F487140
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 359 | 972 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300005545|Ga0070695_100059102|Ga0070695_1000591022 |
| Length | 137 |
| Sequence | VSALAETAPETYPENLLYHPEHDWARIDGDEATFGITWYAQDSLGEVVFFDPPEIGASVSANQSYAEVESVKAVSDVIAPLSGEVTAINEAVSETPELINEDPYEAGWLVKVRLTNAGETDSLLDAATYKAQLELGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 244 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 245 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 250 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 325 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 353 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 359 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 1.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.78 |
| Nodule | 0 |
| Rhizoplane | 8.33 |
| Rhizosphere | 86.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1003359 | 3300000549 | Bacteria | 2152 |
| 2 | JGI24739J22299_10190972 | 3300001989 | Bacteria | 602 |
| 3 | JGI24737J22298_10161390 | 3300001990 | Bacteria | 662 |
| 4 | JGI24743J22301_10016082 | 3300001991 | Bacteria | 1393 |
| 5 | JGI24743J22301_10028122 | 3300001991 | Bacteria | 1100 |
| 6 | JGI24738J21930_10126562 | 3300002075 | Bacteria | 557 |
| 7 | JGI24738J21930_10136050 | 3300002075 | Bacteria | 540 |
| 8 | JGI25407J50210_10003345 | 3300003373 | Bacteria | 3823 |
| 9 | JGI25407J50210_10003751 | 3300003373 | Bacteria | 3666 |
| 10 | JGI25407J50210_10004139 | 3300003373 | Bacteria | 3524 |
| 11 | JGI25407J50210_10045251 | 3300003373 | Bacteria | 1122 |
| 12 | JGI25404J52841_10062149 | 3300003659 | Bacteria | 782 |
| 13 | Ga0058859_11783415 | 3300004798 | Bacteria | 814 |
| 14 | Ga0070658_10042224 | 3300005327 | Bacteria | 3682 |
| 15 | Ga0070676_10107599 | 3300005328 | Bacteria | 1732 |
| 16 | Ga0070676_10357116 | 3300005328 | Unclassified | 1006 |
| 17 | Ga0070683_100048461 | 3300005329 | Bacteria | 3928 |
| 18 | Ga0070690_100182193 | 3300005330 | Bacteria | 1452 |
| 19 | Ga0070690_100946660 | 3300005330 | Bacteria | 676 |
| 20 | Ga0070670_101115124 | 3300005331 | Bacteria | 720 |
| 21 | Ga0068869_100280359 | 3300005334 | Bacteria | 1340 |
| 22 | Ga0070680_100329012 | 3300005336 | Bacteria | 1298 |
| 23 | Ga0070680_101177259 | 3300005336 | Bacteria | 663 |
| 24 | Ga0070682_100013260 | 3300005337 | Bacteria | 4739 |
| 25 | Ga0070682_100034008 | 3300005337 | Bacteria | 3100 |
| 26 | Ga0070682_100188878 | 3300005337 | Bacteria | 1445 |
| 27 | Ga0070682_100926414 | 3300005337 | Bacteria | 718 |
| 28 | Ga0068868_100000026 | 3300005338 | Bacteria | 81980 |
| 29 | Ga0068868_100013771 | 3300005338 | Bacteria | 5943 |
| 30 | Ga0068868_100022497 | 3300005338 | Bacteria | 4758 |
| 31 | Ga0068868_102147364 | 3300005338 | Bacteria | 531 |
| 32 | Ga0070660_100009834 | 3300005339 | Bacteria | 6743 |
| 33 | Ga0070660_100124433 | 3300005339 | Bacteria | 2060 |
| 34 | Ga0070660_100725733 | 3300005339 | Bacteria | 834 |
| 35 | Ga0070660_100772940 | 3300005339 | Bacteria | 807 |
| 36 | Ga0070689_100110622 | 3300005340 | Bacteria | 2184 |
| 37 | Ga0070691_10025637 | 3300005341 | Bacteria | 2746 |
| 38 | Ga0070691_10373969 | 3300005341 | Bacteria | 797 |
| 39 | Ga0070691_10483193 | 3300005341 | Bacteria | 713 |
| 40 | Ga0070691_10524802 | 3300005341 | Bacteria | 688 |
| 41 | Ga0070687_100101359 | 3300005343 | Bacteria | 1612 |
| 42 | Ga0070661_100133458 | 3300005344 | Bacteria | 1866 |
| 43 | Ga0070661_100837222 | 3300005344 | Bacteria | 756 |
| 44 | Ga0070692_10018760 | 3300005345 | Bacteria | 3331 |
| 45 | Ga0070692_10034290 | 3300005345 | Bacteria | 2563 |
| 46 | Ga0070692_10080362 | 3300005345 | Bacteria | 1755 |
| 47 | Ga0070668_100024328 | 3300005347 | Bacteria | 4587 |
| 48 | Ga0070668_100160546 | 3300005347 | Bacteria | 1823 |
| 49 | Ga0070668_100531729 | 3300005347 | Bacteria | 1021 |
| 50 | Ga0070669_100375280 | 3300005353 | Bacteria | 1159 |
| 51 | Ga0070675_100168821 | 3300005354 | Bacteria | 1886 |
| 52 | Ga0070671_100080735 | 3300005355 | Bacteria | 2719 |
| 53 | Ga0070674_100094652 | 3300005356 | Bacteria | 2164 |
| 54 | Ga0070674_100200525 | 3300005356 | Bacteria | 1541 |
| 55 | Ga0070674_100287818 | 3300005356 | Bacteria | 1305 |
| 56 | Ga0070674_101434100 | 3300005356 | Bacteria | 619 |
| 57 | Ga0070673_100774118 | 3300005364 | Bacteria | 885 |
| 58 | Ga0070688_100001123 | 3300005365 | Bacteria | 13401 |
| 59 | Ga0070688_100081740 | 3300005365 | Bacteria | 2093 |
| 60 | Ga0070688_100136059 | 3300005365 | Bacteria | 1663 |
| 61 | Ga0070659_100000450 | 3300005366 | Bacteria | 30693 |
| 62 | Ga0070659_100041398 | 3300005366 | Bacteria | 3601 |
| 63 | Ga0070659_100070835 | 3300005366 | Bacteria | 2771 |
| 64 | Ga0070667_101356301 | 3300005367 | Bacteria | 667 |
| 65 | Ga0070703_10062472 | 3300005406 | Bacteria | 1222 |
| 66 | Ga0070709_10865915 | 3300005434 | Bacteria | 713 |
| 67 | Ga0070714_101535027 | 3300005435 | Bacteria | 651 |
| 68 | Ga0070713_100000079 | 3300005436 | Bacteria | 60238 |
| 69 | Ga0070710_10149835 | 3300005437 | Bacteria | 1438 |
| 70 | Ga0070710_10203644 | 3300005437 | Bacteria | 1251 |
| 71 | Ga0070701_10317038 | 3300005438 | Bacteria | 963 |
| 72 | Ga0070701_10383125 | 3300005438 | Bacteria | 887 |
| 73 | Ga0070701_10699009 | 3300005438 | Bacteria | 682 |
| 74 | Ga0070711_100000497 | 3300005439 | Bacteria | 20499 |
| 75 | Ga0070711_100077432 | 3300005439 | Bacteria | 2360 |
| 76 | Ga0070711_100079258 | 3300005439 | Bacteria | 2335 |
| 77 | Ga0070711_100160723 | 3300005439 | Bacteria | 1703 |
| 78 | Ga0070711_100202219 | 3300005439 | Bacteria | 1534 |
| 79 | Ga0070705_100023460 | 3300005440 | Bacteria | 3314 |
| 80 | Ga0070700_100003638 | 3300005441 | Bacteria | 7977 |
| 81 | Ga0070700_100020787 | 3300005441 | Bacteria | 3809 |
| 82 | Ga0070700_100127548 | 3300005441 | Bacteria | 1712 |
| 83 | Ga0070700_100377555 | 3300005441 | Bacteria | 1059 |
| 84 | Ga0070700_100589910 | 3300005441 | Bacteria | 869 |
| 85 | Ga0070694_100541763 | 3300005444 | Bacteria | 931 |
| 86 | Ga0070694_101250540 | 3300005444 | Bacteria | 623 |
| 87 | Ga0070708_100000127 | 3300005445 | Bacteria | 51711 |
| 88 | Ga0070708_100358285 | 3300005445 | Bacteria | 1375 |
| 89 | Ga0070708_101208313 | 3300005445 | Bacteria | 707 |
| 90 | Ga0070663_100000104 | 3300005455 | Bacteria | 38955 |
| 91 | Ga0070678_100408872 | 3300005456 | Bacteria | 1181 |
| 92 | Ga0070678_100609457 | 3300005456 | Bacteria | 976 |
| 93 | Ga0070678_101546318 | 3300005456 | Bacteria | 622 |
| 94 | Ga0070662_100000009 | 3300005457 | Bacteria | 142979 |
| 95 | Ga0070662_100009106 | 3300005457 | Bacteria | 6481 |
| 96 | Ga0070662_100042278 | 3300005457 | Bacteria | 3255 |
| 97 | Ga0070662_100201190 | 3300005457 | Bacteria | 1581 |
| 98 | Ga0070662_100494912 | 3300005457 | Bacteria | 1019 |
| 99 | Ga0070681_10091087 | 3300005458 | Bacteria | 3000 |
| 100 | Ga0070681_10257061 | 3300005458 | Bacteria | 1659 |
| 101 | Ga0070681_10381672 | 3300005458 | Bacteria | 1320 |
| 102 | Ga0068867_100024074 | 3300005459 | Bacteria | 4363 |
| 103 | Ga0068867_101990744 | 3300005459 | Unclassified | 549 |
| 104 | Ga0070685_10000024 | 3300005466 | Bacteria | 101602 |
| 105 | Ga0070685_10143701 | 3300005466 | Bacteria | 1505 |
| 106 | Ga0070706_100001206 | 3300005467 | Bacteria | 27672 |
| 107 | Ga0070706_100372284 | 3300005467 | Bacteria | 1331 |
| 108 | Ga0070707_100008434 | 3300005468 | Bacteria | 9574 |
| 109 | Ga0070707_100204336 | 3300005468 | Bacteria | 1925 |
| 110 | Ga0070698_100376632 | 3300005471 | Bacteria | 1352 |
| 111 | Ga0070699_100020245 | 3300005518 | Bacteria | 5736 |
| 112 | Ga0070679_100000430 | 3300005530 | Bacteria | 35674 |
| 113 | Ga0070679_100687407 | 3300005530 | Bacteria | 966 |
| 114 | Ga0070679_100953340 | 3300005530 | Bacteria | 802 |
| 115 | Ga0070679_101228673 | 3300005530 | Bacteria | 695 |
| 116 | Ga0070679_102211790 | 3300005530 | Bacteria | 500 |
| 117 | Ga0070684_100087171 | 3300005535 | Bacteria | 2771 |
| 118 | Ga0070684_100216932 | 3300005535 | Bacteria | 1745 |
| 119 | Ga0070684_100461992 | 3300005535 | Bacteria | 1174 |
| 120 | Ga0070684_100669392 | 3300005535 | Bacteria | 967 |
| 121 | Ga0070684_100980860 | 3300005535 | Bacteria | 793 |
| 122 | Ga0070684_102287748 | 3300005535 | Bacteria | 510 |
| 123 | Ga0070697_100000319 | 3300005536 | Bacteria | 38314 |
| 124 | Ga0068853_100040106 | 3300005539 | Bacteria | 3994 |
| 125 | Ga0068853_100377823 | 3300005539 | Bacteria | 1323 |
| 126 | Ga0070672_100000283 | 3300005543 | Bacteria | 28861 |
| 127 | Ga0070672_100013241 | 3300005543 | Bacteria | 5818 |
| 128 | Ga0070672_100241345 | 3300005543 | Bacteria | 1520 |
| 129 | Ga0070686_100013194 | 3300005544 | Bacteria | 4723 |
| 130 | Ga0070686_100021678 | 3300005544 | Bacteria | 3824 |
| 131 | Ga0070686_100141046 | 3300005544 | Bacteria | 1678 |
| 132 | Ga0070695_100059102 | 3300005545 | Bacteria | 2481 |
| 133 | Ga0070695_100167672 | 3300005545 | Bacteria | 1547 |
| 134 | Ga0070696_100122276 | 3300005546 | Bacteria | 1885 |
| 135 | Ga0070696_100193139 | 3300005546 | Bacteria | 1516 |
| 136 | Ga0070696_100700187 | 3300005546 | Bacteria | 826 |
| 137 | Ga0070696_101267759 | 3300005546 | Bacteria | 625 |
| 138 | Ga0070693_100070471 | 3300005547 | Bacteria | 2057 |
| 139 | Ga0070693_100383924 | 3300005547 | Bacteria | 970 |
| 140 | Ga0070665_100895640 | 3300005548 | Bacteria | 900 |
| 141 | Ga0070704_100028087 | 3300005549 | Bacteria | 3738 |
| 142 | Ga0070704_100158818 | 3300005549 | Bacteria | 1786 |
| 143 | Ga0070704_100562242 | 3300005549 | Bacteria | 998 |
| 144 | Ga0070704_100638654 | 3300005549 | Bacteria | 939 |
| 145 | Ga0070704_100733410 | 3300005549 | Bacteria | 879 |
| 146 | Ga0070704_101688469 | 3300005549 | Unclassified | 585 |
| 147 | Ga0068855_100655702 | 3300005563 | Bacteria | 1127 |
| 148 | Ga0070664_100028067 | 3300005564 | Bacteria | 4680 |
| 149 | Ga0068857_100116289 | 3300005577 | Bacteria | 2406 |
| 150 | Ga0068857_100761189 | 3300005577 | Bacteria | 923 |
| 151 | Ga0068857_101572630 | 3300005577 | Bacteria | 642 |
| 152 | Ga0068854_100023641 | 3300005578 | Bacteria | 4199 |
| 153 | Ga0068854_100048335 | 3300005578 | Bacteria | 3035 |
| 154 | Ga0068854_100221019 | 3300005578 | Bacteria | 1499 |
| 155 | Ga0068854_100569150 | 3300005578 | Bacteria | 963 |
| 156 | Ga0068854_100738626 | 3300005578 | Bacteria | 853 |
| 157 | Ga0068854_101151364 | 3300005578 | Bacteria | 693 |
| 158 | Ga0068856_100054015 | 3300005614 | Bacteria | 3962 |
| 159 | Ga0068856_100100076 | 3300005614 | Bacteria | 2891 |
| 160 | Ga0068856_101203770 | 3300005614 | Bacteria | 774 |
| 161 | Ga0068856_101258188 | 3300005614 | Bacteria | 756 |
| 162 | Ga0070702_100016651 | 3300005615 | Bacteria | 3775 |
| 163 | Ga0070702_100095410 | 3300005615 | Bacteria | 1813 |
| 164 | Ga0070702_100100128 | 3300005615 | Bacteria | 1776 |
| 165 | Ga0068852_100066720 | 3300005616 | Bacteria | 3143 |
| 166 | Ga0068852_100271139 | 3300005616 | Bacteria | 1633 |
| 167 | Ga0068859_100028788 | 3300005617 | Bacteria | 5570 |
| 168 | Ga0068864_100363890 | 3300005618 | Bacteria | 1367 |
| 169 | Ga0068864_100514728 | 3300005618 | Bacteria | 1153 |
| 170 | Ga0068864_101214852 | 3300005618 | Bacteria | 753 |
| 171 | Ga0068866_10205505 | 3300005718 | Bacteria | 1179 |
| 172 | Ga0068866_10219342 | 3300005718 | Bacteria | 1147 |
| 173 | Ga0068861_100011706 | 3300005719 | Bacteria | 6105 |
| 174 | Ga0068861_100174527 | 3300005719 | Bacteria | 1784 |
| 175 | Ga0068861_100213684 | 3300005719 | Bacteria | 1626 |
| 176 | Ga0068861_100957270 | 3300005719 | Bacteria | 815 |
| 177 | Ga0068861_101115569 | 3300005719 | Bacteria | 759 |
| 178 | Ga0068851_10161296 | 3300005834 | Bacteria | 1232 |
| 179 | Ga0068851_10462195 | 3300005834 | Bacteria | 756 |
| 180 | Ga0068870_10061404 | 3300005840 | Bacteria | 2020 |
| 181 | Ga0068870_10740057 | 3300005840 | Bacteria | 682 |
| 182 | Ga0068863_100440502 | 3300005841 | Bacteria | 1278 |
| 183 | Ga0068863_101090061 | 3300005841 | Bacteria | 803 |
| 184 | Ga0068858_100083115 | 3300005842 | Bacteria | 2977 |
| 185 | Ga0068858_100160734 | 3300005842 | Bacteria | 2115 |
| 186 | Ga0068860_101836034 | 3300005843 | Bacteria | 628 |
| 187 | Ga0068862_101258074 | 3300005844 | Bacteria | 740 |
| 188 | Ga0068862_101265504 | 3300005844 | Bacteria | 738 |
| 189 | Ga0068862_102036393 | 3300005844 | Bacteria | 585 |
| 190 | Ga0081455_10058384 | 3300005937 | Bacteria | 3265 |
| 191 | Ga0081455_10082841 | 3300005937 | Bacteria | 2623 |
| 192 | Ga0081455_10097913 | 3300005937 | Bacteria | 2363 |
| 193 | Ga0081455_10617615 | 3300005937 | Bacteria | 704 |
| 194 | Ga0081538_10000035 | 3300005981 | Bacteria | 120009 |
| 195 | Ga0081538_10002058 | 3300005981 | Bacteria | 20081 |
| 196 | Ga0081538_10016003 | 3300005981 | Bacteria | 5773 |
| 197 | Ga0081538_10038766 | 3300005981 | Bacteria | 3067 |
| 198 | Ga0081538_10087819 | 3300005981 | Bacteria | 1621 |
| 199 | Ga0081538_10155902 | 3300005981 | Bacteria | 1024 |
| 200 | Ga0081538_10238932 | 3300005981 | Bacteria | 702 |
| 201 | Ga0081540_1005020 | 3300005983 | Bacteria | 9939 |
| 202 | Ga0081540_1009024 | 3300005983 | Bacteria | 6891 |
| 203 | Ga0081540_1050501 | 3300005983 | Bacteria | 2065 |
| 204 | Ga0081539_10116145 | 3300005985 | Bacteria | 1337 |
| 205 | Ga0081539_10183926 | 3300005985 | Bacteria | 978 |
| 206 | Ga0081539_10243597 | 3300005985 | Bacteria | 803 |
| 207 | Ga0075365_10002863 | 3300006038 | Bacteria | 8671 |
| 208 | Ga0075365_10038880 | 3300006038 | Bacteria | 3095 |
| 209 | Ga0075365_10074921 | 3300006038 | Bacteria | 2283 |
| 210 | Ga0075365_10170248 | 3300006038 | Bacteria | 1520 |
| 211 | Ga0075365_10665482 | 3300006038 | Bacteria | 736 |
| 212 | Ga0075368_10216393 | 3300006042 | Bacteria | 813 |
| 213 | Ga0075363_100003547 | 3300006048 | Bacteria | 6663 |
| 214 | Ga0075363_100193973 | 3300006048 | Bacteria | 1159 |
| 215 | Ga0075364_10012604 | 3300006051 | Bacteria | 5177 |
| 216 | Ga0075364_10017734 | 3300006051 | Bacteria | 4452 |
| 217 | Ga0075364_10033710 | 3300006051 | Bacteria | 3299 |
| 218 | Ga0075364_10538871 | 3300006051 | Bacteria | 798 |
| 219 | Ga0075432_10018617 | 3300006058 | Bacteria | 2369 |
| 220 | Ga0075432_10025797 | 3300006058 | Bacteria | 2017 |
| 221 | Ga0070712_100048741 | 3300006175 | Bacteria | 2938 |
| 222 | Ga0070712_100132854 | 3300006175 | Bacteria | 1889 |
| 223 | Ga0070712_100333897 | 3300006175 | Bacteria | 1236 |
| 224 | Ga0075367_10418647 | 3300006178 | Bacteria | 848 |
| 225 | Ga0097621_100627036 | 3300006237 | Bacteria | 985 |
| 226 | Ga0068871_100231571 | 3300006358 | Bacteria | 1603 |
| 227 | Ga0068871_101505215 | 3300006358 | Bacteria | 636 |
| 228 | Ga0075428_100016818 | 3300006844 | Bacteria | 8077 |
| 229 | Ga0075428_100068173 | 3300006844 | Bacteria | 3892 |
| 230 | Ga0075428_100138236 | 3300006844 | Bacteria | 2649 |
| 231 | Ga0075428_100299641 | 3300006844 | Bacteria | 1728 |
| 232 | Ga0075428_100652990 | 3300006844 | Bacteria | 1122 |
| 233 | Ga0075428_101203150 | 3300006844 | Bacteria | 799 |
| 234 | Ga0075428_101303274 | 3300006844 | Bacteria | 764 |
| 235 | Ga0075430_100010387 | 3300006846 | Bacteria | 7884 |
| 236 | Ga0075430_100032438 | 3300006846 | Bacteria | 4434 |
| 237 | Ga0075430_100034598 | 3300006846 | Bacteria | 4288 |
| 238 | Ga0075430_100307128 | 3300006846 | Bacteria | 1312 |
| 239 | Ga0075431_100181290 | 3300006847 | Bacteria | 2161 |
| 240 | Ga0075431_100323459 | 3300006847 | Bacteria | 1555 |
| 241 | Ga0075431_100369503 | 3300006847 | Bacteria | 1439 |
| 242 | Ga0075431_100373663 | 3300006847 | Bacteria | 1430 |
| 243 | Ga0075431_100508849 | 3300006847 | Bacteria | 1194 |
| 244 | Ga0075431_100706412 | 3300006847 | Bacteria | 986 |
| 245 | Ga0075433_10069082 | 3300006852 | Bacteria | 3102 |
| 246 | Ga0075433_10177895 | 3300006852 | Bacteria | 1893 |
| 247 | Ga0075434_100057440 | 3300006871 | Bacteria | 3867 |
| 248 | Ga0075434_100667233 | 3300006871 | Bacteria | 1058 |
| 249 | Ga0075434_100934082 | 3300006871 | Bacteria | 882 |
| 250 | Ga0075434_101075089 | 3300006871 | Bacteria | 818 |
| 251 | Ga0075434_102596508 | 3300006871 | Bacteria | 507 |
| 252 | Ga0075429_100024381 | 3300006880 | Bacteria | 5248 |
| 253 | Ga0075429_100283950 | 3300006880 | Bacteria | 1449 |
| 254 | Ga0075429_100415206 | 3300006880 | Bacteria | 1178 |
| 255 | Ga0075429_100518281 | 3300006880 | Bacteria | 1045 |
| 256 | Ga0068865_100005630 | 3300006881 | Bacteria | 7606 |
| 257 | Ga0068865_101392870 | 3300006881 | Bacteria | 626 |
| 258 | Ga0075436_100858152 | 3300006914 | Bacteria | 678 |
| 259 | Ga0097620_100028786 | 3300006931 | Bacteria | 5570 |
| 260 | Ga0075435_100374339 | 3300007076 | Bacteria | 1223 |
| 261 | Ga0075435_100459793 | 3300007076 | Bacteria | 1098 |
| 262 | Ga0099794_10000317 | 3300007265 | Bacteria | 16474 |
| 263 | Ga0105251_10104591 | 3300009011 | Bacteria | 1293 |
| 264 | Ga0105240_10003665 | 3300009093 | Bacteria | 23758 |
| 265 | Ga0105240_10304470 | 3300009093 | Bacteria | 1822 |
| 266 | Ga0111539_10077902 | 3300009094 | Bacteria | 3901 |
| 267 | Ga0111539_10079936 | 3300009094 | Bacteria | 3846 |
| 268 | Ga0111539_10090862 | 3300009094 | Bacteria | 3588 |
| 269 | Ga0111539_10099470 | 3300009094 | Bacteria | 3415 |
| 270 | Ga0111539_10133033 | 3300009094 | Bacteria | 2912 |
| 271 | Ga0111539_10162982 | 3300009094 | Bacteria | 2608 |
| 272 | Ga0111539_10269372 | 3300009094 | Bacteria | 1983 |
| 273 | Ga0111539_13171834 | 3300009094 | Bacteria | 530 |
| 274 | Ga0105245_10002293 | 3300009098 | Bacteria | 17319 |
| 275 | Ga0105245_10005001 | 3300009098 | Bacteria | 11653 |
| 276 | Ga0105245_10021965 | 3300009098 | Bacteria | 5600 |
| 277 | Ga0105245_10236355 | 3300009098 | Bacteria | 1769 |
| 278 | Ga0105245_10253919 | 3300009098 | Bacteria | 1709 |
| 279 | Ga0105245_10333199 | 3300009098 | Bacteria | 1498 |
| 280 | Ga0105245_10357332 | 3300009098 | Unclassified | 1449 |
| 281 | Ga0105245_11935364 | 3300009098 | Bacteria | 643 |
| 282 | Ga0105245_12688276 | 3300009098 | Bacteria | 551 |
| 283 | Ga0105247_10098886 | 3300009101 | Bacteria | 1863 |
| 284 | Ga0105247_10643460 | 3300009101 | Bacteria | 791 |
| 285 | Ga0114129_10003411 | 3300009147 | Bacteria | 22329 |
| 286 | Ga0114129_10005383 | 3300009147 | Bacteria | 18068 |
| 287 | Ga0114129_10006344 | 3300009147 | Bacteria | 16771 |
| 288 | Ga0114129_10024361 | 3300009147 | Bacteria | 8575 |
| 289 | Ga0114129_10025786 | 3300009147 | Bacteria | 8325 |
| 290 | Ga0114129_10063226 | 3300009147 | Bacteria | 5169 |
| 291 | Ga0114129_10230121 | 3300009147 | Bacteria | 2497 |
| 292 | Ga0114129_10374892 | 3300009147 | Bacteria | 1880 |
| 293 | Ga0114129_10522328 | 3300009147 | Bacteria | 1548 |
| 294 | Ga0114129_10606212 | 3300009147 | Bacteria | 1418 |
| 295 | Ga0114129_11151010 | 3300009147 | Bacteria | 969 |
| 296 | Ga0114129_13283356 | 3300009147 | Bacteria | 524 |
| 297 | Ga0105243_10001579 | 3300009148 | Bacteria | 19913 |
| 298 | Ga0105243_10060424 | 3300009148 | Bacteria | 3028 |
| 299 | Ga0105243_10392824 | 3300009148 | Bacteria | 1286 |
| 300 | Ga0105243_10733590 | 3300009148 | Bacteria | 967 |
| 301 | Ga0105243_11304143 | 3300009148 | Bacteria | 743 |
| 302 | Ga0105243_11797446 | 3300009148 | Bacteria | 644 |
| 303 | Ga0105243_12558535 | 3300009148 | Bacteria | 550 |
| 304 | Ga0105243_12977471 | 3300009148 | Bacteria | 514 |
| 305 | Ga0105241_10688089 | 3300009174 | Bacteria | 932 |
| 306 | Ga0105241_10882218 | 3300009174 | Bacteria | 829 |
| 307 | Ga0105242_10658791 | 3300009176 | Bacteria | 1019 |
| 308 | Ga0105242_11080811 | 3300009176 | Bacteria | 815 |
| 309 | Ga0105242_11133783 | 3300009176 | Archaea | 798 |
| 310 | Ga0105242_11258245 | 3300009176 | Bacteria | 762 |
| 311 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 312 | Ga0105248_10198030 | 3300009177 | Bacteria | 2263 |
| 313 | Ga0105248_10412279 | 3300009177 | Bacteria | 1521 |
| 314 | Ga0105237_10314547 | 3300009545 | Bacteria | 1569 |
| 315 | Ga0105237_10720834 | 3300009545 | Bacteria | 1004 |
| 316 | Ga0105237_10914927 | 3300009545 | Bacteria | 884 |
| 317 | Ga0105237_12385692 | 3300009545 | Bacteria | 539 |
| 318 | Ga0105238_10201130 | 3300009551 | Bacteria | 1967 |
| 319 | Ga0105238_10388862 | 3300009551 | Bacteria | 1387 |
| 320 | Ga0105238_10516037 | 3300009551 | Bacteria | 1197 |
| 321 | Ga0105249_10004662 | 3300009553 | Bacteria | 11840 |
| 322 | Ga0105249_10036499 | 3300009553 | Bacteria | 4458 |
| 323 | Ga0105249_10062840 | 3300009553 | Bacteria | 3410 |
| 324 | Ga0105249_10186065 | 3300009553 | Bacteria | 2024 |
| 325 | Ga0105249_10406820 | 3300009553 | Bacteria | 1392 |
| 326 | Ga0105249_11138076 | 3300009553 | Bacteria | 851 |
| 327 | Ga0105249_12089740 | 3300009553 | Unclassified | 639 |
| 328 | Ga0105249_12940483 | 3300009553 | Unclassified | 547 |
| 329 | Ga0105148_123194 | 3300009978 | Bacteria | 500 |
| 330 | Ga0105239_10009680 | 3300010375 | Bacteria | 10837 |
| 331 | Ga0105239_10199135 | 3300010375 | Bacteria | 2243 |
| 332 | Ga0105239_10291479 | 3300010375 | Bacteria | 1838 |
| 333 | Ga0105239_10498189 | 3300010375 | Bacteria | 1385 |
| 334 | Ga0105239_11534687 | 3300010375 | Bacteria | 770 |
| 335 | Ga0105239_11885062 | 3300010375 | Unclassified | 693 |
| 336 | Ga0105246_10103171 | 3300011119 | Bacteria | 2080 |
| 337 | Ga0105246_10281410 | 3300011119 | Bacteria | 1334 |
| 338 | Ga0105246_10852061 | 3300011119 | Bacteria | 813 |
| 339 | Ga0105246_11426980 | 3300011119 | Bacteria | 647 |
| 340 | Ga0157324_1040859 | 3300012506 | Bacteria | 567 |
| 341 | Ga0157373_10858711 | 3300013100 | Bacteria | 672 |
| 342 | Ga0157371_10254600 | 3300013102 | Bacteria | 1265 |
| 343 | Ga0157371_10298410 | 3300013102 | Archaea | 1166 |
| 344 | Ga0157369_10578664 | 3300013105 | Bacteria | 1160 |
| 345 | Ga0157369_10588887 | 3300013105 | Bacteria | 1149 |
| 346 | Ga0157374_10404701 | 3300013296 | Bacteria | 1362 |
| 347 | Ga0157374_10408904 | 3300013296 | Bacteria | 1354 |
| 348 | Ga0157374_10599913 | 3300013296 | Bacteria | 1111 |
| 349 | Ga0157378_10435956 | 3300013297 | Bacteria | 1298 |
| 350 | Ga0157378_10486661 | 3300013297 | Bacteria | 1230 |
| 351 | Ga0157378_10821452 | 3300013297 | Bacteria | 956 |
| 352 | Ga0157378_12850850 | 3300013297 | Bacteria | 536 |
| 353 | Ga0163162_10071093 | 3300013306 | Bacteria | 3532 |
| 354 | Ga0163162_10088029 | 3300013306 | Bacteria | 3185 |
| 355 | Ga0163162_10470168 | 3300013306 | Bacteria | 1389 |
| 356 | Ga0157372_10269173 | 3300013307 | Bacteria | 1979 |
| 357 | Ga0157372_10287044 | 3300013307 | Bacteria | 1914 |
| 358 | Ga0157372_10326295 | 3300013307 | Bacteria | 1787 |
| 359 | Ga0157375_10055287 | 3300013308 | Bacteria | 3914 |
| 360 | Ga0157375_10318580 | 3300013308 | Bacteria | 1720 |
| 361 | Ga0157375_10865425 | 3300013308 | Bacteria | 1050 |
| 362 | Ga0157375_11487420 | 3300013308 | Unclassified | 799 |
| 363 | Ga0157375_12405654 | 3300013308 | Bacteria | 628 |
| 364 | Ga0157375_12591540 | 3300013308 | Bacteria | 606 |
| 365 | Ga0163163_10615414 | 3300014325 | Bacteria | 1149 |
| 366 | Ga0163163_10644957 | 3300014325 | Bacteria | 1122 |
| 367 | Ga0157380_11433390 | 3300014326 | Bacteria | 742 |
| 368 | Ga0182008_10609015 | 3300014497 | Bacteria | 614 |
| 369 | Ga0182008_10735549 | 3300014497 | Bacteria | 567 |
| 370 | Ga0157377_10023806 | 3300014745 | Bacteria | 3250 |
| 371 | Ga0157377_10110244 | 3300014745 | Bacteria | 1653 |
| 372 | Ga0157377_10270898 | 3300014745 | Bacteria | 1109 |
| 373 | Ga0157377_11155193 | 3300014745 | Bacteria | 597 |
| 374 | Ga0157379_10326789 | 3300014968 | Bacteria | 1401 |
| 375 | Ga0157376_10111081 | 3300014969 | Bacteria | 2413 |
| 376 | Ga0157376_10670151 | 3300014969 | Bacteria | 1040 |
| 377 | Ga0197907_11097511 | 3300020069 | Bacteria | 891 |
| 378 | Ga0206356_10483172 | 3300020070 | Bacteria | 2419 |
| 379 | Ga0206351_10176479 | 3300020077 | Bacteria | 505 |
| 380 | Ga0206350_10275672 | 3300020080 | Bacteria | 895 |
| 381 | Ga0206350_10560135 | 3300020080 | Unclassified | 804 |
| 382 | Ga0206354_11057515 | 3300020081 | Bacteria | 608 |
| 383 | Ga0206354_11261973 | 3300020081 | Bacteria | 751 |
| 384 | Ga0206354_11502332 | 3300020081 | Bacteria | 722 |
| 385 | Ga0206353_11195742 | 3300020082 | Bacteria | 742 |
| 386 | Ga0213874_10103837 | 3300021377 | Bacteria | 948 |
| 387 | Ga0213876_10002786 | 3300021384 | Bacteria | 10180 |
| 388 | Ga0213876_10021465 | 3300021384 | Bacteria | 3414 |
| 389 | Ga0213875_10018820 | 3300021388 | Bacteria | 3326 |
| 390 | Ga0213875_10024795 | 3300021388 | Bacteria | 2859 |
| 391 | Ga0207656_10028437 | 3300025321 | Bacteria | 2295 |
| 392 | Ga0207656_10178008 | 3300025321 | Bacteria | 1020 |
| 393 | Ga0207692_10133495 | 3300025898 | Bacteria | 1405 |
| 394 | Ga0207692_10176227 | 3300025898 | Bacteria | 1243 |
| 395 | Ga0207642_10047533 | 3300025899 | Bacteria | 1919 |
| 396 | Ga0207642_10323489 | 3300025899 | Bacteria | 901 |
| 397 | Ga0207642_10605425 | 3300025899 | Unclassified | 682 |
| 398 | Ga0207710_10137187 | 3300025900 | Bacteria | 1179 |
| 399 | Ga0207688_10028678 | 3300025901 | Bacteria | 3062 |
| 400 | Ga0207688_10175358 | 3300025901 | Bacteria | 1276 |
| 401 | Ga0207680_10060775 | 3300025903 | Bacteria | 2302 |
| 402 | Ga0207647_10099475 | 3300025904 | Bacteria | 1727 |
| 403 | Ga0207647_10389681 | 3300025904 | Bacteria | 786 |
| 404 | Ga0207647_10668759 | 3300025904 | Bacteria | 568 |
| 405 | Ga0207645_10253181 | 3300025907 | Bacteria | 1165 |
| 406 | Ga0207645_10563836 | 3300025907 | Bacteria | 773 |
| 407 | Ga0207643_10030222 | 3300025908 | Bacteria | 3014 |
| 408 | Ga0207643_10072603 | 3300025908 | Bacteria | 1982 |
| 409 | Ga0207684_10000047 | 3300025910 | Bacteria | 244386 |
| 410 | Ga0207654_11438856 | 3300025911 | Bacteria | 503 |
| 411 | Ga0207707_10129640 | 3300025912 | Bacteria | 2206 |
| 412 | Ga0207707_10172122 | 3300025912 | Bacteria | 1892 |
| 413 | Ga0207695_10049810 | 3300025913 | Bacteria | 4411 |
| 414 | Ga0207695_10421865 | 3300025913 | Bacteria | 1218 |
| 415 | Ga0207671_10215198 | 3300025914 | Bacteria | 1504 |
| 416 | Ga0207693_10016724 | 3300025915 | Bacteria | 5859 |
| 417 | Ga0207693_10062157 | 3300025915 | Bacteria | 2926 |
| 418 | Ga0207663_10005141 | 3300025916 | Bacteria | 6580 |
| 419 | Ga0207663_10065387 | 3300025916 | Bacteria | 2325 |
| 420 | Ga0207663_10467236 | 3300025916 | Bacteria | 975 |
| 421 | Ga0207663_11688829 | 3300025916 | Bacteria | 509 |
| 422 | Ga0207660_10783540 | 3300025917 | Bacteria | 778 |
| 423 | Ga0207662_10005024 | 3300025918 | Bacteria | 7004 |
| 424 | Ga0207657_10002552 | 3300025919 | Bacteria | 19694 |
| 425 | Ga0207657_10054230 | 3300025919 | Bacteria | 3468 |
| 426 | Ga0207657_10119163 | 3300025919 | Bacteria | 2172 |
| 427 | Ga0207657_10843779 | 3300025919 | Bacteria | 707 |
| 428 | Ga0207649_10018935 | 3300025920 | Bacteria | 3927 |
| 429 | Ga0207649_10340233 | 3300025920 | Bacteria | 1108 |
| 430 | Ga0207649_10519642 | 3300025920 | Bacteria | 907 |
| 431 | Ga0207652_10001888 | 3300025921 | Bacteria | 18144 |
| 432 | Ga0207652_10333537 | 3300025921 | Bacteria | 1369 |
| 433 | Ga0207652_11059668 | 3300025921 | Bacteria | 710 |
| 434 | Ga0207646_10012901 | 3300025922 | Bacteria | 8010 |
| 435 | Ga0207646_10496162 | 3300025922 | Bacteria | 1100 |
| 436 | Ga0207646_10836387 | 3300025922 | Bacteria | 819 |
| 437 | Ga0207681_10363260 | 3300025923 | Bacteria | 1162 |
| 438 | Ga0207681_10537408 | 3300025923 | Bacteria | 961 |
| 439 | Ga0207681_10875072 | 3300025923 | Bacteria | 752 |
| 440 | Ga0207694_10210635 | 3300025924 | Bacteria | 1583 |
| 441 | Ga0207694_11103124 | 3300025924 | Unclassified | 672 |
| 442 | Ga0207659_10052243 | 3300025926 | Bacteria | 2910 |
| 443 | Ga0207659_10526793 | 3300025926 | Bacteria | 1002 |
| 444 | Ga0207687_10034419 | 3300025927 | Bacteria | 3440 |
| 445 | Ga0207687_10269701 | 3300025927 | Bacteria | 1360 |
| 446 | Ga0207687_10320219 | 3300025927 | Unclassified | 1255 |
| 447 | Ga0207687_10533723 | 3300025927 | Bacteria | 983 |
| 448 | Ga0207687_10535322 | 3300025927 | Bacteria | 981 |
| 449 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 450 | Ga0207644_10115427 | 3300025931 | Bacteria | 2036 |
| 451 | Ga0207644_10574342 | 3300025931 | Bacteria | 935 |
| 452 | Ga0207644_10940662 | 3300025931 | Bacteria | 725 |
| 453 | Ga0207690_10029154 | 3300025932 | Bacteria | 3506 |
| 454 | Ga0207690_10032974 | 3300025932 | Bacteria | 3327 |
| 455 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 456 | Ga0207706_10003250 | 3300025933 | Bacteria | 15577 |
| 457 | Ga0207706_10011806 | 3300025933 | Bacteria | 7955 |
| 458 | Ga0207706_10226661 | 3300025933 | Bacteria | 1636 |
| 459 | Ga0207706_10932796 | 3300025933 | Unclassified | 732 |
| 460 | Ga0207709_10036448 | 3300025935 | Bacteria | 2915 |
| 461 | Ga0207709_10111344 | 3300025935 | Bacteria | 1831 |
| 462 | Ga0207709_10174005 | 3300025935 | Bacteria | 1514 |
| 463 | Ga0207709_10384838 | 3300025935 | Bacteria | 1068 |
| 464 | Ga0207669_10018416 | 3300025937 | Bacteria | 3610 |
| 465 | Ga0207669_10109891 | 3300025937 | Bacteria | 1845 |
| 466 | Ga0207669_10658865 | 3300025937 | Bacteria | 857 |
| 467 | Ga0207669_11293120 | 3300025937 | Bacteria | 619 |
| 468 | Ga0207704_10006431 | 3300025938 | Bacteria | 5481 |
| 469 | Ga0207665_11071266 | 3300025939 | Bacteria | 642 |
| 470 | Ga0207691_10000934 | 3300025940 | Bacteria | 28991 |
| 471 | Ga0207691_10025843 | 3300025940 | Bacteria | 5511 |
| 472 | Ga0207691_10126820 | 3300025940 | Bacteria | 2258 |
| 473 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 474 | Ga0207711_10481421 | 3300025941 | Bacteria | 1156 |
| 475 | Ga0207689_10066855 | 3300025942 | Bacteria | 2955 |
| 476 | Ga0207689_10167201 | 3300025942 | Bacteria | 1812 |
| 477 | Ga0207661_10019528 | 3300025944 | Bacteria | 5055 |
| 478 | Ga0207661_10138898 | 3300025944 | Bacteria | 2089 |
| 479 | Ga0207661_10374056 | 3300025944 | Bacteria | 1289 |
| 480 | Ga0207661_11128205 | 3300025944 | Bacteria | 722 |
| 481 | Ga0207679_10401709 | 3300025945 | Bacteria | 1205 |
| 482 | Ga0207667_10719665 | 3300025949 | Bacteria | 999 |
| 483 | Ga0207651_10026571 | 3300025960 | Bacteria | 3620 |
| 484 | Ga0207651_11506213 | 3300025960 | Bacteria | 606 |
| 485 | Ga0207712_10010679 | 3300025961 | Bacteria | 5831 |
| 486 | Ga0207712_10147605 | 3300025961 | Bacteria | 1812 |
| 487 | Ga0207712_10169272 | 3300025961 | Bacteria | 1706 |
| 488 | Ga0207712_10305562 | 3300025961 | Bacteria | 1307 |
| 489 | Ga0207712_10621263 | 3300025961 | Bacteria | 937 |
| 490 | Ga0207712_11345001 | 3300025961 | Bacteria | 639 |
| 491 | Ga0207668_10014261 | 3300025972 | Bacteria | 4916 |
| 492 | Ga0207668_10318815 | 3300025972 | Bacteria | 1289 |
| 493 | Ga0207668_11593592 | 3300025972 | Bacteria | 589 |
| 494 | Ga0207668_12107192 | 3300025972 | Bacteria | 508 |
| 495 | Ga0207640_10029686 | 3300025981 | Bacteria | 3359 |
| 496 | Ga0207640_10235450 | 3300025981 | Bacteria | 1411 |
| 497 | Ga0207640_10382153 | 3300025981 | Unclassified | 1141 |
| 498 | Ga0207658_10663228 | 3300025986 | Bacteria | 941 |
| 499 | Ga0207658_10839912 | 3300025986 | Bacteria | 835 |
| 500 | Ga0207677_10000106 | 3300026023 | Bacteria | 68108 |
| 501 | Ga0207677_10018790 | 3300026023 | Bacteria | 4157 |
| 502 | Ga0207677_10210514 | 3300026023 | Bacteria | 1552 |
| 503 | Ga0207677_11271484 | 3300026023 | Bacteria | 675 |
| 504 | Ga0207703_10133455 | 3300026035 | Bacteria | 2147 |
| 505 | Ga0207639_10050495 | 3300026041 | Bacteria | 3159 |
| 506 | Ga0207678_10000152 | 3300026067 | Bacteria | 56873 |
| 507 | Ga0207678_10006012 | 3300026067 | Bacteria | 10798 |
| 508 | Ga0207678_10296183 | 3300026067 | Bacteria | 1390 |
| 509 | Ga0207708_10000518 | 3300026075 | Bacteria | 29755 |
| 510 | Ga0207708_10001883 | 3300026075 | Bacteria | 15485 |
| 511 | Ga0207708_10206704 | 3300026075 | Bacteria | 1568 |
| 512 | Ga0207708_10349506 | 3300026075 | Bacteria | 1213 |
| 513 | Ga0207708_10667001 | 3300026075 | Bacteria | 886 |
| 514 | Ga0207702_10017839 | 3300026078 | Bacteria | 5875 |
| 515 | Ga0207702_10052231 | 3300026078 | Bacteria | 3458 |
| 516 | Ga0207702_10995014 | 3300026078 | Bacteria | 832 |
| 517 | Ga0207641_10557472 | 3300026088 | Bacteria | 1118 |
| 518 | Ga0207648_10015251 | 3300026089 | Bacteria | 7068 |
| 519 | Ga0207648_10032791 | 3300026089 | Bacteria | 4584 |
| 520 | Ga0207648_10651690 | 3300026089 | Bacteria | 973 |
| 521 | Ga0207648_11800609 | 3300026089 | Unclassified | 574 |
| 522 | Ga0207676_10071048 | 3300026095 | Bacteria | 2793 |
| 523 | Ga0207676_10196557 | 3300026095 | Bacteria | 1779 |
| 524 | Ga0207676_11252395 | 3300026095 | Bacteria | 736 |
| 525 | Ga0207674_10063341 | 3300026116 | Bacteria | 3732 |
| 526 | Ga0207674_10451099 | 3300026116 | Bacteria | 1243 |
| 527 | Ga0207674_10619249 | 3300026116 | Unclassified | 1045 |
| 528 | Ga0207674_10723951 | 3300026116 | Bacteria | 960 |
| 529 | Ga0207674_10984215 | 3300026116 | Bacteria | 812 |
| 530 | Ga0207675_100000091 | 3300026118 | Bacteria | 70559 |
| 531 | Ga0207675_100012493 | 3300026118 | Bacteria | 7933 |
| 532 | Ga0207675_100248908 | 3300026118 | Bacteria | 1719 |
| 533 | Ga0207675_100575891 | 3300026118 | Bacteria | 1127 |
| 534 | Ga0207675_100901786 | 3300026118 | Bacteria | 900 |
| 535 | Ga0207675_101257124 | 3300026118 | Bacteria | 761 |
| 536 | Ga0207675_101259102 | 3300026118 | Bacteria | 760 |
| 537 | Ga0207675_102374337 | 3300026118 | Bacteria | 543 |
| 538 | Ga0207683_10044824 | 3300026121 | Bacteria | 3867 |
| 539 | Ga0207683_11197344 | 3300026121 | Bacteria | 704 |
| 540 | Ga0207683_12011748 | 3300026121 | Bacteria | 526 |
| 541 | Ga0207698_10025692 | 3300026142 | Bacteria | 4154 |
| 542 | Ga0207698_10456873 | 3300026142 | Bacteria | 1234 |
| 543 | Ga0207698_12549727 | 3300026142 | Bacteria | 521 |
| 544 | Ga0209588_1000016 | 3300027671 | Bacteria | 128475 |
| 545 | Ga0207428_10385388 | 3300027907 | Bacteria | 1028 |
| 546 | Ga0207428_10386459 | 3300027907 | Bacteria | 1026 |
| 547 | Ga0207428_10658649 | 3300027907 | Bacteria | 751 |
| 548 | Ga0207428_10671129 | 3300027907 | Bacteria | 743 |
| 549 | Ga0268265_10065021 | 3300028380 | Bacteria | 2813 |
| 550 | Ga0268265_10811010 | 3300028380 | Bacteria | 913 |
| 551 | Ga0268265_11543743 | 3300028380 | Bacteria | 668 |
| 552 | Ga0268264_10270291 | 3300028381 | Bacteria | 1588 |
| 553 | Ga0268264_10363390 | 3300028381 | Bacteria | 1381 |
| 554 | Ga0268264_10470735 | 3300028381 | Bacteria | 1221 |
| 555 | Ga0265316_10084288 | 3300031344 | Bacteria | 2434 |
| 556 | Ga0307408_100058956 | 3300031548 | Bacteria | 2793 |
| 557 | Ga0307408_100290998 | 3300031548 | Bacteria | 1364 |
| 558 | Ga0307408_100368650 | 3300031548 | Bacteria | 1224 |
| 559 | Ga0307408_100787426 | 3300031548 | Bacteria | 862 |
| 560 | Ga0307405_10091008 | 3300031731 | Bacteria | 2020 |
| 561 | Ga0307405_10338654 | 3300031731 | Bacteria | 1156 |
| 562 | Ga0307405_10823444 | 3300031731 | Bacteria | 779 |
| 563 | Ga0307413_10014941 | 3300031824 | Bacteria | 3963 |
| 564 | Ga0307413_10530109 | 3300031824 | Bacteria | 951 |
| 565 | Ga0307413_11056960 | 3300031824 | Bacteria | 699 |
| 566 | Ga0307413_11898350 | 3300031824 | Unclassified | 535 |
| 567 | Ga0307410_10042752 | 3300031852 | Bacteria | 2997 |
| 568 | Ga0307410_10239684 | 3300031852 | Bacteria | 1405 |
| 569 | Ga0307410_10305716 | 3300031852 | Bacteria | 1256 |
| 570 | Ga0307410_10475140 | 3300031852 | Bacteria | 1024 |
| 571 | Ga0307410_10655977 | 3300031852 | Bacteria | 881 |
| 572 | Ga0307410_11371634 | 3300031852 | Bacteria | 620 |
| 573 | Ga0307406_10034550 | 3300031901 | Bacteria | 3102 |
| 574 | Ga0307406_10234201 | 3300031901 | Bacteria | 1373 |
| 575 | Ga0307406_10334196 | 3300031901 | Bacteria | 1177 |
| 576 | Ga0307406_10542362 | 3300031901 | Bacteria | 950 |
| 577 | Ga0307407_10054087 | 3300031903 | Bacteria | 2313 |
| 578 | Ga0307407_10128937 | 3300031903 | Bacteria | 1615 |
| 579 | Ga0307407_10331528 | 3300031903 | Bacteria | 1071 |
| 580 | Ga0307407_11049357 | 3300031903 | Bacteria | 632 |
| 581 | Ga0307412_10064169 | 3300031911 | Bacteria | 2481 |
| 582 | Ga0307412_10247974 | 3300031911 | Bacteria | 1381 |
| 583 | Ga0307412_11078449 | 3300031911 | Bacteria | 714 |
| 584 | Ga0307409_100028997 | 3300031995 | Bacteria | 3954 |
| 585 | Ga0307409_100076991 | 3300031995 | Bacteria | 2677 |
| 586 | Ga0307409_100136227 | 3300031995 | Bacteria | 2108 |
| 587 | Ga0307409_100297346 | 3300031995 | Bacteria | 1500 |
| 588 | Ga0307409_100406829 | 3300031995 | Bacteria | 1301 |
| 589 | Ga0307409_101128739 | 3300031995 | Bacteria | 806 |
| 590 | Ga0307416_100031212 | 3300032002 | Bacteria | 4007 |
| 591 | Ga0307416_100443250 | 3300032002 | Bacteria | 1349 |
| 592 | Ga0307416_100471998 | 3300032002 | Bacteria | 1312 |
| 593 | Ga0307416_100498553 | 3300032002 | Bacteria | 1281 |
| 594 | Ga0307416_100628284 | 3300032002 | Bacteria | 1157 |
| 595 | Ga0307416_101293797 | 3300032002 | Unclassified | 835 |
| 596 | Ga0307414_10974487 | 3300032004 | Bacteria | 780 |
| 597 | Ga0307414_11059575 | 3300032004 | Bacteria | 748 |
| 598 | Ga0307414_11349755 | 3300032004 | Bacteria | 662 |
| 599 | Ga0307411_10567697 | 3300032005 | Bacteria | 971 |
| 600 | Ga0307415_100173401 | 3300032126 | Bacteria | 1684 |
| 601 | Ga0307415_100410655 | 3300032126 | Bacteria | 1159 |
| 602 | Ga0307415_100463062 | 3300032126 | Bacteria | 1099 |
| 603 | Ga0307415_100582147 | 3300032126 | Bacteria | 993 |
| 604 | Ga0373958_0058354 | 3300034819 | Bacteria | 831 |
| 605 | Ga0373944_0328270 | 3300035089 | Bacteria | 579 |
| 606 | Ga0373952_0117729 | 3300035092 | Bacteria | 718 |
| 607 | Ga0373939_0084137 | 3300035114 | Bacteria | 1063 |
| 608 | Ga0373939_0152325 | 3300035114 | Bacteria | 843 |
| 609 | Ga0373941_0018221 | 3300035115 | Bacteria | 1937 |
| 610 | Ga0373941_0410659 | 3300035115 | Bacteria | 562 |
| 611 | Ga0373943_0195358 | 3300035170 | Bacteria | 1118 |
| 612 | Ga0373961_0139904 | 3300035241 | Bacteria | 817 |
| 613 | Ga0316574_0113307 | 3300035398 | Bacteria | 1739 |
| 614 | Ga0373931_0091576 | 3300035691 | Bacteria | 1695 |
| 615 | Ga0373931_0407118 | 3300035691 | Bacteria | 862 |
| 616 | Ga0373925_0251802 | 3300037068 | Bacteria | 1417 |
| 617 | Ga0395899_0113234 | 3300037312 | Bacteria | 1949 |
| 618 | Ga0395900_0003892 | 3300037418 | Bacteria | 15948 |
| 619 | Ga0395900_0214656 | 3300037418 | Bacteria | 1942 |
| 620 | Ga0395900_0227351 | 3300037418 | Bacteria | 1878 |
| 621 | Ga0395900_0319619 | 3300037418 | Bacteria | 1533 |
| 622 | Ga0395900_0406265 | 3300037418 | Bacteria | 1325 |
| 623 | Ga0395898_0003289 | 3300037466 | Bacteria | 18160 |
| 624 | Ga0395898_0013673 | 3300037466 | Bacteria | 8350 |
| 625 | Ga0395898_0027694 | 3300037466 | Bacteria | 5684 |
| 626 | Ga0395898_0769541 | 3300037466 | Bacteria | 904 |
| 627 | Ga0395898_1221621 | 3300037466 | Bacteria | 682 |
| 628 | Ga0395898_1916392 | 3300037466 | Bacteria | 513 |
| 629 | Ga0395905_0009566 | 3300037471 | Bacteria | 9463 |
| 630 | Ga0395905_0157711 | 3300037471 | Bacteria | 2134 |
| 631 | Ga0395905_0295161 | 3300037471 | Bacteria | 1508 |
| 632 | Ga0395905_0443893 | 3300037471 | Bacteria | 1195 |
| 633 | Ga0436364_0528708 | 3300037853 | Bacteria | 35377 |
| 634 | Ga0436364_0994313 | 3300037853 | Bacteria | 503 |
| 635 | Ga0436364_1364766 | 3300037853 | Bacteria | 3085 |
| 636 | Ga0395901_0010061 | 3300038443 | Bacteria | 9586 |
| 637 | Ga0395901_0038792 | 3300038443 | Bacteria | 4927 |
| 638 | Ga0395901_0424117 | 3300038443 | Bacteria | 1364 |
| 639 | Ga0395901_0455313 | 3300038443 | Bacteria | 1308 |
| 640 | Ga0395901_0608243 | 3300038443 | Bacteria | 1101 |
| 641 | Ga0395901_0953274 | 3300038443 | Bacteria | 837 |
| 642 | Ga0395901_1096014 | 3300038443 | Bacteria | 767 |
| 643 | Ga0395901_1207160 | 3300038443 | Bacteria | 722 |
| 644 | Ga0395901_1296917 | 3300038443 | Bacteria | 690 |
| 645 | Ga0395901_1819612 | 3300038443 | Bacteria | 558 |
| 646 | Ga0436365_0279888 | 3300039437 | Bacteria | 799 |
| 647 | Ga0436365_0378539 | 3300039437 | Bacteria | 21711 |
| 648 | Ga0436365_0727247 | 3300039437 | Bacteria | 646 |
| 649 | Ga0436365_0952728 | 3300039437 | Bacteria | 564 |
| 650 | Ga0436365_1727618 | 3300039437 | Bacteria | 14282 |
| 651 | Ga0436365_1868477 | 3300039437 | Bacteria | 6327 |
| 652 | Ga0436363_1470231 | 3300039450 | Bacteria | 997 |
| 653 | Ga0436363_1632579 | 3300039450 | Bacteria | 3098 |
| 654 | Ga0436362_0308584 | 3300039453 | Bacteria | 678 |
| 655 | Ga0436362_0402256 | 3300039453 | Bacteria | 617 |
| 656 | Ga0436362_0527905 | 3300039453 | Bacteria | 4707 |
| 657 | Ga0451791_0013117 | 3300041451 | Bacteria | 517 |
| 658 | Ga0451797_0368693 | 3300041453 | Bacteria | 588 |
| 659 | Ga0451807_2024780 | 3300041486 | Bacteria | 1241 |
| 660 | Ga0451833_0205188 | 3300041491 | Bacteria | 644 |
| 661 | Ga0451841_0618205 | 3300041498 | Bacteria | 885 |
| 662 | Ga0451849_0929619 | 3300041505 | Bacteria | 787 |
| 663 | Ga0451853_3135641 | 3300041512 | Bacteria | 1465 |
| 664 | Ga0439463_040070 | 3300042016 | Bacteria | 1190 |
| 665 | Ga0439464_0047592 | 3300042439 | Bacteria | 1234 |
| 666 | Ga0439460_0056377 | 3300042461 | Bacteria | 1190 |
| 667 | Ga0439440_0162319 | 3300042993 | Bacteria | 646 |
| 668 | Ga0466969_0004458 | 3300044656 | Bacteria | 7450 |
| 669 | Ga0466969_0063251 | 3300044656 | Bacteria | 1794 |
| 670 | Ga0466972_0034144 | 3300044658 | Bacteria | 2494 |
| 671 | Ga0466965_0023873 | 3300044683 | Bacteria | 2955 |
| 672 | Ga0466965_0091914 | 3300044683 | Bacteria | 1545 |
| 673 | Ga0466965_0303241 | 3300044683 | Bacteria | 867 |
| 674 | Ga0466965_0481116 | 3300044683 | Bacteria | 694 |
| 675 | Ga0466966_0190529 | 3300044684 | Bacteria | 1242 |
| 676 | Ga0466966_0285915 | 3300044684 | Bacteria | 991 |
| 677 | Ga0466966_0379460 | 3300044684 | Bacteria | 849 |
| 678 | Ga0466966_0577026 | 3300044684 | Bacteria | 677 |
| 679 | Ga0466966_0957685 | 3300044684 | Bacteria | 516 |
| 680 | Ga0466961_0028695 | 3300044693 | Bacteria | 3578 |
| 681 | Ga0466961_0313052 | 3300044693 | Bacteria | 958 |
| 682 | Ga0466961_0324175 | 3300044693 | Bacteria | 939 |
| 683 | Ga0466963_0012064 | 3300044694 | Bacteria | 5280 |
| 684 | Ga0466963_0184568 | 3300044694 | Bacteria | 1457 |
| 685 | Ga0466963_0295351 | 3300044694 | Bacteria | 1139 |
| 686 | Ga0466963_0311492 | 3300044694 | Bacteria | 1107 |
| 687 | Ga0466963_0503093 | 3300044694 | Bacteria | 855 |
| 688 | Ga0466964_0017949 | 3300044706 | Bacteria | 2711 |
| 689 | Ga0466964_0043347 | 3300044706 | Bacteria | 1825 |
| 690 | Ga0466964_0112139 | 3300044706 | Bacteria | 1218 |
| 691 | Ga0466964_0460099 | 3300044706 | Bacteria | 676 |
| 692 | Ga0466964_0510164 | 3300044706 | Bacteria | 647 |
| 693 | Ga0466971_0404361 | 3300044719 | Bacteria | 666 |
| 694 | Ga0466968_0141625 | 3300044735 | Bacteria | 1100 |
| 695 | Ga0466970_0070305 | 3300044765 | Bacteria | 1882 |
| 696 | Ga0466957_0010702 | 3300044842 | Bacteria | 5274 |
| 697 | Ga0466957_0800724 | 3300044842 | Bacteria | 669 |
| 698 | Ga0466960_0136623 | 3300044901 | Bacteria | 1299 |
| 699 | Ga0466960_0372251 | 3300044901 | Bacteria | 819 |
| 700 | Ga0466959_0038186 | 3300045049 | Bacteria | 3548 |
| 701 | Ga0466959_0042946 | 3300045049 | Bacteria | 3334 |
| 702 | Ga0466959_0355042 | 3300045049 | Bacteria | 999 |
| 703 | Ga0466959_0476319 | 3300045049 | Bacteria | 845 |
| 704 | Ga0466959_0649468 | 3300045049 | Bacteria | 708 |
| 705 | Ga0466958_0025030 | 3300045836 | Bacteria | 3515 |
| 706 | Ga0466958_0066323 | 3300045836 | Bacteria | 2204 |
| 707 | Ga0466958_0077765 | 3300045836 | Bacteria | 2038 |
| 708 | Ga0466958_0100358 | 3300045836 | Bacteria | 1799 |
| 709 | Ga0466958_0136145 | 3300045836 | Bacteria | 1544 |
| 710 | Ga0466958_0256961 | 3300045836 | Bacteria | 1118 |
| 711 | Ga0466967_0015873 | 3300045976 | Bacteria | 5919 |
| 712 | Ga0466967_0043106 | 3300045976 | Bacteria | 3905 |
| 713 | Ga0466967_0051648 | 3300045976 | Bacteria | 3604 |
| 714 | Ga0466967_0252978 | 3300045976 | Bacteria | 1683 |
| 715 | Ga0466967_0433195 | 3300045976 | Bacteria | 1283 |
| 716 | Ga0466967_0687452 | 3300045976 | Bacteria | 1013 |
| 717 | Ga0466967_0692615 | 3300045976 | Bacteria | 1009 |
| 718 | Ga0466967_0708487 | 3300045976 | Bacteria | 997 |
| 719 | Ga0466967_0737988 | 3300045976 | Bacteria | 976 |
| 720 | Ga0466967_2030475 | 3300045976 | Bacteria | 571 |
| 721 | Ga0495603_0117058 | 3300046455 | Bacteria | 1554 |
| 722 | Ga0495629_0105496 | 3300046459 | Bacteria | 1966 |
| 723 | Ga0495641_0037914 | 3300046461 | Bacteria | 2255 |
| 724 | Ga0495605_0388054 | 3300046474 | Bacteria | 582 |
| 725 | Ga0495584_0106485 | 3300046491 | Bacteria | 1418 |
| 726 | Ga0495585_0482224 | 3300046492 | Bacteria | 591 |
| 727 | Ga0495596_0023720 | 3300046500 | Bacteria | 2488 |
| 728 | Ga0495596_0080713 | 3300046500 | Bacteria | 1263 |
| 729 | Ga0495596_0288588 | 3300046500 | Bacteria | 638 |
| 730 | Ga0495596_0351091 | 3300046500 | Bacteria | 574 |
| 731 | Ga0495608_0000023 | 3300046511 | Bacteria | 160090 |
| 732 | Ga0495608_0181040 | 3300046511 | Bacteria | 1333 |
| 733 | Ga0495628_0133196 | 3300046516 | Bacteria | 1900 |
| 734 | Ga0495631_0356389 | 3300046518 | Bacteria | 623 |
| 735 | Ga0495631_0413850 | 3300046518 | Unclassified | 574 |
| 736 | Ga0495656_0159710 | 3300046615 | Bacteria | 1095 |
| 737 | Ga0495656_0334584 | 3300046615 | Bacteria | 782 |
| 738 | Ga0495625_0250896 | 3300046660 | Bacteria | 1149 |
| 739 | Ga0495588_0336136 | 3300046674 | Bacteria | 794 |
| 740 | Ga0495657_0000020 | 3300046675 | Bacteria | 160089 |
| 741 | Ga0495658_0215131 | 3300046683 | Bacteria | 1202 |
| 742 | Ga0495613_0000251 | 3300046689 | Bacteria | 50730 |
| 743 | Ga0495624_0376867 | 3300046690 | Bacteria | 853 |
| 744 | Ga0495670_0168975 | 3300046691 | Bacteria | 1151 |
| 745 | Ga0495589_0336337 | 3300046794 | Bacteria | 696 |
| 746 | Ga0495604_0000158 | 3300047317 | Bacteria | 59386 |
| 747 | Ga0495675_0000561 | 3300047444 | Bacteria | 23982 |
| 748 | Ga0495593_0247261 | 3300047673 | Bacteria | 893 |
| 749 | Ga0495593_0618296 | 3300047673 | Bacteria | 544 |
| 750 | Ga0496100_0100042 | 3300048903 | Bacteria | 1996 |
| 751 | Ga0496100_0174683 | 3300048903 | Bacteria | 1550 |
| 752 | Ga0496100_0179279 | 3300048903 | Bacteria | 1531 |
| 753 | Ga0496100_0187151 | 3300048903 | Bacteria | 1501 |
| 754 | Ga0496100_0541474 | 3300048903 | Bacteria | 900 |
| 755 | Ga0496100_1534716 | 3300048903 | Bacteria | 526 |
| 756 | Ga0496101_0041686 | 3300048904 | Bacteria | 3274 |
| 757 | Ga0496101_0044046 | 3300048904 | Bacteria | 3192 |
| 758 | Ga0496101_0065871 | 3300048904 | Bacteria | 2641 |
| 759 | Ga0496101_0398490 | 3300048904 | Bacteria | 1083 |
| 760 | Ga0496102_0003095 | 3300048905 | Bacteria | 14096 |
| 761 | Ga0496102_0198940 | 3300048905 | Bacteria | 1889 |
| 762 | Ga0496102_0503376 | 3300048905 | Bacteria | 1133 |
| 763 | Ga0496102_0976998 | 3300048905 | Bacteria | 767 |
| 764 | Ga0496102_1080381 | 3300048905 | Bacteria | 722 |
| 765 | Ga0496102_1457173 | 3300048905 | Bacteria | 603 |
| 766 | Ga0496103_0022041 | 3300048906 | Bacteria | 3834 |
| 767 | Ga0496103_0030924 | 3300048906 | Bacteria | 3259 |
| 768 | Ga0496104_0012412 | 3300048907 | Bacteria | 7660 |
| 769 | Ga0496104_0021418 | 3300048907 | Bacteria | 5934 |
| 770 | Ga0496104_0075754 | 3300048907 | Bacteria | 3204 |
| 771 | Ga0496104_0259428 | 3300048907 | Bacteria | 1651 |
| 772 | Ga0496104_1767976 | 3300048907 | Bacteria | 520 |
| 773 | Ga0496105_0070815 | 3300048908 | Bacteria | 2882 |
| 774 | Ga0496105_0154886 | 3300048908 | Bacteria | 1882 |
| 775 | Ga0496105_0353859 | 3300048908 | Bacteria | 1172 |
| 776 | Ga0496105_0778513 | 3300048908 | Bacteria | 729 |
| 777 | Ga0496106_0006523 | 3300048909 | Bacteria | 8636 |
| 778 | Ga0496106_0036277 | 3300048909 | Bacteria | 3688 |
| 779 | Ga0496107_0042362 | 3300048910 | Bacteria | 3270 |
| 780 | Ga0496107_0050430 | 3300048910 | Bacteria | 3000 |
| 781 | Ga0496107_0159475 | 3300048910 | Bacteria | 1671 |
| 782 | Ga0496107_0226511 | 3300048910 | Bacteria | 1391 |
| 783 | Ga0496107_0276299 | 3300048910 | Bacteria | 1250 |
| 784 | Ga0496107_0574043 | 3300048910 | Bacteria | 834 |
| 785 | Ga0496107_0588607 | 3300048910 | Bacteria | 823 |
| 786 | Ga0496107_0637477 | 3300048910 | Bacteria | 786 |
| 787 | Ga0496108_0004449 | 3300048911 | Bacteria | 11283 |
| 788 | Ga0496108_0024711 | 3300048911 | Bacteria | 4949 |
| 789 | Ga0496108_0046338 | 3300048911 | Bacteria | 3632 |
| 790 | Ga0496108_0176298 | 3300048911 | Bacteria | 1850 |
| 791 | Ga0496108_0214434 | 3300048911 | Bacteria | 1672 |
| 792 | Ga0496108_0775168 | 3300048911 | Bacteria | 828 |
| 793 | Ga0496108_0969796 | 3300048911 | Bacteria | 727 |
| 794 | Ga0496109_0000075 | 3300048912 | Bacteria | 105050 |
| 795 | Ga0496109_0003244 | 3300048912 | Bacteria | 13555 |
| 796 | Ga0496109_0012257 | 3300048912 | Bacteria | 7400 |
| 797 | Ga0496109_0014690 | 3300048912 | Bacteria | 6815 |
| 798 | Ga0496109_0577518 | 3300048912 | Bacteria | 1059 |
| 799 | Ga0496109_0649710 | 3300048912 | Bacteria | 992 |
| 800 | Ga0496109_0660889 | 3300048912 | Bacteria | 982 |
| 801 | Ga0496109_0708155 | 3300048912 | Bacteria | 944 |
| 802 | Ga0496109_1213058 | 3300048912 | Bacteria | 691 |
| 803 | Ga0496109_1257147 | 3300048912 | Bacteria | 676 |
| 804 | Ga0496109_1618315 | 3300048912 | Bacteria | 582 |
| 805 | Ga0496109_1783984 | 3300048912 | Bacteria | 548 |
| 806 | Ga0496110_0062927 | 3300048913 | Bacteria | 3278 |
| 807 | Ga0496110_0072468 | 3300048913 | Bacteria | 3056 |
| 808 | Ga0496110_0269852 | 3300048913 | Bacteria | 1549 |
| 809 | Ga0496110_0475352 | 3300048913 | Unclassified | 1138 |
| 810 | Ga0496110_0482394 | 3300048913 | Bacteria | 1129 |
| 811 | Ga0496110_1794422 | 3300048913 | Bacteria | 523 |
| 812 | Ga0496111_0027123 | 3300048914 | Bacteria | 4049 |
| 813 | Ga0496111_0214719 | 3300048914 | Bacteria | 1429 |
| 814 | Ga0496112_0000013 | 3300048915 | Bacteria | 237194 |
| 815 | Ga0496112_0024384 | 3300048915 | Bacteria | 5790 |
| 816 | Ga0496112_0202224 | 3300048915 | Bacteria | 1945 |
| 817 | Ga0496112_0233867 | 3300048915 | Bacteria | 1792 |
| 818 | Ga0496112_0347291 | 3300048915 | Bacteria | 1426 |
| 819 | Ga0496112_0372740 | 3300048915 | Bacteria | 1369 |
| 820 | Ga0496113_0026775 | 3300048916 | Bacteria | 4126 |
| 821 | Ga0496113_0037782 | 3300048916 | Bacteria | 3546 |
| 822 | Ga0496113_0071478 | 3300048916 | Bacteria | 2639 |
| 823 | Ga0496113_0546862 | 3300048916 | Bacteria | 929 |
| 824 | Ga0496114_0021547 | 3300048917 | Bacteria | 5243 |
| 825 | Ga0496114_0122625 | 3300048917 | Bacteria | 2237 |
| 826 | Ga0496114_0377166 | 3300048917 | Bacteria | 1255 |
| 827 | Ga0496115_0216447 | 3300048918 | Bacteria | 1581 |
| 828 | Ga0501031_0291316 | 3300049568 | Bacteria | 1058 |
| 829 | Ga0501031_0895057 | 3300049568 | Bacteria | 568 |
| 830 | Ga0501033_0373905 | 3300049570 | Bacteria | 996 |
| 831 | Ga0501036_0651252 | 3300049572 | Bacteria | 872 |
| 832 | Ga0501036_1674400 | 3300049572 | Bacteria | 513 |
| 833 | Ga0501038_0443030 | 3300049574 | Bacteria | 1000 |
| 834 | Ga0501039_0171504 | 3300049575 | Bacteria | 1706 |
| 835 | Ga0501039_0323562 | 3300049575 | Bacteria | 1212 |
| 836 | Ga0501040_0023006 | 3300049576 | Bacteria | 4176 |
| 837 | Ga0501040_0085543 | 3300049576 | Bacteria | 2189 |
| 838 | Ga0501040_0528064 | 3300049576 | Bacteria | 851 |
| 839 | Ga0501041_0021960 | 3300049577 | Bacteria | 3822 |
| 840 | Ga0501041_0149692 | 3300049577 | Bacteria | 1457 |
| 841 | Ga0501042_0191243 | 3300049578 | Bacteria | 1476 |
| 842 | Ga0501042_0331440 | 3300049578 | Bacteria | 1100 |
| 843 | Ga0501046_0369590 | 3300049580 | Bacteria | 1039 |
| 844 | Ga0501046_0421466 | 3300049580 | Bacteria | 962 |
| 845 | Ga0501048_0041902 | 3300049582 | Bacteria | 3280 |
| 846 | Ga0501048_0289431 | 3300049582 | Bacteria | 1165 |
| 847 | Ga0501067_0175878 | 3300049583 | Bacteria | 1192 |
| 848 | Ga0501069_0470778 | 3300049585 | Bacteria | 748 |
| 849 | Ga0501071_0026554 | 3300049587 | Bacteria | 4066 |
| 850 | Ga0501071_0069904 | 3300049587 | Bacteria | 2557 |
| 851 | Ga0501071_0121517 | 3300049587 | Bacteria | 1936 |
| 852 | Ga0501071_0321901 | 3300049587 | Bacteria | 1174 |
| 853 | Ga0501071_0341938 | 3300049587 | Bacteria | 1138 |
| 854 | Ga0501072_0019744 | 3300049588 | Bacteria | 5213 |
| 855 | Ga0501072_0057878 | 3300049588 | Bacteria | 3055 |
| 856 | Ga0501072_0147308 | 3300049588 | Bacteria | 1877 |
| 857 | Ga0501072_0377024 | 3300049588 | Bacteria | 1126 |
| 858 | Ga0501072_1130225 | 3300049588 | Bacteria | 609 |
| 859 | Ga0501074_0303848 | 3300049590 | Unclassified | 1133 |
| 860 | Ga0501074_0494255 | 3300049590 | Bacteria | 867 |
| 861 | Ga0501075_0029679 | 3300049591 | Bacteria | 4045 |
| 862 | Ga0501075_0038581 | 3300049591 | Bacteria | 3572 |
| 863 | Ga0501075_0073939 | 3300049591 | Bacteria | 2578 |
| 864 | Ga0501075_0643588 | 3300049591 | Bacteria | 808 |
| 865 | Ga0501076_0031553 | 3300049592 | Bacteria | 4133 |
| 866 | Ga0501076_0036078 | 3300049592 | Bacteria | 3872 |
| 867 | Ga0501076_0179253 | 3300049592 | Bacteria | 1727 |
| 868 | Ga0501076_0265097 | 3300049592 | Bacteria | 1407 |
| 869 | Ga0501076_0525250 | 3300049592 | Bacteria | 976 |
| 870 | Ga0501077_0358088 | 3300049593 | Bacteria | 931 |
| 871 | Ga0501077_0397261 | 3300049593 | Bacteria | 881 |
| 872 | Ga0501223_074980 | 3300049663 | Bacteria | 672 |
| 873 | Ga0501227_184058 | 3300049665 | Bacteria | 588 |
| 874 | Ga0501235_191922 | 3300049669 | Bacteria | 549 |
| 875 | Ga0501259_013667 | 3300049688 | Bacteria | 1368 |
| 876 | Ga0501079_0225345 | 3300049741 | Bacteria | 1464 |
| 877 | Ga0501079_0437106 | 3300049741 | Bacteria | 1027 |
| 878 | Ga0501079_1137010 | 3300049741 | Bacteria | 615 |
| 879 | Ga0501080_1176813 | 3300049742 | Bacteria | 660 |
| 880 | Ga0501081_0002804 | 3300049743 | Bacteria | 11058 |
| 881 | Ga0501081_0264230 | 3300049743 | Bacteria | 1258 |
| 882 | Ga0501081_0362245 | 3300049743 | Bacteria | 1070 |
| 883 | Ga0501081_1155998 | 3300049743 | Bacteria | 586 |
| 884 | Ga0501083_0482690 | 3300049744 | Bacteria | 807 |
| 885 | Ga0501273_087628 | 3300049770 | Bacteria | 525 |
| 886 | Ga0501035_0291652 | 3300049822 | Bacteria | 1377 |
| 887 | Ga0501035_0637531 | 3300049822 | Bacteria | 865 |
| 888 | Ga0501035_1195217 | 3300049822 | Bacteria | 590 |
| 889 | Ga0501045_0060924 | 3300049824 | Bacteria | 2767 |
| 890 | Ga0501045_0520842 | 3300049824 | Bacteria | 883 |
| 891 | Ga0501045_0538672 | 3300049824 | Bacteria | 866 |
| 892 | nmdc:mga03n38_290846_c1 | 3300050490 | Bacteria | 875 |
| 893 | nmdc:mga03n38_44508_c1 | 3300050490 | Bacteria | 1162 |
| 894 | nmdc:mga00v17_33154_c1 | 3300050491 | Bacteria | 3058 |
| 895 | nmdc:mga00v17_7459_c1 | 3300050491 | Bacteria | 5837 |
| 896 | nmdc:mga00v17_74686_c1 | 3300050491 | Bacteria | 2107 |
| 897 | nmdc:mga0yw44_2119_c1 | 3300050492 | Bacteria | 8315 |
| 898 | nmdc:mga0yw44_39020_c1 | 3300050492 | Bacteria | 2813 |
| 899 | nmdc:mga0yw44_47850_c2 | 3300050492 | Bacteria | 1699 |
| 900 | nmdc:mga0yw44_619864_c1 | 3300050492 | Bacteria | 735 |
| 901 | nmdc:mga06z11_1035300_c1 | 3300050494 | Bacteria | 500 |
| 902 | nmdc:mga06z11_435155_c1 | 3300050494 | Bacteria | 791 |
| 903 | nmdc:mga06z11_679730_c1 | 3300050494 | Bacteria | 627 |
| 904 | nmdc:mga06z11_779797_c1 | 3300050494 | Bacteria | 582 |
| 905 | nmdc:mga05p37_14788_c1 | 3300050507 | Bacteria | 9372 |
| 906 | nmdc:mga05p37_148787_c1 | 3300050507 | Bacteria | 2866 |
| 907 | nmdc:mga05p37_169778_c1 | 3300050507 | Bacteria | 2661 |
| 908 | nmdc:mga05p37_172958_c1 | 3300050507 | Bacteria | 2633 |
| 909 | nmdc:mga05p37_343537_c1 | 3300050507 | Bacteria | 1759 |
| 910 | nmdc:mga05p37_4564_c1 | 3300050507 | Bacteria | 16189 |
| 911 | nmdc:mga05p37_559193_c1 | 3300050507 | Bacteria | 1300 |
| 912 | nmdc:mga09592_144042_c1 | 3300050508 | Bacteria | 2054 |
| 913 | nmdc:mga09592_185824_c1 | 3300050508 | Bacteria | 1798 |
| 914 | nmdc:mga09592_19018_c1 | 3300050508 | Bacteria | 5637 |
| 915 | nmdc:mga09592_443722_c1 | 3300050508 | Bacteria | 1120 |
| 916 | nmdc:mga09592_992034_c1 | 3300050508 | Bacteria | 702 |
| 917 | nmdc:mga0qj67_127541_c1 | 3300050509 | Bacteria | 2059 |
| 918 | nmdc:mga0qj67_27450_c1 | 3300050509 | Bacteria | 4414 |
| 919 | nmdc:mga06r32_193547_c1 | 3300050510 | Bacteria | 2021 |
| 920 | nmdc:mga06r32_219728_c1 | 3300050510 | Bacteria | 1888 |
| 921 | nmdc:mga06r32_253554_c1 | 3300050510 | Bacteria | 1747 |
| 922 | nmdc:mga06r32_25649_c1 | 3300050510 | Bacteria | 5487 |
| 923 | nmdc:mga06r32_286483_c1 | 3300050510 | Bacteria | 1634 |
| 924 | nmdc:mga06r32_519487_c1 | 3300050510 | Bacteria | 1166 |
| 925 | nmdc:mga06r32_558464_c1 | 3300050510 | Bacteria | 1118 |
| 926 | nmdc:mga08y16_1232607_c1 | 3300050511 | Bacteria | 717 |
| 927 | nmdc:mga08y16_1254734_c1 | 3300050511 | Bacteria | 710 |
| 928 | nmdc:mga08y16_18190_c1 | 3300050511 | Bacteria | 7405 |
| 929 | nmdc:mga08y16_288085_c1 | 3300050511 | Bacteria | 1693 |
| 930 | nmdc:mga08y16_353532_c1 | 3300050511 | Bacteria | 1509 |
| 931 | nmdc:mga08y16_47862_c1 | 3300050511 | Bacteria | 4475 |
| 932 | nmdc:mga08y16_493031_c1 | 3300050511 | Bacteria | 1246 |
| 933 | nmdc:mga08y16_498894_c1 | 3300050511 | Bacteria | 1237 |
| 934 | nmdc:mga08y16_533875_c1 | 3300050511 | Bacteria | 1189 |
| 935 | nmdc:mga08y16_58425_c1 | 3300050511 | Bacteria | 4030 |
| 936 | nmdc:mga0n895_1048682_c1 | 3300050512 | Bacteria | 794 |
| 937 | nmdc:mga0n895_166491_c1 | 3300050512 | Bacteria | 2236 |
| 938 | nmdc:mga0n895_1940942_c1 | 3300050512 | Bacteria | 547 |
| 939 | nmdc:mga0n895_1974714_c1 | 3300050512 | Bacteria | 541 |
| 940 | nmdc:mga0n895_2231470_c1 | 3300050512 | Bacteria | 502 |
| 941 | nmdc:mga0n895_561078_c1 | 3300050512 | Bacteria | 1147 |
| 942 | nmdc:mga0rr50_598822_c1 | 3300050513 | Bacteria | 940 |
| 943 | nmdc:mga08x19_407988_c1 | 3300050514 | Bacteria | 954 |
| 944 | nmdc:mga0a205_154858_c1 | 3300050515 | Bacteria | 2190 |
| 945 | nmdc:mga0a205_214067_c1 | 3300050515 | Bacteria | 1814 |
| 946 | nmdc:mga0a205_78610_c1 | 3300050515 | Bacteria | 3187 |
| 947 | Ga0495612_0000022 | 3300053078 | Bacteria | 119126 |
| 948 | Ga0495655_0071852 | 3300053083 | Bacteria | 969 |
| 949 | Ga0495655_0101842 | 3300053083 | Bacteria | 851 |
| 950 | Ga0495655_0215508 | 3300053083 | Bacteria | 633 |
| 951 | Ga0495595_0000022 | 3300053084 | Bacteria | 110598 |
| 952 | Ga0495619_0000070 | 3300053085 | Bacteria | 80588 |
| 953 | Ga0500616_0004292 | 3300053153 | Bacteria | 10233 |
| 954 | Ga0501084_0418861 | 3300054114 | Bacteria | 1132 |
| 955 | Ga0501084_0969359 | 3300054114 | Bacteria | 715 |
| 956 | Ga0501084_1051000 | 3300054114 | Bacteria | 684 |
| 957 | Ga0590075_094382 | 3300059424 | Bacteria | 777 |
| 958 | Ga0587070_145090 | 3300059491 | Bacteria | 590 |
| 959 | Ga0587073_0109275 | 3300059492 | Bacteria | 730 |
| 960 | Ga0587067_123080 | 3300059640 | Bacteria | 625 |
| 961 | Ga0587067_126318 | 3300059640 | Bacteria | 619 |
| 962 | Ga0587114_104150 | 3300059655 | Bacteria | 556 |
| 963 | Ga0501082_0006969 | 3300060353 | Bacteria | 9762 |
| 964 | Ga0501082_0130106 | 3300060353 | Bacteria | 2184 |
| 965 | Ga0501082_0185504 | 3300060353 | Bacteria | 1810 |
| 966 | Ga0466962_0010743 | 3300061719 | Bacteria | 4401 |
| 967 | Ga0466962_0077598 | 3300061719 | Bacteria | 1588 |
| 968 | Ga0466962_0121791 | 3300061719 | Bacteria | 1259 |
| 969 | Ga0530510_0005169 | 3300061734 | Bacteria | 9003 |
| 970 | Ga0530510_0061101 | 3300061734 | Bacteria | 2728 |
| 971 | Ga0530510_0622348 | 3300061734 | Bacteria | 821 |
| 972 | Ga0530510_1029904 | 3300061734 | Bacteria | 630 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005719 | Ga0068861_101115569 | Ga0068861_1011155692 | 106 |
| 2 | 3300028381 | Ga0268264_10470735 | Ga0268264_104707352 | 106 |
| 3 | 3300048905 | Ga0496102_0198940 | Ga0496102_0198940_415_819 | 106 |
| 4 | 3300049587 | Ga0501071_0341938 | Ga0501071_0341938_265_663 | 106 |
| 5 | 3300061734 | Ga0530510_1029904 | Ga0530510_1029904_29_427 | 106 |
| 6 | 3300005444 | Ga0070694_101250540 | Ga0070694_1012505402 | 115 |
| 7 | 3300009545 | Ga0105237_12385692 | Ga0105237_123856922 | 116 |
| 8 | 3300046511 | Ga0495608_0181040 | Ga0495608_0181040_599_994 | 119 |
| 9 | 3300049742 | Ga0501080_1176813 | Ga0501080_1176813_241_621 | 121 |
| 10 | 3300049743 | Ga0501081_1155998 | Ga0501081_1155998_84_479 | 121 |
| 11 | 3300049824 | Ga0501045_0520842 | Ga0501045_0520842_424_819 | 121 |
| 12 | 3300025923 | Ga0207681_10537408 | Ga0207681_105374082 | 123 |
| 13 | 3300005436 | Ga0070713_100000079 | Ga0070713_10000007953 | 125 |
| 14 | 3300005445 | Ga0070708_100000127 | Ga0070708_10000012748 | 125 |
| 15 | 3300005467 | Ga0070706_100001206 | Ga0070706_1000012064 | 125 |
| 16 | 3300005468 | Ga0070707_100008434 | Ga0070707_1000084343 | 125 |
| 17 | 3300005471 | Ga0070698_100376632 | Ga0070698_1003766322 | 125 |
| 18 | 3300005518 | Ga0070699_100020245 | Ga0070699_1000202456 | 125 |
| 19 | 3300005536 | Ga0070697_100000319 | Ga0070697_10000031915 | 125 |
| 20 | 3300005983 | Ga0081540_1009024 | Ga0081540_10090242 | 125 |
| 21 | 3300007265 | Ga0099794_10000317 | Ga0099794_100003176 | 125 |
| 22 | 3300009093 | Ga0105240_10003665 | Ga0105240_100036652 | 125 |
| 23 | 3300009147 | Ga0114129_10522328 | Ga0114129_105223282 | 125 |
| 24 | 3300025910 | Ga0207684_10000047 | Ga0207684_10000047196 | 125 |
| 25 | 3300025913 | Ga0207695_10049810 | Ga0207695_100498104 | 125 |
| 26 | 3300025922 | Ga0207646_10012901 | Ga0207646_100129012 | 125 |
| 27 | 3300025928 | Ga0207700_10000007 | Ga0207700_1000000768 | 125 |
| 28 | 3300027671 | Ga0209588_1000016 | Ga0209588_100001624 | 125 |
| 29 | 3300044684 | Ga0466966_0957685 | Ga0466966_0957685_126_506 | 125 |
| 30 | 3300003373 | JGI25407J50210_10003345 | JGI25407J50210_100033453 | 126 |
| 31 | 3300003373 | JGI25407J50210_10003751 | JGI25407J50210_100037511 | 126 |
| 32 | 3300003373 | JGI25407J50210_10004139 | JGI25407J50210_100041391 | 126 |
| 33 | 3300003373 | JGI25407J50210_10045251 | JGI25407J50210_100452512 | 126 |
| 34 | 3300005578 | Ga0068854_100738626 | Ga0068854_1007386262 | 126 |
| 35 | 3300005937 | Ga0081455_10082841 | Ga0081455_100828413 | 126 |
| 36 | 3300005981 | Ga0081538_10000035 | Ga0081538_1000003567 | 126 |
| 37 | 3300005981 | Ga0081538_10002058 | Ga0081538_1000205820 | 126 |
| 38 | 3300006042 | Ga0075368_10216393 | Ga0075368_102163932 | 126 |
| 39 | 3300006048 | Ga0075363_100193973 | Ga0075363_1001939732 | 126 |
| 40 | 3300006844 | Ga0075428_100138236 | Ga0075428_1001382362 | 126 |
| 41 | 3300006844 | Ga0075428_100652990 | Ga0075428_1006529902 | 126 |
| 42 | 3300006846 | Ga0075430_100307128 | Ga0075430_1003071282 | 126 |
| 43 | 3300006847 | Ga0075431_100373663 | Ga0075431_1003736632 | 126 |
| 44 | 3300006847 | Ga0075431_100706412 | Ga0075431_1007064122 | 126 |
| 45 | 3300026075 | Ga0207708_10349506 | Ga0207708_103495062 | 126 |
| 46 | 3300031548 | Ga0307408_100368650 | Ga0307408_1003686502 | 126 |
| 47 | 3300031548 | Ga0307408_100787426 | Ga0307408_1007874262 | 126 |
| 48 | 3300031731 | Ga0307405_10823444 | Ga0307405_108234442 | 126 |
| 49 | 3300031824 | Ga0307413_10530109 | Ga0307413_105301092 | 126 |
| 50 | 3300031824 | Ga0307413_11056960 | Ga0307413_110569601 | 126 |
| 51 | 3300031852 | Ga0307410_10305716 | Ga0307410_103057162 | 126 |
| 52 | 3300031852 | Ga0307410_10475140 | Ga0307410_104751402 | 126 |
| 53 | 3300031901 | Ga0307406_10234201 | Ga0307406_102342012 | 126 |
| 54 | 3300031903 | Ga0307407_10331528 | Ga0307407_103315282 | 126 |
| 55 | 3300031903 | Ga0307407_11049357 | Ga0307407_110493572 | 126 |
| 56 | 3300031911 | Ga0307412_10247974 | Ga0307412_102479742 | 126 |
| 57 | 3300031911 | Ga0307412_11078449 | Ga0307412_110784492 | 126 |
| 58 | 3300031995 | Ga0307409_100297346 | Ga0307409_1002973462 | 126 |
| 59 | 3300031995 | Ga0307409_100406829 | Ga0307409_1004068292 | 126 |
| 60 | 3300032002 | Ga0307416_100471998 | Ga0307416_1004719981 | 126 |
| 61 | 3300032002 | Ga0307416_100498553 | Ga0307416_1004985532 | 126 |
| 62 | 3300032004 | Ga0307414_10974487 | Ga0307414_109744872 | 126 |
| 63 | 3300032005 | Ga0307411_10567697 | Ga0307411_105676972 | 126 |
| 64 | 3300032126 | Ga0307415_100173401 | Ga0307415_1001734012 | 126 |
| 65 | 3300039450 | Ga0436363_1470231 | Ga0436363_1470231_518_901 | 126 |
| 66 | 3300044683 | Ga0466965_0481116 | Ga0466965_0481116_234_623 | 126 |
| 67 | 3300044706 | Ga0466964_0043347 | Ga0466964_0043347_550_939 | 126 |
| 68 | 3300045976 | Ga0466967_0252978 | Ga0466967_0252978_1190_1579 | 126 |
| 69 | 3300046500 | Ga0495596_0023720 | Ga0495596_0023720_1621_2004 | 126 |
| 70 | 3300046615 | Ga0495656_0334584 | Ga0495656_0334584_35_418 | 126 |
| 71 | 3300046691 | Ga0495670_0168975 | Ga0495670_0168975_214_597 | 126 |
| 72 | 3300048903 | Ga0496100_0174683 | Ga0496100_0174683_627_1010 | 126 |
| 73 | 3300048903 | Ga0496100_1534716 | Ga0496100_1534716_87_476 | 126 |
| 74 | 3300048904 | Ga0496101_0398490 | Ga0496101_0398490_43_432 | 126 |
| 75 | 3300048910 | Ga0496107_0226511 | Ga0496107_0226511_118_507 | 126 |
| 76 | 3300049741 | Ga0501079_1137010 | Ga0501079_1137010_108_491 | 126 |
| 77 | 3300050494 | nmdc:mga06z11_779797_c1 | nmdc:mga06z11_779797_c1_23_406 | 126 |
| 78 | 3300050510 | nmdc:mga06r32_193547_c1 | nmdc:mga06r32_193547_c1_17_400 | 126 |
| 79 | 3300050510 | nmdc:mga06r32_519487_c1 | nmdc:mga06r32_519487_c1_362_745 | 126 |
| 80 | 3300053083 | Ga0495655_0071852 | Ga0495655_0071852_104_487 | 126 |
| 81 | 3300054114 | Ga0501084_0969359 | Ga0501084_0969359_230_613 | 126 |
| 82 | 3300059640 | Ga0587067_123080 | Ga0587067_123080_14_397 | 126 |
| 83 | 3300000549 | LJQas_1003359 | LJQas_10033592 | 127 |
| 84 | 3300001989 | JGI24739J22299_10190972 | JGI24739J22299_101909721 | 127 |
| 85 | 3300001990 | JGI24737J22298_10161390 | JGI24737J22298_101613901 | 127 |
| 86 | 3300001991 | JGI24743J22301_10016082 | JGI24743J22301_100160822 | 127 |
| 87 | 3300001991 | JGI24743J22301_10028122 | JGI24743J22301_100281221 | 127 |
| 88 | 3300002075 | JGI24738J21930_10126562 | JGI24738J21930_101265621 | 127 |
| 89 | 3300002075 | JGI24738J21930_10136050 | JGI24738J21930_101360501 | 127 |
| 90 | 3300003659 | JGI25404J52841_10062149 | JGI25404J52841_100621491 | 127 |
| 91 | 3300004798 | Ga0058859_11783415 | Ga0058859_117834152 | 127 |
| 92 | 3300005327 | Ga0070658_10042224 | Ga0070658_100422243 | 127 |
| 93 | 3300005328 | Ga0070676_10107599 | Ga0070676_101075992 | 127 |
| 94 | 3300005328 | Ga0070676_10357116 | Ga0070676_103571162 | 127 |
| 95 | 3300005329 | Ga0070683_100048461 | Ga0070683_1000484614 | 127 |
| 96 | 3300005330 | Ga0070690_100182193 | Ga0070690_1001821932 | 127 |
| 97 | 3300005330 | Ga0070690_100946660 | Ga0070690_1009466602 | 127 |
| 98 | 3300005331 | Ga0070670_101115124 | Ga0070670_1011151241 | 127 |
| 99 | 3300005334 | Ga0068869_100280359 | Ga0068869_1002803592 | 127 |
| 100 | 3300005336 | Ga0070680_100329012 | Ga0070680_1003290122 | 127 |
| 101 | 3300005336 | Ga0070680_101177259 | Ga0070680_1011772591 | 127 |
| 102 | 3300005337 | Ga0070682_100013260 | Ga0070682_1000132603 | 127 |
| 103 | 3300005337 | Ga0070682_100034008 | Ga0070682_1000340082 | 127 |
| 104 | 3300005337 | Ga0070682_100188878 | Ga0070682_1001888781 | 127 |
| 105 | 3300005337 | Ga0070682_100926414 | Ga0070682_1009264142 | 127 |
| 106 | 3300005338 | Ga0068868_100000026 | Ga0068868_10000002646 | 127 |
| 107 | 3300005338 | Ga0068868_100013771 | Ga0068868_1000137712 | 127 |
| 108 | 3300005338 | Ga0068868_100022497 | Ga0068868_1000224972 | 127 |
| 109 | 3300005338 | Ga0068868_102147364 | Ga0068868_1021473641 | 127 |
| 110 | 3300005339 | Ga0070660_100009834 | Ga0070660_1000098342 | 127 |
| 111 | 3300005339 | Ga0070660_100124433 | Ga0070660_1001244332 | 127 |
| 112 | 3300005339 | Ga0070660_100725733 | Ga0070660_1007257332 | 127 |
| 113 | 3300005339 | Ga0070660_100772940 | Ga0070660_1007729401 | 127 |
| 114 | 3300005340 | Ga0070689_100110622 | Ga0070689_1001106222 | 127 |
| 115 | 3300005341 | Ga0070691_10025637 | Ga0070691_100256372 | 127 |
| 116 | 3300005341 | Ga0070691_10373969 | Ga0070691_103739692 | 127 |
| 117 | 3300005341 | Ga0070691_10483193 | Ga0070691_104831932 | 127 |
| 118 | 3300005341 | Ga0070691_10524802 | Ga0070691_105248021 | 127 |
| 119 | 3300005343 | Ga0070687_100101359 | Ga0070687_1001013592 | 127 |
| 120 | 3300005344 | Ga0070661_100133458 | Ga0070661_1001334582 | 127 |
| 121 | 3300005344 | Ga0070661_100837222 | Ga0070661_1008372221 | 127 |
| 122 | 3300005345 | Ga0070692_10018760 | Ga0070692_100187602 | 127 |
| 123 | 3300005345 | Ga0070692_10034290 | Ga0070692_100342903 | 127 |
| 124 | 3300005345 | Ga0070692_10080362 | Ga0070692_100803622 | 127 |
| 125 | 3300005347 | Ga0070668_100024328 | Ga0070668_1000243282 | 127 |
| 126 | 3300005347 | Ga0070668_100160546 | Ga0070668_1001605462 | 127 |
| 127 | 3300005347 | Ga0070668_100531729 | Ga0070668_1005317291 | 127 |
| 128 | 3300005353 | Ga0070669_100375280 | Ga0070669_1003752802 | 127 |
| 129 | 3300005354 | Ga0070675_100168821 | Ga0070675_1001688212 | 127 |
| 130 | 3300005355 | Ga0070671_100080735 | Ga0070671_1000807353 | 127 |
| 131 | 3300005356 | Ga0070674_100094652 | Ga0070674_1000946522 | 127 |
| 132 | 3300005356 | Ga0070674_100200525 | Ga0070674_1002005251 | 127 |
| 133 | 3300005356 | Ga0070674_100287818 | Ga0070674_1002878182 | 127 |
| 134 | 3300005356 | Ga0070674_101434100 | Ga0070674_1014341001 | 127 |
| 135 | 3300005364 | Ga0070673_100774118 | Ga0070673_1007741182 | 127 |
| 136 | 3300005365 | Ga0070688_100001123 | Ga0070688_1000011233 | 127 |
| 137 | 3300005365 | Ga0070688_100081740 | Ga0070688_1000817402 | 127 |
| 138 | 3300005365 | Ga0070688_100136059 | Ga0070688_1001360592 | 127 |
| 139 | 3300005366 | Ga0070659_100000450 | Ga0070659_10000045024 | 127 |
| 140 | 3300005366 | Ga0070659_100041398 | Ga0070659_1000413983 | 127 |
| 141 | 3300005366 | Ga0070659_100070835 | Ga0070659_1000708353 | 127 |
| 142 | 3300005367 | Ga0070667_101356301 | Ga0070667_1013563011 | 127 |
| 143 | 3300005406 | Ga0070703_10062472 | Ga0070703_100624722 | 127 |
| 144 | 3300005434 | Ga0070709_10865915 | Ga0070709_108659151 | 127 |
| 145 | 3300005435 | Ga0070714_101535027 | Ga0070714_1015350272 | 127 |
| 146 | 3300005437 | Ga0070710_10149835 | Ga0070710_101498352 | 127 |
| 147 | 3300005437 | Ga0070710_10203644 | Ga0070710_102036442 | 127 |
| 148 | 3300005438 | Ga0070701_10317038 | Ga0070701_103170382 | 127 |
| 149 | 3300005438 | Ga0070701_10383125 | Ga0070701_103831252 | 127 |
| 150 | 3300005438 | Ga0070701_10699009 | Ga0070701_106990091 | 127 |
| 151 | 3300005439 | Ga0070711_100000497 | Ga0070711_1000004976 | 127 |
| 152 | 3300005439 | Ga0070711_100077432 | Ga0070711_1000774322 | 127 |
| 153 | 3300005439 | Ga0070711_100079258 | Ga0070711_1000792582 | 127 |
| 154 | 3300005439 | Ga0070711_100160723 | Ga0070711_1001607232 | 127 |
| 155 | 3300005439 | Ga0070711_100202219 | Ga0070711_1002022191 | 127 |
| 156 | 3300005440 | Ga0070705_100023460 | Ga0070705_1000234602 | 127 |
| 157 | 3300005441 | Ga0070700_100003638 | Ga0070700_1000036385 | 127 |
| 158 | 3300005441 | Ga0070700_100020787 | Ga0070700_1000207875 | 127 |
| 159 | 3300005441 | Ga0070700_100127548 | Ga0070700_1001275482 | 127 |
| 160 | 3300005441 | Ga0070700_100377555 | Ga0070700_1003775552 | 127 |
| 161 | 3300005441 | Ga0070700_100589910 | Ga0070700_1005899102 | 127 |
| 162 | 3300005444 | Ga0070694_100541763 | Ga0070694_1005417632 | 127 |
| 163 | 3300005445 | Ga0070708_100358285 | Ga0070708_1003582852 | 127 |
| 164 | 3300005445 | Ga0070708_101208313 | Ga0070708_1012083131 | 127 |
| 165 | 3300005455 | Ga0070663_100000104 | Ga0070663_10000010414 | 127 |
| 166 | 3300005456 | Ga0070678_100408872 | Ga0070678_1004088721 | 127 |
| 167 | 3300005456 | Ga0070678_100609457 | Ga0070678_1006094571 | 127 |
| 168 | 3300005456 | Ga0070678_101546318 | Ga0070678_1015463181 | 127 |
| 169 | 3300005457 | Ga0070662_100000009 | Ga0070662_10000000933 | 127 |
| 170 | 3300005457 | Ga0070662_100009106 | Ga0070662_1000091063 | 127 |
| 171 | 3300005457 | Ga0070662_100042278 | Ga0070662_1000422782 | 127 |
| 172 | 3300005457 | Ga0070662_100201190 | Ga0070662_1002011902 | 127 |
| 173 | 3300005457 | Ga0070662_100494912 | Ga0070662_1004949122 | 127 |
| 174 | 3300005458 | Ga0070681_10091087 | Ga0070681_100910871 | 127 |
| 175 | 3300005458 | Ga0070681_10257061 | Ga0070681_102570612 | 127 |
| 176 | 3300005458 | Ga0070681_10381672 | Ga0070681_103816722 | 127 |
| 177 | 3300005459 | Ga0068867_100024074 | Ga0068867_1000240743 | 127 |
| 178 | 3300005459 | Ga0068867_101990744 | Ga0068867_1019907441 | 127 |
| 179 | 3300005466 | Ga0070685_10000024 | Ga0070685_1000002450 | 127 |
| 180 | 3300005466 | Ga0070685_10143701 | Ga0070685_101437012 | 127 |
| 181 | 3300005467 | Ga0070706_100372284 | Ga0070706_1003722842 | 127 |
| 182 | 3300005468 | Ga0070707_100204336 | Ga0070707_1002043362 | 127 |
| 183 | 3300005530 | Ga0070679_100000430 | Ga0070679_10000043014 | 127 |
| 184 | 3300005530 | Ga0070679_100687407 | Ga0070679_1006874072 | 127 |
| 185 | 3300005530 | Ga0070679_100953340 | Ga0070679_1009533401 | 127 |
| 186 | 3300005530 | Ga0070679_101228673 | Ga0070679_1012286732 | 127 |
| 187 | 3300005530 | Ga0070679_102211790 | Ga0070679_1022117901 | 127 |
| 188 | 3300005535 | Ga0070684_100087171 | Ga0070684_1000871712 | 127 |
| 189 | 3300005535 | Ga0070684_100216932 | Ga0070684_1002169322 | 127 |
| 190 | 3300005535 | Ga0070684_100461992 | Ga0070684_1004619922 | 127 |
| 191 | 3300005535 | Ga0070684_100669392 | Ga0070684_1006693922 | 127 |
| 192 | 3300005535 | Ga0070684_100980860 | Ga0070684_1009808602 | 127 |
| 193 | 3300005535 | Ga0070684_102287748 | Ga0070684_1022877481 | 127 |
| 194 | 3300005539 | Ga0068853_100040106 | Ga0068853_1000401062 | 127 |
| 195 | 3300005539 | Ga0068853_100377823 | Ga0068853_1003778232 | 127 |
| 196 | 3300005543 | Ga0070672_100000283 | Ga0070672_10000028327 | 127 |
| 197 | 3300005543 | Ga0070672_100013241 | Ga0070672_1000132414 | 127 |
| 198 | 3300005543 | Ga0070672_100241345 | Ga0070672_1002413452 | 127 |
| 199 | 3300005544 | Ga0070686_100013194 | Ga0070686_1000131942 | 127 |
| 200 | 3300005544 | Ga0070686_100021678 | Ga0070686_1000216783 | 127 |
| 201 | 3300005544 | Ga0070686_100141046 | Ga0070686_1001410462 | 127 |
| 202 | 3300005545 | Ga0070695_100059102 | Ga0070695_1000591022 | 127 |
| 203 | 3300005545 | Ga0070695_100167672 | Ga0070695_1001676722 | 127 |
| 204 | 3300005546 | Ga0070696_100122276 | Ga0070696_1001222762 | 127 |
| 205 | 3300005546 | Ga0070696_100193139 | Ga0070696_1001931392 | 127 |
| 206 | 3300005546 | Ga0070696_100700187 | Ga0070696_1007001871 | 127 |
| 207 | 3300005546 | Ga0070696_101267759 | Ga0070696_1012677591 | 127 |
| 208 | 3300005547 | Ga0070693_100070471 | Ga0070693_1000704712 | 127 |
| 209 | 3300005547 | Ga0070693_100383924 | Ga0070693_1003839242 | 127 |
| 210 | 3300005548 | Ga0070665_100895640 | Ga0070665_1008956402 | 127 |
| 211 | 3300005549 | Ga0070704_100028087 | Ga0070704_1000280873 | 127 |
| 212 | 3300005549 | Ga0070704_100158818 | Ga0070704_1001588182 | 127 |
| 213 | 3300005549 | Ga0070704_100562242 | Ga0070704_1005622422 | 127 |
| 214 | 3300005549 | Ga0070704_100638654 | Ga0070704_1006386542 | 127 |
| 215 | 3300005549 | Ga0070704_100733410 | Ga0070704_1007334102 | 127 |
| 216 | 3300005549 | Ga0070704_101688469 | Ga0070704_1016884691 | 127 |
| 217 | 3300005563 | Ga0068855_100655702 | Ga0068855_1006557022 | 127 |
| 218 | 3300005564 | Ga0070664_100028067 | Ga0070664_1000280672 | 127 |
| 219 | 3300005577 | Ga0068857_100116289 | Ga0068857_1001162892 | 127 |
| 220 | 3300005577 | Ga0068857_100761189 | Ga0068857_1007611892 | 127 |
| 221 | 3300005577 | Ga0068857_101572630 | Ga0068857_1015726302 | 127 |
| 222 | 3300005578 | Ga0068854_100023641 | Ga0068854_1000236412 | 127 |
| 223 | 3300005578 | Ga0068854_100048335 | Ga0068854_1000483351 | 127 |
| 224 | 3300005578 | Ga0068854_100221019 | Ga0068854_1002210192 | 127 |
| 225 | 3300005578 | Ga0068854_100569150 | Ga0068854_1005691502 | 127 |
| 226 | 3300005578 | Ga0068854_101151364 | Ga0068854_1011513641 | 127 |
| 227 | 3300005614 | Ga0068856_100054015 | Ga0068856_1000540152 | 127 |
| 228 | 3300005614 | Ga0068856_100100076 | Ga0068856_1001000762 | 127 |
| 229 | 3300005614 | Ga0068856_101203770 | Ga0068856_1012037701 | 127 |
| 230 | 3300005614 | Ga0068856_101258188 | Ga0068856_1012581881 | 127 |
| 231 | 3300005615 | Ga0070702_100016651 | Ga0070702_1000166512 | 127 |
| 232 | 3300005615 | Ga0070702_100095410 | Ga0070702_1000954102 | 127 |
| 233 | 3300005615 | Ga0070702_100100128 | Ga0070702_1001001282 | 127 |
| 234 | 3300005616 | Ga0068852_100066720 | Ga0068852_1000667202 | 127 |
| 235 | 3300005616 | Ga0068852_100271139 | Ga0068852_1002711392 | 127 |
| 236 | 3300005617 | Ga0068859_100028788 | Ga0068859_1000287885 | 127 |
| 237 | 3300005618 | Ga0068864_100363890 | Ga0068864_1003638902 | 127 |
| 238 | 3300005618 | Ga0068864_100514728 | Ga0068864_1005147282 | 127 |
| 239 | 3300005618 | Ga0068864_101214852 | Ga0068864_1012148521 | 127 |
| 240 | 3300005718 | Ga0068866_10205505 | Ga0068866_102055052 | 127 |
| 241 | 3300005718 | Ga0068866_10219342 | Ga0068866_102193422 | 127 |
| 242 | 3300005719 | Ga0068861_100011706 | Ga0068861_1000117063 | 127 |
| 243 | 3300005719 | Ga0068861_100174527 | Ga0068861_1001745272 | 127 |
| 244 | 3300005719 | Ga0068861_100213684 | Ga0068861_1002136842 | 127 |
| 245 | 3300005719 | Ga0068861_100957270 | Ga0068861_1009572702 | 127 |
| 246 | 3300005834 | Ga0068851_10161296 | Ga0068851_101612962 | 127 |
| 247 | 3300005834 | Ga0068851_10462195 | Ga0068851_104621952 | 127 |
| 248 | 3300005840 | Ga0068870_10061404 | Ga0068870_100614042 | 127 |
| 249 | 3300005840 | Ga0068870_10740057 | Ga0068870_107400571 | 127 |
| 250 | 3300005841 | Ga0068863_100440502 | Ga0068863_1004405022 | 127 |
| 251 | 3300005841 | Ga0068863_101090061 | Ga0068863_1010900612 | 127 |
| 252 | 3300005842 | Ga0068858_100083115 | Ga0068858_1000831152 | 127 |
| 253 | 3300005842 | Ga0068858_100160734 | Ga0068858_1001607343 | 127 |
| 254 | 3300005843 | Ga0068860_101836034 | Ga0068860_1018360342 | 127 |
| 255 | 3300005844 | Ga0068862_101258074 | Ga0068862_1012580742 | 127 |
| 256 | 3300005844 | Ga0068862_101265504 | Ga0068862_1012655042 | 127 |
| 257 | 3300005844 | Ga0068862_102036393 | Ga0068862_1020363931 | 127 |
| 258 | 3300005937 | Ga0081455_10058384 | Ga0081455_100583842 | 127 |
| 259 | 3300005937 | Ga0081455_10097913 | Ga0081455_100979133 | 127 |
| 260 | 3300005937 | Ga0081455_10617615 | Ga0081455_106176152 | 127 |
| 261 | 3300005981 | Ga0081538_10016003 | Ga0081538_100160034 | 127 |
| 262 | 3300005981 | Ga0081538_10038766 | Ga0081538_100387662 | 127 |
| 263 | 3300005981 | Ga0081538_10087819 | Ga0081538_100878192 | 127 |
| 264 | 3300005981 | Ga0081538_10155902 | Ga0081538_101559021 | 127 |
| 265 | 3300005981 | Ga0081538_10238932 | Ga0081538_102389322 | 127 |
| 266 | 3300005983 | Ga0081540_1005020 | Ga0081540_10050204 | 127 |
| 267 | 3300005983 | Ga0081540_1050501 | Ga0081540_10505012 | 127 |
| 268 | 3300005985 | Ga0081539_10116145 | Ga0081539_101161453 | 127 |
| 269 | 3300005985 | Ga0081539_10183926 | Ga0081539_101839261 | 127 |
| 270 | 3300005985 | Ga0081539_10243597 | Ga0081539_102435971 | 127 |
| 271 | 3300006038 | Ga0075365_10002863 | Ga0075365_100028637 | 127 |
| 272 | 3300006038 | Ga0075365_10038880 | Ga0075365_100388803 | 127 |
| 273 | 3300006038 | Ga0075365_10074921 | Ga0075365_100749212 | 127 |
| 274 | 3300006038 | Ga0075365_10170248 | Ga0075365_101702482 | 127 |
| 275 | 3300006038 | Ga0075365_10665482 | Ga0075365_106654822 | 127 |
| 276 | 3300006048 | Ga0075363_100003547 | Ga0075363_1000035477 | 127 |
| 277 | 3300006051 | Ga0075364_10012604 | Ga0075364_100126043 | 127 |
| 278 | 3300006051 | Ga0075364_10017734 | Ga0075364_100177343 | 127 |
| 279 | 3300006051 | Ga0075364_10033710 | Ga0075364_100337103 | 127 |
| 280 | 3300006051 | Ga0075364_10538871 | Ga0075364_105388712 | 127 |
| 281 | 3300006058 | Ga0075432_10018617 | Ga0075432_100186172 | 127 |
| 282 | 3300006058 | Ga0075432_10025797 | Ga0075432_100257972 | 127 |
| 283 | 3300006175 | Ga0070712_100048741 | Ga0070712_1000487412 | 127 |
| 284 | 3300006175 | Ga0070712_100132854 | Ga0070712_1001328541 | 127 |
| 285 | 3300006175 | Ga0070712_100333897 | Ga0070712_1003338972 | 127 |
| 286 | 3300006178 | Ga0075367_10418647 | Ga0075367_104186472 | 127 |
| 287 | 3300006237 | Ga0097621_100627036 | Ga0097621_1006270362 | 127 |
| 288 | 3300006358 | Ga0068871_100231571 | Ga0068871_1002315712 | 127 |
| 289 | 3300006358 | Ga0068871_101505215 | Ga0068871_1015052151 | 127 |
| 290 | 3300006844 | Ga0075428_100016818 | Ga0075428_1000168186 | 127 |
| 291 | 3300006844 | Ga0075428_100068173 | Ga0075428_1000681733 | 127 |
| 292 | 3300006844 | Ga0075428_100299641 | Ga0075428_1002996412 | 127 |
| 293 | 3300006844 | Ga0075428_101203150 | Ga0075428_1012031502 | 127 |
| 294 | 3300006844 | Ga0075428_101303274 | Ga0075428_1013032742 | 127 |
| 295 | 3300006846 | Ga0075430_100010387 | Ga0075430_1000103876 | 127 |
| 296 | 3300006846 | Ga0075430_100032438 | Ga0075430_1000324383 | 127 |
| 297 | 3300006846 | Ga0075430_100034598 | Ga0075430_1000345985 | 127 |
| 298 | 3300006847 | Ga0075431_100181290 | Ga0075431_1001812902 | 127 |
| 299 | 3300006847 | Ga0075431_100323459 | Ga0075431_1003234592 | 127 |
| 300 | 3300006847 | Ga0075431_100369503 | Ga0075431_1003695031 | 127 |
| 301 | 3300006847 | Ga0075431_100508849 | Ga0075431_1005088492 | 127 |
| 302 | 3300006852 | Ga0075433_10069082 | Ga0075433_100690823 | 127 |
| 303 | 3300006852 | Ga0075433_10177895 | Ga0075433_101778952 | 127 |
| 304 | 3300006871 | Ga0075434_100057440 | Ga0075434_1000574403 | 127 |
| 305 | 3300006871 | Ga0075434_100667233 | Ga0075434_1006672332 | 127 |
| 306 | 3300006871 | Ga0075434_100934082 | Ga0075434_1009340822 | 127 |
| 307 | 3300006871 | Ga0075434_101075089 | Ga0075434_1010750892 | 127 |
| 308 | 3300006871 | Ga0075434_102596508 | Ga0075434_1025965082 | 127 |
| 309 | 3300006880 | Ga0075429_100024381 | Ga0075429_1000243812 | 127 |
| 310 | 3300006880 | Ga0075429_100283950 | Ga0075429_1002839502 | 127 |
| 311 | 3300006880 | Ga0075429_100415206 | Ga0075429_1004152062 | 127 |
| 312 | 3300006880 | Ga0075429_100518281 | Ga0075429_1005182812 | 127 |
| 313 | 3300006881 | Ga0068865_100005630 | Ga0068865_1000056303 | 127 |
| 314 | 3300006881 | Ga0068865_101392870 | Ga0068865_1013928702 | 127 |
| 315 | 3300006914 | Ga0075436_100858152 | Ga0075436_1008581522 | 127 |
| 316 | 3300006931 | Ga0097620_100028786 | Ga0097620_1000287865 | 127 |
| 317 | 3300007076 | Ga0075435_100374339 | Ga0075435_1003743392 | 127 |
| 318 | 3300007076 | Ga0075435_100459793 | Ga0075435_1004597932 | 127 |
| 319 | 3300009011 | Ga0105251_10104591 | Ga0105251_101045912 | 127 |
| 320 | 3300009093 | Ga0105240_10304470 | Ga0105240_103044703 | 127 |
| 321 | 3300009094 | Ga0111539_10077902 | Ga0111539_100779024 | 127 |
| 322 | 3300009094 | Ga0111539_10079936 | Ga0111539_100799363 | 127 |
| 323 | 3300009094 | Ga0111539_10090862 | Ga0111539_100908624 | 127 |
| 324 | 3300009094 | Ga0111539_10099470 | Ga0111539_100994702 | 127 |
| 325 | 3300009094 | Ga0111539_10133033 | Ga0111539_101330332 | 127 |
| 326 | 3300009094 | Ga0111539_10162982 | Ga0111539_101629823 | 127 |
| 327 | 3300009094 | Ga0111539_10269372 | Ga0111539_102693722 | 127 |
| 328 | 3300009094 | Ga0111539_13171834 | Ga0111539_131718342 | 127 |
| 329 | 3300009098 | Ga0105245_10002293 | Ga0105245_1000229320 | 127 |
| 330 | 3300009098 | Ga0105245_10005001 | Ga0105245_1000500110 | 127 |
| 331 | 3300009098 | Ga0105245_10021965 | Ga0105245_100219654 | 127 |
| 332 | 3300009098 | Ga0105245_10236355 | Ga0105245_102363552 | 127 |
| 333 | 3300009098 | Ga0105245_10253919 | Ga0105245_102539192 | 127 |
| 334 | 3300009098 | Ga0105245_10333199 | Ga0105245_103331992 | 127 |
| 335 | 3300009098 | Ga0105245_10357332 | Ga0105245_103573322 | 127 |
| 336 | 3300009098 | Ga0105245_11935364 | Ga0105245_119353642 | 127 |
| 337 | 3300009098 | Ga0105245_12688276 | Ga0105245_126882762 | 127 |
| 338 | 3300009101 | Ga0105247_10098886 | Ga0105247_100988862 | 127 |
| 339 | 3300009101 | Ga0105247_10643460 | Ga0105247_106434602 | 127 |
| 340 | 3300009147 | Ga0114129_10003411 | Ga0114129_100034113 | 127 |
| 341 | 3300009147 | Ga0114129_10005383 | Ga0114129_100053837 | 127 |
| 342 | 3300009147 | Ga0114129_10006344 | Ga0114129_100063442 | 127 |
| 343 | 3300009147 | Ga0114129_10024361 | Ga0114129_100243615 | 127 |
| 344 | 3300009147 | Ga0114129_10025786 | Ga0114129_100257862 | 127 |
| 345 | 3300009147 | Ga0114129_10063226 | Ga0114129_100632263 | 127 |
| 346 | 3300009147 | Ga0114129_10230121 | Ga0114129_102301212 | 127 |
| 347 | 3300009147 | Ga0114129_10374892 | Ga0114129_103748922 | 127 |
| 348 | 3300009147 | Ga0114129_10606212 | Ga0114129_106062122 | 127 |
| 349 | 3300009147 | Ga0114129_11151010 | Ga0114129_111510102 | 127 |
| 350 | 3300009147 | Ga0114129_13283356 | Ga0114129_132833561 | 127 |
| 351 | 3300009148 | Ga0105243_10001579 | Ga0105243_100015793 | 127 |
| 352 | 3300009148 | Ga0105243_10060424 | Ga0105243_100604242 | 127 |
| 353 | 3300009148 | Ga0105243_10392824 | Ga0105243_103928242 | 127 |
| 354 | 3300009148 | Ga0105243_10733590 | Ga0105243_107335902 | 127 |
| 355 | 3300009148 | Ga0105243_11304143 | Ga0105243_113041432 | 127 |
| 356 | 3300009148 | Ga0105243_11797446 | Ga0105243_117974461 | 127 |
| 357 | 3300009148 | Ga0105243_12558535 | Ga0105243_125585351 | 127 |
| 358 | 3300009148 | Ga0105243_12977471 | Ga0105243_129774711 | 127 |
| 359 | 3300009174 | Ga0105241_10688089 | Ga0105241_106880892 | 127 |
| 360 | 3300009174 | Ga0105241_10882218 | Ga0105241_108822182 | 127 |
| 361 | 3300009176 | Ga0105242_10658791 | Ga0105242_106587912 | 127 |
| 362 | 3300009176 | Ga0105242_11080811 | Ga0105242_110808112 | 127 |
| 363 | 3300009176 | Ga0105242_11133783 | Ga0105242_111337831 | 127 |
| 364 | 3300009176 | Ga0105242_11258245 | Ga0105242_112582452 | 127 |
| 365 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008162 | 127 |
| 366 | 3300009177 | Ga0105248_10198030 | Ga0105248_101980302 | 127 |
| 367 | 3300009177 | Ga0105248_10412279 | Ga0105248_104122792 | 127 |
| 368 | 3300009545 | Ga0105237_10314547 | Ga0105237_103145472 | 127 |
| 369 | 3300009545 | Ga0105237_10720834 | Ga0105237_107208342 | 127 |
| 370 | 3300009545 | Ga0105237_10914927 | Ga0105237_109149271 | 127 |
| 371 | 3300009551 | Ga0105238_10201130 | Ga0105238_102011302 | 127 |
| 372 | 3300009551 | Ga0105238_10388862 | Ga0105238_103888622 | 127 |
| 373 | 3300009551 | Ga0105238_10516037 | Ga0105238_105160372 | 127 |
| 374 | 3300009553 | Ga0105249_10004662 | Ga0105249_100046623 | 127 |
| 375 | 3300009553 | Ga0105249_10036499 | Ga0105249_100364992 | 127 |
| 376 | 3300009553 | Ga0105249_10062840 | Ga0105249_100628402 | 127 |
| 377 | 3300009553 | Ga0105249_10186065 | Ga0105249_101860653 | 127 |
| 378 | 3300009553 | Ga0105249_10406820 | Ga0105249_104068202 | 127 |
| 379 | 3300009553 | Ga0105249_11138076 | Ga0105249_111380762 | 127 |
| 380 | 3300009553 | Ga0105249_12089740 | Ga0105249_120897402 | 127 |
| 381 | 3300009553 | Ga0105249_12940483 | Ga0105249_129404832 | 127 |
| 382 | 3300009978 | Ga0105148_123194 | Ga0105148_1231941 | 127 |
| 383 | 3300010375 | Ga0105239_10009680 | Ga0105239_100096809 | 127 |
| 384 | 3300010375 | Ga0105239_10199135 | Ga0105239_101991352 | 127 |
| 385 | 3300010375 | Ga0105239_10291479 | Ga0105239_102914792 | 127 |
| 386 | 3300010375 | Ga0105239_10498189 | Ga0105239_104981892 | 127 |
| 387 | 3300010375 | Ga0105239_11534687 | Ga0105239_115346872 | 127 |
| 388 | 3300010375 | Ga0105239_11885062 | Ga0105239_118850622 | 127 |
| 389 | 3300011119 | Ga0105246_10103171 | Ga0105246_101031712 | 127 |
| 390 | 3300011119 | Ga0105246_10281410 | Ga0105246_102814102 | 127 |
| 391 | 3300011119 | Ga0105246_10852061 | Ga0105246_108520612 | 127 |
| 392 | 3300011119 | Ga0105246_11426980 | Ga0105246_114269801 | 127 |
| 393 | 3300012506 | Ga0157324_1040859 | Ga0157324_10408591 | 127 |
| 394 | 3300013100 | Ga0157373_10858711 | Ga0157373_108587112 | 127 |
| 395 | 3300013102 | Ga0157371_10254600 | Ga0157371_102546002 | 127 |
| 396 | 3300013102 | Ga0157371_10298410 | Ga0157371_102984102 | 127 |
| 397 | 3300013105 | Ga0157369_10578664 | Ga0157369_105786642 | 127 |
| 398 | 3300013105 | Ga0157369_10588887 | Ga0157369_105888872 | 127 |
| 399 | 3300013296 | Ga0157374_10404701 | Ga0157374_104047012 | 127 |
| 400 | 3300013296 | Ga0157374_10408904 | Ga0157374_104089042 | 127 |
| 401 | 3300013296 | Ga0157374_10599913 | Ga0157374_105999132 | 127 |
| 402 | 3300013297 | Ga0157378_10435956 | Ga0157378_104359562 | 127 |
| 403 | 3300013297 | Ga0157378_10486661 | Ga0157378_104866612 | 127 |
| 404 | 3300013297 | Ga0157378_10821452 | Ga0157378_108214522 | 127 |
| 405 | 3300013297 | Ga0157378_12850850 | Ga0157378_128508502 | 127 |
| 406 | 3300013306 | Ga0163162_10071093 | Ga0163162_100710932 | 127 |
| 407 | 3300013306 | Ga0163162_10088029 | Ga0163162_100880293 | 127 |
| 408 | 3300013306 | Ga0163162_10470168 | Ga0163162_104701682 | 127 |
| 409 | 3300013307 | Ga0157372_10269173 | Ga0157372_102691732 | 127 |
| 410 | 3300013307 | Ga0157372_10287044 | Ga0157372_102870442 | 127 |
| 411 | 3300013307 | Ga0157372_10326295 | Ga0157372_103262951 | 127 |
| 412 | 3300013308 | Ga0157375_10055287 | Ga0157375_100552872 | 127 |
| 413 | 3300013308 | Ga0157375_10318580 | Ga0157375_103185802 | 127 |
| 414 | 3300013308 | Ga0157375_10865425 | Ga0157375_108654252 | 127 |
| 415 | 3300013308 | Ga0157375_11487420 | Ga0157375_114874202 | 127 |
| 416 | 3300013308 | Ga0157375_12405654 | Ga0157375_124056542 | 127 |
| 417 | 3300013308 | Ga0157375_12591540 | Ga0157375_125915401 | 127 |
| 418 | 3300014325 | Ga0163163_10615414 | Ga0163163_106154142 | 127 |
| 419 | 3300014325 | Ga0163163_10644957 | Ga0163163_106449572 | 127 |
| 420 | 3300014326 | Ga0157380_11433390 | Ga0157380_114333902 | 127 |
| 421 | 3300014497 | Ga0182008_10609015 | Ga0182008_106090152 | 127 |
| 422 | 3300014497 | Ga0182008_10735549 | Ga0182008_107355491 | 127 |
| 423 | 3300014745 | Ga0157377_10023806 | Ga0157377_100238062 | 127 |
| 424 | 3300014745 | Ga0157377_10110244 | Ga0157377_101102442 | 127 |
| 425 | 3300014745 | Ga0157377_10270898 | Ga0157377_102708982 | 127 |
| 426 | 3300014745 | Ga0157377_11155193 | Ga0157377_111551931 | 127 |
| 427 | 3300014968 | Ga0157379_10326789 | Ga0157379_103267892 | 127 |
| 428 | 3300014969 | Ga0157376_10111081 | Ga0157376_101110812 | 127 |
| 429 | 3300014969 | Ga0157376_10670151 | Ga0157376_106701512 | 127 |
| 430 | 3300020069 | Ga0197907_11097511 | Ga0197907_110975112 | 127 |
| 431 | 3300020070 | Ga0206356_10483172 | Ga0206356_104831722 | 127 |
| 432 | 3300020077 | Ga0206351_10176479 | Ga0206351_101764792 | 127 |
| 433 | 3300020080 | Ga0206350_10275672 | Ga0206350_102756722 | 127 |
| 434 | 3300020080 | Ga0206350_10560135 | Ga0206350_105601352 | 127 |
| 435 | 3300020081 | Ga0206354_11057515 | Ga0206354_110575152 | 127 |
| 436 | 3300020081 | Ga0206354_11261973 | Ga0206354_112619732 | 127 |
| 437 | 3300020081 | Ga0206354_11502332 | Ga0206354_115023322 | 127 |
| 438 | 3300020082 | Ga0206353_11195742 | Ga0206353_111957422 | 127 |
| 439 | 3300021377 | Ga0213874_10103837 | Ga0213874_101038372 | 127 |
| 440 | 3300021384 | Ga0213876_10002786 | Ga0213876_100027864 | 127 |
| 441 | 3300021384 | Ga0213876_10021465 | Ga0213876_100214653 | 127 |
| 442 | 3300021388 | Ga0213875_10018820 | Ga0213875_100188202 | 127 |
| 443 | 3300021388 | Ga0213875_10024795 | Ga0213875_100247953 | 127 |
| 444 | 3300025321 | Ga0207656_10028437 | Ga0207656_100284372 | 127 |
| 445 | 3300025321 | Ga0207656_10178008 | Ga0207656_101780082 | 127 |
| 446 | 3300025898 | Ga0207692_10133495 | Ga0207692_101334952 | 127 |
| 447 | 3300025898 | Ga0207692_10176227 | Ga0207692_101762272 | 127 |
| 448 | 3300025899 | Ga0207642_10047533 | Ga0207642_100475332 | 127 |
| 449 | 3300025899 | Ga0207642_10323489 | Ga0207642_103234891 | 127 |
| 450 | 3300025899 | Ga0207642_10605425 | Ga0207642_106054251 | 127 |
| 451 | 3300025900 | Ga0207710_10137187 | Ga0207710_101371872 | 127 |
| 452 | 3300025901 | Ga0207688_10028678 | Ga0207688_100286783 | 127 |
| 453 | 3300025901 | Ga0207688_10175358 | Ga0207688_101753582 | 127 |
| 454 | 3300025903 | Ga0207680_10060775 | Ga0207680_100607752 | 127 |
| 455 | 3300025904 | Ga0207647_10099475 | Ga0207647_100994752 | 127 |
| 456 | 3300025904 | Ga0207647_10389681 | Ga0207647_103896812 | 127 |
| 457 | 3300025904 | Ga0207647_10668759 | Ga0207647_106687592 | 127 |
| 458 | 3300025907 | Ga0207645_10253181 | Ga0207645_102531812 | 127 |
| 459 | 3300025907 | Ga0207645_10563836 | Ga0207645_105638362 | 127 |
| 460 | 3300025908 | Ga0207643_10030222 | Ga0207643_100302223 | 127 |
| 461 | 3300025908 | Ga0207643_10072603 | Ga0207643_100726031 | 127 |
| 462 | 3300025911 | Ga0207654_11438856 | Ga0207654_114388562 | 127 |
| 463 | 3300025912 | Ga0207707_10129640 | Ga0207707_101296402 | 127 |
| 464 | 3300025912 | Ga0207707_10172122 | Ga0207707_101721223 | 127 |
| 465 | 3300025913 | Ga0207695_10421865 | Ga0207695_104218652 | 127 |
| 466 | 3300025914 | Ga0207671_10215198 | Ga0207671_102151982 | 127 |
| 467 | 3300025915 | Ga0207693_10016724 | Ga0207693_100167242 | 127 |
| 468 | 3300025915 | Ga0207693_10062157 | Ga0207693_100621572 | 127 |
| 469 | 3300025916 | Ga0207663_10005141 | Ga0207663_100051415 | 127 |
| 470 | 3300025916 | Ga0207663_10065387 | Ga0207663_100653872 | 127 |
| 471 | 3300025916 | Ga0207663_10467236 | Ga0207663_104672362 | 127 |
| 472 | 3300025916 | Ga0207663_11688829 | Ga0207663_116888291 | 127 |
| 473 | 3300025917 | Ga0207660_10783540 | Ga0207660_107835402 | 127 |
| 474 | 3300025918 | Ga0207662_10005024 | Ga0207662_100050242 | 127 |
| 475 | 3300025919 | Ga0207657_10002552 | Ga0207657_100025525 | 127 |
| 476 | 3300025919 | Ga0207657_10054230 | Ga0207657_100542303 | 127 |
| 477 | 3300025919 | Ga0207657_10119163 | Ga0207657_101191632 | 127 |
| 478 | 3300025919 | Ga0207657_10843779 | Ga0207657_108437792 | 127 |
| 479 | 3300025920 | Ga0207649_10018935 | Ga0207649_100189354 | 127 |
| 480 | 3300025920 | Ga0207649_10340233 | Ga0207649_103402332 | 127 |
| 481 | 3300025920 | Ga0207649_10519642 | Ga0207649_105196422 | 127 |
| 482 | 3300025921 | Ga0207652_10001888 | Ga0207652_100018882 | 127 |
| 483 | 3300025921 | Ga0207652_10333537 | Ga0207652_103335372 | 127 |
| 484 | 3300025921 | Ga0207652_11059668 | Ga0207652_110596682 | 127 |
| 485 | 3300025922 | Ga0207646_10496162 | Ga0207646_104961622 | 127 |
| 486 | 3300025922 | Ga0207646_10836387 | Ga0207646_108363872 | 127 |
| 487 | 3300025923 | Ga0207681_10363260 | Ga0207681_103632602 | 127 |
| 488 | 3300025923 | Ga0207681_10875072 | Ga0207681_108750722 | 127 |
| 489 | 3300025924 | Ga0207694_10210635 | Ga0207694_102106352 | 127 |
| 490 | 3300025924 | Ga0207694_11103124 | Ga0207694_111031242 | 127 |
| 491 | 3300025926 | Ga0207659_10052243 | Ga0207659_100522432 | 127 |
| 492 | 3300025926 | Ga0207659_10526793 | Ga0207659_105267932 | 127 |
| 493 | 3300025927 | Ga0207687_10034419 | Ga0207687_100344193 | 127 |
| 494 | 3300025927 | Ga0207687_10269701 | Ga0207687_102697012 | 127 |
| 495 | 3300025927 | Ga0207687_10320219 | Ga0207687_103202192 | 127 |
| 496 | 3300025927 | Ga0207687_10533723 | Ga0207687_105337232 | 127 |
| 497 | 3300025927 | Ga0207687_10535322 | Ga0207687_105353222 | 127 |
| 498 | 3300025931 | Ga0207644_10115427 | Ga0207644_101154272 | 127 |
| 499 | 3300025931 | Ga0207644_10574342 | Ga0207644_105743422 | 127 |
| 500 | 3300025931 | Ga0207644_10940662 | Ga0207644_109406622 | 127 |
| 501 | 3300025932 | Ga0207690_10029154 | Ga0207690_100291544 | 127 |
| 502 | 3300025932 | Ga0207690_10032974 | Ga0207690_100329743 | 127 |
| 503 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001120 | 127 |
| 504 | 3300025933 | Ga0207706_10003250 | Ga0207706_100032501 | 127 |
| 505 | 3300025933 | Ga0207706_10011806 | Ga0207706_100118065 | 127 |
| 506 | 3300025933 | Ga0207706_10226661 | Ga0207706_102266612 | 127 |
| 507 | 3300025933 | Ga0207706_10932796 | Ga0207706_109327962 | 127 |
| 508 | 3300025935 | Ga0207709_10036448 | Ga0207709_100364482 | 127 |
| 509 | 3300025935 | Ga0207709_10111344 | Ga0207709_101113442 | 127 |
| 510 | 3300025935 | Ga0207709_10174005 | Ga0207709_101740052 | 127 |
| 511 | 3300025935 | Ga0207709_10384838 | Ga0207709_103848382 | 127 |
| 512 | 3300025937 | Ga0207669_10018416 | Ga0207669_100184162 | 127 |
| 513 | 3300025937 | Ga0207669_10109891 | Ga0207669_101098912 | 127 |
| 514 | 3300025937 | Ga0207669_10658865 | Ga0207669_106588652 | 127 |
| 515 | 3300025937 | Ga0207669_11293120 | Ga0207669_112931202 | 127 |
| 516 | 3300025938 | Ga0207704_10006431 | Ga0207704_100064315 | 127 |
| 517 | 3300025939 | Ga0207665_11071266 | Ga0207665_110712661 | 127 |
| 518 | 3300025940 | Ga0207691_10000934 | Ga0207691_1000093427 | 127 |
| 519 | 3300025940 | Ga0207691_10025843 | Ga0207691_100258436 | 127 |
| 520 | 3300025940 | Ga0207691_10126820 | Ga0207691_101268202 | 127 |
| 521 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006557 | 127 |
| 522 | 3300025941 | Ga0207711_10481421 | Ga0207711_104814212 | 127 |
| 523 | 3300025942 | Ga0207689_10066855 | Ga0207689_100668552 | 127 |
| 524 | 3300025942 | Ga0207689_10167201 | Ga0207689_101672012 | 127 |
| 525 | 3300025944 | Ga0207661_10019528 | Ga0207661_100195283 | 127 |
| 526 | 3300025944 | Ga0207661_10138898 | Ga0207661_101388982 | 127 |
| 527 | 3300025944 | Ga0207661_10374056 | Ga0207661_103740562 | 127 |
| 528 | 3300025944 | Ga0207661_11128205 | Ga0207661_111282052 | 127 |
| 529 | 3300025945 | Ga0207679_10401709 | Ga0207679_104017092 | 127 |
| 530 | 3300025949 | Ga0207667_10719665 | Ga0207667_107196652 | 127 |
| 531 | 3300025960 | Ga0207651_10026571 | Ga0207651_100265712 | 127 |
| 532 | 3300025960 | Ga0207651_11506213 | Ga0207651_115062132 | 127 |
| 533 | 3300025961 | Ga0207712_10010679 | Ga0207712_100106792 | 127 |
| 534 | 3300025961 | Ga0207712_10147605 | Ga0207712_101476052 | 127 |
| 535 | 3300025961 | Ga0207712_10169272 | Ga0207712_101692721 | 127 |
| 536 | 3300025961 | Ga0207712_10305562 | Ga0207712_103055622 | 127 |
| 537 | 3300025961 | Ga0207712_10621263 | Ga0207712_106212632 | 127 |
| 538 | 3300025961 | Ga0207712_11345001 | Ga0207712_113450012 | 127 |
| 539 | 3300025972 | Ga0207668_10014261 | Ga0207668_100142614 | 127 |
| 540 | 3300025972 | Ga0207668_10318815 | Ga0207668_103188152 | 127 |
| 541 | 3300025972 | Ga0207668_11593592 | Ga0207668_115935921 | 127 |
| 542 | 3300025972 | Ga0207668_12107192 | Ga0207668_121071922 | 127 |
| 543 | 3300025981 | Ga0207640_10029686 | Ga0207640_100296863 | 127 |
| 544 | 3300025981 | Ga0207640_10235450 | Ga0207640_102354502 | 127 |
| 545 | 3300025981 | Ga0207640_10382153 | Ga0207640_103821532 | 127 |
| 546 | 3300025986 | Ga0207658_10663228 | Ga0207658_106632282 | 127 |
| 547 | 3300025986 | Ga0207658_10839912 | Ga0207658_108399122 | 127 |
| 548 | 3300026023 | Ga0207677_10000106 | Ga0207677_1000010633 | 127 |
| 549 | 3300026023 | Ga0207677_10018790 | Ga0207677_100187903 | 127 |
| 550 | 3300026023 | Ga0207677_10210514 | Ga0207677_102105142 | 127 |
| 551 | 3300026023 | Ga0207677_11271484 | Ga0207677_112714842 | 127 |
| 552 | 3300026035 | Ga0207703_10133455 | Ga0207703_101334553 | 127 |
| 553 | 3300026041 | Ga0207639_10050495 | Ga0207639_100504953 | 127 |
| 554 | 3300026067 | Ga0207678_10000152 | Ga0207678_1000015250 | 127 |
| 555 | 3300026067 | Ga0207678_10006012 | Ga0207678_100060123 | 127 |
| 556 | 3300026067 | Ga0207678_10296183 | Ga0207678_102961832 | 127 |
| 557 | 3300026075 | Ga0207708_10000518 | Ga0207708_1000051810 | 127 |
| 558 | 3300026075 | Ga0207708_10001883 | Ga0207708_100018837 | 127 |
| 559 | 3300026075 | Ga0207708_10206704 | Ga0207708_102067042 | 127 |
| 560 | 3300026075 | Ga0207708_10667001 | Ga0207708_106670012 | 127 |
| 561 | 3300026078 | Ga0207702_10017839 | Ga0207702_100178394 | 127 |
| 562 | 3300026078 | Ga0207702_10052231 | Ga0207702_100522313 | 127 |
| 563 | 3300026078 | Ga0207702_10995014 | Ga0207702_109950142 | 127 |
| 564 | 3300026088 | Ga0207641_10557472 | Ga0207641_105574722 | 127 |
| 565 | 3300026089 | Ga0207648_10015251 | Ga0207648_100152513 | 127 |
| 566 | 3300026089 | Ga0207648_10032791 | Ga0207648_100327913 | 127 |
| 567 | 3300026089 | Ga0207648_10651690 | Ga0207648_106516902 | 127 |
| 568 | 3300026089 | Ga0207648_11800609 | Ga0207648_118006091 | 127 |
| 569 | 3300026095 | Ga0207676_10071048 | Ga0207676_100710483 | 127 |
| 570 | 3300026095 | Ga0207676_10196557 | Ga0207676_101965572 | 127 |
| 571 | 3300026095 | Ga0207676_11252395 | Ga0207676_112523952 | 127 |
| 572 | 3300026116 | Ga0207674_10063341 | Ga0207674_100633412 | 127 |
| 573 | 3300026116 | Ga0207674_10451099 | Ga0207674_104510992 | 127 |
| 574 | 3300026116 | Ga0207674_10619249 | Ga0207674_106192492 | 127 |
| 575 | 3300026116 | Ga0207674_10723951 | Ga0207674_107239511 | 127 |
| 576 | 3300026116 | Ga0207674_10984215 | Ga0207674_109842152 | 127 |
| 577 | 3300026118 | Ga0207675_100000091 | Ga0207675_10000009122 | 127 |
| 578 | 3300026118 | Ga0207675_100012493 | Ga0207675_1000124935 | 127 |
| 579 | 3300026118 | Ga0207675_100248908 | Ga0207675_1002489082 | 127 |
| 580 | 3300026118 | Ga0207675_100575891 | Ga0207675_1005758912 | 127 |
| 581 | 3300026118 | Ga0207675_100901786 | Ga0207675_1009017861 | 127 |
| 582 | 3300026118 | Ga0207675_101257124 | Ga0207675_1012571241 | 127 |
| 583 | 3300026118 | Ga0207675_101259102 | Ga0207675_1012591022 | 127 |
| 584 | 3300026118 | Ga0207675_102374337 | Ga0207675_1023743372 | 127 |
| 585 | 3300026121 | Ga0207683_10044824 | Ga0207683_100448243 | 127 |
| 586 | 3300026121 | Ga0207683_11197344 | Ga0207683_111973442 | 127 |
| 587 | 3300026121 | Ga0207683_12011748 | Ga0207683_120117482 | 127 |
| 588 | 3300026142 | Ga0207698_10025692 | Ga0207698_100256922 | 127 |
| 589 | 3300026142 | Ga0207698_10456873 | Ga0207698_104568732 | 127 |
| 590 | 3300026142 | Ga0207698_12549727 | Ga0207698_125497271 | 127 |
| 591 | 3300027907 | Ga0207428_10385388 | Ga0207428_103853882 | 127 |
| 592 | 3300027907 | Ga0207428_10386459 | Ga0207428_103864592 | 127 |
| 593 | 3300027907 | Ga0207428_10658649 | Ga0207428_106586492 | 127 |
| 594 | 3300027907 | Ga0207428_10671129 | Ga0207428_106711292 | 127 |
| 595 | 3300028380 | Ga0268265_10065021 | Ga0268265_100650213 | 127 |
| 596 | 3300028380 | Ga0268265_10811010 | Ga0268265_108110102 | 127 |
| 597 | 3300028380 | Ga0268265_11543743 | Ga0268265_115437432 | 127 |
| 598 | 3300028381 | Ga0268264_10270291 | Ga0268264_102702912 | 127 |
| 599 | 3300028381 | Ga0268264_10363390 | Ga0268264_103633902 | 127 |
| 600 | 3300031344 | Ga0265316_10084288 | Ga0265316_100842882 | 127 |
| 601 | 3300031548 | Ga0307408_100058956 | Ga0307408_1000589563 | 127 |
| 602 | 3300031548 | Ga0307408_100290998 | Ga0307408_1002909982 | 127 |
| 603 | 3300031731 | Ga0307405_10091008 | Ga0307405_100910082 | 127 |
| 604 | 3300031731 | Ga0307405_10338654 | Ga0307405_103386542 | 127 |
| 605 | 3300031824 | Ga0307413_10014941 | Ga0307413_100149413 | 127 |
| 606 | 3300031824 | Ga0307413_11898350 | Ga0307413_118983501 | 127 |
| 607 | 3300031852 | Ga0307410_10042752 | Ga0307410_100427523 | 127 |
| 608 | 3300031852 | Ga0307410_10239684 | Ga0307410_102396842 | 127 |
| 609 | 3300031852 | Ga0307410_10655977 | Ga0307410_106559772 | 127 |
| 610 | 3300031852 | Ga0307410_11371634 | Ga0307410_113716342 | 127 |
| 611 | 3300031901 | Ga0307406_10034550 | Ga0307406_100345502 | 127 |
| 612 | 3300031901 | Ga0307406_10334196 | Ga0307406_103341962 | 127 |
| 613 | 3300031901 | Ga0307406_10542362 | Ga0307406_105423622 | 127 |
| 614 | 3300031903 | Ga0307407_10054087 | Ga0307407_100540873 | 127 |
| 615 | 3300031903 | Ga0307407_10128937 | Ga0307407_101289372 | 127 |
| 616 | 3300031911 | Ga0307412_10064169 | Ga0307412_100641693 | 127 |
| 617 | 3300031995 | Ga0307409_100028997 | Ga0307409_1000289975 | 127 |
| 618 | 3300031995 | Ga0307409_100076991 | Ga0307409_1000769913 | 127 |
| 619 | 3300031995 | Ga0307409_100136227 | Ga0307409_1001362272 | 127 |
| 620 | 3300031995 | Ga0307409_101128739 | Ga0307409_1011287392 | 127 |
| 621 | 3300032002 | Ga0307416_100031212 | Ga0307416_1000312123 | 127 |
| 622 | 3300032002 | Ga0307416_100443250 | Ga0307416_1004432502 | 127 |
| 623 | 3300032002 | Ga0307416_100628284 | Ga0307416_1006282842 | 127 |
| 624 | 3300032002 | Ga0307416_101293797 | Ga0307416_1012937972 | 127 |
| 625 | 3300032004 | Ga0307414_11059575 | Ga0307414_110595752 | 127 |
| 626 | 3300032004 | Ga0307414_11349755 | Ga0307414_113497552 | 127 |
| 627 | 3300032126 | Ga0307415_100410655 | Ga0307415_1004106552 | 127 |
| 628 | 3300032126 | Ga0307415_100463062 | Ga0307415_1004630621 | 127 |
| 629 | 3300032126 | Ga0307415_100582147 | Ga0307415_1005821472 | 127 |
| 630 | 3300034819 | Ga0373958_0058354 | Ga0373958_0058354_390_782 | 127 |
| 631 | 3300035089 | Ga0373944_0328270 | Ga0373944_0328270_80_472 | 127 |
| 632 | 3300035092 | Ga0373952_0117729 | Ga0373952_0117729_23_412 | 127 |
| 633 | 3300035114 | Ga0373939_0084137 | Ga0373939_0084137_500_889 | 127 |
| 634 | 3300035114 | Ga0373939_0152325 | Ga0373939_0152325_32_421 | 127 |
| 635 | 3300035115 | Ga0373941_0018221 | Ga0373941_0018221_842_1231 | 127 |
| 636 | 3300035115 | Ga0373941_0410659 | Ga0373941_0410659_147_533 | 127 |
| 637 | 3300035170 | Ga0373943_0195358 | Ga0373943_0195358_325_717 | 127 |
| 638 | 3300035241 | Ga0373961_0139904 | Ga0373961_0139904_344_733 | 127 |
| 639 | 3300035398 | Ga0316574_0113307 | Ga0316574_0113307_925_1323 | 127 |
| 640 | 3300035691 | Ga0373931_0091576 | Ga0373931_0091576_303_692 | 127 |
| 641 | 3300035691 | Ga0373931_0407118 | Ga0373931_0407118_345_731 | 127 |
| 642 | 3300037068 | Ga0373925_0251802 | Ga0373925_0251802_636_1028 | 127 |
| 643 | 3300037312 | Ga0395899_0113234 | Ga0395899_0113234_521_913 | 127 |
| 644 | 3300037418 | Ga0395900_0003892 | Ga0395900_0003892_1024_1410 | 127 |
| 645 | 3300037418 | Ga0395900_0214656 | Ga0395900_0214656_946_1338 | 127 |
| 646 | 3300037418 | Ga0395900_0227351 | Ga0395900_0227351_390_776 | 127 |
| 647 | 3300037418 | Ga0395900_0319619 | Ga0395900_0319619_63_458 | 127 |
| 648 | 3300037418 | Ga0395900_0406265 | Ga0395900_0406265_240_635 | 127 |
| 649 | 3300037466 | Ga0395898_0003289 | Ga0395898_0003289_11048_11434 | 127 |
| 650 | 3300037466 | Ga0395898_0013673 | Ga0395898_0013673_2006_2398 | 127 |
| 651 | 3300037466 | Ga0395898_0027694 | Ga0395898_0027694_2637_3023 | 127 |
| 652 | 3300037466 | Ga0395898_0769541 | Ga0395898_0769541_364_759 | 127 |
| 653 | 3300037466 | Ga0395898_1221621 | Ga0395898_1221621_214_606 | 127 |
| 654 | 3300037466 | Ga0395898_1916392 | Ga0395898_1916392_108_494 | 127 |
| 655 | 3300037471 | Ga0395905_0009566 | Ga0395905_0009566_4557_4949 | 127 |
| 656 | 3300037471 | Ga0395905_0157711 | Ga0395905_0157711_354_740 | 127 |
| 657 | 3300037471 | Ga0395905_0295161 | Ga0395905_0295161_189_584 | 127 |
| 658 | 3300037471 | Ga0395905_0443893 | Ga0395905_0443893_453_845 | 127 |
| 659 | 3300037853 | Ga0436364_0528708 | Ga0436364_0528708_12350_12742 | 127 |
| 660 | 3300037853 | Ga0436364_0994313 | Ga0436364_0994313_16_408 | 127 |
| 661 | 3300037853 | Ga0436364_1364766 | Ga0436364_1364766_545_931 | 127 |
| 662 | 3300038443 | Ga0395901_0010061 | Ga0395901_0010061_5592_5984 | 127 |
| 663 | 3300038443 | Ga0395901_0038792 | Ga0395901_0038792_1509_1895 | 127 |
| 664 | 3300038443 | Ga0395901_0424117 | Ga0395901_0424117_471_863 | 127 |
| 665 | 3300038443 | Ga0395901_0455313 | Ga0395901_0455313_861_1256 | 127 |
| 666 | 3300038443 | Ga0395901_0608243 | Ga0395901_0608243_631_1026 | 127 |
| 667 | 3300038443 | Ga0395901_0953274 | Ga0395901_0953274_397_792 | 127 |
| 668 | 3300038443 | Ga0395901_1096014 | Ga0395901_1096014_173_568 | 127 |
| 669 | 3300038443 | Ga0395901_1207160 | Ga0395901_1207160_246_641 | 127 |
| 670 | 3300038443 | Ga0395901_1296917 | Ga0395901_1296917_133_519 | 127 |
| 671 | 3300038443 | Ga0395901_1819612 | Ga0395901_1819612_67_459 | 127 |
| 672 | 3300039437 | Ga0436365_0279888 | Ga0436365_0279888_269_655 | 127 |
| 673 | 3300039437 | Ga0436365_0378539 | Ga0436365_0378539_935_1321 | 127 |
| 674 | 3300039437 | Ga0436365_0727247 | Ga0436365_0727247_103_495 | 127 |
| 675 | 3300039437 | Ga0436365_0952728 | Ga0436365_0952728_127_513 | 127 |
| 676 | 3300039437 | Ga0436365_1727618 | Ga0436365_1727618_13618_14010 | 127 |
| 677 | 3300039437 | Ga0436365_1868477 | Ga0436365_1868477_2280_2666 | 127 |
| 678 | 3300039450 | Ga0436363_1632579 | Ga0436363_1632579_202_588 | 127 |
| 679 | 3300039453 | Ga0436362_0308584 | Ga0436362_0308584_168_557 | 127 |
| 680 | 3300039453 | Ga0436362_0402256 | Ga0436362_0402256_133_525 | 127 |
| 681 | 3300039453 | Ga0436362_0527905 | Ga0436362_0527905_1421_1813 | 127 |
| 682 | 3300041451 | Ga0451791_0013117 | Ga0451791_0013117_59_451 | 127 |
| 683 | 3300041453 | Ga0451797_0368693 | Ga0451797_0368693_76_471 | 127 |
| 684 | 3300041486 | Ga0451807_2024780 | Ga0451807_2024780_809_1204 | 127 |
| 685 | 3300041491 | Ga0451833_0205188 | Ga0451833_0205188_117_503 | 127 |
| 686 | 3300041498 | Ga0451841_0618205 | Ga0451841_0618205_458_850 | 127 |
| 687 | 3300041505 | Ga0451849_0929619 | Ga0451849_0929619_70_462 | 127 |
| 688 | 3300041512 | Ga0451853_3135641 | Ga0451853_3135641_93_479 | 127 |
| 689 | 3300042016 | Ga0439463_040070 | Ga0439463_040070_275_667 | 127 |
| 690 | 3300042439 | Ga0439464_0047592 | Ga0439464_0047592_455_847 | 127 |
| 691 | 3300042461 | Ga0439460_0056377 | Ga0439460_0056377_434_826 | 127 |
| 692 | 3300042993 | Ga0439440_0162319 | Ga0439440_0162319_97_492 | 127 |
| 693 | 3300044656 | Ga0466969_0004458 | Ga0466969_0004458_6179_6565 | 127 |
| 694 | 3300044656 | Ga0466969_0063251 | Ga0466969_0063251_990_1376 | 127 |
| 695 | 3300044658 | Ga0466972_0034144 | Ga0466972_0034144_1482_1868 | 127 |
| 696 | 3300044683 | Ga0466965_0023873 | Ga0466965_0023873_602_988 | 127 |
| 697 | 3300044683 | Ga0466965_0091914 | Ga0466965_0091914_1048_1434 | 127 |
| 698 | 3300044683 | Ga0466965_0303241 | Ga0466965_0303241_375_761 | 127 |
| 699 | 3300044684 | Ga0466966_0190529 | Ga0466966_0190529_524_910 | 127 |
| 700 | 3300044684 | Ga0466966_0285915 | Ga0466966_0285915_539_925 | 127 |
| 701 | 3300044684 | Ga0466966_0379460 | Ga0466966_0379460_371_757 | 127 |
| 702 | 3300044684 | Ga0466966_0577026 | Ga0466966_0577026_233_619 | 127 |
| 703 | 3300044693 | Ga0466961_0028695 | Ga0466961_0028695_249_635 | 127 |
| 704 | 3300044693 | Ga0466961_0313052 | Ga0466961_0313052_244_630 | 127 |
| 705 | 3300044693 | Ga0466961_0324175 | Ga0466961_0324175_161_547 | 127 |
| 706 | 3300044694 | Ga0466963_0012064 | Ga0466963_0012064_1467_1853 | 127 |
| 707 | 3300044694 | Ga0466963_0184568 | Ga0466963_0184568_176_562 | 127 |
| 708 | 3300044694 | Ga0466963_0295351 | Ga0466963_0295351_524_910 | 127 |
| 709 | 3300044694 | Ga0466963_0311492 | Ga0466963_0311492_434_820 | 127 |
| 710 | 3300044694 | Ga0466963_0503093 | Ga0466963_0503093_345_731 | 127 |
| 711 | 3300044706 | Ga0466964_0017949 | Ga0466964_0017949_1270_1662 | 127 |
| 712 | 3300044706 | Ga0466964_0112139 | Ga0466964_0112139_314_709 | 127 |
| 713 | 3300044706 | Ga0466964_0460099 | Ga0466964_0460099_110_496 | 127 |
| 714 | 3300044706 | Ga0466964_0510164 | Ga0466964_0510164_58_444 | 127 |
| 715 | 3300044719 | Ga0466971_0404361 | Ga0466971_0404361_251_637 | 127 |
| 716 | 3300044735 | Ga0466968_0141625 | Ga0466968_0141625_56_442 | 127 |
| 717 | 3300044765 | Ga0466970_0070305 | Ga0466970_0070305_248_634 | 127 |
| 718 | 3300044842 | Ga0466957_0010702 | Ga0466957_0010702_2896_3282 | 127 |
| 719 | 3300044842 | Ga0466957_0800724 | Ga0466957_0800724_59_445 | 127 |
| 720 | 3300044901 | Ga0466960_0136623 | Ga0466960_0136623_428_814 | 127 |
| 721 | 3300044901 | Ga0466960_0372251 | Ga0466960_0372251_328_714 | 127 |
| 722 | 3300045049 | Ga0466959_0038186 | Ga0466959_0038186_2413_2799 | 127 |
| 723 | 3300045049 | Ga0466959_0042946 | Ga0466959_0042946_2132_2518 | 127 |
| 724 | 3300045049 | Ga0466959_0355042 | Ga0466959_0355042_181_567 | 127 |
| 725 | 3300045049 | Ga0466959_0476319 | Ga0466959_0476319_394_780 | 127 |
| 726 | 3300045049 | Ga0466959_0649468 | Ga0466959_0649468_139_525 | 127 |
| 727 | 3300045836 | Ga0466958_0025030 | Ga0466958_0025030_1302_1688 | 127 |
| 728 | 3300045836 | Ga0466958_0066323 | Ga0466958_0066323_1345_1731 | 127 |
| 729 | 3300045836 | Ga0466958_0077765 | Ga0466958_0077765_65_451 | 127 |
| 730 | 3300045836 | Ga0466958_0100358 | Ga0466958_0100358_188_574 | 127 |
| 731 | 3300045836 | Ga0466958_0136145 | Ga0466958_0136145_427_813 | 127 |
| 732 | 3300045836 | Ga0466958_0256961 | Ga0466958_0256961_135_521 | 127 |
| 733 | 3300045976 | Ga0466967_0015873 | Ga0466967_0015873_4369_4764 | 127 |
| 734 | 3300045976 | Ga0466967_0043106 | Ga0466967_0043106_1889_2275 | 127 |
| 735 | 3300045976 | Ga0466967_0051648 | Ga0466967_0051648_131_517 | 127 |
| 736 | 3300045976 | Ga0466967_0433195 | Ga0466967_0433195_640_1038 | 127 |
| 737 | 3300045976 | Ga0466967_0687452 | Ga0466967_0687452_294_680 | 127 |
| 738 | 3300045976 | Ga0466967_0692615 | Ga0466967_0692615_48_434 | 127 |
| 739 | 3300045976 | Ga0466967_0708487 | Ga0466967_0708487_597_983 | 127 |
| 740 | 3300045976 | Ga0466967_0737988 | Ga0466967_0737988_287_673 | 127 |
| 741 | 3300045976 | Ga0466967_2030475 | Ga0466967_2030475_18_404 | 127 |
| 742 | 3300046455 | Ga0495603_0117058 | Ga0495603_0117058_352_744 | 127 |
| 743 | 3300046459 | Ga0495629_0105496 | Ga0495629_0105496_984_1376 | 127 |
| 744 | 3300046461 | Ga0495641_0037914 | Ga0495641_0037914_446_838 | 127 |
| 745 | 3300046474 | Ga0495605_0388054 | Ga0495605_0388054_98_493 | 127 |
| 746 | 3300046491 | Ga0495584_0106485 | Ga0495584_0106485_429_824 | 127 |
| 747 | 3300046492 | Ga0495585_0482224 | Ga0495585_0482224_65_460 | 127 |
| 748 | 3300046500 | Ga0495596_0080713 | Ga0495596_0080713_356_751 | 127 |
| 749 | 3300046500 | Ga0495596_0288588 | Ga0495596_0288588_53_442 | 127 |
| 750 | 3300046500 | Ga0495596_0351091 | Ga0495596_0351091_41_436 | 127 |
| 751 | 3300046511 | Ga0495608_0000023 | Ga0495608_0000023_33243_33638 | 127 |
| 752 | 3300046516 | Ga0495628_0133196 | Ga0495628_0133196_388_786 | 127 |
| 753 | 3300046518 | Ga0495631_0356389 | Ga0495631_0356389_182_577 | 127 |
| 754 | 3300046518 | Ga0495631_0413850 | Ga0495631_0413850_96_491 | 127 |
| 755 | 3300046615 | Ga0495656_0159710 | Ga0495656_0159710_591_986 | 127 |
| 756 | 3300046660 | Ga0495625_0250896 | Ga0495625_0250896_412_804 | 127 |
| 757 | 3300046674 | Ga0495588_0336136 | Ga0495588_0336136_291_683 | 127 |
| 758 | 3300046675 | Ga0495657_0000020 | Ga0495657_0000020_33243_33638 | 127 |
| 759 | 3300046683 | Ga0495658_0215131 | Ga0495658_0215131_577_969 | 127 |
| 760 | 3300046689 | Ga0495613_0000251 | Ga0495613_0000251_15197_15586 | 127 |
| 761 | 3300046690 | Ga0495624_0376867 | Ga0495624_0376867_301_693 | 127 |
| 762 | 3300046794 | Ga0495589_0336337 | Ga0495589_0336337_148_543 | 127 |
| 763 | 3300047317 | Ga0495604_0000158 | Ga0495604_0000158_8762_9181 | 127 |
| 764 | 3300047444 | Ga0495675_0000561 | Ga0495675_0000561_15585_15980 | 127 |
| 765 | 3300047673 | Ga0495593_0247261 | Ga0495593_0247261_292_684 | 127 |
| 766 | 3300047673 | Ga0495593_0618296 | Ga0495593_0618296_83_478 | 127 |
| 767 | 3300048903 | Ga0496100_0100042 | Ga0496100_0100042_1504_1890 | 127 |
| 768 | 3300048903 | Ga0496100_0179279 | Ga0496100_0179279_903_1295 | 127 |
| 769 | 3300048903 | Ga0496100_0187151 | Ga0496100_0187151_65_451 | 127 |
| 770 | 3300048903 | Ga0496100_0541474 | Ga0496100_0541474_312_704 | 127 |
| 771 | 3300048904 | Ga0496101_0041686 | Ga0496101_0041686_1360_1746 | 127 |
| 772 | 3300048904 | Ga0496101_0044046 | Ga0496101_0044046_1638_2030 | 127 |
| 773 | 3300048904 | Ga0496101_0065871 | Ga0496101_0065871_1755_2141 | 127 |
| 774 | 3300048905 | Ga0496102_0003095 | Ga0496102_0003095_1769_2161 | 127 |
| 775 | 3300048905 | Ga0496102_0503376 | Ga0496102_0503376_73_459 | 127 |
| 776 | 3300048905 | Ga0496102_0976998 | Ga0496102_0976998_79_471 | 127 |
| 777 | 3300048905 | Ga0496102_1080381 | Ga0496102_1080381_38_433 | 127 |
| 778 | 3300048905 | Ga0496102_1457173 | Ga0496102_1457173_202_588 | 127 |
| 779 | 3300048906 | Ga0496103_0022041 | Ga0496103_0022041_663_1049 | 127 |
| 780 | 3300048906 | Ga0496103_0030924 | Ga0496103_0030924_1941_2333 | 127 |
| 781 | 3300048907 | Ga0496104_0012412 | Ga0496104_0012412_1708_2094 | 127 |
| 782 | 3300048907 | Ga0496104_0021418 | Ga0496104_0021418_5275_5667 | 127 |
| 783 | 3300048907 | Ga0496104_0075754 | Ga0496104_0075754_2065_2454 | 127 |
| 784 | 3300048907 | Ga0496104_0259428 | Ga0496104_0259428_555_941 | 127 |
| 785 | 3300048907 | Ga0496104_1767976 | Ga0496104_1767976_50_436 | 127 |
| 786 | 3300048908 | Ga0496105_0070815 | Ga0496105_0070815_358_750 | 127 |
| 787 | 3300048908 | Ga0496105_0154886 | Ga0496105_0154886_526_912 | 127 |
| 788 | 3300048908 | Ga0496105_0353859 | Ga0496105_0353859_752_1138 | 127 |
| 789 | 3300048908 | Ga0496105_0778513 | Ga0496105_0778513_167_559 | 127 |
| 790 | 3300048909 | Ga0496106_0006523 | Ga0496106_0006523_3073_3465 | 127 |
| 791 | 3300048909 | Ga0496106_0036277 | Ga0496106_0036277_3228_3620 | 127 |
| 792 | 3300048910 | Ga0496107_0042362 | Ga0496107_0042362_42_434 | 127 |
| 793 | 3300048910 | Ga0496107_0050430 | Ga0496107_0050430_1446_1838 | 127 |
| 794 | 3300048910 | Ga0496107_0159475 | Ga0496107_0159475_141_527 | 127 |
| 795 | 3300048910 | Ga0496107_0276299 | Ga0496107_0276299_16_408 | 127 |
| 796 | 3300048910 | Ga0496107_0574043 | Ga0496107_0574043_233_625 | 127 |
| 797 | 3300048910 | Ga0496107_0588607 | Ga0496107_0588607_191_586 | 127 |
| 798 | 3300048910 | Ga0496107_0637477 | Ga0496107_0637477_263_658 | 127 |
| 799 | 3300048911 | Ga0496108_0004449 | Ga0496108_0004449_7602_7994 | 127 |
| 800 | 3300048911 | Ga0496108_0024711 | Ga0496108_0024711_4123_4512 | 127 |
| 801 | 3300048911 | Ga0496108_0046338 | Ga0496108_0046338_2402_2794 | 127 |
| 802 | 3300048911 | Ga0496108_0176298 | Ga0496108_0176298_445_831 | 127 |
| 803 | 3300048911 | Ga0496108_0214434 | Ga0496108_0214434_1230_1616 | 127 |
| 804 | 3300048911 | Ga0496108_0775168 | Ga0496108_0775168_40_441 | 127 |
| 805 | 3300048911 | Ga0496108_0969796 | Ga0496108_0969796_89_484 | 127 |
| 806 | 3300048912 | Ga0496109_0000075 | Ga0496109_0000075_15194_15583 | 127 |
| 807 | 3300048912 | Ga0496109_0003244 | Ga0496109_0003244_10867_11259 | 127 |
| 808 | 3300048912 | Ga0496109_0012257 | Ga0496109_0012257_5626_6012 | 127 |
| 809 | 3300048912 | Ga0496109_0014690 | Ga0496109_0014690_6358_6744 | 127 |
| 810 | 3300048912 | Ga0496109_0577518 | Ga0496109_0577518_49_441 | 127 |
| 811 | 3300048912 | Ga0496109_0649710 | Ga0496109_0649710_449_844 | 127 |
| 812 | 3300048912 | Ga0496109_0660889 | Ga0496109_0660889_11_397 | 127 |
| 813 | 3300048912 | Ga0496109_0708155 | Ga0496109_0708155_399_800 | 127 |
| 814 | 3300048912 | Ga0496109_1213058 | Ga0496109_1213058_155_550 | 127 |
| 815 | 3300048912 | Ga0496109_1257147 | Ga0496109_1257147_230_619 | 127 |
| 816 | 3300048912 | Ga0496109_1618315 | Ga0496109_1618315_31_423 | 127 |
| 817 | 3300048912 | Ga0496109_1783984 | Ga0496109_1783984_119_505 | 127 |
| 818 | 3300048913 | Ga0496110_0062927 | Ga0496110_0062927_2449_2841 | 127 |
| 819 | 3300048913 | Ga0496110_0072468 | Ga0496110_0072468_1420_1821 | 127 |
| 820 | 3300048913 | Ga0496110_0269852 | Ga0496110_0269852_688_1080 | 127 |
| 821 | 3300048913 | Ga0496110_0475352 | Ga0496110_0475352_424_819 | 127 |
| 822 | 3300048913 | Ga0496110_0482394 | Ga0496110_0482394_307_693 | 127 |
| 823 | 3300048913 | Ga0496110_1794422 | Ga0496110_1794422_98_484 | 127 |
| 824 | 3300048914 | Ga0496111_0027123 | Ga0496111_0027123_2316_2708 | 127 |
| 825 | 3300048914 | Ga0496111_0214719 | Ga0496111_0214719_330_716 | 127 |
| 826 | 3300048915 | Ga0496112_0000013 | Ga0496112_0000013_235588_235980 | 127 |
| 827 | 3300048915 | Ga0496112_0024384 | Ga0496112_0024384_5282_5668 | 127 |
| 828 | 3300048915 | Ga0496112_0202224 | Ga0496112_0202224_780_1166 | 127 |
| 829 | 3300048915 | Ga0496112_0233867 | Ga0496112_0233867_1211_1612 | 127 |
| 830 | 3300048915 | Ga0496112_0347291 | Ga0496112_0347291_1020_1412 | 127 |
| 831 | 3300048915 | Ga0496112_0372740 | Ga0496112_0372740_622_1017 | 127 |
| 832 | 3300048916 | Ga0496113_0026775 | Ga0496113_0026775_3205_3597 | 127 |
| 833 | 3300048916 | Ga0496113_0037782 | Ga0496113_0037782_251_637 | 127 |
| 834 | 3300048916 | Ga0496113_0071478 | Ga0496113_0071478_189_590 | 127 |
| 835 | 3300048916 | Ga0496113_0546862 | Ga0496113_0546862_85_474 | 127 |
| 836 | 3300048917 | Ga0496114_0021547 | Ga0496114_0021547_1647_2039 | 127 |
| 837 | 3300048917 | Ga0496114_0122625 | Ga0496114_0122625_1325_1711 | 127 |
| 838 | 3300048917 | Ga0496114_0377166 | Ga0496114_0377166_654_1040 | 127 |
| 839 | 3300048918 | Ga0496115_0216447 | Ga0496115_0216447_255_641 | 127 |
| 840 | 3300049568 | Ga0501031_0291316 | Ga0501031_0291316_19_414 | 127 |
| 841 | 3300049568 | Ga0501031_0895057 | Ga0501031_0895057_85_468 | 127 |
| 842 | 3300049570 | Ga0501033_0373905 | Ga0501033_0373905_130_528 | 127 |
| 843 | 3300049572 | Ga0501036_0651252 | Ga0501036_0651252_86_484 | 127 |
| 844 | 3300049572 | Ga0501036_1674400 | Ga0501036_1674400_66_455 | 127 |
| 845 | 3300049574 | Ga0501038_0443030 | Ga0501038_0443030_496_894 | 127 |
| 846 | 3300049575 | Ga0501039_0171504 | Ga0501039_0171504_260_652 | 127 |
| 847 | 3300049575 | Ga0501039_0323562 | Ga0501039_0323562_507_902 | 127 |
| 848 | 3300049576 | Ga0501040_0023006 | Ga0501040_0023006_933_1328 | 127 |
| 849 | 3300049576 | Ga0501040_0085543 | Ga0501040_0085543_776_1168 | 127 |
| 850 | 3300049576 | Ga0501040_0528064 | Ga0501040_0528064_203_601 | 127 |
| 851 | 3300049577 | Ga0501041_0021960 | Ga0501041_0021960_357_755 | 127 |
| 852 | 3300049577 | Ga0501041_0149692 | Ga0501041_0149692_627_1022 | 127 |
| 853 | 3300049578 | Ga0501042_0191243 | Ga0501042_0191243_860_1258 | 127 |
| 854 | 3300049578 | Ga0501042_0331440 | Ga0501042_0331440_12_404 | 127 |
| 855 | 3300049580 | Ga0501046_0369590 | Ga0501046_0369590_477_872 | 127 |
| 856 | 3300049580 | Ga0501046_0421466 | Ga0501046_0421466_439_831 | 127 |
| 857 | 3300049582 | Ga0501048_0041902 | Ga0501048_0041902_332_730 | 127 |
| 858 | 3300049582 | Ga0501048_0289431 | Ga0501048_0289431_687_1079 | 127 |
| 859 | 3300049583 | Ga0501067_0175878 | Ga0501067_0175878_735_1121 | 127 |
| 860 | 3300049585 | Ga0501069_0470778 | Ga0501069_0470778_148_546 | 127 |
| 861 | 3300049587 | Ga0501071_0026554 | Ga0501071_0026554_1023_1421 | 127 |
| 862 | 3300049587 | Ga0501071_0069904 | Ga0501071_0069904_1341_1733 | 127 |
| 863 | 3300049587 | Ga0501071_0121517 | Ga0501071_0121517_1073_1471 | 127 |
| 864 | 3300049587 | Ga0501071_0321901 | Ga0501071_0321901_85_480 | 127 |
| 865 | 3300049588 | Ga0501072_0019744 | Ga0501072_0019744_1064_1462 | 127 |
| 866 | 3300049588 | Ga0501072_0057878 | Ga0501072_0057878_2462_2857 | 127 |
| 867 | 3300049588 | Ga0501072_0147308 | Ga0501072_0147308_464_856 | 127 |
| 868 | 3300049588 | Ga0501072_0377024 | Ga0501072_0377024_655_1047 | 127 |
| 869 | 3300049588 | Ga0501072_1130225 | Ga0501072_1130225_15_407 | 127 |
| 870 | 3300049590 | Ga0501074_0303848 | Ga0501074_0303848_160_558 | 127 |
| 871 | 3300049590 | Ga0501074_0494255 | Ga0501074_0494255_183_578 | 127 |
| 872 | 3300049591 | Ga0501075_0029679 | Ga0501075_0029679_374_772 | 127 |
| 873 | 3300049591 | Ga0501075_0038581 | Ga0501075_0038581_1052_1444 | 127 |
| 874 | 3300049591 | Ga0501075_0073939 | Ga0501075_0073939_350_748 | 127 |
| 875 | 3300049591 | Ga0501075_0643588 | Ga0501075_0643588_304_696 | 127 |
| 876 | 3300049592 | Ga0501076_0031553 | Ga0501076_0031553_1733_2128 | 127 |
| 877 | 3300049592 | Ga0501076_0036078 | Ga0501076_0036078_1359_1757 | 127 |
| 878 | 3300049592 | Ga0501076_0179253 | Ga0501076_0179253_255_647 | 127 |
| 879 | 3300049592 | Ga0501076_0265097 | Ga0501076_0265097_1007_1393 | 127 |
| 880 | 3300049592 | Ga0501076_0525250 | Ga0501076_0525250_543_938 | 127 |
| 881 | 3300049593 | Ga0501077_0358088 | Ga0501077_0358088_443_841 | 127 |
| 882 | 3300049593 | Ga0501077_0397261 | Ga0501077_0397261_370_768 | 127 |
| 883 | 3300049663 | Ga0501223_074980 | Ga0501223_074980_99_488 | 127 |
| 884 | 3300049665 | Ga0501227_184058 | Ga0501227_184058_116_505 | 127 |
| 885 | 3300049669 | Ga0501235_191922 | Ga0501235_191922_66_461 | 127 |
| 886 | 3300049688 | Ga0501259_013667 | Ga0501259_013667_171_560 | 127 |
| 887 | 3300049741 | Ga0501079_0225345 | Ga0501079_0225345_602_1000 | 127 |
| 888 | 3300049741 | Ga0501079_0437106 | Ga0501079_0437106_305_703 | 127 |
| 889 | 3300049743 | Ga0501081_0002804 | Ga0501081_0002804_9596_9994 | 127 |
| 890 | 3300049743 | Ga0501081_0264230 | Ga0501081_0264230_144_539 | 127 |
| 891 | 3300049743 | Ga0501081_0362245 | Ga0501081_0362245_400_807 | 127 |
| 892 | 3300049744 | Ga0501083_0482690 | Ga0501083_0482690_323_721 | 127 |
| 893 | 3300049770 | Ga0501273_087628 | Ga0501273_087628_96_506 | 127 |
| 894 | 3300049822 | Ga0501035_0291652 | Ga0501035_0291652_654_1049 | 127 |
| 895 | 3300049822 | Ga0501035_0637531 | Ga0501035_0637531_405_803 | 127 |
| 896 | 3300049822 | Ga0501035_1195217 | Ga0501035_1195217_152_544 | 127 |
| 897 | 3300049824 | Ga0501045_0060924 | Ga0501045_0060924_1343_1741 | 127 |
| 898 | 3300049824 | Ga0501045_0538672 | Ga0501045_0538672_406_801 | 127 |
| 899 | 3300050490 | nmdc:mga03n38_290846_c1 | nmdc:mga03n38_290846_c1_440_829 | 127 |
| 900 | 3300050490 | nmdc:mga03n38_44508_c1 | nmdc:mga03n38_44508_c1_18_410 | 127 |
| 901 | 3300050491 | nmdc:mga00v17_33154_c1 | nmdc:mga00v17_33154_c1_1693_2085 | 127 |
| 902 | 3300050491 | nmdc:mga00v17_7459_c1 | nmdc:mga00v17_7459_c1_2348_2740 | 127 |
| 903 | 3300050491 | nmdc:mga00v17_74686_c1 | nmdc:mga00v17_74686_c1_1386_1778 | 127 |
| 904 | 3300050492 | nmdc:mga0yw44_2119_c1 | nmdc:mga0yw44_2119_c1_7529_7921 | 127 |
| 905 | 3300050492 | nmdc:mga0yw44_39020_c1 | nmdc:mga0yw44_39020_c1_2226_2618 | 127 |
| 906 | 3300050492 | nmdc:mga0yw44_47850_c2 | nmdc:mga0yw44_47850_c2_131_520 | 127 |
| 907 | 3300050492 | nmdc:mga0yw44_619864_c1 | nmdc:mga0yw44_619864_c1_59_457 | 127 |
| 908 | 3300050494 | nmdc:mga06z11_1035300_c1 | nmdc:mga06z11_1035300_c1_98_484 | 127 |
| 909 | 3300050494 | nmdc:mga06z11_435155_c1 | nmdc:mga06z11_435155_c1_269_661 | 127 |
| 910 | 3300050494 | nmdc:mga06z11_679730_c1 | nmdc:mga06z11_679730_c1_221_613 | 127 |
| 911 | 3300050507 | nmdc:mga05p37_14788_c1 | nmdc:mga05p37_14788_c1_6277_6675 | 127 |
| 912 | 3300050507 | nmdc:mga05p37_148787_c1 | nmdc:mga05p37_148787_c1_2058_2453 | 127 |
| 913 | 3300050507 | nmdc:mga05p37_169778_c1 | nmdc:mga05p37_169778_c1_2189_2578 | 127 |
| 914 | 3300050507 | nmdc:mga05p37_172958_c1 | nmdc:mga05p37_172958_c1_1089_1484 | 127 |
| 915 | 3300050507 | nmdc:mga05p37_343537_c1 | nmdc:mga05p37_343537_c1_912_1304 | 127 |
| 916 | 3300050507 | nmdc:mga05p37_4564_c1 | nmdc:mga05p37_4564_c1_10666_11061 | 127 |
| 917 | 3300050507 | nmdc:mga05p37_559193_c1 | nmdc:mga05p37_559193_c1_236_646 | 127 |
| 918 | 3300050508 | nmdc:mga09592_144042_c1 | nmdc:mga09592_144042_c1_1399_1788 | 127 |
| 919 | 3300050508 | nmdc:mga09592_185824_c1 | nmdc:mga09592_185824_c1_958_1353 | 127 |
| 920 | 3300050508 | nmdc:mga09592_19018_c1 | nmdc:mga09592_19018_c1_457_849 | 127 |
| 921 | 3300050508 | nmdc:mga09592_443722_c1 | nmdc:mga09592_443722_c1_236_631 | 127 |
| 922 | 3300050508 | nmdc:mga09592_992034_c1 | nmdc:mga09592_992034_c1_57_452 | 127 |
| 923 | 3300050509 | nmdc:mga0qj67_127541_c1 | nmdc:mga0qj67_127541_c1_1308_1703 | 127 |
| 924 | 3300050509 | nmdc:mga0qj67_27450_c1 | nmdc:mga0qj67_27450_c1_2303_2695 | 127 |
| 925 | 3300050510 | nmdc:mga06r32_219728_c1 | nmdc:mga06r32_219728_c1_846_1238 | 127 |
| 926 | 3300050510 | nmdc:mga06r32_253554_c1 | nmdc:mga06r32_253554_c1_167_556 | 127 |
| 927 | 3300050510 | nmdc:mga06r32_25649_c1 | nmdc:mga06r32_25649_c1_4790_5182 | 127 |
| 928 | 3300050510 | nmdc:mga06r32_286483_c1 | nmdc:mga06r32_286483_c1_433_828 | 127 |
| 929 | 3300050510 | nmdc:mga06r32_558464_c1 | nmdc:mga06r32_558464_c1_583_981 | 127 |
| 930 | 3300050511 | nmdc:mga08y16_1232607_c1 | nmdc:mga08y16_1232607_c1_76_474 | 127 |
| 931 | 3300050511 | nmdc:mga08y16_1254734_c1 | nmdc:mga08y16_1254734_c1_86_472 | 127 |
| 932 | 3300050511 | nmdc:mga08y16_18190_c1 | nmdc:mga08y16_18190_c1_4154_4549 | 127 |
| 933 | 3300050511 | nmdc:mga08y16_288085_c1 | nmdc:mga08y16_288085_c1_934_1329 | 127 |
| 934 | 3300050511 | nmdc:mga08y16_353532_c1 | nmdc:mga08y16_353532_c1_725_1120 | 127 |
| 935 | 3300050511 | nmdc:mga08y16_47862_c1 | nmdc:mga08y16_47862_c1_1947_2342 | 127 |
| 936 | 3300050511 | nmdc:mga08y16_493031_c1 | nmdc:mga08y16_493031_c1_289_678 | 127 |
| 937 | 3300050511 | nmdc:mga08y16_498894_c1 | nmdc:mga08y16_498894_c1_541_951 | 127 |
| 938 | 3300050511 | nmdc:mga08y16_533875_c1 | nmdc:mga08y16_533875_c1_592_984 | 127 |
| 939 | 3300050511 | nmdc:mga08y16_58425_c1 | nmdc:mga08y16_58425_c1_1349_1738 | 127 |
| 940 | 3300050512 | nmdc:mga0n895_1048682_c1 | nmdc:mga0n895_1048682_c1_242_637 | 127 |
| 941 | 3300050512 | nmdc:mga0n895_166491_c1 | nmdc:mga0n895_166491_c1_919_1314 | 127 |
| 942 | 3300050512 | nmdc:mga0n895_1940942_c1 | nmdc:mga0n895_1940942_c1_93_479 | 127 |
| 943 | 3300050512 | nmdc:mga0n895_1974714_c1 | nmdc:mga0n895_1974714_c1_96_482 | 127 |
| 944 | 3300050512 | nmdc:mga0n895_2231470_c1 | nmdc:mga0n895_2231470_c1_13_408 | 127 |
| 945 | 3300050512 | nmdc:mga0n895_561078_c1 | nmdc:mga0n895_561078_c1_162_548 | 127 |
| 946 | 3300050513 | nmdc:mga0rr50_598822_c1 | nmdc:mga0rr50_598822_c1_447_842 | 127 |
| 947 | 3300050514 | nmdc:mga08x19_407988_c1 | nmdc:mga08x19_407988_c1_278_673 | 127 |
| 948 | 3300050515 | nmdc:mga0a205_154858_c1 | nmdc:mga0a205_154858_c1_754_1140 | 127 |
| 949 | 3300050515 | nmdc:mga0a205_214067_c1 | nmdc:mga0a205_214067_c1_998_1387 | 127 |
| 950 | 3300050515 | nmdc:mga0a205_78610_c1 | nmdc:mga0a205_78610_c1_979_1374 | 127 |
| 951 | 3300053078 | Ga0495612_0000022 | Ga0495612_0000022_77873_78271 | 127 |
| 952 | 3300053083 | Ga0495655_0101842 | Ga0495655_0101842_130_525 | 127 |
| 953 | 3300053083 | Ga0495655_0215508 | Ga0495655_0215508_82_468 | 127 |
| 954 | 3300053084 | Ga0495595_0000022 | Ga0495595_0000022_76961_77356 | 127 |
| 955 | 3300053085 | Ga0495619_0000070 | Ga0495619_0000070_76900_77295 | 127 |
| 956 | 3300053153 | Ga0500616_0004292 | Ga0500616_0004292_7154_7540 | 127 |
| 957 | 3300054114 | Ga0501084_0418861 | Ga0501084_0418861_312_710 | 127 |
| 958 | 3300054114 | Ga0501084_1051000 | Ga0501084_1051000_229_621 | 127 |
| 959 | 3300059424 | Ga0590075_094382 | Ga0590075_094382_192_587 | 127 |
| 960 | 3300059491 | Ga0587070_145090 | Ga0587070_145090_100_486 | 127 |
| 961 | 3300059492 | Ga0587073_0109275 | Ga0587073_0109275_334_720 | 127 |
| 962 | 3300059640 | Ga0587067_126318 | Ga0587067_126318_144_530 | 127 |
| 963 | 3300059655 | Ga0587114_104150 | Ga0587114_104150_80_466 | 127 |
| 964 | 3300060353 | Ga0501082_0006969 | Ga0501082_0006969_7370_7768 | 127 |
| 965 | 3300060353 | Ga0501082_0130106 | Ga0501082_0130106_722_1120 | 127 |
| 966 | 3300060353 | Ga0501082_0185504 | Ga0501082_0185504_53_448 | 127 |
| 967 | 3300061719 | Ga0466962_0010743 | Ga0466962_0010743_2724_3110 | 127 |
| 968 | 3300061719 | Ga0466962_0077598 | Ga0466962_0077598_14_400 | 127 |
| 969 | 3300061719 | Ga0466962_0121791 | Ga0466962_0121791_281_667 | 127 |
| 970 | 3300061734 | Ga0530510_0005169 | Ga0530510_0005169_6102_6500 | 127 |
| 971 | 3300061734 | Ga0530510_0061101 | Ga0530510_0061101_700_1098 | 127 |
| 972 | 3300061734 | Ga0530510_0622348 | Ga0530510_0622348_283_675 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9952 | 4 | 124 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9857 | 9 | 126 |
| 1zko-assembly1.cif.gz_A | crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution | 0.9789 | 9 | 125 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9782 | 4 | 126 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9736 | 4 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9849 | 9 | 126 | 2.40.50.100 |
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9847 | 9 | 125 | 2.40.50.100 |
| af_K7TZ76_31_128_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9799 | 39 | 126 | 2.40.50.100 |
| af_Q54JU3_2_142_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9688 | 9 | 127 | 2.40.50.100 |
| af_A4IC11_1_107_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9571 | 22 | 127 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534S1C2-F1-model_v4 | Glycine cleavage system H protein | 0.9988 | 10 | 126 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A314YSG0-F1-model_v4 | Pentatricopeptide repeat-containing protein | 0.9986 | 1 | 126 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A6A5LLD4-F1-model_v4 | deleted | 0.9976 | 6 | 125 |
|
| AF-A0A067GPV7-F1-model_v4 | Glycine cleavage system H protein | 0.9975 | 6 | 126 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A498IWY7-F1-model_v4 | Lipoyl-binding domain-containing protein | 0.9975 | 6 | 125 |
GO:0005739
GO:0005960 GO:0006511 GO:0019464 GO:0019773 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar