 Bacteria 3632
790 Ga0496108_0176298 3300048911 Bacteria 1850
791 Ga0496108_0214434 3300048911 Bacteria 1672
792 Ga0496108_0775168 3300048911 Bacteria 828
793 Ga0496108_0969796 3300048911 Bacteria 727
794 Ga0496109_0000075 3300048912 Bacteria 105050
795 Ga0496109_0003244 3300048912 Bacteria 13555
796 Ga0496109_0012257 3300048912 Bacteria 7400
797 Ga0496109_0014690 3300048912 Bacteria 6815
798 Ga0496109_0577518 3300048912 Bacteria 1059
799 Ga0496109_0649710 3300048912 Bacteria 992
800 Ga0496109_0660889 3300048912 Bacteria 982
801 Ga0496109_0708155 3300048912 Bacteria 944
802 Ga0496109_1213058 3300048912 Bacteria 691
803 Ga0496109_1257147 3300048912 Bacteria 676
804 Ga0496109_1618315 3300048912 Bacteria 582
805 Ga0496109_1783984 3300048912 Bacteria 548
806 Ga0496110_0062927 3300048913 Bacteria 3278
807 Ga0496110_0072468 3300048913 Bacteria 3056
808 Ga0496110_0269852 3300048913 Bacteria 1549
809 Ga0496110_0475352 3300048913 Unclassified 1138
810 Ga0496110_0482394 3300048913 Bacteria 1129
811 Ga0496110_1794422 3300048913 Bacteria 523
812 Ga0496111_0027123 3300048914 Bacteria 4049
813 Ga0496111_0214719 3300048914 Bacteria 1429
814 Ga0496112_0000013 3300048915 Bacteria 237194
815 Ga0496112_0024384 3300048915 Bacteria 5790
816 Ga0496112_0202224 3300048915 Bacteria 1945
817 Ga0496112_0233867 3300048915 Bacteria 1792
818 Ga0496112_0347291 3300048915 Bacteria 1426
819 Ga0496112_0372740 3300048915 Bacteria 1369
820 Ga0496113_0026775 3300048916 Bacteria 4126
821 Ga0496113_0037782 3300048916 Bacteria 3546
822 Ga0496113_0071478 3300048916 Bacteria 2639
823 Ga0496113_0546862 3300048916 Bacteria 929
824 Ga0496114_0021547 3300048917 Bacteria 5243
825 Ga0496114_0122625 3300048917 Bacteria 2237
826 Ga0496114_0377166 3300048917 Bacteria 1255
827 Ga0496115_0216447 3300048918 Bacteria 1581
828 Ga0501031_0291316 3300049568 Bacteria 1058
829 Ga0501031_0895057 3300049568 Bacteria 568
830 Ga0501033_0373905 3300049570 Bacteria 996
831 Ga0501036_0651252 3300049572 Bacteria 872
832 Ga0501036_1674400 3300049572 Bacteria 513
833 Ga0501038_0443030 3300049574 Bacteria 1000
834 Ga0501039_0171504 3300049575 Bacteria 1706
835 Ga0501039_0323562 3300049575 Bacteria 1212
836 Ga0501040_0023006 3300049576 Bacteria 4176
837 Ga0501040_0085543 3300049576 Bacteria 2189
838 Ga0501040_0528064 3300049576 Bacteria 851
839 Ga0501041_0021960 3300049577 Bacteria 3822
840 Ga0501041_0149692 3300049577 Bacteria 1457
841 Ga0501042_0191243 3300049578 Bacteria 1476
842 Ga0501042_0331440 3300049578 Bacteria 1100
843 Ga0501046_0369590 3300049580 Bacteria 1039
844 Ga0501046_0421466 3300049580 Bacteria 962
845 Ga0501048_0041902 3300049582 Bacteria 3280
846 Ga0501048_0289431 3300049582 Bacteria 1165
847 Ga0501067_0175878 3300049583 Bacteria 1192
848 Ga0501069_0470778 3300049585 Bacteria 748
849 Ga0501071_0026554 3300049587 Bacteria 4066
850 Ga0501071_0069904 3300049587 Bacteria 2557
851 Ga0501071_0121517 3300049587 Bacteria 1936
852 Ga0501071_0321901 3300049587 Bacteria 1174
853 Ga0501071_0341938 3300049587 Bacteria 1138
854 Ga0501072_0019744 3300049588 Bacteria 5213
855 Ga0501072_0057878 3300049588 Bacteria 3055
856 Ga0501072_0147308 3300049588 Bacteria 1877
857 Ga0501072_0377024 3300049588 Bacteria 1126
858 Ga0501072_1130225 3300049588 Bacteria 609
859 Ga0501074_0303848 3300049590 Unclassified 1133
860 Ga0501074_0494255 3300049590 Bacteria 867
861 Ga0501075_0029679 3300049591 Bacteria 4045
862 Ga0501075_0038581 3300049591 Bacteria 3572
863 Ga0501075_0073939 3300049591 Bacteria 2578
864 Ga0501075_0643588 3300049591 Bacteria 808
865 Ga0501076_0031553 3300049592 Bacteria 4133
866 Ga0501076_0036078 3300049592 Bacteria 3872
867 Ga0501076_0179253 3300049592 Bacteria 1727
868 Ga0501076_0265097 3300049592 Bacteria 1407
869 Ga0501076_0525250 3300049592 Bacteria 976
870 Ga0501077_0358088 3300049593 Bacteria 931
871 Ga0501077_0397261 3300049593 Bacteria 881
872 Ga0501223_074980 3300049663 Bacteria 672
873 Ga0501227_184058 3300049665 Bacteria 588
874 Ga0501235_191922 3300049669 Bacteria 549
875 Ga0501259_013667 3300049688 Bacteria 1368
876 Ga0501079_0225345 3300049741 Bacteria 1464
877 Ga0501079_0437106 3300049741 Bacteria 1027
878 Ga0501079_1137010 3300049741 Bacteria 615
879 Ga0501080_1176813 3300049742 Bacteria 660
880 Ga0501081_0002804 3300049743 Bacteria 11058
881 Ga0501081_0264230 3300049743 Bacteria 1258
882 Ga0501081_0362245 3300049743 Bacteria 1070
883 Ga0501081_1155998 3300049743 Bacteria 586
884 Ga0501083_0482690 3300049744 Bacteria 807
885 Ga0501273_087628 3300049770 Bacteria 525
886 Ga0501035_0291652 3300049822 Bacteria 1377
887 Ga0501035_0637531 3300049822 Bacteria 865
888 Ga0501035_1195217 3300049822 Bacteria 590
889 Ga0501045_0060924 3300049824 Bacteria 2767
890 Ga0501045_0520842 3300049824 Bacteria 883
891 Ga0501045_0538672 3300049824 Bacteria 866
892 nmdc:mga03n38_290846_c1 3300050490 Bacteria 875
893 nmdc:mga03n38_44508_c1 3300050490 Bacteria 1162
894 nmdc:mga00v17_33154_c1 3300050491 Bacteria 3058
895 nmdc:mga00v17_7459_c1 3300050491 Bacteria 5837
896 nmdc:mga00v17_74686_c1 3300050491 Bacteria 2107
897 nmdc:mga0yw44_2119_c1 3300050492 Bacteria 8315
898 nmdc:mga0yw44_39020_c1 3300050492 Bacteria 2813
899 nmdc:mga0yw44_47850_c2 3300050492 Bacteria 1699
900 nmdc:mga0yw44_619864_c1 3300050492 Bacteria 735
901 nmdc:mga06z11_1035300_c1 3300050494 Bacteria 500
902 nmdc:mga06z11_435155_c1 3300050494 Bacteria 791
903 nmdc:mga06z11_679730_c1 3300050494 Bacteria 627
904 nmdc:mga06z11_779797_c1 3300050494 Bacteria 582
905 nmdc:mga05p37_14788_c1 3300050507 Bacteria 9372
906 nmdc:mga05p37_148787_c1 3300050507 Bacteria 2866
907 nmdc:mga05p37_169778_c1 3300050507 Bacteria 2661
908 nmdc:mga05p37_172958_c1 3300050507 Bacteria 2633
909 nmdc:mga05p37_343537_c1 3300050507 Bacteria 1759
910 nmdc:mga05p37_4564_c1 3300050507 Bacteria 16189
911 nmdc:mga05p37_559193_c1 3300050507 Bacteria 1300
912 nmdc:mga09592_144042_c1 3300050508 Bacteria 2054
913 nmdc:mga09592_185824_c1 3300050508 Bacteria 1798
914 nmdc:mga09592_19018_c1 3300050508 Bacteria 5637
915 nmdc:mga09592_443722_c1 3300050508 Bacteria 1120
916 nmdc:mga09592_992034_c1 3300050508 Bacteria 702
917 nmdc:mga0qj67_127541_c1 3300050509 Bacteria 2059
918 nmdc:mga0qj67_27450_c1 3300050509 Bacteria 4414
919 nmdc:mga06r32_193547_c1 3300050510 Bacteria 2021
920 nmdc:mga06r32_219728_c1 3300050510 Bacteria 1888
921 nmdc:mga06r32_253554_c1 3300050510 Bacteria 1747
922 nmdc:mga06r32_25649_c1 3300050510 Bacteria 5487
923 nmdc:mga06r32_286483_c1 3300050510 Bacteria 1634
924 nmdc:mga06r32_519487_c1 3300050510 Bacteria 1166
925 nmdc:mga06r32_558464_c1 3300050510 Bacteria 1118
926 nmdc:mga08y16_1232607_c1 3300050511 Bacteria 717
927 nmdc:mga08y16_1254734_c1 3300050511 Bacteria 710
928 nmdc:mga08y16_18190_c1 3300050511 Bacteria 7405
929 nmdc:mga08y16_288085_c1 3300050511 Bacteria 1693
930 nmdc:mga08y16_353532_c1 3300050511 Bacteria 1509
931 nmdc:mga08y16_47862_c1 3300050511 Bacteria 4475
932 nmdc:mga08y16_493031_c1 3300050511 Bacteria 1246
933 nmdc:mga08y16_498894_c1 3300050511 Bacteria 1237
934 nmdc:mga08y16_533875_c1 3300050511 Bacteria 1189
935 nmdc:mga08y16_58425_c1 3300050511 Bacteria 4030
936 nmdc:mga0n895_1048682_c1 3300050512 Bacteria 794
937 nmdc:mga0n895_166491_c1 3300050512 Bacteria 2236
938 nmdc:mga0n895_1940942_c1 3300050512 Bacteria 547
939 nmdc:mga0n895_1974714_c1 3300050512 Bacteria 541
940 nmdc:mga0n895_2231470_c1 3300050512 Bacteria 502
941 nmdc:mga0n895_561078_c1 3300050512 Bacteria 1147
942 nmdc:mga0rr50_598822_c1 3300050513 Bacteria 940
943 nmdc:mga08x19_407988_c1 3300050514 Bacteria 954
944 nmdc:mga0a205_154858_c1 3300050515 Bacteria 2190
945 nmdc:mga0a205_214067_c1 3300050515 Bacteria 1814
946 nmdc:mga0a205_78610_c1 3300050515 Bacteria 3187
947 Ga0495612_0000022 3300053078 Bacteria 119126
948 Ga0495655_0071852 3300053083 Bacteria 969
949 Ga0495655_0101842 3300053083 Bacteria 851
950 Ga0495655_0215508 3300053083 Bacteria 633
951 Ga0495595_0000022 3300053084 Bacteria 110598
952 Ga0495619_0000070 3300053085 Bacteria 80588
953 Ga0500616_0004292 3300053153 Bacteria 10233
954 Ga0501084_0418861 3300054114 Bacteria 1132
955 Ga0501084_0969359 3300054114 Bacteria 715
956 Ga0501084_1051000 3300054114 Bacteria 684
957 Ga0590075_094382 3300059424 Bacteria 777
958 Ga0587070_145090 3300059491 Bacteria 590
959 Ga0587073_0109275 3300059492 Bacteria 730
960 Ga0587067_123080 3300059640 Bacteria 625
961 Ga0587067_126318 3300059640 Bacteria 619
962 Ga0587114_104150 3300059655 Bacteria 556
963 Ga0501082_0006969 3300060353 Bacteria 9762
964 Ga0501082_0130106 3300060353 Bacteria 2184
965 Ga0501082_0185504 3300060353 Bacteria 1810
966 Ga0466962_0010743 3300061719 Bacteria 4401
967 Ga0466962_0077598 3300061719 Bacteria 1588
968 Ga0466962_0121791 3300061719 Bacteria 1259
969 Ga0530510_0005169 3300061734 Bacteria 9003
970 Ga0530510_0061101 3300061734 Bacteria 2728
971 Ga0530510_0622348 3300061734 Bacteria 821
972 Ga0530510_1029904 3300061734 Bacteria 630

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005719 Ga0068861_101115569 Ga0068861_1011155692 106
2 3300028381 Ga0268264_10470735 Ga0268264_104707352 106
3 3300048905 Ga0496102_0198940 Ga0496102_0198940_415_819 106
4 3300049587 Ga0501071_0341938 Ga0501071_0341938_265_663 106
5 3300061734 Ga0530510_1029904 Ga0530510_1029904_29_427 106
6 3300005444 Ga0070694_101250540 Ga0070694_1012505402 115
7 3300009545 Ga0105237_12385692 Ga0105237_123856922 116
8 3300046511 Ga0495608_0181040 Ga0495608_0181040_599_994 119
9 3300049742 Ga0501080_1176813 Ga0501080_1176813_241_621 121
10 3300049743 Ga0501081_1155998 Ga0501081_1155998_84_479 121
11 3300049824 Ga0501045_0520842 Ga0501045_0520842_424_819 121
12 3300025923 Ga0207681_10537408 Ga0207681_105374082 123
13 3300005436 Ga0070713_100000079 Ga0070713_10000007953 125
14 3300005445 Ga0070708_100000127 Ga0070708_10000012748 125
15 3300005467 Ga0070706_100001206 Ga0070706_1000012064 125
16 3300005468 Ga0070707_100008434 Ga0070707_1000084343 125
17 3300005471 Ga0070698_100376632 Ga0070698_1003766322 125
18 3300005518 Ga0070699_100020245 Ga0070699_1000202456 125
19 3300005536 Ga0070697_100000319 Ga0070697_10000031915 125
20 3300005983 Ga0081540_1009024 Ga0081540_10090242 125
21 3300007265 Ga0099794_10000317 Ga0099794_100003176 125
22 3300009093 Ga0105240_10003665 Ga0105240_100036652 125
23 3300009147 Ga0114129_10522328 Ga0114129_105223282 125
24 3300025910 Ga0207684_10000047 Ga0207684_10000047196 125
25 3300025913 Ga0207695_10049810 Ga0207695_100498104 125
26 3300025922 Ga0207646_10012901 Ga0207646_100129012 125
27 3300025928 Ga0207700_10000007 Ga0207700_1000000768 125
28 3300027671 Ga0209588_1000016 Ga0209588_100001624 125
29 3300044684 Ga0466966_0957685 Ga0466966_0957685_126_506 125
30 3300003373 JGI25407J50210_10003345 JGI25407J50210_100033453 126
31 3300003373 JGI25407J50210_10003751 JGI25407J50210_100037511 126
32 3300003373 JGI25407J50210_10004139 JGI25407J50210_100041391 126
33 3300003373 JGI25407J50210_10045251 JGI25407J50210_100452512 126
34 3300005578 Ga0068854_100738626 Ga0068854_1007386262 126
35 3300005937 Ga0081455_10082841 Ga0081455_100828413 126
36 3300005981 Ga0081538_10000035 Ga0081538_1000003567 126
37 3300005981 Ga0081538_10002058 Ga0081538_1000205820 126
38 3300006042 Ga0075368_10216393 Ga0075368_102163932 126
39 3300006048 Ga0075363_100193973 Ga0075363_1001939732 126
40 3300006844 Ga0075428_100138236 Ga0075428_1001382362 126
41 3300006844 Ga0075428_100652990 Ga0075428_1006529902 126
42 3300006846 Ga0075430_100307128 Ga0075430_1003071282 126
43 3300006847 Ga0075431_100373663 Ga0075431_1003736632 126
44 3300006847 Ga0075431_100706412 Ga0075431_1007064122 126
45 3300026075 Ga0207708_10349506 Ga0207708_103495062 126
46 3300031548 Ga0307408_100368650 Ga0307408_1003686502 126
47 3300031548 Ga0307408_100787426 Ga0307408_1007874262 126
48 3300031731 Ga0307405_10823444 Ga0307405_108234442 126
49 3300031824 Ga0307413_10530109 Ga0307413_105301092 126
50 3300031824 Ga0307413_11056960 Ga0307413_110569601 126
51 3300031852 Ga0307410_10305716 Ga0307410_103057162 126
52 3300031852 Ga0307410_10475140 Ga0307410_104751402 126
53 3300031901 Ga0307406_10234201 Ga0307406_102342012 126
54 3300031903 Ga0307407_10331528 Ga0307407_103315282 126
55 3300031903 Ga0307407_11049357 Ga0307407_110493572 126
56 3300031911 Ga0307412_10247974 Ga0307412_102479742 126
57 3300031911 Ga0307412_11078449 Ga0307412_110784492 126
58 3300031995 Ga0307409_100297346 Ga0307409_1002973462 126
59 3300031995 Ga0307409_100406829 Ga0307409_1004068292 126
60 3300032002 Ga0307416_100471998 Ga0307416_1004719981 126
61 3300032002 Ga0307416_100498553 Ga0307416_1004985532 126
62 3300032004 Ga0307414_10974487 Ga0307414_109744872 126
63 3300032005 Ga0307411_10567697 Ga0307411_105676972 126
64 3300032126 Ga0307415_100173401 Ga0307415_1001734012 126
65 3300039450 Ga0436363_1470231 Ga0436363_1470231_518_901 126
66 3300044683 Ga0466965_0481116 Ga0466965_0481116_234_623 126
67 3300044706 Ga0466964_0043347 Ga0466964_0043347_550_939 126
68 3300045976 Ga0466967_0252978 Ga0466967_0252978_1190_1579 126
69 3300046500 Ga0495596_0023720 Ga0495596_0023720_1621_2004 126
70 3300046615 Ga0495656_0334584 Ga0495656_0334584_35_418 126
71 3300046691 Ga0495670_0168975 Ga0495670_0168975_214_597 126
72 3300048903 Ga0496100_0174683 Ga0496100_0174683_627_1010 126
73 3300048903 Ga0496100_1534716 Ga0496100_1534716_87_476 126
74 3300048904 Ga0496101_0398490 Ga0496101_0398490_43_432 126
75 3300048910 Ga0496107_0226511 Ga0496107_0226511_118_507 126
76 3300049741 Ga0501079_1137010 Ga0501079_1137010_108_491 126
77 3300050494 nmdc:mga06z11_779797_c1 nmdc:mga06z11_779797_c1_23_406 126
78 3300050510 nmdc:mga06r32_193547_c1 nmdc:mga06r32_193547_c1_17_400 126
79 3300050510 nmdc:mga06r32_519487_c1 nmdc:mga06r32_519487_c1_362_745 126
80 3300053083 Ga0495655_0071852 Ga0495655_0071852_104_487 126
81 3300054114 Ga0501084_0969359 Ga0501084_0969359_230_613 126
82 3300059640 Ga0587067_123080 Ga0587067_123080_14_397 126
83 3300000549 LJQas_1003359 LJQas_10033592 127
84 3300001989 JGI24739J22299_10190972 JGI24739J22299_101909721 127
85 3300001990 JGI24737J22298_10161390 JGI24737J22298_101613901 127
86 3300001991 JGI24743J22301_10016082 JGI24743J22301_100160822 127
87 3300001991 JGI24743J22301_10028122 JGI24743J22301_100281221 127
88 3300002075 JGI24738J21930_10126562 JGI24738J21930_101265621 127
89 3300002075 JGI24738J21930_10136050 JGI24738J21930_101360501 127
90 3300003659 JGI25404J52841_10062149 JGI25404J52841_100621491 127
91 3300004798 Ga0058859_11783415 Ga0058859_117834152 127
92 3300005327 Ga0070658_10042224 Ga0070658_100422243 127
93 3300005328 Ga0070676_10107599 Ga0070676_101075992 127
94 3300005328 Ga0070676_10357116 Ga0070676_103571162 127
95 3300005329 Ga0070683_100048461 Ga0070683_1000484614 127
96 3300005330 Ga0070690_100182193 Ga0070690_1001821932 127
97 3300005330 Ga0070690_100946660 Ga0070690_1009466602 127
98 3300005331 Ga0070670_101115124 Ga0070670_1011151241 127
99 3300005334 Ga0068869_100280359 Ga0068869_1002803592 127
100 3300005336 Ga0070680_100329012 Ga0070680_1003290122 127
101 3300005336 Ga0070680_101177259 Ga0070680_1011772591 127
102 3300005337 Ga0070682_100013260 Ga0070682_1000132603 127
103 3300005337 Ga0070682_100034008 Ga0070682_1000340082 127
104 3300005337 Ga0070682_100188878 Ga0070682_1001888781 127
105 3300005337 Ga0070682_100926414 Ga0070682_1009264142 127
106 3300005338 Ga0068868_100000026 Ga0068868_10000002646 127
107 3300005338 Ga0068868_100013771 Ga0068868_1000137712 127
108 3300005338 Ga0068868_100022497 Ga0068868_1000224972 127
109 3300005338 Ga0068868_102147364 Ga0068868_1021473641 127
110 3300005339 Ga0070660_100009834 Ga0070660_1000098342 127
111 3300005339 Ga0070660_100124433 Ga0070660_1001244332 127
112 3300005339 Ga0070660_100725733 Ga0070660_1007257332 127
113 3300005339 Ga0070660_100772940 Ga0070660_1007729401 127
114 3300005340 Ga0070689_100110622 Ga0070689_1001106222 127
115 3300005341 Ga0070691_10025637 Ga0070691_100256372 127
116 3300005341 Ga0070691_10373969 Ga0070691_103739692 127
117 3300005341 Ga0070691_10483193 Ga0070691_104831932 127
118 3300005341 Ga0070691_10524802 Ga0070691_105248021 127
119 3300005343 Ga0070687_100101359 Ga0070687_1001013592 127
120 3300005344 Ga0070661_100133458 Ga0070661_1001334582 127
121 3300005344 Ga0070661_100837222 Ga0070661_1008372221 127
122 3300005345 Ga0070692_10018760 Ga0070692_100187602 127
123 3300005345 Ga0070692_10034290 Ga0070692_100342903 127
124 3300005345 Ga0070692_10080362 Ga0070692_100803622 127
125 3300005347 Ga0070668_100024328 Ga0070668_1000243282 127
126 3300005347 Ga0070668_100160546 Ga0070668_1001605462 127
127 3300005347 Ga0070668_100531729 Ga0070668_1005317291 127
128 3300005353 Ga0070669_100375280 Ga0070669_1003752802 127
129 3300005354 Ga0070675_100168821 Ga0070675_1001688212 127
130 3300005355 Ga0070671_100080735 Ga0070671_1000807353 127
131 3300005356 Ga0070674_100094652 Ga0070674_1000946522 127
132 3300005356 Ga0070674_100200525 Ga0070674_1002005251 127
133 3300005356 Ga0070674_100287818 Ga0070674_1002878182 127
134 3300005356 Ga0070674_101434100 Ga0070674_1014341001 127
135 3300005364 Ga0070673_100774118 Ga0070673_1007741182 127
136 3300005365 Ga0070688_100001123 Ga0070688_1000011233 127
137 3300005365 Ga0070688_100081740 Ga0070688_1000817402 127
138 3300005365 Ga0070688_100136059 Ga0070688_1001360592 127
139 3300005366 Ga0070659_100000450 Ga0070659_10000045024 127
140 3300005366 Ga0070659_100041398 Ga0070659_1000413983 127
141 3300005366 Ga0070659_100070835 Ga0070659_1000708353 127
142 3300005367 Ga0070667_101356301 Ga0070667_1013563011 127
143 3300005406 Ga0070703_10062472 Ga0070703_100624722 127
144 3300005434 Ga0070709_10865915 Ga0070709_108659151 127
145 3300005435 Ga0070714_101535027 Ga0070714_1015350272 127
146 3300005437 Ga0070710_10149835 Ga0070710_101498352 127
147 3300005437 Ga0070710_10203644 Ga0070710_102036442 127
148 3300005438 Ga0070701_10317038 Ga0070701_103170382 127
149 3300005438 Ga0070701_10383125 Ga0070701_103831252 127
150 3300005438 Ga0070701_10699009 Ga0070701_106990091 127
151 3300005439 Ga0070711_100000497 Ga0070711_1000004976 127
152 3300005439 Ga0070711_100077432 Ga0070711_1000774322 127
153 3300005439 Ga0070711_100079258 Ga0070711_1000792582 127
154 3300005439 Ga0070711_100160723 Ga0070711_1001607232 127
155 3300005439 Ga0070711_100202219 Ga0070711_1002022191 127
156 3300005440 Ga0070705_100023460 Ga0070705_1000234602 127
157 3300005441 Ga0070700_100003638 Ga0070700_1000036385 127
158 3300005441 Ga0070700_100020787 Ga0070700_1000207875 127
159 3300005441 Ga0070700_100127548 Ga0070700_1001275482 127
160 3300005441 Ga0070700_100377555 Ga0070700_1003775552 127
161 3300005441 Ga0070700_100589910 Ga0070700_1005899102 127
162 3300005444 Ga0070694_100541763 Ga0070694_1005417632 127
163 3300005445 Ga0070708_100358285 Ga0070708_1003582852 127
164 3300005445 Ga0070708_101208313 Ga0070708_1012083131 127
165 3300005455 Ga0070663_100000104 Ga0070663_10000010414 127
166 3300005456 Ga0070678_100408872 Ga0070678_1004088721 127
167 3300005456 Ga0070678_100609457 Ga0070678_1006094571 127
168 3300005456 Ga0070678_101546318 Ga0070678_1015463181 127
169 3300005457 Ga0070662_100000009 Ga0070662_10000000933 127
170 3300005457 Ga0070662_100009106 Ga0070662_1000091063 127
171 3300005457 Ga0070662_100042278 Ga0070662_1000422782 127
172 3300005457 Ga0070662_100201190 Ga0070662_1002011902 127
173 3300005457 Ga0070662_100494912 Ga0070662_1004949122 127
174 3300005458 Ga0070681_10091087 Ga0070681_100910871 127
175 3300005458 Ga0070681_10257061 Ga0070681_102570612 127
176 3300005458 Ga0070681_10381672 Ga0070681_103816722 127
177 3300005459 Ga0068867_100024074 Ga0068867_1000240743 127
178 3300005459 Ga0068867_101990744 Ga0068867_1019907441 127
179 3300005466 Ga0070685_10000024 Ga0070685_1000002450 127
180 3300005466 Ga0070685_10143701 Ga0070685_101437012 127
181 3300005467 Ga0070706_100372284 Ga0070706_1003722842 127
182 3300005468 Ga0070707_100204336 Ga0070707_1002043362 127
183 3300005530 Ga0070679_100000430 Ga0070679_10000043014 127
184 3300005530 Ga0070679_100687407 Ga0070679_1006874072 127
185 3300005530 Ga0070679_100953340 Ga0070679_1009533401 127
186 3300005530 Ga0070679_101228673 Ga0070679_1012286732 127
187 3300005530 Ga0070679_102211790 Ga0070679_1022117901 127
188 3300005535 Ga0070684_100087171 Ga0070684_1000871712 127
189 3300005535 Ga0070684_100216932 Ga0070684_1002169322 127
190 3300005535 Ga0070684_100461992 Ga0070684_1004619922 127
191 3300005535 Ga0070684_100669392 Ga0070684_1006693922 127
192 3300005535 Ga0070684_100980860 Ga0070684_1009808602 127
193 3300005535 Ga0070684_102287748 Ga0070684_1022877481 127
194 3300005539 Ga0068853_100040106 Ga0068853_1000401062 127
195 3300005539 Ga0068853_100377823 Ga0068853_1003778232 127
196 3300005543 Ga0070672_100000283 Ga0070672_10000028327 127
197 3300005543 Ga0070672_100013241 Ga0070672_1000132414 127
198 3300005543 Ga0070672_100241345 Ga0070672_1002413452 127
199 3300005544 Ga0070686_100013194 Ga0070686_1000131942 127
200 3300005544 Ga0070686_100021678 Ga0070686_1000216783 127
201 3300005544 Ga0070686_100141046 Ga0070686_1001410462 127
202 3300005545 Ga0070695_100059102 Ga0070695_1000591022 127
203 3300005545 Ga0070695_100167672 Ga0070695_1001676722 127
204 3300005546 Ga0070696_100122276 Ga0070696_1001222762 127
205 3300005546 Ga0070696_100193139 Ga0070696_1001931392 127
206 3300005546 Ga0070696_100700187 Ga0070696_1007001871 127
207 3300005546 Ga0070696_101267759 Ga0070696_1012677591 127
208 3300005547 Ga0070693_100070471 Ga0070693_1000704712 127
209 3300005547 Ga0070693_100383924 Ga0070693_1003839242 127
210 3300005548 Ga0070665_100895640 Ga0070665_1008956402 127
211 3300005549 Ga0070704_100028087 Ga0070704_1000280873 127
212 3300005549 Ga0070704_100158818 Ga0070704_1001588182 127
213 3300005549 Ga0070704_100562242 Ga0070704_1005622422 127
214 3300005549 Ga0070704_100638654 Ga0070704_1006386542 127
215 3300005549 Ga0070704_100733410 Ga0070704_1007334102 127
216 3300005549 Ga0070704_101688469 Ga0070704_1016884691 127
217 3300005563 Ga0068855_100655702 Ga0068855_1006557022 127
218 3300005564 Ga0070664_100028067 Ga0070664_1000280672 127
219 3300005577 Ga0068857_100116289 Ga0068857_1001162892 127
220 3300005577 Ga0068857_100761189 Ga0068857_1007611892 127
221 3300005577 Ga0068857_101572630 Ga0068857_1015726302 127
222 3300005578 Ga0068854_100023641 Ga0068854_1000236412 127
223 3300005578 Ga0068854_100048335 Ga0068854_1000483351 127
224 3300005578 Ga0068854_100221019 Ga0068854_1002210192 127
225 3300005578 Ga0068854_100569150 Ga0068854_1005691502 127
226 3300005578 Ga0068854_101151364 Ga0068854_1011513641 127
227 3300005614 Ga0068856_100054015 Ga0068856_1000540152 127
228 3300005614 Ga0068856_100100076 Ga0068856_1001000762 127
229 3300005614 Ga0068856_101203770 Ga0068856_1012037701 127
230 3300005614 Ga0068856_101258188 Ga0068856_1012581881 127
231 3300005615 Ga0070702_100016651 Ga0070702_1000166512 127
232 3300005615 Ga0070702_100095410 Ga0070702_1000954102 127
233 3300005615 Ga0070702_100100128 Ga0070702_1001001282 127
234 3300005616 Ga0068852_100066720 Ga0068852_1000667202 127
235 3300005616 Ga0068852_100271139 Ga0068852_1002711392 127
236 3300005617 Ga0068859_100028788 Ga0068859_1000287885 127
237 3300005618 Ga0068864_100363890 Ga0068864_1003638902 127
238 3300005618 Ga0068864_100514728 Ga0068864_1005147282 127
239 3300005618 Ga0068864_101214852 Ga0068864_1012148521 127
240 3300005718 Ga0068866_10205505 Ga0068866_102055052 127
241 3300005718 Ga0068866_10219342 Ga0068866_102193422 127
242 3300005719 Ga0068861_100011706 Ga0068861_1000117063 127
243 3300005719 Ga0068861_100174527 Ga0068861_1001745272 127
244 3300005719 Ga0068861_100213684 Ga0068861_1002136842 127
245 3300005719 Ga0068861_100957270 Ga0068861_1009572702 127
246 3300005834 Ga0068851_10161296 Ga0068851_101612962 127
247 3300005834 Ga0068851_10462195 Ga0068851_104621952 127
248 3300005840 Ga0068870_10061404 Ga0068870_100614042 127
249 3300005840 Ga0068870_10740057 Ga0068870_107400571 127
250 3300005841 Ga0068863_100440502 Ga0068863_1004405022 127
251 3300005841 Ga0068863_101090061 Ga0068863_1010900612 127
252 3300005842 Ga0068858_100083115 Ga0068858_1000831152 127
253 3300005842 Ga0068858_100160734 Ga0068858_1001607343 127
254 3300005843 Ga0068860_101836034 Ga0068860_1018360342 127
255 3300005844 Ga0068862_101258074 Ga0068862_1012580742 127
256 3300005844 Ga0068862_101265504 Ga0068862_1012655042 127
257 3300005844 Ga0068862_102036393 Ga0068862_1020363931 127
258 3300005937 Ga0081455_10058384 Ga0081455_100583842 127
259 3300005937 Ga0081455_10097913 Ga0081455_100979133 127
260 3300005937 Ga0081455_10617615 Ga0081455_106176152 127
261 3300005981 Ga0081538_10016003 Ga0081538_100160034 127
262 3300005981 Ga0081538_10038766 Ga0081538_100387662 127
263 3300005981 Ga0081538_10087819 Ga0081538_100878192 127
264 3300005981 Ga0081538_10155902 Ga0081538_101559021 127
265 3300005981 Ga0081538_10238932 Ga0081538_102389322 127
266 3300005983 Ga0081540_1005020 Ga0081540_10050204 127
267 3300005983 Ga0081540_1050501 Ga0081540_10505012 127
268 3300005985 Ga0081539_10116145 Ga0081539_101161453 127
269 3300005985 Ga0081539_10183926 Ga0081539_101839261 127
270 3300005985 Ga0081539_10243597 Ga0081539_102435971 127
271 3300006038 Ga0075365_10002863 Ga0075365_100028637 127
272 3300006038 Ga0075365_10038880 Ga0075365_100388803 127
273 3300006038 Ga0075365_10074921 Ga0075365_100749212 127
274 3300006038 Ga0075365_10170248 Ga0075365_101702482 127
275 3300006038 Ga0075365_10665482 Ga0075365_106654822 127
276 3300006048 Ga0075363_100003547 Ga0075363_1000035477 127
277 3300006051 Ga0075364_10012604 Ga0075364_100126043 127
278 3300006051 Ga0075364_10017734 Ga0075364_100177343 127
279 3300006051 Ga0075364_10033710 Ga0075364_100337103 127
280 3300006051 Ga0075364_10538871 Ga0075364_105388712 127
281 3300006058 Ga0075432_10018617 Ga0075432_100186172 127
282 3300006058 Ga0075432_10025797 Ga0075432_100257972 127
283 3300006175 Ga0070712_100048741 Ga0070712_1000487412 127
284 3300006175 Ga0070712_100132854 Ga0070712_1001328541 127
285 3300006175 Ga0070712_100333897 Ga0070712_1003338972 127
286 3300006178 Ga0075367_10418647 Ga0075367_104186472 127
287 3300006237 Ga0097621_100627036 Ga0097621_1006270362 127
288 3300006358 Ga0068871_100231571 Ga0068871_1002315712 127
289 3300006358 Ga0068871_101505215 Ga0068871_1015052151 127
290 3300006844 Ga0075428_100016818 Ga0075428_1000168186 127
291 3300006844 Ga0075428_100068173 Ga0075428_1000681733 127
292 3300006844 Ga0075428_100299641 Ga0075428_1002996412 127
293 3300006844 Ga0075428_101203150 Ga0075428_1012031502 127
294 3300006844 Ga0075428_101303274 Ga0075428_1013032742 127
295 3300006846 Ga0075430_100010387 Ga0075430_1000103876 127
296 3300006846 Ga0075430_100032438 Ga0075430_1000324383 127
297 3300006846 Ga0075430_100034598 Ga0075430_1000345985 127
298 3300006847 Ga0075431_100181290 Ga0075431_1001812902 127
299 3300006847 Ga0075431_100323459 Ga0075431_1003234592 127
300 3300006847 Ga0075431_100369503 Ga0075431_1003695031 127
301 3300006847 Ga0075431_100508849 Ga0075431_1005088492 127
302 3300006852 Ga0075433_10069082 Ga0075433_100690823 127
303 3300006852 Ga0075433_10177895 Ga0075433_101778952 127
304 3300006871 Ga0075434_100057440 Ga0075434_1000574403 127
305 3300006871 Ga0075434_100667233 Ga0075434_1006672332 127
306 3300006871 Ga0075434_100934082 Ga0075434_1009340822 127
307 3300006871 Ga0075434_101075089 Ga0075434_1010750892 127
308 3300006871 Ga0075434_102596508 Ga0075434_1025965082 127
309 3300006880 Ga0075429_100024381 Ga0075429_1000243812 127
310 3300006880 Ga0075429_100283950 Ga0075429_1002839502 127
311 3300006880 Ga0075429_100415206 Ga0075429_1004152062 127
312 3300006880 Ga0075429_100518281 Ga0075429_1005182812 127
313 3300006881 Ga0068865_100005630 Ga0068865_1000056303 127
314 3300006881 Ga0068865_101392870 Ga0068865_1013928702 127
315 3300006914 Ga0075436_100858152 Ga0075436_1008581522 127
316 3300006931 Ga0097620_100028786 Ga0097620_1000287865 127
317 3300007076 Ga0075435_100374339 Ga0075435_1003743392 127
318 3300007076 Ga0075435_100459793 Ga0075435_1004597932 127
319 3300009011 Ga0105251_10104591 Ga0105251_101045912 127
320 3300009093 Ga0105240_10304470 Ga0105240_103044703 127
321 3300009094 Ga0111539_10077902 Ga0111539_100779024 127
322 3300009094 Ga0111539_10079936 Ga0111539_100799363 127
323 3300009094 Ga0111539_10090862 Ga0111539_100908624 127
324 3300009094 Ga0111539_10099470 Ga0111539_100994702 127
325 3300009094 Ga0111539_10133033 Ga0111539_101330332 127
326 3300009094 Ga0111539_10162982 Ga0111539_101629823 127
327 3300009094 Ga0111539_10269372 Ga0111539_102693722 127
328 3300009094 Ga0111539_13171834 Ga0111539_131718342 127
329 3300009098 Ga0105245_10002293 Ga0105245_1000229320 127
330 3300009098 Ga0105245_10005001 Ga0105245_1000500110 127
331 3300009098 Ga0105245_10021965 Ga0105245_100219654 127
332 3300009098 Ga0105245_10236355 Ga0105245_102363552 127
333 3300009098 Ga0105245_10253919 Ga0105245_102539192 127
334 3300009098 Ga0105245_10333199 Ga0105245_103331992 127
335 3300009098 Ga0105245_10357332 Ga0105245_103573322 127
336 3300009098 Ga0105245_11935364 Ga0105245_119353642 127
337 3300009098 Ga0105245_12688276 Ga0105245_126882762 127
338 3300009101 Ga0105247_10098886 Ga0105247_100988862 127
339 3300009101 Ga0105247_10643460 Ga0105247_106434602 127
340 3300009147 Ga0114129_10003411 Ga0114129_100034113 127
341 3300009147 Ga0114129_10005383 Ga0114129_100053837 127
342 3300009147 Ga0114129_10006344 Ga0114129_100063442 127
343 3300009147 Ga0114129_10024361 Ga0114129_100243615 127
344 3300009147 Ga0114129_10025786 Ga0114129_100257862 127
345 3300009147 Ga0114129_10063226 Ga0114129_100632263 127
346 3300009147 Ga0114129_10230121 Ga0114129_102301212 127
347 3300009147 Ga0114129_10374892 Ga0114129_103748922 127
348 3300009147 Ga0114129_10606212 Ga0114129_106062122 127
349 3300009147 Ga0114129_11151010 Ga0114129_111510102 127
350 3300009147 Ga0114129_13283356 Ga0114129_132833561 127
351 3300009148 Ga0105243_10001579 Ga0105243_100015793 127
352 3300009148 Ga0105243_10060424 Ga0105243_100604242 127
353 3300009148 Ga0105243_10392824 Ga0105243_103928242 127
354 3300009148 Ga0105243_10733590 Ga0105243_107335902 127
355 3300009148 Ga0105243_11304143 Ga0105243_113041432 127
356 3300009148 Ga0105243_11797446 Ga0105243_117974461 127
357 3300009148 Ga0105243_12558535 Ga0105243_125585351 127
358 3300009148 Ga0105243_12977471 Ga0105243_129774711 127
359 3300009174 Ga0105241_10688089 Ga0105241_106880892 127
360 3300009174 Ga0105241_10882218 Ga0105241_108822182 127
361 3300009176 Ga0105242_10658791 Ga0105242_106587912 127
362 3300009176 Ga0105242_11080811 Ga0105242_110808112 127
363 3300009176 Ga0105242_11133783 Ga0105242_111337831 127
364 3300009176 Ga0105242_11258245 Ga0105242_112582452 127
365 3300009177 Ga0105248_10000008 Ga0105248_10000008162 127
366 3300009177 Ga0105248_10198030 Ga0105248_101980302 127
367 3300009177 Ga0105248_10412279 Ga0105248_104122792 127
368 3300009545 Ga0105237_10314547 Ga0105237_103145472 127
369 3300009545 Ga0105237_10720834 Ga0105237_107208342 127
370 3300009545 Ga0105237_10914927 Ga0105237_109149271 127
371 3300009551 Ga0105238_10201130 Ga0105238_102011302 127
372 3300009551 Ga0105238_10388862 Ga0105238_103888622 127
373 3300009551 Ga0105238_10516037 Ga0105238_105160372 127
374 3300009553 Ga0105249_10004662 Ga0105249_100046623 127
375 3300009553 Ga0105249_10036499 Ga0105249_100364992 127
376 3300009553 Ga0105249_10062840 Ga0105249_100628402 127
377 3300009553 Ga0105249_10186065 Ga0105249_101860653 127
378 3300009553 Ga0105249_10406820 Ga0105249_104068202 127
379 3300009553 Ga0105249_11138076 Ga0105249_111380762 127
380 3300009553 Ga0105249_12089740 Ga0105249_120897402 127
381 3300009553 Ga0105249_12940483 Ga0105249_129404832 127
382 3300009978 Ga0105148_123194 Ga0105148_1231941 127
383 3300010375 Ga0105239_10009680 Ga0105239_100096809 127
384 3300010375 Ga0105239_10199135 Ga0105239_101991352 127
385 3300010375 Ga0105239_10291479 Ga0105239_102914792 127
386 3300010375 Ga0105239_10498189 Ga0105239_104981892 127
387 3300010375 Ga0105239_11534687 Ga0105239_115346872 127
388 3300010375 Ga0105239_11885062 Ga0105239_118850622 127
389 3300011119 Ga0105246_10103171 Ga0105246_101031712 127
390 3300011119 Ga0105246_10281410 Ga0105246_102814102 127
391 3300011119 Ga0105246_10852061 Ga0105246_108520612 127
392 3300011119 Ga0105246_11426980 Ga0105246_114269801 127
393 3300012506 Ga0157324_1040859 Ga0157324_10408591 127
394 3300013100 Ga0157373_10858711 Ga0157373_108587112 127
395 3300013102 Ga0157371_10254600 Ga0157371_102546002 127
396 3300013102 Ga0157371_10298410 Ga0157371_102984102 127
397 3300013105 Ga0157369_10578664 Ga0157369_105786642 127
398 3300013105 Ga0157369_10588887 Ga0157369_105888872 127
399 3300013296 Ga0157374_10404701 Ga0157374_104047012 127
400 3300013296 Ga0157374_10408904 Ga0157374_104089042 127
401 3300013296 Ga0157374_10599913 Ga0157374_105999132 127
402 3300013297 Ga0157378_10435956 Ga0157378_104359562 127
403 3300013297 Ga0157378_10486661 Ga0157378_104866612 127
404 3300013297 Ga0157378_10821452 Ga0157378_108214522 127
405 3300013297 Ga0157378_12850850 Ga0157378_128508502 127
406 3300013306 Ga0163162_10071093 Ga0163162_100710932 127
407 3300013306 Ga0163162_10088029 Ga0163162_100880293 127
408 3300013306 Ga0163162_10470168 Ga0163162_104701682 127
409 3300013307 Ga0157372_10269173 Ga0157372_102691732 127
410 3300013307 Ga0157372_10287044 Ga0157372_102870442 127
411 3300013307 Ga0157372_10326295 Ga0157372_103262951 127
412 3300013308 Ga0157375_10055287 Ga0157375_100552872 127
413 3300013308 Ga0157375_10318580 Ga0157375_103185802 127
414 3300013308 Ga0157375_10865425 Ga0157375_108654252 127
415 3300013308 Ga0157375_11487420 Ga0157375_114874202 127
416 3300013308 Ga0157375_12405654 Ga0157375_124056542 127
417 3300013308 Ga0157375_12591540 Ga0157375_125915401 127
418 3300014325 Ga0163163_10615414 Ga0163163_106154142 127
419 3300014325 Ga0163163_10644957 Ga0163163_106449572 127
420 3300014326 Ga0157380_11433390 Ga0157380_114333902 127
421 3300014497 Ga0182008_10609015 Ga0182008_106090152 127
422 3300014497 Ga0182008_10735549 Ga0182008_107355491 127
423 3300014745 Ga0157377_10023806 Ga0157377_100238062 127
424 3300014745 Ga0157377_10110244 Ga0157377_101102442 127
425 3300014745 Ga0157377_10270898 Ga0157377_102708982 127
426 3300014745 Ga0157377_11155193 Ga0157377_111551931 127
427 3300014968 Ga0157379_10326789 Ga0157379_103267892 127
428 3300014969 Ga0157376_10111081 Ga0157376_101110812 127
429 3300014969 Ga0157376_10670151 Ga0157376_106701512 127
430 3300020069 Ga0197907_11097511 Ga0197907_110975112 127
431 3300020070 Ga0206356_10483172 Ga0206356_104831722 127
432 3300020077 Ga0206351_10176479 Ga0206351_101764792 127
433 3300020080 Ga0206350_10275672 Ga0206350_102756722 127
434 3300020080 Ga0206350_10560135 Ga0206350_105601352 127
435 3300020081 Ga0206354_11057515 Ga0206354_110575152 127
436 3300020081 Ga0206354_11261973 Ga0206354_112619732 127
437 3300020081 Ga0206354_11502332 Ga0206354_115023322 127
438 3300020082 Ga0206353_11195742 Ga0206353_111957422 127
439 3300021377 Ga0213874_10103837 Ga0213874_101038372 127
440 3300021384 Ga0213876_10002786 Ga0213876_100027864 127
441 3300021384 Ga0213876_10021465 Ga0213876_100214653 127
442 3300021388 Ga0213875_10018820 Ga0213875_100188202 127
443 3300021388 Ga0213875_10024795 Ga0213875_100247953 127
444 3300025321 Ga0207656_10028437 Ga0207656_100284372 127
445 3300025321 Ga0207656_10178008 Ga0207656_101780082 127
446 3300025898 Ga0207692_10133495 Ga0207692_101334952 127
447 3300025898 Ga0207692_10176227 Ga0207692_101762272 127
448 3300025899 Ga0207642_10047533 Ga0207642_100475332 127
449 3300025899 Ga0207642_10323489 Ga0207642_103234891 127
450 3300025899 Ga0207642_10605425 Ga0207642_106054251 127
451 3300025900 Ga0207710_10137187 Ga0207710_101371872 127
452 3300025901 Ga0207688_10028678 Ga0207688_100286783 127
453 3300025901 Ga0207688_10175358 Ga0207688_101753582 127
454 3300025903 Ga0207680_10060775 Ga0207680_100607752 127
455 3300025904 Ga0207647_10099475 Ga0207647_100994752 127
456 3300025904 Ga0207647_10389681 Ga0207647_103896812 127
457 3300025904 Ga0207647_10668759 Ga0207647_106687592 127
458 3300025907 Ga0207645_10253181 Ga0207645_102531812 127
459 3300025907 Ga0207645_10563836 Ga0207645_105638362 127
460 3300025908 Ga0207643_10030222 Ga0207643_100302223 127
461 3300025908 Ga0207643_10072603 Ga0207643_100726031 127
462 3300025911 Ga0207654_11438856 Ga0207654_114388562 127
463 3300025912 Ga0207707_10129640 Ga0207707_101296402 127
464 3300025912 Ga0207707_10172122 Ga0207707_101721223 127
465 3300025913 Ga0207695_10421865 Ga0207695_104218652 127
466 3300025914 Ga0207671_10215198 Ga0207671_102151982 127
467 3300025915 Ga0207693_10016724 Ga0207693_100167242 127
468 3300025915 Ga0207693_10062157 Ga0207693_100621572 127
469 3300025916 Ga0207663_10005141 Ga0207663_100051415 127
470 3300025916 Ga0207663_10065387 Ga0207663_100653872 127
471 3300025916 Ga0207663_10467236 Ga0207663_104672362 127
472 3300025916 Ga0207663_11688829 Ga0207663_116888291 127
473 3300025917 Ga0207660_10783540 Ga0207660_107835402 127
474 3300025918 Ga0207662_10005024 Ga0207662_100050242 127
475 3300025919 Ga0207657_10002552 Ga0207657_100025525 127
476 3300025919 Ga0207657_10054230 Ga0207657_100542303 127
477 3300025919 Ga0207657_10119163 Ga0207657_101191632 127
478 3300025919 Ga0207657_10843779 Ga0207657_108437792 127
479 3300025920 Ga0207649_10018935 Ga0207649_100189354 127
480 3300025920 Ga0207649_10340233 Ga0207649_103402332 127
481 3300025920 Ga0207649_10519642 Ga0207649_105196422 127
482 3300025921 Ga0207652_10001888 Ga0207652_100018882 127
483 3300025921 Ga0207652_10333537 Ga0207652_103335372 127
484 3300025921 Ga0207652_11059668 Ga0207652_110596682 127
485 3300025922 Ga0207646_10496162 Ga0207646_104961622 127
486 3300025922 Ga0207646_10836387 Ga0207646_108363872 127
487 3300025923 Ga0207681_10363260 Ga0207681_103632602 127
488 3300025923 Ga0207681_10875072 Ga0207681_108750722 127
489 3300025924 Ga0207694_10210635 Ga0207694_102106352 127
490 3300025924 Ga0207694_11103124 Ga0207694_111031242 127
491 3300025926 Ga0207659_10052243 Ga0207659_100522432 127
492 3300025926 Ga0207659_10526793 Ga0207659_105267932 127
493 3300025927 Ga0207687_10034419 Ga0207687_100344193 127
494 3300025927 Ga0207687_10269701 Ga0207687_102697012 127
495 3300025927 Ga0207687_10320219 Ga0207687_103202192 127
496 3300025927 Ga0207687_10533723 Ga0207687_105337232 127
497 3300025927 Ga0207687_10535322 Ga0207687_105353222 127
498 3300025931 Ga0207644_10115427 Ga0207644_101154272 127
499 3300025931 Ga0207644_10574342 Ga0207644_105743422 127
500 3300025931 Ga0207644_10940662 Ga0207644_109406622 127
501 3300025932 Ga0207690_10029154 Ga0207690_100291544 127
502 3300025932 Ga0207690_10032974 Ga0207690_100329743 127
503 3300025933 Ga0207706_10000001 Ga0207706_10000001120 127
504 3300025933 Ga0207706_10003250 Ga0207706_100032501 127
505 3300025933 Ga0207706_10011806 Ga0207706_100118065 127
506 3300025933 Ga0207706_10226661 Ga0207706_102266612 127
507 3300025933 Ga0207706_10932796 Ga0207706_109327962 127
508 3300025935 Ga0207709_10036448 Ga0207709_100364482 127
509 3300025935 Ga0207709_10111344 Ga0207709_101113442 127
510 3300025935 Ga0207709_10174005 Ga0207709_101740052 127
511 3300025935 Ga0207709_10384838 Ga0207709_103848382 127
512 3300025937 Ga0207669_10018416 Ga0207669_100184162 127
513 3300025937 Ga0207669_10109891 Ga0207669_101098912 127
514 3300025937 Ga0207669_10658865 Ga0207669_106588652 127
515 3300025937 Ga0207669_11293120 Ga0207669_112931202 127
516 3300025938 Ga0207704_10006431 Ga0207704_100064315 127
517 3300025939 Ga0207665_11071266 Ga0207665_110712661 127
518 3300025940 Ga0207691_10000934 Ga0207691_1000093427 127
519 3300025940 Ga0207691_10025843 Ga0207691_100258436 127
520 3300025940 Ga0207691_10126820 Ga0207691_101268202 127
521 3300025941 Ga0207711_10000006 Ga0207711_10000006557 127
522 3300025941 Ga0207711_10481421 Ga0207711_104814212 127
523 3300025942 Ga0207689_10066855 Ga0207689_100668552 127
524 3300025942 Ga0207689_10167201 Ga0207689_101672012 127
525 3300025944 Ga0207661_10019528 Ga0207661_100195283 127
526 3300025944 Ga0207661_10138898 Ga0207661_101388982 127
527 3300025944 Ga0207661_10374056 Ga0207661_103740562 127
528 3300025944 Ga0207661_11128205 Ga0207661_111282052 127
529 3300025945 Ga0207679_10401709 Ga0207679_104017092 127
530 3300025949 Ga0207667_10719665 Ga0207667_107196652 127
531 3300025960 Ga0207651_10026571 Ga0207651_100265712 127
532 3300025960 Ga0207651_11506213 Ga0207651_115062132 127
533 3300025961 Ga0207712_10010679 Ga0207712_100106792 127
534 3300025961 Ga0207712_10147605 Ga0207712_101476052 127
535 3300025961 Ga0207712_10169272 Ga0207712_101692721 127
536 3300025961 Ga0207712_10305562 Ga0207712_103055622 127
537 3300025961 Ga0207712_10621263 Ga0207712_106212632 127
538 3300025961 Ga0207712_11345001 Ga0207712_113450012 127
539 3300025972 Ga0207668_10014261 Ga0207668_100142614 127
540 3300025972 Ga0207668_10318815 Ga0207668_103188152 127
541 3300025972 Ga0207668_11593592 Ga0207668_115935921 127
542 3300025972 Ga0207668_12107192 Ga0207668_121071922 127
543 3300025981 Ga0207640_10029686 Ga0207640_100296863 127
544 3300025981 Ga0207640_10235450 Ga0207640_102354502 127
545 3300025981 Ga0207640_10382153 Ga0207640_103821532 127
546 3300025986 Ga0207658_10663228 Ga0207658_106632282 127
547 3300025986 Ga0207658_10839912 Ga0207658_108399122 127
548 3300026023 Ga0207677_10000106 Ga0207677_1000010633 127
549 3300026023 Ga0207677_10018790 Ga0207677_100187903 127
550 3300026023 Ga0207677_10210514 Ga0207677_102105142 127
551 3300026023 Ga0207677_11271484 Ga0207677_112714842 127
552 3300026035 Ga0207703_10133455 Ga0207703_101334553 127
553 3300026041 Ga0207639_10050495 Ga0207639_100504953 127
554 3300026067 Ga0207678_10000152 Ga0207678_1000015250 127
555 3300026067 Ga0207678_10006012 Ga0207678_100060123 127
556 3300026067 Ga0207678_10296183 Ga0207678_102961832 127
557 3300026075 Ga0207708_10000518 Ga0207708_1000051810 127
558 3300026075 Ga0207708_10001883 Ga0207708_100018837 127
559 3300026075 Ga0207708_10206704 Ga0207708_102067042 127
560 3300026075 Ga0207708_10667001 Ga0207708_106670012 127
561 3300026078 Ga0207702_10017839 Ga0207702_100178394 127
562 3300026078 Ga0207702_10052231 Ga0207702_100522313 127
563 3300026078 Ga0207702_10995014 Ga0207702_109950142 127
564 3300026088 Ga0207641_10557472 Ga0207641_105574722 127
565 3300026089 Ga0207648_10015251 Ga0207648_100152513 127
566 3300026089 Ga0207648_10032791 Ga0207648_100327913 127
567 3300026089 Ga0207648_10651690 Ga0207648_106516902 127
568 3300026089 Ga0207648_11800609 Ga0207648_118006091 127
569 3300026095 Ga0207676_10071048 Ga0207676_100710483 127
570 3300026095 Ga0207676_10196557 Ga0207676_101965572 127
571 3300026095 Ga0207676_11252395 Ga0207676_112523952 127
572 3300026116 Ga0207674_10063341 Ga0207674_100633412 127
573 3300026116 Ga0207674_10451099 Ga0207674_104510992 127
574 3300026116 Ga0207674_10619249 Ga0207674_106192492 127
575 3300026116 Ga0207674_10723951 Ga0207674_107239511 127
576 3300026116 Ga0207674_10984215 Ga0207674_109842152 127
577 3300026118 Ga0207675_100000091 Ga0207675_10000009122 127
578 3300026118 Ga0207675_100012493 Ga0207675_1000124935 127
579 3300026118 Ga0207675_100248908 Ga0207675_1002489082 127
580 3300026118 Ga0207675_100575891 Ga0207675_1005758912 127
581 3300026118 Ga0207675_100901786 Ga0207675_1009017861 127
582 3300026118 Ga0207675_101257124 Ga0207675_1012571241 127
583 3300026118 Ga0207675_101259102 Ga0207675_1012591022 127
584 3300026118 Ga0207675_102374337 Ga0207675_1023743372 127
585 3300026121 Ga0207683_10044824 Ga0207683_100448243 127
586 3300026121 Ga0207683_11197344 Ga0207683_111973442 127
587 3300026121 Ga0207683_12011748 Ga0207683_120117482 127
588 3300026142 Ga0207698_10025692 Ga0207698_100256922 127
589 3300026142 Ga0207698_10456873 Ga0207698_104568732 127
590 3300026142 Ga0207698_12549727 Ga0207698_125497271 127
591 3300027907 Ga0207428_10385388 Ga0207428_103853882 127
592 3300027907 Ga0207428_10386459 Ga0207428_103864592 127
593 3300027907 Ga0207428_10658649 Ga0207428_106586492 127
594 3300027907 Ga0207428_10671129 Ga0207428_106711292 127
595 3300028380 Ga0268265_10065021 Ga0268265_100650213 127
596 3300028380 Ga0268265_10811010 Ga0268265_108110102 127
597 3300028380 Ga0268265_11543743 Ga0268265_115437432 127
598 3300028381 Ga0268264_10270291 Ga0268264_102702912 127
599 3300028381 Ga0268264_10363390 Ga0268264_103633902 127
600 3300031344 Ga0265316_10084288 Ga0265316_100842882 127
601 3300031548 Ga0307408_100058956 Ga0307408_1000589563 127
602 3300031548 Ga0307408_100290998 Ga0307408_1002909982 127
603 3300031731 Ga0307405_10091008 Ga0307405_100910082 127
604 3300031731 Ga0307405_10338654 Ga0307405_103386542 127
605 3300031824 Ga0307413_10014941 Ga0307413_100149413 127
606 3300031824 Ga0307413_11898350 Ga0307413_118983501 127
607 3300031852 Ga0307410_10042752 Ga0307410_100427523 127
608 3300031852 Ga0307410_10239684 Ga0307410_102396842 127
609 3300031852 Ga0307410_10655977 Ga0307410_106559772 127
610 3300031852 Ga0307410_11371634 Ga0307410_113716342 127
611 3300031901 Ga0307406_10034550 Ga0307406_100345502 127
612 3300031901 Ga0307406_10334196 Ga0307406_103341962 127
613 3300031901 Ga0307406_10542362 Ga0307406_105423622 127
614 3300031903 Ga0307407_10054087 Ga0307407_100540873 127
615 3300031903 Ga0307407_10128937 Ga0307407_101289372 127
616 3300031911 Ga0307412_10064169 Ga0307412_100641693 127
617 3300031995 Ga0307409_100028997 Ga0307409_1000289975 127
618 3300031995 Ga0307409_100076991 Ga0307409_1000769913 127
619 3300031995 Ga0307409_100136227 Ga0307409_1001362272 127
620 3300031995 Ga0307409_101128739 Ga0307409_1011287392 127
621 3300032002 Ga0307416_100031212 Ga0307416_1000312123 127
622 3300032002 Ga0307416_100443250 Ga0307416_1004432502 127
623 3300032002 Ga0307416_100628284 Ga0307416_1006282842 127
624 3300032002 Ga0307416_101293797 Ga0307416_1012937972 127
625 3300032004 Ga0307414_11059575 Ga0307414_110595752 127
626 3300032004 Ga0307414_11349755 Ga0307414_113497552 127
627 3300032126 Ga0307415_100410655 Ga0307415_1004106552 127
628 3300032126 Ga0307415_100463062 Ga0307415_1004630621 127
629 3300032126 Ga0307415_100582147 Ga0307415_1005821472 127
630 3300034819 Ga0373958_0058354 Ga0373958_0058354_390_782 127
631 3300035089 Ga0373944_0328270 Ga0373944_0328270_80_472 127
632 3300035092 Ga0373952_0117729 Ga0373952_0117729_23_412 127
633 3300035114 Ga0373939_0084137 Ga0373939_0084137_500_889 127
634 3300035114 Ga0373939_0152325 Ga0373939_0152325_32_421 127
635 3300035115 Ga0373941_0018221 Ga0373941_0018221_842_1231 127
636 3300035115 Ga0373941_0410659 Ga0373941_0410659_147_533 127
637 3300035170 Ga0373943_0195358 Ga0373943_0195358_325_717 127
638 3300035241 Ga0373961_0139904 Ga0373961_0139904_344_733 127
639 3300035398 Ga0316574_0113307 Ga0316574_0113307_925_1323 127
640 3300035691 Ga0373931_0091576 Ga0373931_0091576_303_692 127
641 3300035691 Ga0373931_0407118 Ga0373931_0407118_345_731 127
642 3300037068 Ga0373925_0251802 Ga0373925_0251802_636_1028 127
643 3300037312 Ga0395899_0113234 Ga0395899_0113234_521_913 127
644 3300037418 Ga0395900_0003892 Ga0395900_0003892_1024_1410 127
645 3300037418 Ga0395900_0214656 Ga0395900_0214656_946_1338 127
646 3300037418 Ga0395900_0227351 Ga0395900_0227351_390_776 127
647 3300037418 Ga0395900_0319619 Ga0395900_0319619_63_458 127
648 3300037418 Ga0395900_0406265 Ga0395900_0406265_240_635 127
649 3300037466 Ga0395898_0003289 Ga0395898_0003289_11048_11434 127
650 3300037466 Ga0395898_0013673 Ga0395898_0013673_2006_2398 127
651 3300037466 Ga0395898_0027694 Ga0395898_0027694_2637_3023 127
652 3300037466 Ga0395898_0769541 Ga0395898_0769541_364_759 127
653 3300037466 Ga0395898_1221621 Ga0395898_1221621_214_606 127
654 3300037466 Ga0395898_1916392 Ga0395898_1916392_108_494 127
655 3300037471 Ga0395905_0009566 Ga0395905_0009566_4557_4949 127
656 3300037471 Ga0395905_0157711 Ga0395905_0157711_354_740 127
657 3300037471 Ga0395905_0295161 Ga0395905_0295161_189_584 127
658 3300037471 Ga0395905_0443893 Ga0395905_0443893_453_845 127
659 3300037853 Ga0436364_0528708 Ga0436364_0528708_12350_12742 127
660 3300037853 Ga0436364_0994313 Ga0436364_0994313_16_408 127
661 3300037853 Ga0436364_1364766 Ga0436364_1364766_545_931 127
662 3300038443 Ga0395901_0010061 Ga0395901_0010061_5592_5984 127
663 3300038443 Ga0395901_0038792 Ga0395901_0038792_1509_1895 127
664 3300038443 Ga0395901_0424117 Ga0395901_0424117_471_863 127
665 3300038443 Ga0395901_0455313 Ga0395901_0455313_861_1256 127
666 3300038443 Ga0395901_0608243 Ga0395901_0608243_631_1026 127
667 3300038443 Ga0395901_0953274 Ga0395901_0953274_397_792 127
668 3300038443 Ga0395901_1096014 Ga0395901_1096014_173_568 127
669 3300038443 Ga0395901_1207160 Ga0395901_1207160_246_641 127
670 3300038443 Ga0395901_1296917 Ga0395901_1296917_133_519 127
671 3300038443 Ga0395901_1819612 Ga0395901_1819612_67_459 127
672 3300039437 Ga0436365_0279888 Ga0436365_0279888_269_655 127
673 3300039437 Ga0436365_0378539 Ga0436365_0378539_935_1321 127
674 3300039437 Ga0436365_0727247 Ga0436365_0727247_103_495 127
675 3300039437 Ga0436365_0952728 Ga0436365_0952728_127_513 127
676 3300039437 Ga0436365_1727618 Ga0436365_1727618_13618_14010 127
677 3300039437 Ga0436365_1868477 Ga0436365_1868477_2280_2666 127
678 3300039450 Ga0436363_1632579 Ga0436363_1632579_202_588 127
679 3300039453 Ga0436362_0308584 Ga0436362_0308584_168_557 127
680 3300039453 Ga0436362_0402256 Ga0436362_0402256_133_525 127
681 3300039453 Ga0436362_0527905 Ga0436362_0527905_1421_1813 127
682 3300041451 Ga0451791_0013117 Ga0451791_0013117_59_451 127
683 3300041453 Ga0451797_0368693 Ga0451797_0368693_76_471 127
684 3300041486 Ga0451807_2024780 Ga0451807_2024780_809_1204 127
685 3300041491 Ga0451833_0205188 Ga0451833_0205188_117_503 127
686 3300041498 Ga0451841_0618205 Ga0451841_0618205_458_850 127
687 3300041505 Ga0451849_0929619 Ga0451849_0929619_70_462 127
688 3300041512 Ga0451853_3135641 Ga0451853_3135641_93_479 127
689 3300042016 Ga0439463_040070 Ga0439463_040070_275_667 127
690 3300042439 Ga0439464_0047592 Ga0439464_0047592_455_847 127
691 3300042461 Ga0439460_0056377 Ga0439460_0056377_434_826 127
692 3300042993 Ga0439440_0162319 Ga0439440_0162319_97_492 127
693 3300044656 Ga0466969_0004458 Ga0466969_0004458_6179_6565 127
694 3300044656 Ga0466969_0063251 Ga0466969_0063251_990_1376 127
695 3300044658 Ga0466972_0034144 Ga0466972_0034144_1482_1868 127
696 3300044683 Ga0466965_0023873 Ga0466965_0023873_602_988 127
697 3300044683 Ga0466965_0091914 Ga0466965_0091914_1048_1434 127
698 3300044683 Ga0466965_0303241 Ga0466965_0303241_375_761 127
699 3300044684 Ga0466966_0190529 Ga0466966_0190529_524_910 127
700 3300044684 Ga0466966_0285915 Ga0466966_0285915_539_925 127
701 3300044684 Ga0466966_0379460 Ga0466966_0379460_371_757 127
702 3300044684 Ga0466966_0577026 Ga0466966_0577026_233_619 127
703 3300044693 Ga0466961_0028695 Ga0466961_0028695_249_635 127
704 3300044693 Ga0466961_0313052 Ga0466961_0313052_244_630 127
705 3300044693 Ga0466961_0324175 Ga0466961_0324175_161_547 127
706 3300044694 Ga0466963_0012064 Ga0466963_0012064_1467_1853 127
707 3300044694 Ga0466963_0184568 Ga0466963_0184568_176_562 127
708 3300044694 Ga0466963_0295351 Ga0466963_0295351_524_910 127
709 3300044694 Ga0466963_0311492 Ga0466963_0311492_434_820 127
710 3300044694 Ga0466963_0503093 Ga0466963_0503093_345_731 127
711 3300044706 Ga0466964_0017949 Ga0466964_0017949_1270_1662 127
712 3300044706 Ga0466964_0112139 Ga0466964_0112139_314_709 127
713 3300044706 Ga0466964_0460099 Ga0466964_0460099_110_496 127
714 3300044706 Ga0466964_0510164 Ga0466964_0510164_58_444 127
715 3300044719 Ga0466971_0404361 Ga0466971_0404361_251_637 127
716 3300044735 Ga0466968_0141625 Ga0466968_0141625_56_442 127
717 3300044765 Ga0466970_0070305 Ga0466970_0070305_248_634 127
718 3300044842 Ga0466957_0010702 Ga0466957_0010702_2896_3282 127
719 3300044842 Ga0466957_0800724 Ga0466957_0800724_59_445 127
720 3300044901 Ga0466960_0136623 Ga0466960_0136623_428_814 127
721 3300044901 Ga0466960_0372251 Ga0466960_0372251_328_714 127
722 3300045049 Ga0466959_0038186 Ga0466959_0038186_2413_2799 127
723 3300045049 Ga0466959_0042946 Ga0466959_0042946_2132_2518 127
724 3300045049 Ga0466959_0355042 Ga0466959_0355042_181_567 127
725 3300045049 Ga0466959_0476319 Ga0466959_0476319_394_780 127
726 3300045049 Ga0466959_0649468 Ga0466959_0649468_139_525 127
727 3300045836 Ga0466958_0025030 Ga0466958_0025030_1302_1688 127
728 3300045836 Ga0466958_0066323 Ga0466958_0066323_1345_1731 127
729 3300045836 Ga0466958_0077765 Ga0466958_0077765_65_451 127
730 3300045836 Ga0466958_0100358 Ga0466958_0100358_188_574 127
731 3300045836 Ga0466958_0136145 Ga0466958_0136145_427_813 127
732 3300045836 Ga0466958_0256961 Ga0466958_0256961_135_521 127
733 3300045976 Ga0466967_0015873 Ga0466967_0015873_4369_4764 127
734 3300045976 Ga0466967_0043106 Ga0466967_0043106_1889_2275 127
735 3300045976 Ga0466967_0051648 Ga0466967_0051648_131_517 127
736 3300045976 Ga0466967_0433195 Ga0466967_0433195_640_1038 127
737 3300045976 Ga0466967_0687452 Ga0466967_0687452_294_680 127
738 3300045976 Ga0466967_0692615 Ga0466967_0692615_48_434 127
739 3300045976 Ga0466967_0708487 Ga0466967_0708487_597_983 127
740 3300045976 Ga0466967_0737988 Ga0466967_0737988_287_673 127
741 3300045976 Ga0466967_2030475 Ga0466967_2030475_18_404 127
742 3300046455 Ga0495603_0117058 Ga0495603_0117058_352_744 127
743 3300046459 Ga0495629_0105496 Ga0495629_0105496_984_1376 127
744 3300046461 Ga0495641_0037914 Ga0495641_0037914_446_838 127
745 3300046474 Ga0495605_0388054 Ga0495605_0388054_98_493 127
746 3300046491 Ga0495584_0106485 Ga0495584_0106485_429_824 127
747 3300046492 Ga0495585_0482224 Ga0495585_0482224_65_460 127
748 3300046500 Ga0495596_0080713 Ga0495596_0080713_356_751 127
749 3300046500 Ga0495596_0288588 Ga0495596_0288588_53_442 127
750 3300046500 Ga0495596_0351091 Ga0495596_0351091_41_436 127
751 3300046511 Ga0495608_0000023 Ga0495608_0000023_33243_33638 127
752 3300046516 Ga0495628_0133196 Ga0495628_0133196_388_786 127
753 3300046518 Ga0495631_0356389 Ga0495631_0356389_182_577 127
754 3300046518 Ga0495631_0413850 Ga0495631_0413850_96_491 127
755 3300046615 Ga0495656_0159710 Ga0495656_0159710_591_986 127
756 3300046660 Ga0495625_0250896 Ga0495625_0250896_412_804 127
757 3300046674 Ga0495588_0336136 Ga0495588_0336136_291_683 127
758 3300046675 Ga0495657_0000020 Ga0495657_0000020_33243_33638 127
759 3300046683 Ga0495658_0215131 Ga0495658_0215131_577_969 127
760 3300046689 Ga0495613_0000251 Ga0495613_0000251_15197_15586 127
761 3300046690 Ga0495624_0376867 Ga0495624_0376867_301_693 127
762 3300046794 Ga0495589_0336337 Ga0495589_0336337_148_543 127
763 3300047317 Ga0495604_0000158 Ga0495604_0000158_8762_9181 127
764 3300047444 Ga0495675_0000561 Ga0495675_0000561_15585_15980 127
765 3300047673 Ga0495593_0247261 Ga0495593_0247261_292_684 127
766 3300047673 Ga0495593_0618296 Ga0495593_0618296_83_478 127
767 3300048903 Ga0496100_0100042 Ga0496100_0100042_1504_1890 127
768 3300048903 Ga0496100_0179279 Ga0496100_0179279_903_1295 127
769 3300048903 Ga0496100_0187151 Ga0496100_0187151_65_451 127
770 3300048903 Ga0496100_0541474 Ga0496100_0541474_312_704 127
771 3300048904 Ga0496101_0041686 Ga0496101_0041686_1360_1746 127
772 3300048904 Ga0496101_0044046 Ga0496101_0044046_1638_2030 127
773 3300048904 Ga0496101_0065871 Ga0496101_0065871_1755_2141 127
774 3300048905 Ga0496102_0003095 Ga0496102_0003095_1769_2161 127
775 3300048905 Ga0496102_0503376 Ga0496102_0503376_73_459 127
776 3300048905 Ga0496102_0976998 Ga0496102_0976998_79_471 127
777 3300048905 Ga0496102_1080381 Ga0496102_1080381_38_433 127
778 3300048905 Ga0496102_1457173 Ga0496102_1457173_202_588 127
779 3300048906 Ga0496103_0022041 Ga0496103_0022041_663_1049 127
780 3300048906 Ga0496103_0030924 Ga0496103_0030924_1941_2333 127
781 3300048907 Ga0496104_0012412 Ga0496104_0012412_1708_2094 127
782 3300048907 Ga0496104_0021418 Ga0496104_0021418_5275_5667 127
783 3300048907 Ga0496104_0075754 Ga0496104_0075754_2065_2454 127
784 3300048907 Ga0496104_0259428 Ga0496104_0259428_555_941 127
785 3300048907 Ga0496104_1767976 Ga0496104_1767976_50_436 127
786 3300048908 Ga0496105_0070815 Ga0496105_0070815_358_750 127
787 3300048908 Ga0496105_0154886 Ga0496105_0154886_526_912 127
788 3300048908 Ga0496105_0353859 Ga0496105_0353859_752_1138 127
789 3300048908 Ga0496105_0778513 Ga0496105_0778513_167_559 127
790 3300048909 Ga0496106_0006523 Ga0496106_0006523_3073_3465 127
791 3300048909 Ga0496106_0036277 Ga0496106_0036277_3228_3620 127
792 3300048910 Ga0496107_0042362 Ga0496107_0042362_42_434 127
793 3300048910 Ga0496107_0050430 Ga0496107_0050430_1446_1838 127
794 3300048910 Ga0496107_0159475 Ga0496107_0159475_141_527 127
795 3300048910 Ga0496107_0276299 Ga0496107_0276299_16_408 127
796 3300048910 Ga0496107_0574043 Ga0496107_0574043_233_625 127
797 3300048910 Ga0496107_0588607 Ga0496107_0588607_191_586 127
798 3300048910 Ga0496107_0637477 Ga0496107_0637477_263_658 127
799 3300048911 Ga0496108_0004449 Ga0496108_0004449_7602_7994 127
800 3300048911 Ga0496108_0024711 Ga0496108_0024711_4123_4512 127
801 3300048911 Ga0496108_0046338 Ga0496108_0046338_2402_2794 127
802 3300048911 Ga0496108_0176298 Ga0496108_0176298_445_831 127
803 3300048911 Ga0496108_0214434 Ga0496108_0214434_1230_1616 127
804 3300048911 Ga0496108_0775168 Ga0496108_0775168_40_441 127
805 3300048911 Ga0496108_0969796 Ga0496108_0969796_89_484 127
806 3300048912 Ga0496109_0000075 Ga0496109_0000075_15194_15583 127
807 3300048912 Ga0496109_0003244 Ga0496109_0003244_10867_11259 127
808 3300048912 Ga0496109_0012257 Ga0496109_0012257_5626_6012 127
809 3300048912 Ga0496109_0014690 Ga0496109_0014690_6358_6744 127
810 3300048912 Ga0496109_0577518 Ga0496109_0577518_49_441 127
811 3300048912 Ga0496109_0649710 Ga0496109_0649710_449_844 127
812 3300048912 Ga0496109_0660889 Ga0496109_0660889_11_397 127
813 3300048912 Ga0496109_0708155 Ga0496109_0708155_399_800 127
814 3300048912 Ga0496109_1213058 Ga0496109_1213058_155_550 127
815 3300048912 Ga0496109_1257147 Ga0496109_1257147_230_619 127
816 3300048912 Ga0496109_1618315 Ga0496109_1618315_31_423 127
817 3300048912 Ga0496109_1783984 Ga0496109_1783984_119_505 127
818 3300048913 Ga0496110_0062927 Ga0496110_0062927_2449_2841 127
819 3300048913 Ga0496110_0072468 Ga0496110_0072468_1420_1821 127
820 3300048913 Ga0496110_0269852 Ga0496110_0269852_688_1080 127
821 3300048913 Ga0496110_0475352 Ga0496110_0475352_424_819 127
822 3300048913 Ga0496110_0482394 Ga0496110_0482394_307_693 127
823 3300048913 Ga0496110_1794422 Ga0496110_1794422_98_484 127
824 3300048914 Ga0496111_0027123 Ga0496111_0027123_2316_2708 127
825 3300048914 Ga0496111_0214719 Ga0496111_0214719_330_716 127
826 3300048915 Ga0496112_0000013 Ga0496112_0000013_235588_235980 127
827 3300048915 Ga0496112_0024384 Ga0496112_0024384_5282_5668 127
828 3300048915 Ga0496112_0202224 Ga0496112_0202224_780_1166 127
829 3300048915 Ga0496112_0233867 Ga0496112_0233867_1211_1612 127
830 3300048915 Ga0496112_0347291 Ga0496112_0347291_1020_1412 127
831 3300048915 Ga0496112_0372740 Ga0496112_0372740_622_1017 127
832 3300048916 Ga0496113_0026775 Ga0496113_0026775_3205_3597 127
833 3300048916 Ga0496113_0037782 Ga0496113_0037782_251_637 127
834 3300048916 Ga0496113_0071478 Ga0496113_0071478_189_590 127
835 3300048916 Ga0496113_0546862 Ga0496113_0546862_85_474 127
836 3300048917 Ga0496114_0021547 Ga0496114_0021547_1647_2039 127
837 3300048917 Ga0496114_0122625 Ga0496114_0122625_1325_1711 127
838 3300048917 Ga0496114_0377166 Ga0496114_0377166_654_1040 127
839 3300048918 Ga0496115_0216447 Ga0496115_0216447_255_641 127
840 3300049568 Ga0501031_0291316 Ga0501031_0291316_19_414 127
841 3300049568 Ga0501031_0895057 Ga0501031_0895057_85_468 127
842 3300049570 Ga0501033_0373905 Ga0501033_0373905_130_528 127
843 3300049572 Ga0501036_0651252 Ga0501036_0651252_86_484 127
844 3300049572 Ga0501036_1674400 Ga0501036_1674400_66_455 127
845 3300049574 Ga0501038_0443030 Ga0501038_0443030_496_894 127
846 3300049575 Ga0501039_0171504 Ga0501039_0171504_260_652 127
847 3300049575 Ga0501039_0323562 Ga0501039_0323562_507_902 127
848 3300049576 Ga0501040_0023006 Ga0501040_0023006_933_1328 127
849 3300049576 Ga0501040_0085543 Ga0501040_0085543_776_1168 127
850 3300049576 Ga0501040_0528064 Ga0501040_0528064_203_601 127
851 3300049577 Ga0501041_0021960 Ga0501041_0021960_357_755 127
852 3300049577 Ga0501041_0149692 Ga0501041_0149692_627_1022 127
853 3300049578 Ga0501042_0191243 Ga0501042_0191243_860_1258 127
854 3300049578 Ga0501042_0331440 Ga0501042_0331440_12_404 127
855 3300049580 Ga0501046_0369590 Ga0501046_0369590_477_872 127
856 3300049580 Ga0501046_0421466 Ga0501046_0421466_439_831 127
857 3300049582 Ga0501048_0041902 Ga0501048_0041902_332_730 127
858 3300049582 Ga0501048_0289431 Ga0501048_0289431_687_1079 127
859 3300049583 Ga0501067_0175878 Ga0501067_0175878_735_1121 127
860 3300049585 Ga0501069_0470778 Ga0501069_0470778_148_546 127
861 3300049587 Ga0501071_0026554 Ga0501071_0026554_1023_1421 127
862 3300049587 Ga0501071_0069904 Ga0501071_0069904_1341_1733 127
863 3300049587 Ga0501071_0121517 Ga0501071_0121517_1073_1471 127
864 3300049587 Ga0501071_0321901 Ga0501071_0321901_85_480 127
865 3300049588 Ga0501072_0019744 Ga0501072_0019744_1064_1462 127
866 3300049588 Ga0501072_0057878 Ga0501072_0057878_2462_2857 127
867 3300049588 Ga0501072_0147308 Ga0501072_0147308_464_856 127
868 3300049588 Ga0501072_0377024 Ga0501072_0377024_655_1047 127
869 3300049588 Ga0501072_1130225 Ga0501072_1130225_15_407 127
870 3300049590 Ga0501074_0303848 Ga0501074_0303848_160_558 127
871 3300049590 Ga0501074_0494255 Ga0501074_0494255_183_578 127
872 3300049591 Ga0501075_0029679 Ga0501075_0029679_374_772 127
873 3300049591 Ga0501075_0038581 Ga0501075_0038581_1052_1444 127
874 3300049591 Ga0501075_0073939 Ga0501075_0073939_350_748 127
875 3300049591 Ga0501075_0643588 Ga0501075_0643588_304_696 127
876 3300049592 Ga0501076_0031553 Ga0501076_0031553_1733_2128 127
877 3300049592 Ga0501076_0036078 Ga0501076_0036078_1359_1757 127
878 3300049592 Ga0501076_0179253 Ga0501076_0179253_255_647 127
879 3300049592 Ga0501076_0265097 Ga0501076_0265097_1007_1393 127
880 3300049592 Ga0501076_0525250 Ga0501076_0525250_543_938 127
881 3300049593 Ga0501077_0358088 Ga0501077_0358088_443_841 127
882 3300049593 Ga0501077_0397261 Ga0501077_0397261_370_768 127
883 3300049663 Ga0501223_074980 Ga0501223_074980_99_488 127
884 3300049665 Ga0501227_184058 Ga0501227_184058_116_505 127
885 3300049669 Ga0501235_191922 Ga0501235_191922_66_461 127
886 3300049688 Ga0501259_013667 Ga0501259_013667_171_560 127
887 3300049741 Ga0501079_0225345 Ga0501079_0225345_602_1000 127
888 3300049741 Ga0501079_0437106 Ga0501079_0437106_305_703 127
889 3300049743 Ga0501081_0002804 Ga0501081_0002804_9596_9994 127
890 3300049743 Ga0501081_0264230 Ga0501081_0264230_144_539 127
891 3300049743 Ga0501081_0362245 Ga0501081_0362245_400_807 127
892 3300049744 Ga0501083_0482690 Ga0501083_0482690_323_721 127
893 3300049770 Ga0501273_087628 Ga0501273_087628_96_506 127
894 3300049822 Ga0501035_0291652 Ga0501035_0291652_654_1049 127
895 3300049822 Ga0501035_0637531 Ga0501035_0637531_405_803 127
896 3300049822 Ga0501035_1195217 Ga0501035_1195217_152_544 127
897 3300049824 Ga0501045_0060924 Ga0501045_0060924_1343_1741 127
898 3300049824 Ga0501045_0538672 Ga0501045_0538672_406_801 127
899 3300050490 nmdc:mga03n38_290846_c1 nmdc:mga03n38_290846_c1_440_829 127
900 3300050490 nmdc:mga03n38_44508_c1 nmdc:mga03n38_44508_c1_18_410 127
901 3300050491 nmdc:mga00v17_33154_c1 nmdc:mga00v17_33154_c1_1693_2085 127
902 3300050491 nmdc:mga00v17_7459_c1 nmdc:mga00v17_7459_c1_2348_2740 127
903 3300050491 nmdc:mga00v17_74686_c1 nmdc:mga00v17_74686_c1_1386_1778 127
904 3300050492 nmdc:mga0yw44_2119_c1 nmdc:mga0yw44_2119_c1_7529_7921 127
905 3300050492 nmdc:mga0yw44_39020_c1 nmdc:mga0yw44_39020_c1_2226_2618 127
906 3300050492 nmdc:mga0yw44_47850_c2 nmdc:mga0yw44_47850_c2_131_520 127
907 3300050492 nmdc:mga0yw44_619864_c1 nmdc:mga0yw44_619864_c1_59_457 127
908 3300050494 nmdc:mga06z11_1035300_c1 nmdc:mga06z11_1035300_c1_98_484 127
909 3300050494 nmdc:mga06z11_435155_c1 nmdc:mga06z11_435155_c1_269_661 127
910 3300050494 nmdc:mga06z11_679730_c1 nmdc:mga06z11_679730_c1_221_613 127
911 3300050507 nmdc:mga05p37_14788_c1 nmdc:mga05p37_14788_c1_6277_6675 127
912 3300050507 nmdc:mga05p37_148787_c1 nmdc:mga05p37_148787_c1_2058_2453 127
913 3300050507 nmdc:mga05p37_169778_c1 nmdc:mga05p37_169778_c1_2189_2578 127
914 3300050507 nmdc:mga05p37_172958_c1 nmdc:mga05p37_172958_c1_1089_1484 127
915 3300050507 nmdc:mga05p37_343537_c1 nmdc:mga05p37_343537_c1_912_1304 127
916 3300050507 nmdc:mga05p37_4564_c1 nmdc:mga05p37_4564_c1_10666_11061 127
917 3300050507 nmdc:mga05p37_559193_c1 nmdc:mga05p37_559193_c1_236_646 127
918 3300050508 nmdc:mga09592_144042_c1 nmdc:mga09592_144042_c1_1399_1788 127
919 3300050508 nmdc:mga09592_185824_c1 nmdc:mga09592_185824_c1_958_1353 127
920 3300050508 nmdc:mga09592_19018_c1 nmdc:mga09592_19018_c1_457_849 127
921 3300050508 nmdc:mga09592_443722_c1 nmdc:mga09592_443722_c1_236_631 127
922 3300050508 nmdc:mga09592_992034_c1 nmdc:mga09592_992034_c1_57_452 127
923 3300050509 nmdc:mga0qj67_127541_c1 nmdc:mga0qj67_127541_c1_1308_1703 127
924 3300050509 nmdc:mga0qj67_27450_c1 nmdc:mga0qj67_27450_c1_2303_2695 127
925 3300050510 nmdc:mga06r32_219728_c1 nmdc:mga06r32_219728_c1_846_1238 127
926 3300050510 nmdc:mga06r32_253554_c1 nmdc:mga06r32_253554_c1_167_556 127
927 3300050510 nmdc:mga06r32_25649_c1 nmdc:mga06r32_25649_c1_4790_5182 127
928 3300050510 nmdc:mga06r32_286483_c1 nmdc:mga06r32_286483_c1_433_828 127
929 3300050510 nmdc:mga06r32_558464_c1 nmdc:mga06r32_558464_c1_583_981 127
930 3300050511 nmdc:mga08y16_1232607_c1 nmdc:mga08y16_1232607_c1_76_474 127
931 3300050511 nmdc:mga08y16_1254734_c1 nmdc:mga08y16_1254734_c1_86_472 127
932 3300050511 nmdc:mga08y16_18190_c1 nmdc:mga08y16_18190_c1_4154_4549 127
933 3300050511 nmdc:mga08y16_288085_c1 nmdc:mga08y16_288085_c1_934_1329 127
934 3300050511 nmdc:mga08y16_353532_c1 nmdc:mga08y16_353532_c1_725_1120 127
935 3300050511 nmdc:mga08y16_47862_c1 nmdc:mga08y16_47862_c1_1947_2342 127
936 3300050511 nmdc:mga08y16_493031_c1 nmdc:mga08y16_493031_c1_289_678 127
937 3300050511 nmdc:mga08y16_498894_c1 nmdc:mga08y16_498894_c1_541_951 127
938 3300050511 nmdc:mga08y16_533875_c1 nmdc:mga08y16_533875_c1_592_984 127
939 3300050511 nmdc:mga08y16_58425_c1 nmdc:mga08y16_58425_c1_1349_1738 127
940 3300050512 nmdc:mga0n895_1048682_c1 nmdc:mga0n895_1048682_c1_242_637 127
941 3300050512 nmdc:mga0n895_166491_c1 nmdc:mga0n895_166491_c1_919_1314 127
942 3300050512 nmdc:mga0n895_1940942_c1 nmdc:mga0n895_1940942_c1_93_479 127
943 3300050512 nmdc:mga0n895_1974714_c1 nmdc:mga0n895_1974714_c1_96_482 127
944 3300050512 nmdc:mga0n895_2231470_c1 nmdc:mga0n895_2231470_c1_13_408 127
945 3300050512 nmdc:mga0n895_561078_c1 nmdc:mga0n895_561078_c1_162_548 127
946 3300050513 nmdc:mga0rr50_598822_c1 nmdc:mga0rr50_598822_c1_447_842 127
947 3300050514 nmdc:mga08x19_407988_c1 nmdc:mga08x19_407988_c1_278_673 127
948 3300050515 nmdc:mga0a205_154858_c1 nmdc:mga0a205_154858_c1_754_1140 127
949 3300050515 nmdc:mga0a205_214067_c1 nmdc:mga0a205_214067_c1_998_1387 127
950 3300050515 nmdc:mga0a205_78610_c1 nmdc:mga0a205_78610_c1_979_1374 127
951 3300053078 Ga0495612_0000022 Ga0495612_0000022_77873_78271 127
952 3300053083 Ga0495655_0101842 Ga0495655_0101842_130_525 127
953 3300053083 Ga0495655_0215508 Ga0495655_0215508_82_468 127
954 3300053084 Ga0495595_0000022 Ga0495595_0000022_76961_77356 127
955 3300053085 Ga0495619_0000070 Ga0495619_0000070_76900_77295 127
956 3300053153 Ga0500616_0004292 Ga0500616_0004292_7154_7540 127
957 3300054114 Ga0501084_0418861 Ga0501084_0418861_312_710 127
958 3300054114 Ga0501084_1051000 Ga0501084_1051000_229_621 127
959 3300059424 Ga0590075_094382 Ga0590075_094382_192_587 127
960 3300059491 Ga0587070_145090 Ga0587070_145090_100_486 127
961 3300059492 Ga0587073_0109275 Ga0587073_0109275_334_720 127
962 3300059640 Ga0587067_126318 Ga0587067_126318_144_530 127
963 3300059655 Ga0587114_104150 Ga0587114_104150_80_466 127
964 3300060353 Ga0501082_0006969 Ga0501082_0006969_7370_7768 127
965 3300060353 Ga0501082_0130106 Ga0501082_0130106_722_1120 127
966 3300060353 Ga0501082_0185504 Ga0501082_0185504_53_448 127
967 3300061719 Ga0466962_0010743 Ga0466962_0010743_2724_3110 127
968 3300061719 Ga0466962_0077598 Ga0466962_0077598_14_400 127
969 3300061719 Ga0466962_0121791 Ga0466962_0121791_281_667 127
970 3300061734 Ga0530510_0005169 Ga0530510_0005169_6102_6500 127
971 3300061734 Ga0530510_0061101 Ga0530510_0061101_700_1098 127
972 3300061734 Ga0530510_0622348 Ga0530510_0622348_283_675 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

16

135

0.97

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

53

97

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9952 4 124
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9857 9 126
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9789 9 125
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9782 4 126
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9736 4 126
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9849 9 126 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9847 9 125 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9799 39 126 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9688 9 127 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9571 22 127 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A534S1C2-F1-model_v4 Glycine cleavage system H protein 0.9988 10 126 GO:0005829
GO:0005960
GO:0019464
AF-A0A314YSG0-F1-model_v4 Pentatricopeptide repeat-containing protein 0.9986 1 126 GO:0005739
GO:0005960
GO:0019464
AF-A0A6A5LLD4-F1-model_v4 deleted 0.9976 6 125
AF-A0A067GPV7-F1-model_v4 Glycine cleavage system H protein 0.9975 6 126 GO:0005739
GO:0005960
GO:0019464
AF-A0A498IWY7-F1-model_v4 Lipoyl-binding domain-containing protein 0.9975 6 125 GO:0005739
GO:0005960
GO:0006511
GO:0019464
GO:0019773

Feature Viewer

pLDDT pTM Quality
95.11 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map