F487130

General Info

Members Datasets Scaffolds Average Seq Length
971 455 943 294

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0000859|Ga0501035_0000859_14449_15441
Length 330
Sequence MAGLVPAIHAFIALGFSKAWMPATSAGMTAERLKQMTARIIDGKAIAAELRHKVATEVARLKTAHDIVPRLAVVLVGVNPASEVYVRSKSKAVAEIGMRSLDHRLPETASEAELLALIGRLNADPAVSGILVQLPLPPQIDAHEVIAAIDPDKDVDGFHPVNVGRLSIGLPTLPPCTPFGCIVLAKAVHASLAGLDAVVIGRSNIVGKPVAQLLLAENATVTIAHSKTRDLAAVCRRADIVVAAIGRPAFVTKGWIKPGATVIDVGINRVTDKDGKSRIVGDVAADAVEVAGALTPVPGGVGPMTIACLMLNTLRAVCLQRGLPPPDIGR

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
10 2791355199
11 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
12 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
13 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
14 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
15 2904699407
16 2906610324
17 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
18 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
19 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
20 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
21 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
22 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
23 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
29 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
30 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
33 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
34 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
35 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
36 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
70 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
71 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
234 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
235 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
236 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
264 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
265 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
266 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
267 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
270 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
271 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
272 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
273 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
287 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
288 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
302 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
303 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
304 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
305 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
308 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
309 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
310 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
311 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
312 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
313 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
314 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
318 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
319 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
324 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
328 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
336 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
343 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
365 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
366 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
367 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
368 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
369 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
373 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
377 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
378 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
379 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
380 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
398 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
403 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
404 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
416 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
422 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
423 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
424 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
425 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
428 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
429 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
432 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
433 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
434 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
435 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
436 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
437 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
438 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
439 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
440 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
441 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
444 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
445 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
446 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
447 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
448 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
449 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
450 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
451 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
452 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
453 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
454 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
455 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0.52
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 2.27
Rhizoplane 6.49
Rhizosphere 84.24
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1000169 3300001978 Bacteria 3330
2 JGI24740J21852_10022911 3300001979 Bacteria 2141
3 JGI24739J22299_10000897 3300001989 Bacteria 11012
4 JGI24739J22299_10001524 3300001989 Bacteria 8748
5 JGI24739J22299_10003887 3300001989 Bacteria 5710
6 JGI24737J22298_10009404 3300001990 Bacteria 3253
7 JGI24737J22298_10017120 3300001990 Bacteria 2337
8 JGI24735J21928_10003487 3300002067 Bacteria 5356
9 JGI24750J21931_1000745 3300002070 Bacteria 4622
10 JGI24745J21846_1000061 3300002073 Bacteria 7701
11 JGI24748J21848_1000185 3300002074 Bacteria 8024
12 JGI24738J21930_10000067 3300002075 Bacteria 21834
13 JGI24749J21850_1001798 3300002076 Bacteria 3033
14 JGI24035J26624_1000005 3300002126 Bacteria 14770
15 JGI24035J26624_1000190 3300002126 Bacteria 5699
16 JGI24033J26618_1000613 3300002155 Bacteria 3427
17 JGI24034J26672_10000951 3300002239 Bacteria 3776
18 JGI24742J22300_10000153 3300002244 Bacteria 10167
19 JGI25165J46597_1006892 3300003214 Bacteria 1960
20 JGI25153J46596_10038430 3300003215 Bacteria 1508
21 rootH2_10045331 3300003320 Bacteria 10632
22 rootH2_10046910 3300003320 Bacteria 3741
23 JGI25160J50197_1014601 3300003354 Bacteria 2620
24 Ga0065712_10130182 3300005290 Bacteria 1555
25 Ga0065715_10008690 3300005293 Bacteria 2691
26 Ga0065707_10268785 3300005295 Bacteria 1077
27 Ga0070676_10000332 3300005328 Bacteria 21434
28 Ga0070676_10066999 3300005328 Bacteria 2146
29 Ga0070676_10068867 3300005328 Bacteria 2119
30 Ga0070683_100004171 3300005329 Bacteria 11837
31 Ga0070690_100005079 3300005330 Bacteria 7376
32 Ga0070690_100046391 3300005330 Bacteria 2762
33 Ga0070670_100023341 3300005331 Bacteria 5324
34 Ga0070677_10000258 3300005333 Bacteria 18304
35 Ga0068869_100000510 3300005334 Bacteria 21648
36 Ga0070666_10004570 3300005335 Bacteria 8438
37 Ga0070666_10019282 3300005335 Bacteria 4400
38 Ga0070680_100001476 3300005336 Bacteria 17088
39 Ga0070680_100012038 3300005336 Bacteria 6712
40 Ga0070682_100003255 3300005337 Bacteria 9005
41 Ga0068868_100000148 3300005338 Bacteria 45833
42 Ga0070660_100001314 3300005339 Bacteria 16922
43 Ga0070660_100003272 3300005339 Bacteria 11124
44 Ga0070689_100001783 3300005340 Bacteria 13820
45 Ga0070689_100014799 3300005340 Bacteria 5675
46 Ga0070691_10035255 3300005341 Bacteria 2355
47 Ga0070687_100000318 3300005343 Bacteria 16315
48 Ga0070687_100323504 3300005343 Bacteria 986
49 Ga0070661_100000768 3300005344 Bacteria 23141
50 Ga0070661_100127357 3300005344 Bacteria 1911
51 Ga0070692_10011615 3300005345 Bacteria 4047
52 Ga0070668_100051792 3300005347 Bacteria 3164
53 Ga0070668_100093298 3300005347 Bacteria 2375
54 Ga0070668_100137565 3300005347 Bacteria 1966
55 Ga0070669_100003445 3300005353 Bacteria 11403
56 Ga0070675_100001491 3300005354 Bacteria 17261
57 Ga0070675_100108142 3300005354 Bacteria 2348
58 Ga0070675_100174255 3300005354 Bacteria 1857
59 Ga0070671_100003997 3300005355 Bacteria 11616
60 Ga0070671_100043030 3300005355 Bacteria 3755
61 Ga0070671_100352254 3300005355 Bacteria 1256
62 Ga0070674_100001355 3300005356 Bacteria 12909
63 Ga0070674_100139731 3300005356 Bacteria 1816
64 Ga0070674_100213607 3300005356 Bacteria 1497
65 Ga0070673_100000670 3300005364 Bacteria 18859
66 Ga0070673_100008314 3300005364 Bacteria 6894
67 Ga0070673_100053400 3300005364 Bacteria 3174
68 Ga0070673_100134138 3300005364 Bacteria 2082
69 Ga0070688_100031440 3300005365 Bacteria 3193
70 Ga0070688_100070770 3300005365 Bacteria 2231
71 Ga0070659_100001400 3300005366 Bacteria 17383
72 Ga0070659_100064806 3300005366 Bacteria 2893
73 Ga0070659_100108095 3300005366 Bacteria 2243
74 Ga0070659_100115234 3300005366 Bacteria 2172
75 Ga0070659_100159673 3300005366 Bacteria 1843
76 Ga0070667_100002340 3300005367 Bacteria 16596
77 Ga0070667_100061422 3300005367 Bacteria 3181
78 Ga0070703_10013030 3300005406 Bacteria 2357
79 Ga0070709_10022655 3300005434 Bacteria 3678
80 Ga0070714_100103577 3300005435 Bacteria 2510
81 Ga0070714_100256895 3300005435 Bacteria 1617
82 Ga0070713_100000838 3300005436 Bacteria 19660
83 Ga0070713_100015088 3300005436 Bacteria 5758
84 Ga0070713_100043089 3300005436 Bacteria 3687
85 Ga0070713_100129808 3300005436 Bacteria 2221
86 Ga0070713_100205600 3300005436 Bacteria 1780
87 Ga0070713_100219622 3300005436 Bacteria 1724
88 Ga0070710_10003726 3300005437 Bacteria 7205
89 Ga0070710_10012469 3300005437 Bacteria 4222
90 Ga0070710_10049287 3300005437 Bacteria 2355
91 Ga0070701_10019659 3300005438 Bacteria 3193
92 Ga0070701_10128181 3300005438 Bacteria 1439
93 Ga0070711_100028348 3300005439 Bacteria 3684
94 Ga0070711_100043244 3300005439 Bacteria 3050
95 Ga0070711_100055772 3300005439 Bacteria 2731
96 Ga0070711_100172289 3300005439 Bacteria 1650
97 Ga0070705_100001500 3300005440 Bacteria 12285
98 Ga0070705_100341336 3300005440 Bacteria 1089
99 Ga0070700_100001568 3300005441 Bacteria 11405
100 Ga0070700_100107815 3300005441 Bacteria 1846
101 Ga0070708_100105830 3300005445 Bacteria 2581
102 Ga0070708_100193052 3300005445 Bacteria 1905
103 Ga0070663_100001857 3300005455 Bacteria 11779
104 Ga0070678_100000391 3300005456 Bacteria 20585
105 Ga0070678_100015738 3300005456 Bacteria 4815
106 Ga0070678_100025297 3300005456 Bacteria 3991
107 Ga0070678_100227291 3300005456 Bacteria 1554
108 Ga0070662_100090457 3300005457 Bacteria 2297
109 Ga0070662_100220942 3300005457 Bacteria 1512
110 Ga0070681_10006791 3300005458 Bacteria 11139
111 Ga0068867_100006925 3300005459 Bacteria 8025
112 Ga0070685_10003877 3300005466 Bacteria 7563
113 Ga0070685_10008554 3300005466 Bacteria 5265
114 Ga0070698_100108778 3300005471 Bacteria 2739
115 Ga0070698_100183770 3300005471 Bacteria 2029
116 Ga0070699_100078736 3300005518 Bacteria 2871
117 Ga0070679_100026893 3300005530 Bacteria 5658
118 Ga0070679_100142520 3300005530 Bacteria 2375
119 Ga0070679_100299590 3300005530 Bacteria 1558
120 Ga0070684_100000101 3300005535 Bacteria 55960
121 Ga0070684_100074894 3300005535 Bacteria 2984
122 Ga0068853_100116865 3300005539 Bacteria 2375
123 Ga0068853_100251458 3300005539 Bacteria 1622
124 Ga0070672_100000016 3300005543 Bacteria 71848
125 Ga0070672_100259453 3300005543 Bacteria 1465
126 Ga0070686_100008745 3300005544 Bacteria 5675
127 Ga0070686_100018037 3300005544 Bacteria 4135
128 Ga0070686_100272537 3300005544 Bacteria 1245
129 Ga0070695_100000225 3300005545 Bacteria 27760
130 Ga0070695_100004140 3300005545 Bacteria 8475
131 Ga0070696_100002898 3300005546 Bacteria 11405
132 Ga0070696_100382194 3300005546 Bacteria 1098
133 Ga0070693_100000138 3300005547 Bacteria 32988
134 Ga0070693_100289511 3300005547 Bacteria 1100
135 Ga0070665_100146816 3300005548 Bacteria 2361
136 Ga0070665_100164185 3300005548 Bacteria 2223
137 Ga0070665_100172093 3300005548 Bacteria 2167
138 Ga0070704_100082859 3300005549 Bacteria 2366
139 Ga0068855_100000244 3300005563 Bacteria 68503
140 Ga0068855_100023959 3300005563 Bacteria 7308
141 Ga0068855_100040189 3300005563 Bacteria 5552
142 Ga0068855_100047984 3300005563 Bacteria 5042
143 Ga0068855_100059558 3300005563 Bacteria 4467
144 Ga0068855_100129068 3300005563 Bacteria 2888
145 Ga0068855_100245280 3300005563 Bacteria 1999
146 Ga0070664_100000067 3300005564 Bacteria 65201
147 Ga0070664_100039135 3300005564 Bacteria 3994
148 Ga0070664_100263518 3300005564 Bacteria 1551
149 Ga0068857_100000275 3300005577 Bacteria 35176
150 Ga0068857_100018470 3300005577 Bacteria 6116
151 Ga0068857_100066582 3300005577 Bacteria 3205
152 Ga0068857_100160864 3300005577 Bacteria 2037
153 Ga0068857_100176512 3300005577 Bacteria 1943
154 Ga0068857_100258758 3300005577 Bacteria 1597
155 Ga0068857_100751487 3300005577 Bacteria 929
156 Ga0068854_100002271 3300005578 Bacteria 11828
157 Ga0068854_100162112 3300005578 Bacteria 1733
158 Ga0068854_100420622 3300005578 Bacteria 1110
159 Ga0068856_100001016 3300005614 Bacteria 29871
160 Ga0068856_100069733 3300005614 Bacteria 3476
161 Ga0068856_100103133 3300005614 Bacteria 2846
162 Ga0068856_100120811 3300005614 Bacteria 2621
163 Ga0070702_100000175 3300005615 Bacteria 20470
164 Ga0070702_100125218 3300005615 Bacteria 1615
165 Ga0068852_100000611 3300005616 Bacteria 23441
166 Ga0068859_100002948 3300005617 Bacteria 17261
167 Ga0068859_100124564 3300005617 Bacteria 2645
168 Ga0068859_100179054 3300005617 Bacteria 2202
169 Ga0068864_100000234 3300005618 Bacteria 49663
170 Ga0068864_100021303 3300005618 Bacteria 5431
171 Ga0068864_100025360 3300005618 Bacteria 4992
172 Ga0068866_10002227 3300005718 Bacteria 8040
173 Ga0068866_10021000 3300005718 Bacteria 3000
174 Ga0068866_10097364 3300005718 Bacteria 1616
175 Ga0068861_100036887 3300005719 Bacteria 3631
176 Ga0068861_100044242 3300005719 Bacteria 3347
177 Ga0068861_100099380 3300005719 Bacteria 2311
178 Ga0068870_10000009 3300005840 Bacteria 70353
179 Ga0068863_100001729 3300005841 Bacteria 21634
180 Ga0068863_100142449 3300005841 Bacteria 2291
181 Ga0068863_100533685 3300005841 Bacteria 1157
182 Ga0068858_100001059 3300005842 Bacteria 28468
183 Ga0068858_100138508 3300005842 Bacteria 2284
184 Ga0068860_100003167 3300005843 Bacteria 16980
185 Ga0068860_100105682 3300005843 Bacteria 2688
186 Ga0068860_100377212 3300005843 Bacteria 1399
187 Ga0068862_100019397 3300005844 Bacteria 5675
188 Ga0068862_100039735 3300005844 Bacteria 3997
189 Ga0068862_100500322 3300005844 Bacteria 1153
190 Ga0081455_10011795 3300005937 Bacteria 8752
191 Ga0081455_10075776 3300005937 Bacteria 2774
192 Ga0081538_10149572 3300005981 Bacteria 1060
193 Ga0081540_1004206 3300005983 Bacteria 11062
194 Ga0081539_10018244 3300005985 Bacteria 4879
195 Ga0070717_10004993 3300006028 Bacteria 9653
196 Ga0070717_10099451 3300006028 Bacteria 2468
197 Ga0075368_10010605 3300006042 Bacteria 3335
198 Ga0075363_100082898 3300006048 Bacteria 1756
199 Ga0075364_10142245 3300006051 Bacteria 1614
200 Ga0070715_10017080 3300006163 Bacteria 2740
201 Ga0070715_10026067 3300006163 Bacteria 2321
202 Ga0070716_100003280 3300006173 Bacteria 7598
203 Ga0070712_100004136 3300006175 Bacteria 8914
204 Ga0070712_100023829 3300006175 Bacteria 4047
205 Ga0070712_100031650 3300006175 Bacteria 3565
206 Ga0070712_100039495 3300006175 Bacteria 3230
207 Ga0070712_100132686 3300006175 Bacteria 1890
208 Ga0075367_10013106 3300006178 Bacteria 4444
209 Ga0075367_10091430 3300006178 Bacteria 1851
210 Ga0075367_10153160 3300006178 Bacteria 1431
211 Ga0075369_10061791 3300006186 Bacteria 1636
212 Ga0075369_10150760 3300006186 Bacteria 1063
213 Ga0097621_100006760 3300006237 Bacteria 8145
214 Ga0075370_10034531 3300006353 Bacteria 2835
215 Ga0075370_10146369 3300006353 Bacteria 1383
216 Ga0068871_100000012 3300006358 Bacteria 105267
217 Ga0068871_100014044 3300006358 Bacteria 5956
218 Ga0068871_100053613 3300006358 Bacteria 3269
219 Ga0068871_100108554 3300006358 Bacteria 2332
220 Ga0075430_100072654 3300006846 Bacteria 2885
221 Ga0075434_100095961 3300006871 Bacteria 2970
222 Ga0075434_100147219 3300006871 Bacteria 2375
223 Ga0068865_100000355 3300006881 Bacteria 25325
224 Ga0068865_100005877 3300006881 Bacteria 7466
225 Ga0068865_100357595 3300006881 Bacteria 1185
226 Ga0075436_100006210 3300006914 Bacteria 8194
227 Ga0075436_100007339 3300006914 Bacteria 7533
228 Ga0097620_100002948 3300006931 Bacteria 17261
229 Ga0097620_100124548 3300006931 Bacteria 2645
230 Ga0097620_100179052 3300006931 Bacteria 2202
231 Ga0075435_100099820 3300007076 Bacteria 2404
232 Ga0105251_10017705 3300009011 Bacteria 3808
233 Ga0105240_10004853 3300009093 Bacteria 20253
234 Ga0105240_10022674 3300009093 Bacteria 8318
235 Ga0105240_10087262 3300009093 Bacteria 3821
236 Ga0105240_10185858 3300009093 Bacteria 2448
237 Ga0105240_10519388 3300009093 Bacteria 1322
238 Ga0105240_10559793 3300009093 Bacteria 1264
239 Ga0111539_10141004 3300009094 Bacteria 2821
240 Ga0111539_10329681 3300009094 Bacteria 1777
241 Ga0105245_10000409 3300009098 Bacteria 39920
242 Ga0105245_10152826 3300009098 Bacteria 2184
243 Ga0105245_10512549 3300009098 Bacteria 1217
244 Ga0105247_10004080 3300009101 Bacteria 9386
245 Ga0105247_10009067 3300009101 Bacteria 6056
246 Ga0105247_10038738 3300009101 Bacteria 2911
247 Ga0105247_10091424 3300009101 Bacteria 1933
248 Ga0105247_10266445 3300009101 Bacteria 1177
249 Ga0105247_10348041 3300009101 Bacteria 1041
250 Ga0105243_10004202 3300009148 Bacteria 11415
251 Ga0105243_10130712 3300009148 Bacteria 2129
252 Ga0105243_10543975 3300009148 Bacteria 1108
253 Ga0105241_10000053 3300009174 Bacteria 94578
254 Ga0105241_10010799 3300009174 Bacteria 6699
255 Ga0105241_10060625 3300009174 Bacteria 2911
256 Ga0105242_10011250 3300009176 Bacteria 6877
257 Ga0105242_10044930 3300009176 Bacteria 3578
258 Ga0105242_10221084 3300009176 Bacteria 1693
259 Ga0105248_10000309 3300009177 Bacteria 58008
260 Ga0105248_10038164 3300009177 Bacteria 5375
261 Ga0105248_10116016 3300009177 Bacteria 3020
262 Ga0105248_10176677 3300009177 Bacteria 2406
263 Ga0105248_10256225 3300009177 Bacteria 1970
264 Ga0105248_10424316 3300009177 Bacteria 1498
265 Ga0105237_10044970 3300009545 Bacteria 4445
266 Ga0105237_10112288 3300009545 Bacteria 2717
267 Ga0105237_10151426 3300009545 Bacteria 2316
268 Ga0105237_10176114 3300009545 Bacteria 2139
269 Ga0105238_10027365 3300009551 Bacteria 5809
270 Ga0105238_10111585 3300009551 Bacteria 2714
271 Ga0105249_10003451 3300009553 Bacteria 13696
272 Ga0105249_10231262 3300009553 Bacteria 1823
273 Ga0105239_10007939 3300010375 Bacteria 12129
274 Ga0105239_10011468 3300010375 Bacteria 9884
275 Ga0105246_10002040 3300011119 Bacteria 12194
276 Ga0157373_10040211 3300013100 Bacteria 3347
277 Ga0157371_10008314 3300013102 Bacteria 8286
278 Ga0157371_10266337 3300013102 Bacteria 1236
279 Ga0157370_10058079 3300013104 Bacteria 3677
280 Ga0157370_10161055 3300013104 Bacteria 2088
281 Ga0157369_10005855 3300013105 Bacteria 14284
282 Ga0157374_10000452 3300013296 Bacteria 37355
283 Ga0157374_10026788 3300013296 Bacteria 5191
284 Ga0157374_10065714 3300013296 Bacteria 3407
285 Ga0157374_10333689 3300013296 Bacteria 1504
286 Ga0157378_10000872 3300013297 Bacteria 27839
287 Ga0157378_10062596 3300013297 Bacteria 3323
288 Ga0157378_10365575 3300013297 Bacteria 1413
289 Ga0157378_10394722 3300013297 Bacteria 1362
290 Ga0163162_10000796 3300013306 Bacteria 29342
291 Ga0157372_10008710 3300013307 Bacteria 10774
292 Ga0157372_10054142 3300013307 Bacteria 4475
293 Ga0157372_10124519 3300013307 Bacteria 2963
294 Ga0157375_10004563 3300013308 Bacteria 12034
295 Ga0157375_10109327 3300013308 Bacteria 2860
296 Ga0157375_10625201 3300013308 Bacteria 1235
297 Ga0163163_10191746 3300014325 Bacteria 2092
298 Ga0157380_10015191 3300014326 Bacteria 5654
299 Ga0157380_10309619 3300014326 Bacteria 1459
300 Ga0157377_10000538 3300014745 Bacteria 16011
301 Ga0157379_10004942 3300014968 Bacteria 11442
302 Ga0157376_10002295 3300014969 Bacteria 12921
303 Ga0157376_10356693 3300014969 Bacteria 1401
304 Ga0163161_10000499 3300017792 Bacteria 32280
305 Ga0163161_10303267 3300017792 Bacteria 1258
306 Ga0206356_10556735 3300020070 Bacteria 1106
307 Ga0206354_11444921 3300020081 Bacteria 1596
308 Ga0206353_10552086 3300020082 Bacteria 1081
309 Ga0206353_10987334 3300020082 Bacteria 1940
310 Ga0213876_10005419 3300021384 Bacteria 7023
311 Ga0209233_1020069 3300025261 Bacteria 1760
312 Ga0207673_1000072 3300025290 Bacteria 8779
313 Ga0209758_1000616 3300025297 Bacteria 54936
314 Ga0207426_1000420 3300025302 Bacteria 69895
315 Ga0207697_10000252 3300025315 Bacteria 29548
316 Ga0207682_10000029 3300025893 Bacteria 57930
317 Ga0207692_10006712 3300025898 Bacteria 4678
318 Ga0207692_10075086 3300025898 Bacteria 1792
319 Ga0207692_10261499 3300025898 Bacteria 1041
320 Ga0207710_10001576 3300025900 Bacteria 11198
321 Ga0207710_10002176 3300025900 Bacteria 9215
322 Ga0207710_10164322 3300025900 Bacteria 1083
323 Ga0207688_10000020 3300025901 Bacteria 51200
324 Ga0207688_10093665 3300025901 Bacteria 1728
325 Ga0207688_10308730 3300025901 Bacteria 968
326 Ga0207680_10001555 3300025903 Bacteria 10815
327 Ga0207680_10124811 3300025903 Bacteria 1688
328 Ga0207680_10203482 3300025903 Bacteria 1350
329 Ga0207647_10001753 3300025904 Bacteria 16640
330 Ga0207645_10000108 3300025907 Bacteria 61630
331 Ga0207645_10057516 3300025907 Bacteria 2483
332 Ga0207643_10000044 3300025908 Bacteria 82217
333 Ga0207654_10004211 3300025911 Bacteria 7261
334 Ga0207707_10014616 3300025912 Bacteria 6839
335 Ga0207707_10137962 3300025912 Bacteria 2132
336 Ga0207695_10018913 3300025913 Bacteria 7947
337 Ga0207695_10038814 3300025913 Bacteria 5122
338 Ga0207695_10185078 3300025913 Bacteria 2002
339 Ga0207695_10399314 3300025913 Bacteria 1259
340 Ga0207671_10031026 3300025914 Bacteria 3985
341 Ga0207671_10152873 3300025914 Bacteria 1784
342 Ga0207693_10017047 3300025915 Bacteria 5799
343 Ga0207693_10071211 3300025915 Bacteria 2720
344 Ga0207693_10120847 3300025915 Bacteria 2057
345 Ga0207693_10206099 3300025915 Bacteria 1546
346 Ga0207663_10147759 3300025916 Bacteria 1645
347 Ga0207663_10210790 3300025916 Bacteria 1408
348 Ga0207660_10000543 3300025917 Bacteria 25357
349 Ga0207662_10005777 3300025918 Bacteria 6621
350 Ga0207657_10004676 3300025919 Bacteria 14449
351 Ga0207657_10016668 3300025919 Bacteria 7080
352 Ga0207657_10103241 3300025919 Bacteria 2363
353 Ga0207649_10000057 3300025920 Bacteria 102314
354 Ga0207649_10139493 3300025920 Bacteria 1657
355 Ga0207652_10006960 3300025921 Bacteria 9111
356 Ga0207652_10013118 3300025921 Bacteria 6709
357 Ga0207652_10070361 3300025921 Bacteria 3038
358 Ga0207681_10001187 3300025923 Bacteria 16757
359 Ga0207694_10086806 3300025924 Bacteria 2464
360 Ga0207694_10139021 3300025924 Bacteria 1952
361 Ga0207650_10001534 3300025925 Bacteria 16557
362 Ga0207659_10000028 3300025926 Bacteria 130804
363 Ga0207659_10192498 3300025926 Bacteria 1624
364 Ga0207687_10000061 3300025927 Bacteria 84113
365 Ga0207687_10020799 3300025927 Bacteria 4354
366 Ga0207700_10001257 3300025928 Bacteria 14436
367 Ga0207700_10013859 3300025928 Bacteria 5264
368 Ga0207700_10116961 3300025928 Bacteria 2155
369 Ga0207700_10175241 3300025928 Bacteria 1792
370 Ga0207664_10042991 3300025929 Bacteria 3531
371 Ga0207664_10074898 3300025929 Bacteria 2736
372 Ga0207664_10142206 3300025929 Bacteria 2031
373 Ga0207644_10000194 3300025931 Bacteria 43567
374 Ga0207644_10013156 3300025931 Bacteria 5509
375 Ga0207644_10253326 3300025931 Bacteria 1405
376 Ga0207644_10273889 3300025931 Bacteria 1353
377 Ga0207690_10000225 3300025932 Bacteria 42706
378 Ga0207690_10273120 3300025932 Bacteria 1314
379 Ga0207706_10004628 3300025933 Bacteria 12903
380 Ga0207706_10118069 3300025933 Bacteria 2333
381 Ga0207706_10145008 3300025933 Bacteria 2089
382 Ga0207686_10007051 3300025934 Bacteria 6046
383 Ga0207686_10162213 3300025934 Bacteria 1568
384 Ga0207686_10165301 3300025934 Bacteria 1555
385 Ga0207709_10000291 3300025935 Bacteria 56621
386 Ga0207670_10000434 3300025936 Bacteria 23430
387 Ga0207670_10021555 3300025936 Bacteria 3978
388 Ga0207669_10000019 3300025937 Bacteria 111630
389 Ga0207704_10000438 3300025938 Bacteria 18608
390 Ga0207704_10076485 3300025938 Bacteria 2145
391 Ga0207665_10001157 3300025939 Bacteria 17725
392 Ga0207665_10028871 3300025939 Bacteria 3667
393 Ga0207665_10105265 3300025939 Bacteria 1975
394 Ga0207691_10001047 3300025940 Bacteria 27463
395 Ga0207691_10097584 3300025940 Bacteria 2626
396 Ga0207691_10159480 3300025940 Bacteria 1980
397 Ga0207691_10240356 3300025940 Bacteria 1566
398 Ga0207711_10002887 3300025941 Bacteria 15057
399 Ga0207711_10044822 3300025941 Bacteria 3777
400 Ga0207711_10113298 3300025941 Bacteria 2414
401 Ga0207711_10163067 3300025941 Bacteria 2019
402 Ga0207711_10480654 3300025941 Bacteria 1157
403 Ga0207689_10001160 3300025942 Bacteria 25357
404 Ga0207661_10000126 3300025944 Bacteria 48665
405 Ga0207661_10142887 3300025944 Bacteria 2061
406 Ga0207679_10000026 3300025945 Bacteria 200073
407 Ga0207679_10017686 3300025945 Bacteria 4760
408 Ga0207679_10131260 3300025945 Bacteria 2010
409 Ga0207679_10305927 3300025945 Bacteria 1372
410 Ga0207679_10416359 3300025945 Bacteria 1185
411 Ga0207667_10000392 3300025949 Bacteria 59118
412 Ga0207667_10018494 3300025949 Bacteria 7812
413 Ga0207667_10023513 3300025949 Bacteria 6785
414 Ga0207667_10106775 3300025949 Bacteria 2888
415 Ga0207667_10169337 3300025949 Bacteria 2245
416 Ga0207651_10001232 3300025960 Bacteria 11489
417 Ga0207651_10094796 3300025960 Bacteria 2196
418 Ga0207651_10339791 3300025960 Bacteria 1261
419 Ga0207712_10002654 3300025961 Bacteria 11451
420 Ga0207712_10257325 3300025961 Bacteria 1414
421 Ga0207668_10000049 3300025972 Bacteria 99391
422 Ga0207668_10082572 3300025972 Bacteria 2335
423 Ga0207640_10001994 3300025981 Bacteria 11014
424 Ga0207658_10001093 3300025986 Bacteria 21888
425 Ga0207658_10014381 3300025986 Bacteria 5420
426 Ga0207658_10339899 3300025986 Bacteria 1304
427 Ga0207677_10000229 3300026023 Bacteria 44154
428 Ga0207677_10107305 3300026023 Bacteria 2071
429 Ga0207703_10012519 3300026035 Bacteria 6612
430 Ga0207703_10059566 3300026035 Bacteria 3119
431 Ga0207703_10133147 3300026035 Bacteria 2149
432 Ga0207639_10002735 3300026041 Bacteria 11838
433 Ga0207639_10069768 3300026041 Bacteria 2743
434 Ga0207639_10074245 3300026041 Bacteria 2669
435 Ga0207678_10000403 3300026067 Bacteria 39172
436 Ga0207678_10044346 3300026067 Bacteria 3847
437 Ga0207678_10066998 3300026067 Bacteria 3082
438 Ga0207678_10071985 3300026067 Bacteria 2963
439 Ga0207678_10201644 3300026067 Bacteria 1701
440 Ga0207678_10390069 3300026067 Bacteria 1204
441 Ga0207708_10090192 3300026075 Bacteria 2363
442 Ga0207708_10246082 3300026075 Bacteria 1439
443 Ga0207702_10001378 3300026078 Bacteria 24247
444 Ga0207702_10034279 3300026078 Bacteria 4243
445 Ga0207702_10124924 3300026078 Bacteria 2308
446 Ga0207702_10174951 3300026078 Bacteria 1971
447 Ga0207641_10163831 3300026088 Bacteria 2023
448 Ga0207641_10237584 3300026088 Bacteria 1696
449 Ga0207648_10001244 3300026089 Bacteria 28553
450 Ga0207648_10030687 3300026089 Bacteria 4757
451 Ga0207676_10000672 3300026095 Bacteria 27349
452 Ga0207676_10010659 3300026095 Bacteria 6555
453 Ga0207676_10013475 3300026095 Bacteria 5873
454 Ga0207676_10023642 3300026095 Bacteria 4537
455 Ga0207676_10255784 3300026095 Bacteria 1579
456 Ga0207674_10001968 3300026116 Bacteria 26001
457 Ga0207674_10031314 3300026116 Bacteria 5588
458 Ga0207674_10051024 3300026116 Bacteria 4223
459 Ga0207674_10189055 3300026116 Bacteria 2009
460 Ga0207674_10190575 3300026116 Bacteria 2000
461 Ga0207674_10258499 3300026116 Bacteria 1688
462 Ga0207674_10550757 3300026116 Bacteria 1114
463 Ga0207675_100048673 3300026118 Bacteria 3956
464 Ga0207675_100132497 3300026118 Bacteria 2363
465 Ga0207683_10000034 3300026121 Bacteria 101817
466 Ga0207683_10080952 3300026121 Bacteria 2882
467 Ga0207683_10091941 3300026121 Bacteria 2703
468 Ga0207683_10136341 3300026121 Bacteria 2209
469 Ga0207683_10145961 3300026121 Bacteria 2133
470 Ga0207698_10042171 3300026142 Bacteria 3406
471 Ga0207698_10074280 3300026142 Bacteria 2712
472 Ga0207698_10082670 3300026142 Bacteria 2597
473 Ga0209973_1009382 3300027252 Bacteria 1138
474 Ga0209389_1000033 3300027296 Bacteria 131516
475 Ga0209589_1000040 3300027357 Bacteria 126550
476 Ga0209489_100045 3300027361 Bacteria 158225
477 Ga0209967_1009745 3300027364 Bacteria 1334
478 Ga0209970_1004643 3300027614 Bacteria 2274
479 Ga0210002_1000151 3300027617 Bacteria 10314
480 Ga0209983_1002418 3300027665 Bacteria 4091
481 Ga0209966_1002008 3300027695 Bacteria 3404
482 Ga0209974_10018966 3300027876 Bacteria 2281
483 Ga0209974_10054896 3300027876 Bacteria 1343
484 Ga0209974_10061656 3300027876 Bacteria 1270
485 Ga0207428_10000352 3300027907 Bacteria 59444
486 Ga0268266_10002169 3300028379 Bacteria 21507
487 Ga0268266_10003979 3300028379 Bacteria 14332
488 Ga0268266_10111381 3300028379 Bacteria 2425
489 Ga0268266_10155077 3300028379 Bacteria 2068
490 Ga0268265_10000410 3300028380 Bacteria 45939
491 Ga0268265_10106730 3300028380 Bacteria 2275
492 Ga0268265_10182536 3300028380 Bacteria 1804
493 Ga0268265_10436397 3300028380 Bacteria 1220
494 Ga0268265_10672524 3300028380 Bacteria 997
495 Ga0268264_10000062 3300028381 Bacteria 302110
496 Ga0268264_10001567 3300028381 Bacteria 21210
497 Ga0268264_10473333 3300028381 Bacteria 1217
498 Ga0307517_10074981 3300028786 Bacteria 2974
499 Ga0307517_10204464 3300028786 Bacteria 1228
500 Ga0265338_10054112 3300028800 Bacteria 3583
501 Ga0265325_10000141 3300031241 Bacteria 50291
502 Ga0265325_10011173 3300031241 Bacteria 5167
503 Ga0265340_10039425 3300031247 Bacteria 2331
504 Ga0265316_10076472 3300031344 Bacteria 2572
505 Ga0265316_10087704 3300031344 Bacteria 2377
506 Ga0307513_10245025 3300031456 Bacteria 1594
507 Ga0307509_10134992 3300031507 Bacteria 2415
508 Ga0307408_100102075 3300031548 Bacteria 2187
509 Ga0265313_10000008 3300031595 Bacteria 173405
510 Ga0265313_10007607 3300031595 Bacteria 7354
511 Ga0265313_10007635 3300031595 Bacteria 7334
512 Ga0265313_10055574 3300031595 Bacteria 1875
513 Ga0265314_10003949 3300031711 Bacteria 14062
514 Ga0265314_10068326 3300031711 Bacteria 2389
515 Ga0265342_10000912 3300031712 Bacteria 29335
516 Ga0307516_10090465 3300031730 Bacteria 2889
517 Ga0307407_10062753 3300031903 Bacteria 2178
518 Ga0307411_10334840 3300032005 Bacteria 1228
519 Ga0307415_100198287 3300032126 Bacteria 1590
520 Ga0316583_10067483 3300032133 Bacteria 1252
521 Ga0307510_10010287 3300033180 Bacteria 11113
522 Ga0315911_1000008 3300033442 Bacteria 381285
523 Ga0373930_0006816 3300034816 Bacteria 1946
524 Ga0373926_0002177 3300035083 Bacteria 6173
525 Ga0373926_0026925 3300035083 Bacteria 2013
526 Ga0373928_0004025 3300035084 Bacteria 2805
527 Ga0373928_0013398 3300035084 Bacteria 1646
528 Ga0373929_0003944 3300035085 Bacteria 2658
529 Ga0373934_0004922 3300035086 Bacteria 4945
530 Ga0373934_0006581 3300035086 Bacteria 4310
531 Ga0373940_0001866 3300035088 Bacteria 3956
532 Ga0373944_0002474 3300035089 Bacteria 4696
533 Ga0373944_0056352 3300035089 Bacteria 1250
534 Ga0373949_0004067 3300035090 Bacteria 3387
535 Ga0373951_0008754 3300035091 Bacteria 2281
536 Ga0373951_0020349 3300035091 Bacteria 1518
537 Ga0373952_0001062 3300035092 Bacteria 5024
538 Ga0373923_0010862 3300035111 Bacteria 3325
539 Ga0373923_0032130 3300035111 Bacteria 2119
540 Ga0373923_0039425 3300035111 Bacteria 1940
541 Ga0373932_0009450 3300035112 Bacteria 2344
542 Ga0373936_0003212 3300035113 Bacteria 6130
543 Ga0373936_0021839 3300035113 Bacteria 2490
544 Ga0373939_0000706 3300035114 Bacteria 8274
545 Ga0373939_0072659 3300035114 Bacteria 1124
546 Ga0373941_0007982 3300035115 Bacteria 2612
547 Ga0373941_0032927 3300035115 Bacteria 1554
548 Ga0373945_0006425 3300035116 Bacteria 3791
549 Ga0373953_0009788 3300035117 Bacteria 3314
550 Ga0373954_0064983 3300035118 Bacteria 1726
551 Ga0373956_0009825 3300035119 Bacteria 3898
552 Ga0373956_0019299 3300035119 Bacteria 2890
553 Ga0373943_0002977 3300035170 Bacteria 7688
554 Ga0373946_0006715 3300035171 Bacteria 4180
555 Ga0373946_0037007 3300035171 Bacteria 1982
556 Ga0373946_0077953 3300035171 Bacteria 1445
557 Ga0373955_0003281 3300035172 Bacteria 7094
558 Ga0373955_0009848 3300035172 Bacteria 4495
559 Ga0373955_0048173 3300035172 Bacteria 2310
560 Ga0373961_0006819 3300035241 Bacteria 2746
561 Ga0373961_0049321 3300035241 Bacteria 1244
562 Ga0373961_0063469 3300035241 Bacteria 1127
563 Ga0373962_0000258 3300035242 Bacteria 11309
564 Ga0373962_0015271 3300035242 Bacteria 1967
565 Ga0373924_0004203 3300035410 Bacteria 5018
566 Ga0373931_0005613 3300035691 Bacteria 5819
567 Ga0373931_0017116 3300035691 Bacteria 3578
568 Ga0373935_0000046 3300035692 Bacteria 48734
569 Ga0373935_0012931 3300035692 Bacteria 5029
570 Ga0373935_0175368 3300035692 Bacteria 1469
571 Ga0373927_0000209 3300035695 Bacteria 46820
572 Ga0373927_0020410 3300035695 Bacteria 4344
573 Ga0373927_0084080 3300035695 Bacteria 2064
574 Ga0373927_0182326 3300035695 Bacteria 1377
575 Ga0373927_0196592 3300035695 Bacteria 1323
576 Ga0373927_0373028 3300035695 Bacteria 941
577 Ga0373933_0003160 3300035724 Bacteria 9199
578 Ga0373933_0036726 3300035724 Bacteria 2870
579 Ga0373933_0040475 3300035724 Bacteria 2746
580 Ga0373933_0063278 3300035724 Bacteria 2236
581 Ga0373933_0103089 3300035724 Bacteria 1772
582 Ga0373947_0002886 3300035725 Bacteria 10264
583 Ga0373947_0296030 3300035725 Bacteria 1078
584 Ga0373937_0012815 3300036401 Bacteria 7383
585 Ga0373937_0023444 3300036401 Bacteria 5556
586 Ga0373937_0040665 3300036401 Bacteria 4238
587 Ga0373937_0045771 3300036401 Bacteria 3999
588 Ga0373937_0133441 3300036401 Bacteria 2320
589 Ga0373937_0202587 3300036401 Bacteria 1866
590 Ga0373937_0572521 3300036401 Bacteria 1073
591 Ga0372808_008217 3300036459 Bacteria 1443
592 Ga0373925_0005099 3300037068 Bacteria 9835
593 Ga0373925_0037718 3300037068 Bacteria 3569
594 Ga0373925_0126389 3300037068 Bacteria 1990
595 Ga0373925_0370250 3300037068 Bacteria 1165
596 Ga0395900_0005151 3300037418 Bacteria 13732
597 Ga0395900_0105347 3300037418 Bacteria 2897
598 Ga0395898_0003493 3300037466 Bacteria 17565
599 Ga0395898_0036540 3300037466 Bacteria 4877
600 Ga0395901_0043590 3300038443 Bacteria 4653
601 Ga0436365_0911459 3300039437 Bacteria 3343
602 Ga0436365_1148686 3300039437 Bacteria 18630
603 Ga0436365_1181233 3300039437 Bacteria 4977
604 Ga0436365_1422081 3300039437 Bacteria 3254
605 Ga0436363_0927837 3300039450 Bacteria 5750
606 Ga0451793_1659208 3300041452 Bacteria 2586
607 Ga0451800_1674697 3300041459 Bacteria 1001
608 Ga0451807_0850701 3300041486 Bacteria 2875
609 Ga0451807_1403845 3300041486 Bacteria 1097
610 Ga0439445_0045246 3300042004 Bacteria 1177
611 Ga0466963_0091246 3300044694 Bacteria 2075
612 Ga0466963_0092478 3300044694 Bacteria 2061
613 Ga0466963_0109353 3300044694 Bacteria 1896
614 Ga0495617_053834 3300046452 Bacteria 1336
615 Ga0495592_0000513 3300046454 Bacteria 28143
616 Ga0495592_0008115 3300046454 Bacteria 7885
617 Ga0495592_0169782 3300046454 Bacteria 1495
618 Ga0495603_0000153 3300046455 Bacteria 34539
619 Ga0495603_0035918 3300046455 Bacteria 2975
620 Ga0495629_0007084 3300046459 Bacteria 8262
621 Ga0495629_0033278 3300046459 Bacteria 3647
622 Ga0495638_0028639 3300046460 Bacteria 3594
623 Ga0495641_0008708 3300046461 Bacteria 6137
624 Ga0495641_0094615 3300046461 Bacteria 1334
625 Ga0495651_0025967 3300046462 Bacteria 4560
626 Ga0495651_0027931 3300046462 Bacteria 4398
627 Ga0495651_0204633 3300046462 Bacteria 1379
628 Ga0495653_0000912 3300046463 Bacteria 22874
629 Ga0495653_0019530 3300046463 Bacteria 5495
630 Ga0495653_0026746 3300046463 Bacteria 4624
631 Ga0495653_0095109 3300046463 Bacteria 2170
632 Ga0495653_0105670 3300046463 Bacteria 2032
633 Ga0495580_0000246 3300046472 Bacteria 43076
634 Ga0495580_0026873 3300046472 Bacteria 4192
635 Ga0495580_0098423 3300046472 Bacteria 2034
636 Ga0495582_0000686 3300046473 Bacteria 18641
637 Ga0495582_0033766 3300046473 Bacteria 2813
638 Ga0495639_0000799 3300046475 Bacteria 14377
639 Ga0495662_0029283 3300046476 Bacteria 2659
640 Ga0495662_0043882 3300046476 Bacteria 2158
641 Ga0495662_0074205 3300046476 Bacteria 1650
642 Ga0495664_0015494 3300046477 Bacteria 4334
643 Ga0495664_0051228 3300046477 Bacteria 2451
644 Ga0495664_0073934 3300046477 Bacteria 2038
645 Ga0495664_0085121 3300046477 Bacteria 1898
646 Ga0495584_0006986 3300046491 Bacteria 5897
647 Ga0495584_0103335 3300046491 Bacteria 1441
648 Ga0495585_0004083 3300046492 Bacteria 9592
649 Ga0495594_0000243 3300046499 Bacteria 26402
650 Ga0495594_0057740 3300046499 Bacteria 2143
651 Ga0495607_0038217 3300046501 Bacteria 2877
652 Ga0495606_0232159 3300046507 Bacteria 1033
653 Ga0495608_0008983 3300046511 Bacteria 6987
654 Ga0495608_0022196 3300046511 Bacteria 4350
655 Ga0495608_0281239 3300046511 Bacteria 1033
656 Ga0495618_0002089 3300046514 Bacteria 13103
657 Ga0495618_0104308 3300046514 Bacteria 1815
658 Ga0495620_0019530 3300046515 Bacteria 3330
659 Ga0495628_0011083 3300046516 Bacteria 7628
660 Ga0495628_0034712 3300046516 Bacteria 4056
661 Ga0495628_0054964 3300046516 Bacteria 3137
662 Ga0495630_0062267 3300046517 Bacteria 2802
663 Ga0495630_0123501 3300046517 Bacteria 1964
664 Ga0495630_0565085 3300046517 Bacteria 872
665 Ga0495632_0000006 3300046519 Bacteria 345883
666 Ga0495632_0155594 3300046519 Bacteria 1055
667 Ga0495637_0000784 3300046520 Bacteria 21358
668 Ga0495643_0000021 3300046522 Bacteria 293465
669 Ga0495644_0003549 3300046523 Bacteria 6164
670 Ga0495648_0038726 3300046524 Bacteria 3044
671 Ga0495648_0069726 3300046524 Bacteria 2045
672 Ga0495663_0000008 3300046525 Bacteria 260614
673 Ga0495663_0020493 3300046525 Bacteria 1898
674 Ga0495666_0100331 3300046526 Bacteria 1364
675 Ga0495652_0028963 3300046529 Bacteria 4865
676 Ga0495652_0040789 3300046529 Bacteria 4012
677 Ga0495652_0195762 3300046529 Bacteria 1538
678 Ga0495665_0000341 3300046531 Bacteria 23627
679 Ga0495665_0011091 3300046531 Bacteria 4877
680 Ga0495665_0205783 3300046531 Bacteria 1019
681 Ga0495640_0000521 3300046533 Bacteria 28196
682 Ga0495640_0067780 3300046533 Bacteria 2403
683 Ga0495640_0138997 3300046533 Bacteria 1566
684 Ga0495640_0155157 3300046533 Bacteria 1469
685 Ga0495586_0182752 3300046535 Bacteria 1186
686 Ga0495587_0113466 3300046536 Bacteria 1555
687 Ga0495587_0130609 3300046536 Bacteria 1436
688 Ga0495598_0029638 3300046537 Bacteria 1527
689 Ga0495609_0030375 3300046538 Bacteria 2459
690 Ga0495645_0001151 3300046543 Bacteria 17952
691 Ga0495645_0075566 3300046543 Bacteria 2425
692 Ga0495645_0080582 3300046543 Bacteria 2336
693 Ga0495622_0006107 3300046557 Bacteria 5596
694 Ga0495622_0011002 3300046557 Bacteria 4175
695 Ga0495633_0000247 3300046558 Bacteria 64533
696 Ga0495633_0001265 3300046558 Bacteria 20151
697 Ga0495633_0018376 3300046558 Bacteria 3551
698 Ga0495667_0027764 3300046559 Bacteria 3811
699 Ga0495667_0033180 3300046559 Bacteria 3455
700 Ga0495667_0116845 3300046559 Bacteria 1723
701 Ga0495656_0000297 3300046615 Bacteria 17243
702 Ga0495656_0057004 3300046615 Bacteria 1690
703 Ga0495656_0221867 3300046615 Bacteria 945
704 Ga0495668_0194952 3300046616 Bacteria 1109
705 Ga0495634_0006489 3300046642 Bacteria 8886
706 Ga0495611_0031638 3300046648 Bacteria 2330
707 Ga0495611_0177172 3300046648 Bacteria 996
708 Ga0495635_0000470 3300046663 Bacteria 25525
709 Ga0495635_0011642 3300046663 Bacteria 6164
710 Ga0495659_0008457 3300046664 Bacteria 3275
711 Ga0495588_0007378 3300046674 Bacteria 4999
712 Ga0495588_0008423 3300046674 Bacteria 4732
713 Ga0495657_0009329 3300046675 Bacteria 7447
714 Ga0495657_0064306 3300046675 Bacteria 2417
715 Ga0495657_0135465 3300046675 Bacteria 1539
716 Ga0495599_0018304 3300046678 Bacteria 4365
717 Ga0495599_0125811 3300046678 Bacteria 1593
718 Ga0495623_0017571 3300046679 Bacteria 4620
719 Ga0495646_0009857 3300046680 Bacteria 6070
720 Ga0495646_0014448 3300046680 Bacteria 5021
721 Ga0495647_0002355 3300046681 Bacteria 5935
722 Ga0495647_0024406 3300046681 Bacteria 2201
723 Ga0495647_0074420 3300046681 Bacteria 1365
724 Ga0495658_0003407 3300046683 Bacteria 7873
725 Ga0495669_0018118 3300046684 Bacteria 3025
726 Ga0495613_0079747 3300046689 Bacteria 2380
727 Ga0495624_0000144 3300046690 Bacteria 51509
728 Ga0495624_0231186 3300046690 Bacteria 1120
729 Ga0495670_0002440 3300046691 Bacteria 9182
730 Ga0495670_0012052 3300046691 Bacteria 4254
731 Ga0495671_0000017 3300046692 Bacteria 293465
732 Ga0495589_0022874 3300046794 Bacteria 3187
733 Ga0495589_0027347 3300046794 Bacteria 2884
734 Ga0495600_0075284 3300046809 Bacteria 2204
735 Ga0495600_0114453 3300046809 Bacteria 1756
736 Ga0495581_0000223 3300047315 Bacteria 26718
737 Ga0495604_0006502 3300047317 Bacteria 9261
738 Ga0495604_0010832 3300047317 Bacteria 7242
739 Ga0495604_0028443 3300047317 Bacteria 4447
740 Ga0495674_0000700 3300047319 Bacteria 31695
741 Ga0495674_0050715 3300047319 Bacteria 3661
742 Ga0495676_0012616 3300047321 Bacteria 7606
743 Ga0495676_0052101 3300047321 Bacteria 3269
744 Ga0495676_0088961 3300047321 Bacteria 2314
745 Ga0495680_0133466 3300047322 Bacteria 1822
746 Ga0495673_0045725 3300047469 Bacteria 1944
747 Ga0495681_0054630 3300047470 Bacteria 1865
748 Ga0495684_0008189 3300047471 Bacteria 8090
749 Ga0495684_0019592 3300047471 Bacteria 5213
750 Ga0495684_0070264 3300047471 Bacteria 2662
751 Ga0495686_0154635 3300047472 Bacteria 1344
752 Ga0495593_0000007 3300047673 Bacteria 87657
753 Ga0495593_0053018 3300047673 Bacteria 2141
754 Ga0495593_0109969 3300047673 Bacteria 1408
755 Ga0495602_0046224 3300048088 Bacteria 3934
756 Ga0495602_0064510 3300048088 Bacteria 3166
757 Ga0495602_0262997 3300048088 Bacteria 1279
758 Ga0495614_0064488 3300048089 Bacteria 1575
759 Ga0496100_0001439 3300048903 Bacteria 11651
760 Ga0496100_0042849 3300048903 Bacteria 2892
761 Ga0496101_0000171 3300048904 Bacteria 53757
762 Ga0496101_0014780 3300048904 Bacteria 5251
763 Ga0496101_0067795 3300048904 Bacteria 2606
764 Ga0496101_0097188 3300048904 Bacteria 2199
765 Ga0496101_0106117 3300048904 Bacteria 2109
766 Ga0496101_0198928 3300048904 Bacteria 1548
767 Ga0496102_0004728 3300048905 Bacteria 11530
768 Ga0496102_0062018 3300048905 Bacteria 3423
769 Ga0496102_0072433 3300048905 Bacteria 3166
770 Ga0496102_0170807 3300048905 Bacteria 2047
771 Ga0496103_0001994 3300048906 Bacteria 13160
772 Ga0496103_0033981 3300048906 Bacteria 3117
773 Ga0496103_0051430 3300048906 Bacteria 2550
774 Ga0496103_0130948 3300048906 Bacteria 1602
775 Ga0496104_0000067 3300048907 Bacteria 108556
776 Ga0496104_0086181 3300048907 Bacteria 2998
777 Ga0496104_0226813 3300048907 Bacteria 1780
778 Ga0496104_0255365 3300048907 Bacteria 1665
779 Ga0496104_0313519 3300048907 Bacteria 1481
780 Ga0496104_0324287 3300048907 Bacteria 1453
781 Ga0496105_0000130 3300048908 Bacteria 50576
782 Ga0496105_0016996 3300048908 Bacteria 5822
783 Ga0496105_0086060 3300048908 Bacteria 2597
784 Ga0496106_0000581 3300048909 Bacteria 26118
785 Ga0496106_0031601 3300048909 Bacteria 3946
786 Ga0496106_0107536 3300048909 Bacteria 2169
787 Ga0496106_0145671 3300048909 Bacteria 1865
788 Ga0496107_0000224 3300048910 Bacteria 29999
789 Ga0496107_0016922 3300048910 Bacteria 5126
790 Ga0496108_0000547 3300048911 Bacteria 29390
791 Ga0496108_0031606 3300048911 Bacteria 4393
792 Ga0496108_0051587 3300048911 Bacteria 3446
793 Ga0496108_0071071 3300048911 Bacteria 2936
794 Ga0496108_0153649 3300048911 Bacteria 1986
795 Ga0496109_0000384 3300048912 Bacteria 40091
796 Ga0496109_0014332 3300048912 Bacteria 6898
797 Ga0496109_0045791 3300048912 Bacteria 3971
798 Ga0496109_0173137 3300048912 Bacteria 2025
799 Ga0496109_0449569 3300048912 Bacteria 1217
800 Ga0496109_0605465 3300048912 Bacteria 1032
801 Ga0496110_0008712 3300048913 Bacteria 8169
802 Ga0496110_0018951 3300048913 Bacteria 5782
803 Ga0496110_0101203 3300048913 Bacteria 2583
804 Ga0496111_0005888 3300048914 Bacteria 7904
805 Ga0496111_0081880 3300048914 Bacteria 2357
806 Ga0496111_0227857 3300048914 Bacteria 1384
807 Ga0496112_0087114 3300048915 Bacteria 3090
808 Ga0496112_0095365 3300048915 Bacteria 2945
809 Ga0496112_0226817 3300048915 Bacteria 1823
810 Ga0496113_0122603 3300048916 Bacteria 2033
811 Ga0496114_0004538 3300048917 Bacteria 10780
812 Ga0496114_0009885 3300048917 Bacteria 7582
813 Ga0496114_0027436 3300048917 Bacteria 4665
814 Ga0496114_0061841 3300048917 Bacteria 3133
815 Ga0496114_0346705 3300048917 Bacteria 1313
816 Ga0496115_0000826 3300048918 Bacteria 22686
817 Ga0496115_0115152 3300048918 Bacteria 2210
818 Ga0496117_0053499 3300048920 Bacteria 2836
819 Ga0496118_0027463 3300048921 Bacteria 4816
820 Ga0496119_0048946 3300048922 Bacteria 2617
821 Ga0496121_0003211 3300048924 Bacteria 23523
822 Ga0496121_0039220 3300048924 Bacteria 4179
823 Ga0496121_0046169 3300048924 Bacteria 3731
824 Ga0496121_0048197 3300048924 Bacteria 3627
825 Ga0496121_0161441 3300048924 Bacteria 1638
826 Ga0496121_0247341 3300048924 Bacteria 1239
827 Ga0496125_0019978 3300048928 Bacteria 6298
828 Ga0496125_0108084 3300048928 Bacteria 2025
829 Ga0496125_0116572 3300048928 Bacteria 1918
830 Ga0496126_0027170 3300048929 Bacteria 5471
831 Ga0496126_0030950 3300048929 Bacteria 5062
832 Ga0496126_0040378 3300048929 Bacteria 4325
833 Ga0496126_0060648 3300048929 Bacteria 3401
834 Ga0496126_0157417 3300048929 Bacteria 1943
835 Ga0495678_079984 3300049459 Bacteria 1176
836 Ga0495682_0105118 3300049460 Bacteria 1012
837 Ga0501031_0004917 3300049568 Bacteria 8682
838 Ga0501031_0013835 3300049568 Bacteria 5257
839 Ga0501032_0152192 3300049569 Bacteria 1520
840 Ga0501032_0177883 3300049569 Bacteria 1393
841 Ga0501033_0018842 3300049570 Bacteria 5219
842 Ga0501034_0000374 3300049571 Bacteria 76280
843 Ga0501034_0044836 3300049571 Bacteria 4470
844 Ga0501034_0082021 3300049571 Bacteria 3227
845 Ga0501034_0213838 3300049571 Bacteria 1882
846 Ga0501037_0042826 3300049573 Bacteria 3327
847 Ga0501037_0050928 3300049573 Bacteria 3029
848 Ga0501037_0156941 3300049573 Bacteria 1623
849 Ga0501037_0180327 3300049573 Bacteria 1498
850 Ga0501038_0008546 3300049574 Bacteria 9402
851 Ga0501038_0027921 3300049574 Bacteria 5015
852 Ga0501038_0056927 3300049574 Bacteria 3357
853 Ga0501038_0076965 3300049574 Bacteria 2817
854 Ga0501039_0066565 3300049575 Bacteria 2796
855 Ga0501039_0085658 3300049575 Bacteria 2454
856 Ga0501042_0000540 3300049578 Bacteria 19832
857 Ga0501043_0064916 3300049579 Bacteria 2866
858 Ga0501047_0026583 3300049581 Bacteria 5569
859 Ga0501047_0131910 3300049581 Bacteria 2378
860 Ga0501047_0211521 3300049581 Bacteria 1798
861 Ga0501047_0337754 3300049581 Bacteria 1344
862 Ga0501048_0004376 3300049582 Bacteria 10754
863 Ga0501048_0028790 3300049582 Bacteria 4032
864 Ga0501067_0016188 3300049583 Bacteria 4121
865 Ga0501067_0113207 3300049583 Bacteria 1509
866 Ga0501068_0003581 3300049584 Bacteria 8390
867 Ga0501068_0060938 3300049584 Bacteria 2291
868 Ga0501070_0011451 3300049586 Bacteria 7494
869 Ga0501070_0048479 3300049586 Bacteria 3528
870 Ga0501070_0054294 3300049586 Bacteria 3323
871 Ga0501070_0097039 3300049586 Bacteria 2438
872 Ga0501070_0109225 3300049586 Bacteria 2285
873 Ga0501070_0207521 3300049586 Bacteria 1609
874 Ga0501070_0446074 3300049586 Bacteria 1043
875 Ga0501071_0005036 3300049587 Bacteria 8452
876 Ga0501071_0038623 3300049587 Bacteria 3412
877 Ga0501071_0083933 3300049587 Bacteria 2334
878 Ga0501073_0030477 3300049589 Bacteria 3851
879 Ga0501073_0052182 3300049589 Bacteria 2863
880 Ga0501074_0091026 3300049590 Bacteria 2184
881 Ga0501074_0100324 3300049590 Bacteria 2072
882 Ga0501077_0204245 3300049593 Bacteria 1255
883 Ga0501079_0004156 3300049741 Bacteria 10725
884 Ga0501079_0201545 3300049741 Bacteria 1554
885 Ga0501080_0028227 3300049742 Bacteria 5218
886 Ga0501080_0113590 3300049742 Bacteria 2511
887 Ga0501080_0266947 3300049742 Bacteria 1558
888 Ga0501083_0009046 3300049744 Bacteria 7032
889 Ga0501083_0081573 3300049744 Bacteria 2144
890 Ga0501083_0098641 3300049744 Bacteria 1927
891 Ga0501083_0147005 3300049744 Bacteria 1543
892 Ga0501035_0000859 3300049822 Bacteria 32391
893 Ga0501035_0148087 3300049822 Bacteria 2038
894 Ga0501044_0128910 3300049823 Bacteria 2525
895 Ga0501044_0210315 3300049823 Bacteria 1899
896 Ga0501044_0321533 3300049823 Bacteria 1471
897 Ga0501044_0406915 3300049823 Bacteria 1272
898 Ga0501045_0028721 3300049824 Bacteria 4013
899 Ga0501045_0239732 3300049824 Bacteria 1350
900 nmdc:mga03683_132339_c1 3300050489 Bacteria 1116
901 nmdc:mga03683_25287_c1 3300050489 Bacteria 2330
902 nmdc:mga03n38_63288_c1 3300050490 Bacteria 1690
903 nmdc:mga0yw44_141276_c1 3300050492 Bacteria 1565
904 nmdc:mga06z11_12623_c1 3300050494 Bacteria 3680
905 nmdc:mga04h51_8061_c1 3300050495 Bacteria 2806
906 nmdc:mga0qj67_43999_c1 3300050509 Bacteria 3517
907 nmdc:mga08y16_203714_c1 3300050511 Bacteria 2050
908 nmdc:mga08y16_257184_c1 3300050511 Bacteria 1804
909 nmdc:mga0n895_165280_c1 3300050512 Bacteria 2245
910 nmdc:mga0n895_744324_c1 3300050512 Bacteria 974
911 nmdc:mga0rr50_258245_c1 3300050513 Bacteria 1449
912 nmdc:mga08x19_180973_c1 3300050514 Bacteria 1439
913 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
914 nmdc:mga08x19_88601_c1 3300050514 Bacteria 2040
915 Ga0495601_0000237 3300053077 Bacteria 29469
916 Ga0495601_0003203 3300053077 Bacteria 9363
917 Ga0495601_0011542 3300053077 Bacteria 5291
918 Ga0495601_0019726 3300053077 Bacteria 4115
919 Ga0495612_0000563 3300053078 Bacteria 14886
920 Ga0495612_0003858 3300053078 Bacteria 6224
921 Ga0495612_0011052 3300053078 Bacteria 3644
922 Ga0495612_0025831 3300053078 Bacteria 2359
923 Ga0495612_0029435 3300053078 Bacteria 2212
924 Ga0495655_0021718 3300053083 Bacteria 1457
925 Ga0495595_0006203 3300053084 Bacteria 4864
926 Ga0495595_0008416 3300053084 Bacteria 4231
927 Ga0495595_0022604 3300053084 Bacteria 2761
928 Ga0495595_0232034 3300053084 Bacteria 922
929 Ga0495619_0000343 3300053085 Bacteria 32522
930 Ga0495619_0006532 3300053085 Bacteria 7381
931 Ga0495619_0006775 3300053085 Bacteria 7246
932 Ga0495619_0279132 3300053085 Bacteria 1157
933 Ga0500595_001229 3300053119 Bacteria 14141
934 Ga0500577_0016765 3300053142 Bacteria 2318
935 Ga0500577_0079634 3300053142 Bacteria 1303
936 Ga0500588_0041124 3300053146 Bacteria 1393
937 Ga0500589_096076 3300053147 Bacteria 1295
938 Ga0501084_0153751 3300054114 Bacteria 1940
939 Ga0501084_0259381 3300054114 Bacteria 1467
940 Ga0501082_0049053 3300060353 Bacteria 3640
941 Ga0501082_0049262 3300060353 Bacteria 3632
942 Ga0501082_0547648 3300060353 Bacteria 1012
943 Ga0466962_0161774 3300061719 Bacteria 1088

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_1403845 Ga0451807_1403845_371_1087 236
2 3300046514 Ga0495618_0002089 Ga0495618_0002089_6239_7081 244
3 3300046642 Ga0495634_0006489 Ga0495634_0006489_1950_2792 244
4 3300003214 JGI25165J46597_1006892 JGI25165J46597_10068922 266
5 3300025261 Ga0209233_1020069 Ga0209233_10200692 266
6 3300042004 Ga0439445_0045246 Ga0439445_0045246_39_851 266
7 3300046517 Ga0495630_0565085 Ga0495630_0565085_37_852 270
8 3300003320 rootH2_10046910 rootH2_100469105 272
9 3300033442 Ga0315911_1000008 Ga0315911_1000008213 272
10 3300046524 Ga0495648_0069726 Ga0495648_0069726_638_1459 272
11 3300053078 Ga0495612_0029435 Ga0495612_0029435_470_1309 278
12 3300041452 Ga0451793_1659208 Ga0451793_1659208_410_1267 282
13 3300041486 Ga0451807_0850701 Ga0451807_0850701_209_1066 282
14 3300005471 Ga0070698_100183770 Ga0070698_1001837703 283
15 3300047317 Ga0495604_0028443 Ga0495604_0028443_2373_3239 283
16 3300049744 Ga0501083_0098641 Ga0501083_0098641_417_1331 284
17 3300005563 Ga0068855_100000244 Ga0068855_1000002449 285
18 3300025949 Ga0207667_10000392 Ga0207667_1000039228 285
19 3300031730 Ga0307516_10090465 Ga0307516_100904653 285
20 3300003320 rootH2_10045331 rootH2_100453311 286
21 3300005436 Ga0070713_100219622 Ga0070713_1002196221 286
22 3300049581 Ga0501047_0026583 Ga0501047_0026583_724_1611 286
23 3300049823 Ga0501044_0321533 Ga0501044_0321533_486_1373 286
24 3300046491 Ga0495584_0103335 Ga0495584_0103335_90_974 287
25 3300049586 Ga0501070_0011451 Ga0501070_0011451_5247_6134 288
26 iso_pu_bacteria 2744054611 2744955300 288
27 3300044694 Ga0466963_0091246 Ga0466963_0091246_416_1285 289
28 iso_pu_bacteria 2513237104 2513718143 289
29 iso_pu_bacteria 2513237137 2513863320 289
30 iso_pu_bacteria 2513237145 2513922584 289
31 iso_pu_bacteria 2517572143 2517888934 289
32 iso_pu_bacteria 2524023210 2524466953 289
33 iso_pu_bacteria 2721755755 2723841718 289
34 iso_pu_bacteria 2791355199 2793080847 289
35 iso_pu_bacteria 2876808645 2876808980 289
36 iso_pu_bacteria 2879110137 2879113420 289
37 iso_pu_bacteria 2881665667 2881668106 289
38 iso_pu_bacteria 2885383462 2885390396 289
39 iso_pu_bacteria 2904699407 2904708538 289
40 iso_pu_bacteria 2906610324 2906613985 289
41 iso_pu_bacteria 2908739725 2908747539 289
42 iso_pu_bacteria 2922386360 2922392503 289
43 iso_pu_bacteria 2935630451 2935637048 289
44 iso_pu_bacteria 2941507105 2941513685 289
45 iso_pu_bacteria 2941515067 2941521648 289
46 iso_pu_bacteria 2941523033 2941529403 289
47 iso_pu_bacteria 8006933436 8006936119 289
48 iso_pu_bacteria 8006964411 8006967536 289
49 iso_pu_bacteria 8006973647 8006976046 289
50 iso_pu_bacteria 8006984368 8006990999 289
51 iso_pu_bacteria 8056681323 8056687156 289
52 iso_pu_bacteria 8056689827 8056691034 289
53 3300021384 Ga0213876_10005419 Ga0213876_100054193 290
54 3300032005 Ga0307411_10334840 Ga0307411_103348402 290
55 3300039437 Ga0436365_1148686 Ga0436365_1148686_11724_12596 290
56 3300049571 Ga0501034_0000374 Ga0501034_0000374_37121_37993 290
57 3300049586 Ga0501070_0097039 Ga0501070_0097039_615_1487 290
58 3300049742 Ga0501080_0113590 Ga0501080_0113590_1501_2373 290
59 3300049744 Ga0501083_0081573 Ga0501083_0081573_286_1158 290
60 3300060353 Ga0501082_0547648 Ga0501082_0547648_23_895 290
61 iso_pu_bacteria 2643221547 2643758171 290
62 3300039450 Ga0436363_0927837 Ga0436363_0927837_875_1783 291
63 3300005343 Ga0070687_100323504 Ga0070687_1003235041 292
64 3300031595 Ga0265313_10055574 Ga0265313_100555743 292
65 3300001989 JGI24739J22299_10000897 JGI24739J22299_100008974 293
66 3300001990 JGI24737J22298_10009404 JGI24737J22298_100094045 293
67 3300002067 JGI24735J21928_10003487 JGI24735J21928_100034872 293
68 3300003215 JGI25153J46596_10038430 JGI25153J46596_100384302 293
69 3300003354 JGI25160J50197_1014601 JGI25160J50197_10146013 293
70 3300005328 Ga0070676_10068867 Ga0070676_100688673 293
71 3300005336 Ga0070680_100012038 Ga0070680_1000120383 293
72 3300005339 Ga0070660_100003272 Ga0070660_10000327211 293
73 3300005344 Ga0070661_100127357 Ga0070661_1001273572 293
74 3300005347 Ga0070668_100051792 Ga0070668_1000517923 293
75 3300005356 Ga0070674_100213607 Ga0070674_1002136072 293
76 3300005364 Ga0070673_100134138 Ga0070673_1001341382 293
77 3300005366 Ga0070659_100108095 Ga0070659_1001080951 293
78 3300005366 Ga0070659_100115234 Ga0070659_1001152342 293
79 3300005366 Ga0070659_100159673 Ga0070659_1001596731 293
80 3300005435 Ga0070714_100103577 Ga0070714_1001035774 293
81 3300005435 Ga0070714_100256895 Ga0070714_1002568952 293
82 3300005436 Ga0070713_100043089 Ga0070713_1000430895 293
83 3300005439 Ga0070711_100172289 Ga0070711_1001722892 293
84 3300005440 Ga0070705_100341336 Ga0070705_1003413361 293
85 3300005441 Ga0070700_100107815 Ga0070700_1001078151 293
86 3300005456 Ga0070678_100025297 Ga0070678_1000252974 293
87 3300005456 Ga0070678_100227291 Ga0070678_1002272912 293
88 3300005457 Ga0070662_100090457 Ga0070662_1000904574 293
89 3300005457 Ga0070662_100220942 Ga0070662_1002209422 293
90 3300005471 Ga0070698_100108778 Ga0070698_1001087782 293
91 3300005518 Ga0070699_100078736 Ga0070699_1000787362 293
92 3300005530 Ga0070679_100026893 Ga0070679_1000268935 293
93 3300005544 Ga0070686_100272537 Ga0070686_1002725371 293
94 3300005548 Ga0070665_100146816 Ga0070665_1001468162 293
95 3300005563 Ga0068855_100040189 Ga0068855_1000401897 293
96 3300005563 Ga0068855_100047984 Ga0068855_1000479847 293
97 3300005563 Ga0068855_100059558 Ga0068855_1000595582 293
98 3300005563 Ga0068855_100129068 Ga0068855_1001290684 293
99 3300005563 Ga0068855_100245280 Ga0068855_1002452803 293
100 3300005564 Ga0070664_100263518 Ga0070664_1002635182 293
101 3300005577 Ga0068857_100018470 Ga0068857_1000184706 293
102 3300005577 Ga0068857_100160864 Ga0068857_1001608643 293
103 3300005577 Ga0068857_100751487 Ga0068857_1007514871 293
104 3300005614 Ga0068856_100069733 Ga0068856_1000697334 293
105 3300005614 Ga0068856_100103133 Ga0068856_1001031332 293
106 3300005614 Ga0068856_100120811 Ga0068856_1001208113 293
107 3300005718 Ga0068866_10097364 Ga0068866_100973642 293
108 3300005719 Ga0068861_100036887 Ga0068861_1000368873 293
109 3300005719 Ga0068861_100099380 Ga0068861_1000993802 293
110 3300005842 Ga0068858_100138508 Ga0068858_1001385085 293
111 3300005843 Ga0068860_100105682 Ga0068860_1001056822 293
112 3300005844 Ga0068862_100039735 Ga0068862_1000397354 293
113 3300005844 Ga0068862_100500322 Ga0068862_1005003222 293
114 3300005937 Ga0081455_10011795 Ga0081455_1001179510 293
115 3300005937 Ga0081455_10075776 Ga0081455_100757762 293
116 3300005981 Ga0081538_10149572 Ga0081538_101495721 293
117 3300005983 Ga0081540_1004206 Ga0081540_10042064 293
118 3300005985 Ga0081539_10018244 Ga0081539_100182445 293
119 3300006042 Ga0075368_10010605 Ga0075368_100106053 293
120 3300006051 Ga0075364_10142245 Ga0075364_101422453 293
121 3300006175 Ga0070712_100031650 Ga0070712_1000316505 293
122 3300006175 Ga0070712_100132686 Ga0070712_1001326863 293
123 3300006178 Ga0075367_10153160 Ga0075367_101531602 293
124 3300006186 Ga0075369_10061791 Ga0075369_100617912 293
125 3300006353 Ga0075370_10034531 Ga0075370_100345312 293
126 3300006353 Ga0075370_10146369 Ga0075370_101463692 293
127 3300006358 Ga0068871_100053613 Ga0068871_1000536135 293
128 3300006871 Ga0075434_100095961 Ga0075434_1000959615 293
129 3300006881 Ga0068865_100357595 Ga0068865_1003575952 293
130 3300009093 Ga0105240_10004853 Ga0105240_1000485318 293
131 3300009093 Ga0105240_10559793 Ga0105240_105597932 293
132 3300009094 Ga0111539_10329681 Ga0111539_103296812 293
133 3300009098 Ga0105245_10152826 Ga0105245_101528262 293
134 3300009098 Ga0105245_10512549 Ga0105245_105125491 293
135 3300009101 Ga0105247_10266445 Ga0105247_102664451 293
136 3300009101 Ga0105247_10348041 Ga0105247_103480412 293
137 3300009148 Ga0105243_10130712 Ga0105243_101307122 293
138 3300009174 Ga0105241_10060625 Ga0105241_100606252 293
139 3300009176 Ga0105242_10221084 Ga0105242_102210843 293
140 3300009177 Ga0105248_10038164 Ga0105248_100381647 293
141 3300009545 Ga0105237_10044970 Ga0105237_100449706 293
142 3300009545 Ga0105237_10112288 Ga0105237_101122881 293
143 3300009545 Ga0105237_10151426 Ga0105237_101514263 293
144 3300009551 Ga0105238_10027365 Ga0105238_100273656 293
145 3300009551 Ga0105238_10111585 Ga0105238_101115854 293
146 3300009553 Ga0105249_10231262 Ga0105249_102312624 293
147 3300010375 Ga0105239_10011468 Ga0105239_1001146810 293
148 3300013296 Ga0157374_10065714 Ga0157374_100657145 293
149 3300013297 Ga0157378_10365575 Ga0157378_103655752 293
150 3300013307 Ga0157372_10054142 Ga0157372_100541423 293
151 3300013307 Ga0157372_10124519 Ga0157372_101245193 293
152 3300013308 Ga0157375_10625201 Ga0157375_106252011 293
153 3300014326 Ga0157380_10309619 Ga0157380_103096193 293
154 3300017792 Ga0163161_10303267 Ga0163161_103032671 293
155 3300020082 Ga0206353_10552086 Ga0206353_105520862 293
156 3300025297 Ga0209758_1000616 Ga0209758_10006168 293
157 3300025302 Ga0207426_1000420 Ga0207426_10004204 293
158 3300025900 Ga0207710_10164322 Ga0207710_101643221 293
159 3300025901 Ga0207688_10093665 Ga0207688_100936652 293
160 3300025901 Ga0207688_10308730 Ga0207688_103087301 293
161 3300025904 Ga0207647_10001753 Ga0207647_100017536 293
162 3300025913 Ga0207695_10038814 Ga0207695_100388147 293
163 3300025913 Ga0207695_10399314 Ga0207695_103993142 293
164 3300025914 Ga0207671_10031026 Ga0207671_100310263 293
165 3300025914 Ga0207671_10152873 Ga0207671_101528732 293
166 3300025915 Ga0207693_10017047 Ga0207693_100170474 293
167 3300025915 Ga0207693_10206099 Ga0207693_102060993 293
168 3300025916 Ga0207663_10147759 Ga0207663_101477592 293
169 3300025919 Ga0207657_10004676 Ga0207657_1000467611 293
170 3300025920 Ga0207649_10139493 Ga0207649_101394931 293
171 3300025921 Ga0207652_10006960 Ga0207652_100069605 293
172 3300025924 Ga0207694_10086806 Ga0207694_100868062 293
173 3300025924 Ga0207694_10139021 Ga0207694_101390213 293
174 3300025927 Ga0207687_10020799 Ga0207687_100207993 293
175 3300025928 Ga0207700_10013859 Ga0207700_100138596 293
176 3300025929 Ga0207664_10042991 Ga0207664_100429912 293
177 3300025931 Ga0207644_10253326 Ga0207644_102533262 293
178 3300025933 Ga0207706_10004628 Ga0207706_100046284 293
179 3300025933 Ga0207706_10145008 Ga0207706_101450081 293
180 3300025934 Ga0207686_10162213 Ga0207686_101622133 293
181 3300025940 Ga0207691_10097584 Ga0207691_100975843 293
182 3300025945 Ga0207679_10131260 Ga0207679_101312604 293
183 3300025945 Ga0207679_10305927 Ga0207679_103059271 293
184 3300025945 Ga0207679_10416359 Ga0207679_104163592 293
185 3300025949 Ga0207667_10023513 Ga0207667_100235137 293
186 3300025949 Ga0207667_10106775 Ga0207667_101067754 293
187 3300025949 Ga0207667_10169337 Ga0207667_101693372 293
188 3300025960 Ga0207651_10094796 Ga0207651_100947962 293
189 3300025960 Ga0207651_10339791 Ga0207651_103397912 293
190 3300025961 Ga0207712_10257325 Ga0207712_102573252 293
191 3300025986 Ga0207658_10339899 Ga0207658_103398991 293
192 3300026023 Ga0207677_10107305 Ga0207677_101073052 293
193 3300026035 Ga0207703_10059566 Ga0207703_100595665 293
194 3300026041 Ga0207639_10074245 Ga0207639_100742453 293
195 3300026067 Ga0207678_10044346 Ga0207678_100443463 293
196 3300026067 Ga0207678_10066998 Ga0207678_100669984 293
197 3300026067 Ga0207678_10201644 Ga0207678_102016441 293
198 3300026078 Ga0207702_10034279 Ga0207702_100342793 293
199 3300026078 Ga0207702_10124924 Ga0207702_101249243 293
200 3300026078 Ga0207702_10174951 Ga0207702_101749513 293
201 3300026089 Ga0207648_10030687 Ga0207648_100306872 293
202 3300026095 Ga0207676_10255784 Ga0207676_102557841 293
203 3300026116 Ga0207674_10031314 Ga0207674_100313147 293
204 3300026116 Ga0207674_10190575 Ga0207674_101905754 293
205 3300026116 Ga0207674_10550757 Ga0207674_105507571 293
206 3300026118 Ga0207675_100048673 Ga0207675_1000486733 293
207 3300026121 Ga0207683_10080952 Ga0207683_100809522 293
208 3300026121 Ga0207683_10136341 Ga0207683_101363412 293
209 3300026142 Ga0207698_10074280 Ga0207698_100742802 293
210 3300026142 Ga0207698_10082670 Ga0207698_100826702 293
211 3300027296 Ga0209389_1000033 Ga0209389_1000033108 293
212 3300027357 Ga0209589_1000040 Ga0209589_1000040108 293
213 3300027361 Ga0209489_100045 Ga0209489_100045120 293
214 3300028379 Ga0268266_10002169 Ga0268266_1000216910 293
215 3300028380 Ga0268265_10106730 Ga0268265_101067303 293
216 3300028380 Ga0268265_10182536 Ga0268265_101825362 293
217 3300028380 Ga0268265_10672524 Ga0268265_106725241 293
218 3300028381 Ga0268264_10000062 Ga0268264_10000062148 293
219 3300028786 Ga0307517_10074981 Ga0307517_100749812 293
220 3300028786 Ga0307517_10204464 Ga0307517_102044642 293
221 3300031241 Ga0265325_10011173 Ga0265325_100111732 293
222 3300031344 Ga0265316_10087704 Ga0265316_100877045 293
223 3300031456 Ga0307513_10245025 Ga0307513_102450253 293
224 3300031507 Ga0307509_10134992 Ga0307509_101349922 293
225 3300031548 Ga0307408_100102075 Ga0307408_1001020754 293
226 3300031595 Ga0265313_10000008 Ga0265313_1000000868 293
227 3300031595 Ga0265313_10007635 Ga0265313_100076359 293
228 3300031711 Ga0265314_10003949 Ga0265314_1000394910 293
229 3300031711 Ga0265314_10068326 Ga0265314_100683265 293
230 3300031712 Ga0265342_10000912 Ga0265342_1000091226 293
231 3300031903 Ga0307407_10062753 Ga0307407_100627532 293
232 3300032126 Ga0307415_100198287 Ga0307415_1001982871 293
233 3300033180 Ga0307510_10010287 Ga0307510_1001028712 293
234 3300035113 Ga0373936_0003212 Ga0373936_0003212_504_1388 293
235 3300035170 Ga0373943_0002977 Ga0373943_0002977_1448_2332 293
236 3300035171 Ga0373946_0037007 Ga0373946_0037007_149_1033 293
237 3300035172 Ga0373955_0048173 Ga0373955_0048173_948_1832 293
238 3300035241 Ga0373961_0063469 Ga0373961_0063469_91_975 293
239 3300035692 Ga0373935_0000046 Ga0373935_0000046_17449_18333 293
240 3300035695 Ga0373927_0000209 Ga0373927_0000209_5290_6174 293
241 3300035695 Ga0373927_0182326 Ga0373927_0182326_420_1304 293
242 3300035695 Ga0373927_0373028 Ga0373927_0373028_19_903 293
243 3300035724 Ga0373933_0063278 Ga0373933_0063278_136_1020 293
244 3300035725 Ga0373947_0002886 Ga0373947_0002886_4690_5574 293
245 3300035725 Ga0373947_0296030 Ga0373947_0296030_66_950 293
246 3300036401 Ga0373937_0023444 Ga0373937_0023444_1622_2506 293
247 3300036459 Ga0372808_008217 Ga0372808_008217_548_1432 293
248 3300037068 Ga0373925_0005099 Ga0373925_0005099_2314_3198 293
249 3300037068 Ga0373925_0126389 Ga0373925_0126389_159_1043 293
250 3300037418 Ga0395900_0005151 Ga0395900_0005151_7619_8503 293
251 3300037466 Ga0395898_0003493 Ga0395898_0003493_5279_6163 293
252 3300038443 Ga0395901_0043590 Ga0395901_0043590_1078_1962 293
253 3300039437 Ga0436365_0911459 Ga0436365_0911459_1254_2135 293
254 3300039437 Ga0436365_1422081 Ga0436365_1422081_1024_1905 293
255 3300041459 Ga0451800_1674697 Ga0451800_1674697_59_943 293
256 3300046452 Ga0495617_053834 Ga0495617_053834_413_1297 293
257 3300046455 Ga0495603_0000153 Ga0495603_0000153_21024_21908 293
258 3300046459 Ga0495629_0007084 Ga0495629_0007084_401_1285 293
259 3300046461 Ga0495641_0008708 Ga0495641_0008708_5127_6011 293
260 3300046462 Ga0495651_0025967 Ga0495651_0025967_1740_2624 293
261 3300046463 Ga0495653_0105670 Ga0495653_0105670_983_1867 293
262 3300046472 Ga0495580_0000246 Ga0495580_0000246_30657_31541 293
263 3300046473 Ga0495582_0000686 Ga0495582_0000686_17689_18573 293
264 3300046475 Ga0495639_0000799 Ga0495639_0000799_6162_7046 293
265 3300046476 Ga0495662_0074205 Ga0495662_0074205_287_1171 293
266 3300046477 Ga0495664_0015494 Ga0495664_0015494_781_1665 293
267 3300046477 Ga0495664_0085121 Ga0495664_0085121_101_985 293
268 3300046499 Ga0495594_0000243 Ga0495594_0000243_7460_8344 293
269 3300046499 Ga0495594_0057740 Ga0495594_0057740_912_1796 293
270 3300046507 Ga0495606_0232159 Ga0495606_0232159_17_901 293
271 3300046515 Ga0495620_0019530 Ga0495620_0019530_923_1807 293
272 3300046516 Ga0495628_0054964 Ga0495628_0054964_1323_2207 293
273 3300046517 Ga0495630_0123501 Ga0495630_0123501_932_1816 293
274 3300046519 Ga0495632_0155594 Ga0495632_0155594_31_915 293
275 3300046525 Ga0495663_0020493 Ga0495663_0020493_806_1690 293
276 3300046526 Ga0495666_0100331 Ga0495666_0100331_84_968 293
277 3300046529 Ga0495652_0040789 Ga0495652_0040789_164_1048 293
278 3300046531 Ga0495665_0000341 Ga0495665_0000341_16238_17122 293
279 3300046533 Ga0495640_0000521 Ga0495640_0000521_12197_13081 293
280 3300046535 Ga0495586_0182752 Ga0495586_0182752_120_1004 293
281 3300046538 Ga0495609_0030375 Ga0495609_0030375_1357_2241 293
282 3300046557 Ga0495622_0011002 Ga0495622_0011002_1348_2232 293
283 3300046559 Ga0495667_0033180 Ga0495667_0033180_238_1122 293
284 3300046559 Ga0495667_0116845 Ga0495667_0116845_532_1416 293
285 3300046615 Ga0495656_0057004 Ga0495656_0057004_403_1287 293
286 3300046615 Ga0495656_0221867 Ga0495656_0221867_20_904 293
287 3300046616 Ga0495668_0194952 Ga0495668_0194952_88_972 293
288 3300046648 Ga0495611_0177172 Ga0495611_0177172_58_942 293
289 3300046663 Ga0495635_0000470 Ga0495635_0000470_14126_15010 293
290 3300046674 Ga0495588_0007378 Ga0495588_0007378_1899_2783 293
291 3300046678 Ga0495599_0125811 Ga0495599_0125811_386_1270 293
292 3300046680 Ga0495646_0014448 Ga0495646_0014448_630_1514 293
293 3300046681 Ga0495647_0002355 Ga0495647_0002355_5031_5915 293
294 3300046681 Ga0495647_0024406 Ga0495647_0024406_883_1767 293
295 3300046683 Ga0495658_0003407 Ga0495658_0003407_4677_5561 293
296 3300046684 Ga0495669_0018118 Ga0495669_0018118_1633_2517 293
297 3300046690 Ga0495624_0000144 Ga0495624_0000144_4798_5682 293
298 3300046690 Ga0495624_0231186 Ga0495624_0231186_82_966 293
299 3300046691 Ga0495670_0012052 Ga0495670_0012052_2945_3829 293
300 3300046794 Ga0495589_0022874 Ga0495589_0022874_1443_2327 293
301 3300047315 Ga0495581_0000223 Ga0495581_0000223_17689_18573 293
302 3300047319 Ga0495674_0000700 Ga0495674_0000700_12645_13529 293
303 3300047321 Ga0495676_0012616 Ga0495676_0012616_747_1631 293
304 3300047321 Ga0495676_0088961 Ga0495676_0088961_1043_1927 293
305 3300047322 Ga0495680_0133466 Ga0495680_0133466_807_1691 293
306 3300047469 Ga0495673_0045725 Ga0495673_0045725_351_1235 293
307 3300047471 Ga0495684_0019592 Ga0495684_0019592_4269_5153 293
308 3300047472 Ga0495686_0154635 Ga0495686_0154635_247_1131 293
309 3300047673 Ga0495593_0000007 Ga0495593_0000007_46124_47008 293
310 3300048089 Ga0495614_0064488 Ga0495614_0064488_159_1043 293
311 3300048904 Ga0496101_0097188 Ga0496101_0097188_1193_2077 293
312 3300048904 Ga0496101_0106117 Ga0496101_0106117_440_1324 293
313 3300048905 Ga0496102_0072433 Ga0496102_0072433_1302_2186 293
314 3300048905 Ga0496102_0170807 Ga0496102_0170807_259_1143 293
315 3300048906 Ga0496103_0130948 Ga0496103_0130948_708_1592 293
316 3300048907 Ga0496104_0324287 Ga0496104_0324287_86_970 293
317 3300048908 Ga0496105_0086060 Ga0496105_0086060_1522_2406 293
318 3300048909 Ga0496106_0031601 Ga0496106_0031601_1822_2706 293
319 3300048912 Ga0496109_0045791 Ga0496109_0045791_2415_3299 293
320 3300048912 Ga0496109_0605465 Ga0496109_0605465_80_964 293
321 3300048913 Ga0496110_0101203 Ga0496110_0101203_960_1844 293
322 3300048914 Ga0496111_0227857 Ga0496111_0227857_94_978 293
323 3300048915 Ga0496112_0095365 Ga0496112_0095365_1825_2709 293
324 3300048917 Ga0496114_0061841 Ga0496114_0061841_1443_2327 293
325 3300048917 Ga0496114_0346705 Ga0496114_0346705_389_1285 293
326 3300048920 Ga0496117_0053499 Ga0496117_0053499_1644_2528 293
327 3300048921 Ga0496118_0027463 Ga0496118_0027463_3014_3898 293
328 3300048922 Ga0496119_0048946 Ga0496119_0048946_1349_2233 293
329 3300048924 Ga0496121_0003211 Ga0496121_0003211_11845_12729 293
330 3300048924 Ga0496121_0039220 Ga0496121_0039220_1996_2880 293
331 3300048924 Ga0496121_0046169 Ga0496121_0046169_1652_2536 293
332 3300048924 Ga0496121_0048197 Ga0496121_0048197_835_1719 293
333 3300048924 Ga0496121_0161441 Ga0496121_0161441_697_1581 293
334 3300048928 Ga0496125_0019978 Ga0496125_0019978_1145_2029 293
335 3300048928 Ga0496125_0116572 Ga0496125_0116572_474_1358 293
336 3300048929 Ga0496126_0030950 Ga0496126_0030950_2203_3087 293
337 3300048929 Ga0496126_0040378 Ga0496126_0040378_769_1653 293
338 3300048929 Ga0496126_0060648 Ga0496126_0060648_961_1845 293
339 3300049459 Ga0495678_079984 Ga0495678_079984_102_986 293
340 3300049460 Ga0495682_0105118 Ga0495682_0105118_36_920 293
341 3300049568 Ga0501031_0004917 Ga0501031_0004917_3851_4738 293
342 3300049568 Ga0501031_0013835 Ga0501031_0013835_577_1461 293
343 3300049569 Ga0501032_0152192 Ga0501032_0152192_178_1062 293
344 3300049569 Ga0501032_0177883 Ga0501032_0177883_440_1324 293
345 3300049570 Ga0501033_0018842 Ga0501033_0018842_275_1156 293
346 3300049571 Ga0501034_0044836 Ga0501034_0044836_2709_3590 293
347 3300049571 Ga0501034_0082021 Ga0501034_0082021_2313_3194 293
348 3300049571 Ga0501034_0213838 Ga0501034_0213838_74_958 293
349 3300049573 Ga0501037_0042826 Ga0501037_0042826_967_1854 293
350 3300049573 Ga0501037_0156941 Ga0501037_0156941_77_961 293
351 3300049573 Ga0501037_0180327 Ga0501037_0180327_312_1196 293
352 3300049574 Ga0501038_0008546 Ga0501038_0008546_685_1569 293
353 3300049574 Ga0501038_0056927 Ga0501038_0056927_1249_2133 293
354 3300049574 Ga0501038_0076965 Ga0501038_0076965_283_1170 293
355 3300049575 Ga0501039_0066565 Ga0501039_0066565_1030_1914 293
356 3300049578 Ga0501042_0000540 Ga0501042_0000540_4872_5756 293
357 3300049579 Ga0501043_0064916 Ga0501043_0064916_741_1625 293
358 3300049581 Ga0501047_0337754 Ga0501047_0337754_353_1237 293
359 3300049582 Ga0501048_0004376 Ga0501048_0004376_145_1029 293
360 3300049583 Ga0501067_0016188 Ga0501067_0016188_2186_3070 293
361 3300049584 Ga0501068_0060938 Ga0501068_0060938_141_1025 293
362 3300049586 Ga0501070_0048479 Ga0501070_0048479_568_1449 293
363 3300049586 Ga0501070_0054294 Ga0501070_0054294_1310_2191 293
364 3300049586 Ga0501070_0207521 Ga0501070_0207521_439_1332 293
365 3300049586 Ga0501070_0446074 Ga0501070_0446074_144_1028 293
366 3300049587 Ga0501071_0038623 Ga0501071_0038623_1231_2112 293
367 3300049587 Ga0501071_0083933 Ga0501071_0083933_1251_2135 293
368 3300049589 Ga0501073_0052182 Ga0501073_0052182_1097_1981 293
369 3300049590 Ga0501074_0100324 Ga0501074_0100324_235_1116 293
370 3300049593 Ga0501077_0204245 Ga0501077_0204245_312_1196 293
371 3300049741 Ga0501079_0004156 Ga0501079_0004156_5157_6041 293
372 3300049742 Ga0501080_0028227 Ga0501080_0028227_577_1461 293
373 3300049744 Ga0501083_0009046 Ga0501083_0009046_72_956 293
374 3300049822 Ga0501035_0000859 Ga0501035_0000859_14449_15441 293
375 3300049822 Ga0501035_0148087 Ga0501035_0148087_528_1412 293
376 3300049823 Ga0501044_0128910 Ga0501044_0128910_1061_1942 293
377 3300049823 Ga0501044_0210315 Ga0501044_0210315_530_1414 293
378 3300049823 Ga0501044_0406915 Ga0501044_0406915_148_1041 293
379 3300049824 Ga0501045_0028721 Ga0501045_0028721_1447_2331 293
380 3300050489 nmdc:mga03683_25287_c1 nmdc:mga03683_25287_c1_49_933 293
381 3300050490 nmdc:mga03n38_63288_c1 nmdc:mga03n38_63288_c1_527_1411 293
382 3300050492 nmdc:mga0yw44_141276_c1 nmdc:mga0yw44_141276_c1_34_918 293
383 3300050495 nmdc:mga04h51_8061_c1 nmdc:mga04h51_8061_c1_1749_2633 293
384 3300053077 Ga0495601_0019726 Ga0495601_0019726_3149_4030 293
385 3300053085 Ga0495619_0279132 Ga0495619_0279132_163_1044 293
386 3300053119 Ga0500595_001229 Ga0500595_001229_619_1503 293
387 3300053142 Ga0500577_0016765 Ga0500577_0016765_911_1795 293
388 3300053142 Ga0500577_0079634 Ga0500577_0079634_319_1203 293
389 3300053146 Ga0500588_0041124 Ga0500588_0041124_75_959 293
390 3300053147 Ga0500589_096076 Ga0500589_096076_74_958 293
391 3300054114 Ga0501084_0259381 Ga0501084_0259381_295_1179 293
392 3300060353 Ga0501082_0049262 Ga0501082_0049262_1078_1962 293
393 iso_pu_bacteria 2524023228 2524537367 293
394 3300001978 JGI24747J21853_1000169 JGI24747J21853_10001695 294
395 3300001979 JGI24740J21852_10022911 JGI24740J21852_100229112 294
396 3300001989 JGI24739J22299_10001524 JGI24739J22299_100015242 294
397 3300001989 JGI24739J22299_10003887 JGI24739J22299_100038874 294
398 3300001990 JGI24737J22298_10017120 JGI24737J22298_100171204 294
399 3300002070 JGI24750J21931_1000745 JGI24750J21931_10007456 294
400 3300002073 JGI24745J21846_1000061 JGI24745J21846_10000613 294
401 3300002074 JGI24748J21848_1000185 JGI24748J21848_10001853 294
402 3300002075 JGI24738J21930_10000067 JGI24738J21930_1000006717 294
403 3300002076 JGI24749J21850_1001798 JGI24749J21850_10017983 294
404 3300002126 JGI24035J26624_1000005 JGI24035J26624_100000517 294
405 3300002126 JGI24035J26624_1000190 JGI24035J26624_10001906 294
406 3300002155 JGI24033J26618_1000613 JGI24033J26618_10006131 294
407 3300002239 JGI24034J26672_10000951 JGI24034J26672_100009515 294
408 3300002244 JGI24742J22300_10000153 JGI24742J22300_100001538 294
409 3300005290 Ga0065712_10130182 Ga0065712_101301823 294
410 3300005293 Ga0065715_10008690 Ga0065715_100086902 294
411 3300005295 Ga0065707_10268785 Ga0065707_102687851 294
412 3300005328 Ga0070676_10000332 Ga0070676_100003322 294
413 3300005328 Ga0070676_10066999 Ga0070676_100669993 294
414 3300005329 Ga0070683_100004171 Ga0070683_10000417112 294
415 3300005330 Ga0070690_100005079 Ga0070690_1000050798 294
416 3300005330 Ga0070690_100046391 Ga0070690_1000463915 294
417 3300005331 Ga0070670_100023341 Ga0070670_1000233412 294
418 3300005333 Ga0070677_10000258 Ga0070677_1000025813 294
419 3300005334 Ga0068869_100000510 Ga0068869_10000051017 294
420 3300005335 Ga0070666_10004570 Ga0070666_100045708 294
421 3300005335 Ga0070666_10019282 Ga0070666_100192826 294
422 3300005336 Ga0070680_100001476 Ga0070680_10000147617 294
423 3300005337 Ga0070682_100003255 Ga0070682_1000032552 294
424 3300005338 Ga0068868_100000148 Ga0068868_10000014826 294
425 3300005339 Ga0070660_100001314 Ga0070660_10000131413 294
426 3300005340 Ga0070689_100001783 Ga0070689_1000017838 294
427 3300005340 Ga0070689_100014799 Ga0070689_1000147992 294
428 3300005341 Ga0070691_10035255 Ga0070691_100352554 294
429 3300005343 Ga0070687_100000318 Ga0070687_1000003188 294
430 3300005344 Ga0070661_100000768 Ga0070661_10000076815 294
431 3300005345 Ga0070692_10011615 Ga0070692_100116153 294
432 3300005347 Ga0070668_100093298 Ga0070668_1000932984 294
433 3300005347 Ga0070668_100137565 Ga0070668_1001375652 294
434 3300005353 Ga0070669_100003445 Ga0070669_1000034452 294
435 3300005354 Ga0070675_100001491 Ga0070675_10000149117 294
436 3300005354 Ga0070675_100108142 Ga0070675_1001081424 294
437 3300005354 Ga0070675_100174255 Ga0070675_1001742554 294
438 3300005355 Ga0070671_100003997 Ga0070671_1000039974 294
439 3300005355 Ga0070671_100043030 Ga0070671_1000430302 294
440 3300005355 Ga0070671_100352254 Ga0070671_1003522542 294
441 3300005356 Ga0070674_100001355 Ga0070674_10000135513 294
442 3300005356 Ga0070674_100139731 Ga0070674_1001397314 294
443 3300005364 Ga0070673_100000670 Ga0070673_1000006708 294
444 3300005364 Ga0070673_100008314 Ga0070673_1000083148 294
445 3300005364 Ga0070673_100053400 Ga0070673_1000534002 294
446 3300005365 Ga0070688_100031440 Ga0070688_1000314402 294
447 3300005365 Ga0070688_100070770 Ga0070688_1000707702 294
448 3300005366 Ga0070659_100001400 Ga0070659_10000140017 294
449 3300005366 Ga0070659_100064806 Ga0070659_1000648065 294
450 3300005367 Ga0070667_100002340 Ga0070667_10000234013 294
451 3300005367 Ga0070667_100061422 Ga0070667_1000614225 294
452 3300005406 Ga0070703_10013030 Ga0070703_100130302 294
453 3300005434 Ga0070709_10022655 Ga0070709_100226553 294
454 3300005436 Ga0070713_100000838 Ga0070713_10000083818 294
455 3300005436 Ga0070713_100015088 Ga0070713_1000150884 294
456 3300005436 Ga0070713_100129808 Ga0070713_1001298083 294
457 3300005436 Ga0070713_100205600 Ga0070713_1002056002 294
458 3300005437 Ga0070710_10003726 Ga0070710_100037268 294
459 3300005437 Ga0070710_10012469 Ga0070710_100124694 294
460 3300005437 Ga0070710_10049287 Ga0070710_100492872 294
461 3300005438 Ga0070701_10019659 Ga0070701_100196592 294
462 3300005438 Ga0070701_10128181 Ga0070701_101281812 294
463 3300005439 Ga0070711_100028348 Ga0070711_1000283484 294
464 3300005439 Ga0070711_100043244 Ga0070711_1000432445 294
465 3300005439 Ga0070711_100055772 Ga0070711_1000557726 294
466 3300005440 Ga0070705_100001500 Ga0070705_1000015002 294
467 3300005441 Ga0070700_100001568 Ga0070700_10000156812 294
468 3300005445 Ga0070708_100105830 Ga0070708_1001058302 294
469 3300005445 Ga0070708_100193052 Ga0070708_1001930522 294
470 3300005455 Ga0070663_100001857 Ga0070663_1000018572 294
471 3300005456 Ga0070678_100000391 Ga0070678_10000039113 294
472 3300005456 Ga0070678_100015738 Ga0070678_1000157386 294
473 3300005458 Ga0070681_10006791 Ga0070681_1000679112 294
474 3300005459 Ga0068867_100006925 Ga0068867_1000069257 294
475 3300005466 Ga0070685_10003877 Ga0070685_100038775 294
476 3300005466 Ga0070685_10008554 Ga0070685_100085547 294
477 3300005530 Ga0070679_100142520 Ga0070679_1001425202 294
478 3300005530 Ga0070679_100299590 Ga0070679_1002995902 294
479 3300005535 Ga0070684_100000101 Ga0070684_10000010117 294
480 3300005535 Ga0070684_100074894 Ga0070684_1000748941 294
481 3300005539 Ga0068853_100116865 Ga0068853_1001168652 294
482 3300005539 Ga0068853_100251458 Ga0068853_1002514583 294
483 3300005543 Ga0070672_100000016 Ga0070672_10000001661 294
484 3300005543 Ga0070672_100259453 Ga0070672_1002594532 294
485 3300005544 Ga0070686_100008745 Ga0070686_1000087456 294
486 3300005544 Ga0070686_100018037 Ga0070686_1000180374 294
487 3300005545 Ga0070695_100000225 Ga0070695_10000022527 294
488 3300005545 Ga0070695_100004140 Ga0070695_1000041403 294
489 3300005546 Ga0070696_100002898 Ga0070696_10000289812 294
490 3300005546 Ga0070696_100382194 Ga0070696_1003821941 294
491 3300005547 Ga0070693_100000138 Ga0070693_10000013827 294
492 3300005547 Ga0070693_100289511 Ga0070693_1002895111 294
493 3300005548 Ga0070665_100164185 Ga0070665_1001641853 294
494 3300005548 Ga0070665_100172093 Ga0070665_1001720934 294
495 3300005549 Ga0070704_100082859 Ga0070704_1000828594 294
496 3300005563 Ga0068855_100023959 Ga0068855_1000239595 294
497 3300005564 Ga0070664_100000067 Ga0070664_10000006765 294
498 3300005564 Ga0070664_100039135 Ga0070664_1000391353 294
499 3300005577 Ga0068857_100000275 Ga0068857_10000027512 294
500 3300005577 Ga0068857_100066582 Ga0068857_1000665824 294
501 3300005577 Ga0068857_100176512 Ga0068857_1001765124 294
502 3300005577 Ga0068857_100258758 Ga0068857_1002587582 294
503 3300005578 Ga0068854_100002271 Ga0068854_1000022712 294
504 3300005578 Ga0068854_100162112 Ga0068854_1001621122 294
505 3300005578 Ga0068854_100420622 Ga0068854_1004206221 294
506 3300005614 Ga0068856_100001016 Ga0068856_10000101622 294
507 3300005615 Ga0070702_100000175 Ga0070702_1000001758 294
508 3300005615 Ga0070702_100125218 Ga0070702_1001252182 294
509 3300005616 Ga0068852_100000611 Ga0068852_1000006118 294
510 3300005617 Ga0068859_100002948 Ga0068859_1000029482 294
511 3300005617 Ga0068859_100124564 Ga0068859_1001245644 294
512 3300005617 Ga0068859_100179054 Ga0068859_1001790544 294
513 3300005618 Ga0068864_100000234 Ga0068864_1000002349 294
514 3300005618 Ga0068864_100021303 Ga0068864_1000213036 294
515 3300005618 Ga0068864_100025360 Ga0068864_1000253607 294
516 3300005718 Ga0068866_10002227 Ga0068866_100022274 294
517 3300005718 Ga0068866_10021000 Ga0068866_100210003 294
518 3300005719 Ga0068861_100044242 Ga0068861_1000442424 294
519 3300005840 Ga0068870_10000009 Ga0068870_1000000939 294
520 3300005841 Ga0068863_100001729 Ga0068863_10000172915 294
521 3300005841 Ga0068863_100142449 Ga0068863_1001424492 294
522 3300005841 Ga0068863_100533685 Ga0068863_1005336852 294
523 3300005842 Ga0068858_100001059 Ga0068858_1000010592 294
524 3300005843 Ga0068860_100003167 Ga0068860_1000031672 294
525 3300005843 Ga0068860_100377212 Ga0068860_1003772121 294
526 3300005844 Ga0068862_100019397 Ga0068862_1000193976 294
527 3300006028 Ga0070717_10004993 Ga0070717_100049936 294
528 3300006028 Ga0070717_10099451 Ga0070717_100994513 294
529 3300006048 Ga0075363_100082898 Ga0075363_1000828982 294
530 3300006163 Ga0070715_10017080 Ga0070715_100170804 294
531 3300006163 Ga0070715_10026067 Ga0070715_100260674 294
532 3300006173 Ga0070716_100003280 Ga0070716_1000032803 294
533 3300006175 Ga0070712_100004136 Ga0070712_1000041365 294
534 3300006175 Ga0070712_100023829 Ga0070712_1000238296 294
535 3300006175 Ga0070712_100039495 Ga0070712_1000394953 294
536 3300006178 Ga0075367_10013106 Ga0075367_100131061 294
537 3300006178 Ga0075367_10091430 Ga0075367_100914304 294
538 3300006186 Ga0075369_10150760 Ga0075369_101507601 294
539 3300006237 Ga0097621_100006760 Ga0097621_1000067609 294
540 3300006358 Ga0068871_100000012 Ga0068871_10000001264 294
541 3300006358 Ga0068871_100014044 Ga0068871_1000140442 294
542 3300006358 Ga0068871_100108554 Ga0068871_1001085542 294
543 3300006846 Ga0075430_100072654 Ga0075430_1000726542 294
544 3300006871 Ga0075434_100147219 Ga0075434_1001472194 294
545 3300006881 Ga0068865_100000355 Ga0068865_10000035527 294
546 3300006881 Ga0068865_100005877 Ga0068865_1000058773 294
547 3300006914 Ga0075436_100006210 Ga0075436_1000062107 294
548 3300006914 Ga0075436_100007339 Ga0075436_1000073398 294
549 3300006931 Ga0097620_100002948 Ga0097620_1000029482 294
550 3300006931 Ga0097620_100124548 Ga0097620_1001245484 294
551 3300006931 Ga0097620_100179052 Ga0097620_1001790524 294
552 3300007076 Ga0075435_100099820 Ga0075435_1000998206 294
553 3300009011 Ga0105251_10017705 Ga0105251_100177053 294
554 3300009093 Ga0105240_10022674 Ga0105240_100226748 294
555 3300009093 Ga0105240_10087262 Ga0105240_100872621 294
556 3300009093 Ga0105240_10185858 Ga0105240_101858583 294
557 3300009093 Ga0105240_10519388 Ga0105240_105193881 294
558 3300009094 Ga0111539_10141004 Ga0111539_101410042 294
559 3300009098 Ga0105245_10000409 Ga0105245_1000040917 294
560 3300009101 Ga0105247_10004080 Ga0105247_100040809 294
561 3300009101 Ga0105247_10009067 Ga0105247_100090673 294
562 3300009101 Ga0105247_10038738 Ga0105247_100387382 294
563 3300009101 Ga0105247_10091424 Ga0105247_100914242 294
564 3300009148 Ga0105243_10004202 Ga0105243_1000420212 294
565 3300009148 Ga0105243_10543975 Ga0105243_105439751 294
566 3300009174 Ga0105241_10000053 Ga0105241_100000532 294
567 3300009174 Ga0105241_10010799 Ga0105241_100107999 294
568 3300009176 Ga0105242_10011250 Ga0105242_100112502 294
569 3300009176 Ga0105242_10044930 Ga0105242_100449305 294
570 3300009177 Ga0105248_10000309 Ga0105248_1000030950 294
571 3300009177 Ga0105248_10116016 Ga0105248_101160163 294
572 3300009177 Ga0105248_10176677 Ga0105248_101766772 294
573 3300009177 Ga0105248_10256225 Ga0105248_102562254 294
574 3300009177 Ga0105248_10424316 Ga0105248_104243162 294
575 3300009545 Ga0105237_10176114 Ga0105237_101761143 294
576 3300009553 Ga0105249_10003451 Ga0105249_100034512 294
577 3300010375 Ga0105239_10007939 Ga0105239_1000793913 294
578 3300011119 Ga0105246_10002040 Ga0105246_100020402 294
579 3300013100 Ga0157373_10040211 Ga0157373_100402113 294
580 3300013102 Ga0157371_10008314 Ga0157371_100083149 294
581 3300013102 Ga0157371_10266337 Ga0157371_102663371 294
582 3300013104 Ga0157370_10058079 Ga0157370_100580792 294
583 3300013104 Ga0157370_10161055 Ga0157370_101610553 294
584 3300013105 Ga0157369_10005855 Ga0157369_100058558 294
585 3300013296 Ga0157374_10000452 Ga0157374_1000045221 294
586 3300013296 Ga0157374_10026788 Ga0157374_100267888 294
587 3300013296 Ga0157374_10333689 Ga0157374_103336893 294
588 3300013297 Ga0157378_10000872 Ga0157378_100008723 294
589 3300013297 Ga0157378_10062596 Ga0157378_100625963 294
590 3300013297 Ga0157378_10394722 Ga0157378_103947222 294
591 3300013306 Ga0163162_10000796 Ga0163162_100007962 294
592 3300013307 Ga0157372_10008710 Ga0157372_1000871011 294
593 3300013308 Ga0157375_10004563 Ga0157375_1000456313 294
594 3300013308 Ga0157375_10109327 Ga0157375_101093272 294
595 3300014325 Ga0163163_10191746 Ga0163163_101917462 294
596 3300014326 Ga0157380_10015191 Ga0157380_100151916 294
597 3300014745 Ga0157377_10000538 Ga0157377_1000053816 294
598 3300014968 Ga0157379_10004942 Ga0157379_100049424 294
599 3300014969 Ga0157376_10002295 Ga0157376_1000229513 294
600 3300014969 Ga0157376_10356693 Ga0157376_103566931 294
601 3300017792 Ga0163161_10000499 Ga0163161_1000049927 294
602 3300020070 Ga0206356_10556735 Ga0206356_105567352 294
603 3300020081 Ga0206354_11444921 Ga0206354_114449211 294
604 3300020082 Ga0206353_10987334 Ga0206353_109873342 294
605 3300025290 Ga0207673_1000072 Ga0207673_10000723 294
606 3300025315 Ga0207697_10000252 Ga0207697_1000025232 294
607 3300025893 Ga0207682_10000029 Ga0207682_100000292 294
608 3300025898 Ga0207692_10006712 Ga0207692_100067122 294
609 3300025898 Ga0207692_10075086 Ga0207692_100750863 294
610 3300025898 Ga0207692_10261499 Ga0207692_102614991 294
611 3300025900 Ga0207710_10001576 Ga0207710_100015764 294
612 3300025900 Ga0207710_10002176 Ga0207710_100021767 294
613 3300025901 Ga0207688_10000020 Ga0207688_1000002014 294
614 3300025903 Ga0207680_10001555 Ga0207680_100015552 294
615 3300025903 Ga0207680_10124811 Ga0207680_101248112 294
616 3300025903 Ga0207680_10203482 Ga0207680_102034822 294
617 3300025907 Ga0207645_10000108 Ga0207645_1000010840 294
618 3300025907 Ga0207645_10057516 Ga0207645_100575164 294
619 3300025908 Ga0207643_10000044 Ga0207643_1000004471 294
620 3300025911 Ga0207654_10004211 Ga0207654_100042117 294
621 3300025912 Ga0207707_10014616 Ga0207707_100146167 294
622 3300025912 Ga0207707_10137962 Ga0207707_101379625 294
623 3300025913 Ga0207695_10018913 Ga0207695_100189137 294
624 3300025913 Ga0207695_10185078 Ga0207695_101850782 294
625 3300025915 Ga0207693_10071211 Ga0207693_100712113 294
626 3300025915 Ga0207693_10120847 Ga0207693_101208472 294
627 3300025916 Ga0207663_10210790 Ga0207663_102107901 294
628 3300025917 Ga0207660_10000543 Ga0207660_1000054321 294
629 3300025918 Ga0207662_10005777 Ga0207662_100057777 294
630 3300025919 Ga0207657_10016668 Ga0207657_100166685 294
631 3300025919 Ga0207657_10103241 Ga0207657_101032412 294
632 3300025920 Ga0207649_10000057 Ga0207649_1000005745 294
633 3300025921 Ga0207652_10013118 Ga0207652_100131187 294
634 3300025921 Ga0207652_10070361 Ga0207652_100703612 294
635 3300025923 Ga0207681_10001187 Ga0207681_1000118712 294
636 3300025925 Ga0207650_10001534 Ga0207650_100015343 294
637 3300025926 Ga0207659_10000028 Ga0207659_1000002889 294
638 3300025926 Ga0207659_10192498 Ga0207659_101924982 294
639 3300025927 Ga0207687_10000061 Ga0207687_1000006183 294
640 3300025928 Ga0207700_10001257 Ga0207700_100012574 294
641 3300025928 Ga0207700_10116961 Ga0207700_101169612 294
642 3300025928 Ga0207700_10175241 Ga0207700_101752413 294
643 3300025929 Ga0207664_10074898 Ga0207664_100748983 294
644 3300025929 Ga0207664_10142206 Ga0207664_101422062 294
645 3300025931 Ga0207644_10000194 Ga0207644_1000019434 294
646 3300025931 Ga0207644_10013156 Ga0207644_100131567 294
647 3300025931 Ga0207644_10273889 Ga0207644_102738892 294
648 3300025932 Ga0207690_10000225 Ga0207690_1000022543 294
649 3300025932 Ga0207690_10273120 Ga0207690_102731202 294
650 3300025933 Ga0207706_10118069 Ga0207706_101180692 294
651 3300025934 Ga0207686_10007051 Ga0207686_100070516 294
652 3300025934 Ga0207686_10165301 Ga0207686_101653013 294
653 3300025935 Ga0207709_10000291 Ga0207709_1000029142 294
654 3300025936 Ga0207670_10000434 Ga0207670_1000043416 294
655 3300025936 Ga0207670_10021555 Ga0207670_100215554 294
656 3300025937 Ga0207669_10000019 Ga0207669_10000019110 294
657 3300025938 Ga0207704_10000438 Ga0207704_100004382 294
658 3300025938 Ga0207704_10076485 Ga0207704_100764854 294
659 3300025939 Ga0207665_10001157 Ga0207665_100011575 294
660 3300025939 Ga0207665_10028871 Ga0207665_100288713 294
661 3300025939 Ga0207665_10105265 Ga0207665_101052654 294
662 3300025940 Ga0207691_10001047 Ga0207691_1000104728 294
663 3300025940 Ga0207691_10159480 Ga0207691_101594804 294
664 3300025940 Ga0207691_10240356 Ga0207691_102403563 294
665 3300025941 Ga0207711_10002887 Ga0207711_100028879 294
666 3300025941 Ga0207711_10044822 Ga0207711_100448225 294
667 3300025941 Ga0207711_10113298 Ga0207711_101132983 294
668 3300025941 Ga0207711_10163067 Ga0207711_101630672 294
669 3300025941 Ga0207711_10480654 Ga0207711_104806542 294
670 3300025942 Ga0207689_10001160 Ga0207689_1000116012 294
671 3300025944 Ga0207661_10000126 Ga0207661_1000012626 294
672 3300025944 Ga0207661_10142887 Ga0207661_101428874 294
673 3300025945 Ga0207679_10000026 Ga0207679_10000026113 294
674 3300025945 Ga0207679_10017686 Ga0207679_100176862 294
675 3300025949 Ga0207667_10018494 Ga0207667_100184945 294
676 3300025960 Ga0207651_10001232 Ga0207651_100012322 294
677 3300025961 Ga0207712_10002654 Ga0207712_1000265413 294
678 3300025972 Ga0207668_10000049 Ga0207668_1000004986 294
679 3300025972 Ga0207668_10082572 Ga0207668_100825723 294
680 3300025981 Ga0207640_10001994 Ga0207640_100019943 294
681 3300025986 Ga0207658_10001093 Ga0207658_100010937 294
682 3300025986 Ga0207658_10014381 Ga0207658_100143814 294
683 3300026023 Ga0207677_10000229 Ga0207677_1000022912 294
684 3300026035 Ga0207703_10012519 Ga0207703_100125195 294
685 3300026035 Ga0207703_10133147 Ga0207703_101331473 294
686 3300026041 Ga0207639_10002735 Ga0207639_1000273513 294
687 3300026041 Ga0207639_10069768 Ga0207639_100697682 294
688 3300026067 Ga0207678_10000403 Ga0207678_1000040328 294
689 3300026067 Ga0207678_10071985 Ga0207678_100719853 294
690 3300026067 Ga0207678_10390069 Ga0207678_103900691 294
691 3300026075 Ga0207708_10090192 Ga0207708_100901924 294
692 3300026075 Ga0207708_10246082 Ga0207708_102460822 294
693 3300026078 Ga0207702_10001378 Ga0207702_1000137822 294
694 3300026088 Ga0207641_10163831 Ga0207641_101638312 294
695 3300026088 Ga0207641_10237584 Ga0207641_102375842 294
696 3300026089 Ga0207648_10001244 Ga0207648_100012442 294
697 3300026095 Ga0207676_10000672 Ga0207676_1000067224 294
698 3300026095 Ga0207676_10010659 Ga0207676_100106595 294
699 3300026095 Ga0207676_10013475 Ga0207676_100134757 294
700 3300026095 Ga0207676_10023642 Ga0207676_100236425 294
701 3300026116 Ga0207674_10001968 Ga0207674_1000196818 294
702 3300026116 Ga0207674_10051024 Ga0207674_100510244 294
703 3300026116 Ga0207674_10189055 Ga0207674_101890552 294
704 3300026116 Ga0207674_10258499 Ga0207674_102584992 294
705 3300026118 Ga0207675_100132497 Ga0207675_1001324974 294
706 3300026121 Ga0207683_10000034 Ga0207683_1000003486 294
707 3300026121 Ga0207683_10091941 Ga0207683_100919413 294
708 3300026121 Ga0207683_10145961 Ga0207683_101459613 294
709 3300026142 Ga0207698_10042171 Ga0207698_100421712 294
710 3300027252 Ga0209973_1009382 Ga0209973_10093822 294
711 3300027364 Ga0209967_1009745 Ga0209967_10097452 294
712 3300027614 Ga0209970_1004643 Ga0209970_10046433 294
713 3300027617 Ga0210002_1000151 Ga0210002_10001512 294
714 3300027665 Ga0209983_1002418 Ga0209983_10024182 294
715 3300027695 Ga0209966_1002008 Ga0209966_10020082 294
716 3300027876 Ga0209974_10018966 Ga0209974_100189663 294
717 3300027876 Ga0209974_10054896 Ga0209974_100548962 294
718 3300027876 Ga0209974_10061656 Ga0209974_100616561 294
719 3300027907 Ga0207428_10000352 Ga0207428_100003525 294
720 3300028379 Ga0268266_10003979 Ga0268266_100039798 294
721 3300028379 Ga0268266_10111381 Ga0268266_101113813 294
722 3300028379 Ga0268266_10155077 Ga0268266_101550772 294
723 3300028380 Ga0268265_10000410 Ga0268265_1000041045 294
724 3300028380 Ga0268265_10436397 Ga0268265_104363971 294
725 3300028381 Ga0268264_10001567 Ga0268264_1000156713 294
726 3300028381 Ga0268264_10473333 Ga0268264_104733331 294
727 3300028800 Ga0265338_10054112 Ga0265338_100541122 294
728 3300031241 Ga0265325_10000141 Ga0265325_100001416 294
729 3300031247 Ga0265340_10039425 Ga0265340_100394254 294
730 3300031344 Ga0265316_10076472 Ga0265316_100764724 294
731 3300031595 Ga0265313_10007607 Ga0265313_100076075 294
732 3300032133 Ga0316583_10067483 Ga0316583_100674832 294
733 3300034816 Ga0373930_0006816 Ga0373930_0006816_393_1277 294
734 3300035083 Ga0373926_0002177 Ga0373926_0002177_925_1809 294
735 3300035083 Ga0373926_0026925 Ga0373926_0026925_834_1718 294
736 3300035084 Ga0373928_0004025 Ga0373928_0004025_11_895 294
737 3300035084 Ga0373928_0013398 Ga0373928_0013398_474_1358 294
738 3300035085 Ga0373929_0003944 Ga0373929_0003944_280_1164 294
739 3300035086 Ga0373934_0004922 Ga0373934_0004922_310_1194 294
740 3300035086 Ga0373934_0006581 Ga0373934_0006581_2523_3407 294
741 3300035088 Ga0373940_0001866 Ga0373940_0001866_2807_3691 294
742 3300035089 Ga0373944_0002474 Ga0373944_0002474_3568_4452 294
743 3300035089 Ga0373944_0056352 Ga0373944_0056352_154_1038 294
744 3300035090 Ga0373949_0004067 Ga0373949_0004067_1905_2789 294
745 3300035091 Ga0373951_0008754 Ga0373951_0008754_431_1315 294
746 3300035091 Ga0373951_0020349 Ga0373951_0020349_245_1129 294
747 3300035092 Ga0373952_0001062 Ga0373952_0001062_3561_4445 294
748 3300035111 Ga0373923_0010862 Ga0373923_0010862_373_1257 294
749 3300035111 Ga0373923_0032130 Ga0373923_0032130_1172_2056 294
750 3300035111 Ga0373923_0039425 Ga0373923_0039425_932_1816 294
751 3300035112 Ga0373932_0009450 Ga0373932_0009450_414_1298 294
752 3300035113 Ga0373936_0021839 Ga0373936_0021839_816_1700 294
753 3300035114 Ga0373939_0000706 Ga0373939_0000706_55_939 294
754 3300035114 Ga0373939_0072659 Ga0373939_0072659_31_915 294
755 3300035115 Ga0373941_0007982 Ga0373941_0007982_1707_2591 294
756 3300035115 Ga0373941_0032927 Ga0373941_0032927_72_956 294
757 3300035116 Ga0373945_0006425 Ga0373945_0006425_36_920 294
758 3300035117 Ga0373953_0009788 Ga0373953_0009788_1724_2608 294
759 3300035118 Ga0373954_0064983 Ga0373954_0064983_560_1444 294
760 3300035119 Ga0373956_0009825 Ga0373956_0009825_1212_2096 294
761 3300035119 Ga0373956_0019299 Ga0373956_0019299_1832_2716 294
762 3300035171 Ga0373946_0006715 Ga0373946_0006715_2164_3048 294
763 3300035171 Ga0373946_0077953 Ga0373946_0077953_539_1423 294
764 3300035172 Ga0373955_0003281 Ga0373955_0003281_4870_5754 294
765 3300035172 Ga0373955_0009848 Ga0373955_0009848_2140_3024 294
766 3300035241 Ga0373961_0006819 Ga0373961_0006819_365_1249 294
767 3300035241 Ga0373961_0049321 Ga0373961_0049321_85_969 294
768 3300035242 Ga0373962_0000258 Ga0373962_0000258_571_1455 294
769 3300035242 Ga0373962_0015271 Ga0373962_0015271_1043_1927 294
770 3300035410 Ga0373924_0004203 Ga0373924_0004203_2992_3876 294
771 3300035691 Ga0373931_0005613 Ga0373931_0005613_1393_2277 294
772 3300035691 Ga0373931_0017116 Ga0373931_0017116_1688_2572 294
773 3300035692 Ga0373935_0012931 Ga0373935_0012931_3471_4355 294
774 3300035692 Ga0373935_0175368 Ga0373935_0175368_312_1196 294
775 3300035695 Ga0373927_0020410 Ga0373927_0020410_228_1112 294
776 3300035695 Ga0373927_0084080 Ga0373927_0084080_719_1606 294
777 3300035695 Ga0373927_0196592 Ga0373927_0196592_215_1099 294
778 3300035724 Ga0373933_0003160 Ga0373933_0003160_6581_7465 294
779 3300035724 Ga0373933_0036726 Ga0373933_0036726_1060_1944 294
780 3300035724 Ga0373933_0040475 Ga0373933_0040475_833_1717 294
781 3300035724 Ga0373933_0103089 Ga0373933_0103089_16_900 294
782 3300036401 Ga0373937_0012815 Ga0373937_0012815_4851_5735 294
783 3300036401 Ga0373937_0040665 Ga0373937_0040665_2909_3793 294
784 3300036401 Ga0373937_0045771 Ga0373937_0045771_2998_3882 294
785 3300036401 Ga0373937_0133441 Ga0373937_0133441_553_1437 294
786 3300036401 Ga0373937_0202587 Ga0373937_0202587_406_1293 294
787 3300036401 Ga0373937_0572521 Ga0373937_0572521_80_964 294
788 3300037068 Ga0373925_0037718 Ga0373925_0037718_2276_3160 294
789 3300037068 Ga0373925_0370250 Ga0373925_0370250_46_930 294
790 3300037418 Ga0395900_0105347 Ga0395900_0105347_815_1702 294
791 3300037466 Ga0395898_0036540 Ga0395898_0036540_1723_2610 294
792 3300039437 Ga0436365_1181233 Ga0436365_1181233_754_1638 294
793 3300044694 Ga0466963_0092478 Ga0466963_0092478_927_1811 294
794 3300044694 Ga0466963_0109353 Ga0466963_0109353_921_1808 294
795 3300046454 Ga0495592_0000513 Ga0495592_0000513_24569_25453 294
796 3300046454 Ga0495592_0008115 Ga0495592_0008115_3719_4603 294
797 3300046454 Ga0495592_0169782 Ga0495592_0169782_392_1276 294
798 3300046455 Ga0495603_0035918 Ga0495603_0035918_1549_2433 294
799 3300046459 Ga0495629_0033278 Ga0495629_0033278_642_1526 294
800 3300046460 Ga0495638_0028639 Ga0495638_0028639_1462_2370 294
801 3300046461 Ga0495641_0094615 Ga0495641_0094615_21_905 294
802 3300046462 Ga0495651_0027931 Ga0495651_0027931_2777_3661 294
803 3300046462 Ga0495651_0204633 Ga0495651_0204633_478_1362 294
804 3300046463 Ga0495653_0000912 Ga0495653_0000912_21917_22801 294
805 3300046463 Ga0495653_0019530 Ga0495653_0019530_334_1218 294
806 3300046463 Ga0495653_0026746 Ga0495653_0026746_3587_4471 294
807 3300046463 Ga0495653_0095109 Ga0495653_0095109_674_1558 294
808 3300046472 Ga0495580_0026873 Ga0495580_0026873_1889_2773 294
809 3300046472 Ga0495580_0098423 Ga0495580_0098423_366_1250 294
810 3300046473 Ga0495582_0033766 Ga0495582_0033766_1769_2653 294
811 3300046476 Ga0495662_0029283 Ga0495662_0029283_554_1438 294
812 3300046476 Ga0495662_0043882 Ga0495662_0043882_855_1739 294
813 3300046477 Ga0495664_0051228 Ga0495664_0051228_403_1287 294
814 3300046477 Ga0495664_0073934 Ga0495664_0073934_802_1686 294
815 3300046491 Ga0495584_0006986 Ga0495584_0006986_721_1629 294
816 3300046492 Ga0495585_0004083 Ga0495585_0004083_6993_7877 294
817 3300046501 Ga0495607_0038217 Ga0495607_0038217_1155_2039 294
818 3300046511 Ga0495608_0008983 Ga0495608_0008983_2471_3355 294
819 3300046511 Ga0495608_0022196 Ga0495608_0022196_3019_3903 294
820 3300046511 Ga0495608_0281239 Ga0495608_0281239_49_933 294
821 3300046514 Ga0495618_0104308 Ga0495618_0104308_87_971 294
822 3300046516 Ga0495628_0011083 Ga0495628_0011083_5923_6807 294
823 3300046516 Ga0495628_0034712 Ga0495628_0034712_651_1535 294
824 3300046517 Ga0495630_0062267 Ga0495630_0062267_1894_2778 294
825 3300046519 Ga0495632_0000006 Ga0495632_0000006_326559_327455 294
826 3300046520 Ga0495637_0000784 Ga0495637_0000784_1368_2264 294
827 3300046522 Ga0495643_0000021 Ga0495643_0000021_61027_61923 294
828 3300046523 Ga0495644_0003549 Ga0495644_0003549_4293_5177 294
829 3300046524 Ga0495648_0038726 Ga0495648_0038726_599_1495 294
830 3300046525 Ga0495663_0000008 Ga0495663_0000008_18429_19325 294
831 3300046529 Ga0495652_0028963 Ga0495652_0028963_3335_4219 294
832 3300046529 Ga0495652_0195762 Ga0495652_0195762_238_1122 294
833 3300046531 Ga0495665_0011091 Ga0495665_0011091_3201_4085 294
834 3300046531 Ga0495665_0205783 Ga0495665_0205783_18_902 294
835 3300046533 Ga0495640_0067780 Ga0495640_0067780_1375_2259 294
836 3300046533 Ga0495640_0138997 Ga0495640_0138997_445_1329 294
837 3300046533 Ga0495640_0155157 Ga0495640_0155157_25_909 294
838 3300046536 Ga0495587_0113466 Ga0495587_0113466_40_924 294
839 3300046536 Ga0495587_0130609 Ga0495587_0130609_239_1123 294
840 3300046537 Ga0495598_0029638 Ga0495598_0029638_442_1326 294
841 3300046543 Ga0495645_0001151 Ga0495645_0001151_642_1526 294
842 3300046543 Ga0495645_0075566 Ga0495645_0075566_751_1635 294
843 3300046543 Ga0495645_0080582 Ga0495645_0080582_1160_2044 294
844 3300046557 Ga0495622_0006107 Ga0495622_0006107_4376_5260 294
845 3300046558 Ga0495633_0000247 Ga0495633_0000247_4340_5236 294
846 3300046558 Ga0495633_0001265 Ga0495633_0001265_5699_6595 294
847 3300046558 Ga0495633_0018376 Ga0495633_0018376_1314_2198 294
848 3300046559 Ga0495667_0027764 Ga0495667_0027764_1209_2093 294
849 3300046615 Ga0495656_0000297 Ga0495656_0000297_998_1882 294
850 3300046648 Ga0495611_0031638 Ga0495611_0031638_977_1861 294
851 3300046663 Ga0495635_0011642 Ga0495635_0011642_445_1329 294
852 3300046664 Ga0495659_0008457 Ga0495659_0008457_510_1394 294
853 3300046674 Ga0495588_0008423 Ga0495588_0008423_1058_1942 294
854 3300046675 Ga0495657_0009329 Ga0495657_0009329_2082_2966 294
855 3300046675 Ga0495657_0064306 Ga0495657_0064306_940_1824 294
856 3300046675 Ga0495657_0135465 Ga0495657_0135465_444_1328 294
857 3300046678 Ga0495599_0018304 Ga0495599_0018304_2454_3338 294
858 3300046679 Ga0495623_0017571 Ga0495623_0017571_2662_3546 294
859 3300046680 Ga0495646_0009857 Ga0495646_0009857_4375_5259 294
860 3300046681 Ga0495647_0074420 Ga0495647_0074420_29_913 294
861 3300046689 Ga0495613_0079747 Ga0495613_0079747_1131_2015 294
862 3300046691 Ga0495670_0002440 Ga0495670_0002440_1560_2444 294
863 3300046692 Ga0495671_0000017 Ga0495671_0000017_231543_232439 294
864 3300046794 Ga0495589_0027347 Ga0495589_0027347_1900_2784 294
865 3300046809 Ga0495600_0075284 Ga0495600_0075284_1057_1941 294
866 3300046809 Ga0495600_0114453 Ga0495600_0114453_639_1523 294
867 3300047317 Ga0495604_0006502 Ga0495604_0006502_8146_9030 294
868 3300047317 Ga0495604_0010832 Ga0495604_0010832_3569_4453 294
869 3300047319 Ga0495674_0050715 Ga0495674_0050715_366_1250 294
870 3300047321 Ga0495676_0052101 Ga0495676_0052101_2360_3244 294
871 3300047470 Ga0495681_0054630 Ga0495681_0054630_884_1780 294
872 3300047471 Ga0495684_0008189 Ga0495684_0008189_4395_5279 294
873 3300047471 Ga0495684_0070264 Ga0495684_0070264_842_1726 294
874 3300047673 Ga0495593_0053018 Ga0495593_0053018_1105_1989 294
875 3300047673 Ga0495593_0109969 Ga0495593_0109969_434_1318 294
876 3300048088 Ga0495602_0046224 Ga0495602_0046224_1777_2661 294
877 3300048088 Ga0495602_0064510 Ga0495602_0064510_971_1855 294
878 3300048088 Ga0495602_0262997 Ga0495602_0262997_132_1016 294
879 3300048903 Ga0496100_0001439 Ga0496100_0001439_5076_5960 294
880 3300048903 Ga0496100_0042849 Ga0496100_0042849_1630_2607 294
881 3300048904 Ga0496101_0000171 Ga0496101_0000171_15572_16456 294
882 3300048904 Ga0496101_0014780 Ga0496101_0014780_2624_3601 294
883 3300048904 Ga0496101_0067795 Ga0496101_0067795_410_1294 294
884 3300048904 Ga0496101_0198928 Ga0496101_0198928_519_1403 294
885 3300048905 Ga0496102_0004728 Ga0496102_0004728_250_1134 294
886 3300048905 Ga0496102_0062018 Ga0496102_0062018_2330_3214 294
887 3300048906 Ga0496103_0001994 Ga0496103_0001994_802_1686 294
888 3300048906 Ga0496103_0033981 Ga0496103_0033981_1710_2594 294
889 3300048906 Ga0496103_0051430 Ga0496103_0051430_1423_2307 294
890 3300048907 Ga0496104_0000067 Ga0496104_0000067_71023_71907 294
891 3300048907 Ga0496104_0086181 Ga0496104_0086181_46_930 294
892 3300048907 Ga0496104_0226813 Ga0496104_0226813_597_1481 294
893 3300048907 Ga0496104_0255365 Ga0496104_0255365_600_1484 294
894 3300048907 Ga0496104_0313519 Ga0496104_0313519_146_1030 294
895 3300048908 Ga0496105_0000130 Ga0496105_0000130_14306_15190 294
896 3300048908 Ga0496105_0016996 Ga0496105_0016996_573_1457 294
897 3300048909 Ga0496106_0000581 Ga0496106_0000581_5818_6702 294
898 3300048909 Ga0496106_0107536 Ga0496106_0107536_373_1257 294
899 3300048909 Ga0496106_0145671 Ga0496106_0145671_614_1498 294
900 3300048910 Ga0496107_0000224 Ga0496107_0000224_27851_28735 294
901 3300048910 Ga0496107_0016922 Ga0496107_0016922_192_1076 294
902 3300048911 Ga0496108_0000547 Ga0496108_0000547_13379_14263 294
903 3300048911 Ga0496108_0031606 Ga0496108_0031606_2910_3794 294
904 3300048911 Ga0496108_0051587 Ga0496108_0051587_49_933 294
905 3300048911 Ga0496108_0071071 Ga0496108_0071071_827_1711 294
906 3300048911 Ga0496108_0153649 Ga0496108_0153649_677_1561 294
907 3300048912 Ga0496109_0000384 Ga0496109_0000384_8472_9356 294
908 3300048912 Ga0496109_0014332 Ga0496109_0014332_885_1769 294
909 3300048912 Ga0496109_0173137 Ga0496109_0173137_648_1532 294
910 3300048912 Ga0496109_0449569 Ga0496109_0449569_27_911 294
911 3300048913 Ga0496110_0008712 Ga0496110_0008712_7114_7998 294
912 3300048913 Ga0496110_0018951 Ga0496110_0018951_2261_3145 294
913 3300048914 Ga0496111_0005888 Ga0496111_0005888_6176_7060 294
914 3300048914 Ga0496111_0081880 Ga0496111_0081880_1031_1915 294
915 3300048915 Ga0496112_0087114 Ga0496112_0087114_1829_2713 294
916 3300048915 Ga0496112_0226817 Ga0496112_0226817_439_1323 294
917 3300048916 Ga0496113_0122603 Ga0496113_0122603_681_1565 294
918 3300048917 Ga0496114_0004538 Ga0496114_0004538_7937_8821 294
919 3300048917 Ga0496114_0009885 Ga0496114_0009885_443_1327 294
920 3300048917 Ga0496114_0027436 Ga0496114_0027436_3233_4210 294
921 3300048918 Ga0496115_0000826 Ga0496115_0000826_12061_12945 294
922 3300048918 Ga0496115_0115152 Ga0496115_0115152_286_1263 294
923 3300048924 Ga0496121_0247341 Ga0496121_0247341_121_1005 294
924 3300048928 Ga0496125_0108084 Ga0496125_0108084_973_1857 294
925 3300048929 Ga0496126_0027170 Ga0496126_0027170_4269_5156 294
926 3300048929 Ga0496126_0157417 Ga0496126_0157417_1021_1908 294
927 3300049573 Ga0501037_0050928 Ga0501037_0050928_2133_3017 294
928 3300049574 Ga0501038_0027921 Ga0501038_0027921_496_1380 294
929 3300049575 Ga0501039_0085658 Ga0501039_0085658_1059_1943 294
930 3300049581 Ga0501047_0131910 Ga0501047_0131910_686_1570 294
931 3300049581 Ga0501047_0211521 Ga0501047_0211521_374_1258 294
932 3300049582 Ga0501048_0028790 Ga0501048_0028790_2925_3809 294
933 3300049583 Ga0501067_0113207 Ga0501067_0113207_537_1451 294
934 3300049584 Ga0501068_0003581 Ga0501068_0003581_716_1600 294
935 3300049586 Ga0501070_0109225 Ga0501070_0109225_716_1600 294
936 3300049587 Ga0501071_0005036 Ga0501071_0005036_4960_5844 294
937 3300049589 Ga0501073_0030477 Ga0501073_0030477_2397_3281 294
938 3300049590 Ga0501074_0091026 Ga0501074_0091026_665_1549 294
939 3300049741 Ga0501079_0201545 Ga0501079_0201545_643_1527 294
940 3300049742 Ga0501080_0266947 Ga0501080_0266947_247_1134 294
941 3300049744 Ga0501083_0147005 Ga0501083_0147005_200_1084 294
942 3300049824 Ga0501045_0239732 Ga0501045_0239732_187_1071 294
943 3300050489 nmdc:mga03683_132339_c1 nmdc:mga03683_132339_c1_192_1076 294
944 3300050494 nmdc:mga06z11_12623_c1 nmdc:mga06z11_12623_c1_877_1761 294
945 3300050509 nmdc:mga0qj67_43999_c1 nmdc:mga0qj67_43999_c1_1748_2632 294
946 3300050511 nmdc:mga08y16_203714_c1 nmdc:mga08y16_203714_c1_831_1718 294
947 3300050511 nmdc:mga08y16_257184_c1 nmdc:mga08y16_257184_c1_543_1427 294
948 3300050512 nmdc:mga0n895_165280_c1 nmdc:mga0n895_165280_c1_781_1665 294
949 3300050512 nmdc:mga0n895_744324_c1 nmdc:mga0n895_744324_c1_39_923 294
950 3300050513 nmdc:mga0rr50_258245_c1 nmdc:mga0rr50_258245_c1_118_1002 294
951 3300050514 nmdc:mga08x19_180973_c1 nmdc:mga08x19_180973_c1_516_1400 294
952 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_99492_100376 294
953 3300050514 nmdc:mga08x19_88601_c1 nmdc:mga08x19_88601_c1_503_1387 294
954 3300053077 Ga0495601_0000237 Ga0495601_0000237_24056_24940 294
955 3300053077 Ga0495601_0003203 Ga0495601_0003203_1150_2034 294
956 3300053077 Ga0495601_0011542 Ga0495601_0011542_4311_5195 294
957 3300053078 Ga0495612_0000563 Ga0495612_0000563_406_1290 294
958 3300053078 Ga0495612_0003858 Ga0495612_0003858_207_1091 294
959 3300053078 Ga0495612_0011052 Ga0495612_0011052_1959_2843 294
960 3300053078 Ga0495612_0025831 Ga0495612_0025831_875_1759 294
961 3300053083 Ga0495655_0021718 Ga0495655_0021718_242_1126 294
962 3300053084 Ga0495595_0006203 Ga0495595_0006203_784_1668 294
963 3300053084 Ga0495595_0008416 Ga0495595_0008416_1814_2698 294
964 3300053084 Ga0495595_0022604 Ga0495595_0022604_300_1184 294
965 3300053084 Ga0495595_0232034 Ga0495595_0232034_22_906 294
966 3300053085 Ga0495619_0000343 Ga0495619_0000343_12454_13338 294
967 3300053085 Ga0495619_0006532 Ga0495619_0006532_3073_3957 294
968 3300053085 Ga0495619_0006775 Ga0495619_0006775_5076_5960 294
969 3300054114 Ga0501084_0153751 Ga0501084_0153751_25_909 294
970 3300060353 Ga0501082_0049053 Ga0501082_0049053_989_1873 294
971 3300061719 Ga0466962_0161774 Ga0466962_0161774_125_1009 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

41

156

0.98

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

159

321

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9799 2 283
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9758 2 286
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.969 2 286
4a26-assembly1.cif.gz_A the crystal structure of leishmania major n5,n10- methylenetetrahydrofolate dehydrogenase/cyclohydrolase 0.967 2 290
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9662 1 285
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9975 34 114 3.40.50.10860
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9948 13 125 3.40.50.10860
af_K7KYI8_1_78_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9897 27 103 3.40.50.720
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9888 32 115 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9854 34 114 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A382NA53-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9996 1 110 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-J6DD83-F1-model_v4 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9954 1 116 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A3R7R7X4-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9945 1 290 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A418NSJ9-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9942 3 288 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A1Y3G7C1-F1-model_v4 Methenyltetrahydrofolate cyclohydrolase 0.9932 1 201 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Feature Viewer

pLDDT pTM Quality
94.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map