F487130
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 971 | 455 | 943 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0000859|Ga0501035_0000859_14449_15441 |
| Length | 330 |
| Sequence | MAGLVPAIHAFIALGFSKAWMPATSAGMTAERLKQMTARIIDGKAIAAELRHKVATEVARLKTAHDIVPRLAVVLVGVNPASEVYVRSKSKAVAEIGMRSLDHRLPETASEAELLALIGRLNADPAVSGILVQLPLPPQIDAHEVIAAIDPDKDVDGFHPVNVGRLSIGLPTLPPCTPFGCIVLAKAVHASLAGLDAVVIGRSNIVGKPVAQLLLAENATVTIAHSKTRDLAAVCRRADIVVAAIGRPAFVTKGWIKPGATVIDVGINRVTDKDGKSRIVGDVAADAVEVAGALTPVPGGVGPMTIACLMLNTLRAVCLQRGLPPPDIGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 5 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 10 | 2791355199 | |||
| 11 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 12 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 13 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 14 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 15 | 2904699407 | |||
| 16 | 2906610324 | |||
| 17 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 18 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 19 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 20 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 21 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 22 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 23 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 28 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 29 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 30 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 33 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 34 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 35 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 36 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 37 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 115 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 116 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 119 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 120 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 121 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 126 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 128 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 129 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 130 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 243 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 249 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 252 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 264 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 266 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 288 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 289 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 294 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 302 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 305 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 383 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 391 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 397 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 398 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 399 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 402 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 432 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 433 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 444 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 445 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 446 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 447 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 450 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 451 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 452 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 453 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 454 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 455 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.9 |
| Metatranscriptomes | 0.52 |
| Isolates | 2.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.78 |
| Nodule | 2.27 |
| Rhizoplane | 6.49 |
| Rhizosphere | 84.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1000169 | 3300001978 | Bacteria | 3330 |
| 2 | JGI24740J21852_10022911 | 3300001979 | Bacteria | 2141 |
| 3 | JGI24739J22299_10000897 | 3300001989 | Bacteria | 11012 |
| 4 | JGI24739J22299_10001524 | 3300001989 | Bacteria | 8748 |
| 5 | JGI24739J22299_10003887 | 3300001989 | Bacteria | 5710 |
| 6 | JGI24737J22298_10009404 | 3300001990 | Bacteria | 3253 |
| 7 | JGI24737J22298_10017120 | 3300001990 | Bacteria | 2337 |
| 8 | JGI24735J21928_10003487 | 3300002067 | Bacteria | 5356 |
| 9 | JGI24750J21931_1000745 | 3300002070 | Bacteria | 4622 |
| 10 | JGI24745J21846_1000061 | 3300002073 | Bacteria | 7701 |
| 11 | JGI24748J21848_1000185 | 3300002074 | Bacteria | 8024 |
| 12 | JGI24738J21930_10000067 | 3300002075 | Bacteria | 21834 |
| 13 | JGI24749J21850_1001798 | 3300002076 | Bacteria | 3033 |
| 14 | JGI24035J26624_1000005 | 3300002126 | Bacteria | 14770 |
| 15 | JGI24035J26624_1000190 | 3300002126 | Bacteria | 5699 |
| 16 | JGI24033J26618_1000613 | 3300002155 | Bacteria | 3427 |
| 17 | JGI24034J26672_10000951 | 3300002239 | Bacteria | 3776 |
| 18 | JGI24742J22300_10000153 | 3300002244 | Bacteria | 10167 |
| 19 | JGI25165J46597_1006892 | 3300003214 | Bacteria | 1960 |
| 20 | JGI25153J46596_10038430 | 3300003215 | Bacteria | 1508 |
| 21 | rootH2_10045331 | 3300003320 | Bacteria | 10632 |
| 22 | rootH2_10046910 | 3300003320 | Bacteria | 3741 |
| 23 | JGI25160J50197_1014601 | 3300003354 | Bacteria | 2620 |
| 24 | Ga0065712_10130182 | 3300005290 | Bacteria | 1555 |
| 25 | Ga0065715_10008690 | 3300005293 | Bacteria | 2691 |
| 26 | Ga0065707_10268785 | 3300005295 | Bacteria | 1077 |
| 27 | Ga0070676_10000332 | 3300005328 | Bacteria | 21434 |
| 28 | Ga0070676_10066999 | 3300005328 | Bacteria | 2146 |
| 29 | Ga0070676_10068867 | 3300005328 | Bacteria | 2119 |
| 30 | Ga0070683_100004171 | 3300005329 | Bacteria | 11837 |
| 31 | Ga0070690_100005079 | 3300005330 | Bacteria | 7376 |
| 32 | Ga0070690_100046391 | 3300005330 | Bacteria | 2762 |
| 33 | Ga0070670_100023341 | 3300005331 | Bacteria | 5324 |
| 34 | Ga0070677_10000258 | 3300005333 | Bacteria | 18304 |
| 35 | Ga0068869_100000510 | 3300005334 | Bacteria | 21648 |
| 36 | Ga0070666_10004570 | 3300005335 | Bacteria | 8438 |
| 37 | Ga0070666_10019282 | 3300005335 | Bacteria | 4400 |
| 38 | Ga0070680_100001476 | 3300005336 | Bacteria | 17088 |
| 39 | Ga0070680_100012038 | 3300005336 | Bacteria | 6712 |
| 40 | Ga0070682_100003255 | 3300005337 | Bacteria | 9005 |
| 41 | Ga0068868_100000148 | 3300005338 | Bacteria | 45833 |
| 42 | Ga0070660_100001314 | 3300005339 | Bacteria | 16922 |
| 43 | Ga0070660_100003272 | 3300005339 | Bacteria | 11124 |
| 44 | Ga0070689_100001783 | 3300005340 | Bacteria | 13820 |
| 45 | Ga0070689_100014799 | 3300005340 | Bacteria | 5675 |
| 46 | Ga0070691_10035255 | 3300005341 | Bacteria | 2355 |
| 47 | Ga0070687_100000318 | 3300005343 | Bacteria | 16315 |
| 48 | Ga0070687_100323504 | 3300005343 | Bacteria | 986 |
| 49 | Ga0070661_100000768 | 3300005344 | Bacteria | 23141 |
| 50 | Ga0070661_100127357 | 3300005344 | Bacteria | 1911 |
| 51 | Ga0070692_10011615 | 3300005345 | Bacteria | 4047 |
| 52 | Ga0070668_100051792 | 3300005347 | Bacteria | 3164 |
| 53 | Ga0070668_100093298 | 3300005347 | Bacteria | 2375 |
| 54 | Ga0070668_100137565 | 3300005347 | Bacteria | 1966 |
| 55 | Ga0070669_100003445 | 3300005353 | Bacteria | 11403 |
| 56 | Ga0070675_100001491 | 3300005354 | Bacteria | 17261 |
| 57 | Ga0070675_100108142 | 3300005354 | Bacteria | 2348 |
| 58 | Ga0070675_100174255 | 3300005354 | Bacteria | 1857 |
| 59 | Ga0070671_100003997 | 3300005355 | Bacteria | 11616 |
| 60 | Ga0070671_100043030 | 3300005355 | Bacteria | 3755 |
| 61 | Ga0070671_100352254 | 3300005355 | Bacteria | 1256 |
| 62 | Ga0070674_100001355 | 3300005356 | Bacteria | 12909 |
| 63 | Ga0070674_100139731 | 3300005356 | Bacteria | 1816 |
| 64 | Ga0070674_100213607 | 3300005356 | Bacteria | 1497 |
| 65 | Ga0070673_100000670 | 3300005364 | Bacteria | 18859 |
| 66 | Ga0070673_100008314 | 3300005364 | Bacteria | 6894 |
| 67 | Ga0070673_100053400 | 3300005364 | Bacteria | 3174 |
| 68 | Ga0070673_100134138 | 3300005364 | Bacteria | 2082 |
| 69 | Ga0070688_100031440 | 3300005365 | Bacteria | 3193 |
| 70 | Ga0070688_100070770 | 3300005365 | Bacteria | 2231 |
| 71 | Ga0070659_100001400 | 3300005366 | Bacteria | 17383 |
| 72 | Ga0070659_100064806 | 3300005366 | Bacteria | 2893 |
| 73 | Ga0070659_100108095 | 3300005366 | Bacteria | 2243 |
| 74 | Ga0070659_100115234 | 3300005366 | Bacteria | 2172 |
| 75 | Ga0070659_100159673 | 3300005366 | Bacteria | 1843 |
| 76 | Ga0070667_100002340 | 3300005367 | Bacteria | 16596 |
| 77 | Ga0070667_100061422 | 3300005367 | Bacteria | 3181 |
| 78 | Ga0070703_10013030 | 3300005406 | Bacteria | 2357 |
| 79 | Ga0070709_10022655 | 3300005434 | Bacteria | 3678 |
| 80 | Ga0070714_100103577 | 3300005435 | Bacteria | 2510 |
| 81 | Ga0070714_100256895 | 3300005435 | Bacteria | 1617 |
| 82 | Ga0070713_100000838 | 3300005436 | Bacteria | 19660 |
| 83 | Ga0070713_100015088 | 3300005436 | Bacteria | 5758 |
| 84 | Ga0070713_100043089 | 3300005436 | Bacteria | 3687 |
| 85 | Ga0070713_100129808 | 3300005436 | Bacteria | 2221 |
| 86 | Ga0070713_100205600 | 3300005436 | Bacteria | 1780 |
| 87 | Ga0070713_100219622 | 3300005436 | Bacteria | 1724 |
| 88 | Ga0070710_10003726 | 3300005437 | Bacteria | 7205 |
| 89 | Ga0070710_10012469 | 3300005437 | Bacteria | 4222 |
| 90 | Ga0070710_10049287 | 3300005437 | Bacteria | 2355 |
| 91 | Ga0070701_10019659 | 3300005438 | Bacteria | 3193 |
| 92 | Ga0070701_10128181 | 3300005438 | Bacteria | 1439 |
| 93 | Ga0070711_100028348 | 3300005439 | Bacteria | 3684 |
| 94 | Ga0070711_100043244 | 3300005439 | Bacteria | 3050 |
| 95 | Ga0070711_100055772 | 3300005439 | Bacteria | 2731 |
| 96 | Ga0070711_100172289 | 3300005439 | Bacteria | 1650 |
| 97 | Ga0070705_100001500 | 3300005440 | Bacteria | 12285 |
| 98 | Ga0070705_100341336 | 3300005440 | Bacteria | 1089 |
| 99 | Ga0070700_100001568 | 3300005441 | Bacteria | 11405 |
| 100 | Ga0070700_100107815 | 3300005441 | Bacteria | 1846 |
| 101 | Ga0070708_100105830 | 3300005445 | Bacteria | 2581 |
| 102 | Ga0070708_100193052 | 3300005445 | Bacteria | 1905 |
| 103 | Ga0070663_100001857 | 3300005455 | Bacteria | 11779 |
| 104 | Ga0070678_100000391 | 3300005456 | Bacteria | 20585 |
| 105 | Ga0070678_100015738 | 3300005456 | Bacteria | 4815 |
| 106 | Ga0070678_100025297 | 3300005456 | Bacteria | 3991 |
| 107 | Ga0070678_100227291 | 3300005456 | Bacteria | 1554 |
| 108 | Ga0070662_100090457 | 3300005457 | Bacteria | 2297 |
| 109 | Ga0070662_100220942 | 3300005457 | Bacteria | 1512 |
| 110 | Ga0070681_10006791 | 3300005458 | Bacteria | 11139 |
| 111 | Ga0068867_100006925 | 3300005459 | Bacteria | 8025 |
| 112 | Ga0070685_10003877 | 3300005466 | Bacteria | 7563 |
| 113 | Ga0070685_10008554 | 3300005466 | Bacteria | 5265 |
| 114 | Ga0070698_100108778 | 3300005471 | Bacteria | 2739 |
| 115 | Ga0070698_100183770 | 3300005471 | Bacteria | 2029 |
| 116 | Ga0070699_100078736 | 3300005518 | Bacteria | 2871 |
| 117 | Ga0070679_100026893 | 3300005530 | Bacteria | 5658 |
| 118 | Ga0070679_100142520 | 3300005530 | Bacteria | 2375 |
| 119 | Ga0070679_100299590 | 3300005530 | Bacteria | 1558 |
| 120 | Ga0070684_100000101 | 3300005535 | Bacteria | 55960 |
| 121 | Ga0070684_100074894 | 3300005535 | Bacteria | 2984 |
| 122 | Ga0068853_100116865 | 3300005539 | Bacteria | 2375 |
| 123 | Ga0068853_100251458 | 3300005539 | Bacteria | 1622 |
| 124 | Ga0070672_100000016 | 3300005543 | Bacteria | 71848 |
| 125 | Ga0070672_100259453 | 3300005543 | Bacteria | 1465 |
| 126 | Ga0070686_100008745 | 3300005544 | Bacteria | 5675 |
| 127 | Ga0070686_100018037 | 3300005544 | Bacteria | 4135 |
| 128 | Ga0070686_100272537 | 3300005544 | Bacteria | 1245 |
| 129 | Ga0070695_100000225 | 3300005545 | Bacteria | 27760 |
| 130 | Ga0070695_100004140 | 3300005545 | Bacteria | 8475 |
| 131 | Ga0070696_100002898 | 3300005546 | Bacteria | 11405 |
| 132 | Ga0070696_100382194 | 3300005546 | Bacteria | 1098 |
| 133 | Ga0070693_100000138 | 3300005547 | Bacteria | 32988 |
| 134 | Ga0070693_100289511 | 3300005547 | Bacteria | 1100 |
| 135 | Ga0070665_100146816 | 3300005548 | Bacteria | 2361 |
| 136 | Ga0070665_100164185 | 3300005548 | Bacteria | 2223 |
| 137 | Ga0070665_100172093 | 3300005548 | Bacteria | 2167 |
| 138 | Ga0070704_100082859 | 3300005549 | Bacteria | 2366 |
| 139 | Ga0068855_100000244 | 3300005563 | Bacteria | 68503 |
| 140 | Ga0068855_100023959 | 3300005563 | Bacteria | 7308 |
| 141 | Ga0068855_100040189 | 3300005563 | Bacteria | 5552 |
| 142 | Ga0068855_100047984 | 3300005563 | Bacteria | 5042 |
| 143 | Ga0068855_100059558 | 3300005563 | Bacteria | 4467 |
| 144 | Ga0068855_100129068 | 3300005563 | Bacteria | 2888 |
| 145 | Ga0068855_100245280 | 3300005563 | Bacteria | 1999 |
| 146 | Ga0070664_100000067 | 3300005564 | Bacteria | 65201 |
| 147 | Ga0070664_100039135 | 3300005564 | Bacteria | 3994 |
| 148 | Ga0070664_100263518 | 3300005564 | Bacteria | 1551 |
| 149 | Ga0068857_100000275 | 3300005577 | Bacteria | 35176 |
| 150 | Ga0068857_100018470 | 3300005577 | Bacteria | 6116 |
| 151 | Ga0068857_100066582 | 3300005577 | Bacteria | 3205 |
| 152 | Ga0068857_100160864 | 3300005577 | Bacteria | 2037 |
| 153 | Ga0068857_100176512 | 3300005577 | Bacteria | 1943 |
| 154 | Ga0068857_100258758 | 3300005577 | Bacteria | 1597 |
| 155 | Ga0068857_100751487 | 3300005577 | Bacteria | 929 |
| 156 | Ga0068854_100002271 | 3300005578 | Bacteria | 11828 |
| 157 | Ga0068854_100162112 | 3300005578 | Bacteria | 1733 |
| 158 | Ga0068854_100420622 | 3300005578 | Bacteria | 1110 |
| 159 | Ga0068856_100001016 | 3300005614 | Bacteria | 29871 |
| 160 | Ga0068856_100069733 | 3300005614 | Bacteria | 3476 |
| 161 | Ga0068856_100103133 | 3300005614 | Bacteria | 2846 |
| 162 | Ga0068856_100120811 | 3300005614 | Bacteria | 2621 |
| 163 | Ga0070702_100000175 | 3300005615 | Bacteria | 20470 |
| 164 | Ga0070702_100125218 | 3300005615 | Bacteria | 1615 |
| 165 | Ga0068852_100000611 | 3300005616 | Bacteria | 23441 |
| 166 | Ga0068859_100002948 | 3300005617 | Bacteria | 17261 |
| 167 | Ga0068859_100124564 | 3300005617 | Bacteria | 2645 |
| 168 | Ga0068859_100179054 | 3300005617 | Bacteria | 2202 |
| 169 | Ga0068864_100000234 | 3300005618 | Bacteria | 49663 |
| 170 | Ga0068864_100021303 | 3300005618 | Bacteria | 5431 |
| 171 | Ga0068864_100025360 | 3300005618 | Bacteria | 4992 |
| 172 | Ga0068866_10002227 | 3300005718 | Bacteria | 8040 |
| 173 | Ga0068866_10021000 | 3300005718 | Bacteria | 3000 |
| 174 | Ga0068866_10097364 | 3300005718 | Bacteria | 1616 |
| 175 | Ga0068861_100036887 | 3300005719 | Bacteria | 3631 |
| 176 | Ga0068861_100044242 | 3300005719 | Bacteria | 3347 |
| 177 | Ga0068861_100099380 | 3300005719 | Bacteria | 2311 |
| 178 | Ga0068870_10000009 | 3300005840 | Bacteria | 70353 |
| 179 | Ga0068863_100001729 | 3300005841 | Bacteria | 21634 |
| 180 | Ga0068863_100142449 | 3300005841 | Bacteria | 2291 |
| 181 | Ga0068863_100533685 | 3300005841 | Bacteria | 1157 |
| 182 | Ga0068858_100001059 | 3300005842 | Bacteria | 28468 |
| 183 | Ga0068858_100138508 | 3300005842 | Bacteria | 2284 |
| 184 | Ga0068860_100003167 | 3300005843 | Bacteria | 16980 |
| 185 | Ga0068860_100105682 | 3300005843 | Bacteria | 2688 |
| 186 | Ga0068860_100377212 | 3300005843 | Bacteria | 1399 |
| 187 | Ga0068862_100019397 | 3300005844 | Bacteria | 5675 |
| 188 | Ga0068862_100039735 | 3300005844 | Bacteria | 3997 |
| 189 | Ga0068862_100500322 | 3300005844 | Bacteria | 1153 |
| 190 | Ga0081455_10011795 | 3300005937 | Bacteria | 8752 |
| 191 | Ga0081455_10075776 | 3300005937 | Bacteria | 2774 |
| 192 | Ga0081538_10149572 | 3300005981 | Bacteria | 1060 |
| 193 | Ga0081540_1004206 | 3300005983 | Bacteria | 11062 |
| 194 | Ga0081539_10018244 | 3300005985 | Bacteria | 4879 |
| 195 | Ga0070717_10004993 | 3300006028 | Bacteria | 9653 |
| 196 | Ga0070717_10099451 | 3300006028 | Bacteria | 2468 |
| 197 | Ga0075368_10010605 | 3300006042 | Bacteria | 3335 |
| 198 | Ga0075363_100082898 | 3300006048 | Bacteria | 1756 |
| 199 | Ga0075364_10142245 | 3300006051 | Bacteria | 1614 |
| 200 | Ga0070715_10017080 | 3300006163 | Bacteria | 2740 |
| 201 | Ga0070715_10026067 | 3300006163 | Bacteria | 2321 |
| 202 | Ga0070716_100003280 | 3300006173 | Bacteria | 7598 |
| 203 | Ga0070712_100004136 | 3300006175 | Bacteria | 8914 |
| 204 | Ga0070712_100023829 | 3300006175 | Bacteria | 4047 |
| 205 | Ga0070712_100031650 | 3300006175 | Bacteria | 3565 |
| 206 | Ga0070712_100039495 | 3300006175 | Bacteria | 3230 |
| 207 | Ga0070712_100132686 | 3300006175 | Bacteria | 1890 |
| 208 | Ga0075367_10013106 | 3300006178 | Bacteria | 4444 |
| 209 | Ga0075367_10091430 | 3300006178 | Bacteria | 1851 |
| 210 | Ga0075367_10153160 | 3300006178 | Bacteria | 1431 |
| 211 | Ga0075369_10061791 | 3300006186 | Bacteria | 1636 |
| 212 | Ga0075369_10150760 | 3300006186 | Bacteria | 1063 |
| 213 | Ga0097621_100006760 | 3300006237 | Bacteria | 8145 |
| 214 | Ga0075370_10034531 | 3300006353 | Bacteria | 2835 |
| 215 | Ga0075370_10146369 | 3300006353 | Bacteria | 1383 |
| 216 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 217 | Ga0068871_100014044 | 3300006358 | Bacteria | 5956 |
| 218 | Ga0068871_100053613 | 3300006358 | Bacteria | 3269 |
| 219 | Ga0068871_100108554 | 3300006358 | Bacteria | 2332 |
| 220 | Ga0075430_100072654 | 3300006846 | Bacteria | 2885 |
| 221 | Ga0075434_100095961 | 3300006871 | Bacteria | 2970 |
| 222 | Ga0075434_100147219 | 3300006871 | Bacteria | 2375 |
| 223 | Ga0068865_100000355 | 3300006881 | Bacteria | 25325 |
| 224 | Ga0068865_100005877 | 3300006881 | Bacteria | 7466 |
| 225 | Ga0068865_100357595 | 3300006881 | Bacteria | 1185 |
| 226 | Ga0075436_100006210 | 3300006914 | Bacteria | 8194 |
| 227 | Ga0075436_100007339 | 3300006914 | Bacteria | 7533 |
| 228 | Ga0097620_100002948 | 3300006931 | Bacteria | 17261 |
| 229 | Ga0097620_100124548 | 3300006931 | Bacteria | 2645 |
| 230 | Ga0097620_100179052 | 3300006931 | Bacteria | 2202 |
| 231 | Ga0075435_100099820 | 3300007076 | Bacteria | 2404 |
| 232 | Ga0105251_10017705 | 3300009011 | Bacteria | 3808 |
| 233 | Ga0105240_10004853 | 3300009093 | Bacteria | 20253 |
| 234 | Ga0105240_10022674 | 3300009093 | Bacteria | 8318 |
| 235 | Ga0105240_10087262 | 3300009093 | Bacteria | 3821 |
| 236 | Ga0105240_10185858 | 3300009093 | Bacteria | 2448 |
| 237 | Ga0105240_10519388 | 3300009093 | Bacteria | 1322 |
| 238 | Ga0105240_10559793 | 3300009093 | Bacteria | 1264 |
| 239 | Ga0111539_10141004 | 3300009094 | Bacteria | 2821 |
| 240 | Ga0111539_10329681 | 3300009094 | Bacteria | 1777 |
| 241 | Ga0105245_10000409 | 3300009098 | Bacteria | 39920 |
| 242 | Ga0105245_10152826 | 3300009098 | Bacteria | 2184 |
| 243 | Ga0105245_10512549 | 3300009098 | Bacteria | 1217 |
| 244 | Ga0105247_10004080 | 3300009101 | Bacteria | 9386 |
| 245 | Ga0105247_10009067 | 3300009101 | Bacteria | 6056 |
| 246 | Ga0105247_10038738 | 3300009101 | Bacteria | 2911 |
| 247 | Ga0105247_10091424 | 3300009101 | Bacteria | 1933 |
| 248 | Ga0105247_10266445 | 3300009101 | Bacteria | 1177 |
| 249 | Ga0105247_10348041 | 3300009101 | Bacteria | 1041 |
| 250 | Ga0105243_10004202 | 3300009148 | Bacteria | 11415 |
| 251 | Ga0105243_10130712 | 3300009148 | Bacteria | 2129 |
| 252 | Ga0105243_10543975 | 3300009148 | Bacteria | 1108 |
| 253 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 254 | Ga0105241_10010799 | 3300009174 | Bacteria | 6699 |
| 255 | Ga0105241_10060625 | 3300009174 | Bacteria | 2911 |
| 256 | Ga0105242_10011250 | 3300009176 | Bacteria | 6877 |
| 257 | Ga0105242_10044930 | 3300009176 | Bacteria | 3578 |
| 258 | Ga0105242_10221084 | 3300009176 | Bacteria | 1693 |
| 259 | Ga0105248_10000309 | 3300009177 | Bacteria | 58008 |
| 260 | Ga0105248_10038164 | 3300009177 | Bacteria | 5375 |
| 261 | Ga0105248_10116016 | 3300009177 | Bacteria | 3020 |
| 262 | Ga0105248_10176677 | 3300009177 | Bacteria | 2406 |
| 263 | Ga0105248_10256225 | 3300009177 | Bacteria | 1970 |
| 264 | Ga0105248_10424316 | 3300009177 | Bacteria | 1498 |
| 265 | Ga0105237_10044970 | 3300009545 | Bacteria | 4445 |
| 266 | Ga0105237_10112288 | 3300009545 | Bacteria | 2717 |
| 267 | Ga0105237_10151426 | 3300009545 | Bacteria | 2316 |
| 268 | Ga0105237_10176114 | 3300009545 | Bacteria | 2139 |
| 269 | Ga0105238_10027365 | 3300009551 | Bacteria | 5809 |
| 270 | Ga0105238_10111585 | 3300009551 | Bacteria | 2714 |
| 271 | Ga0105249_10003451 | 3300009553 | Bacteria | 13696 |
| 272 | Ga0105249_10231262 | 3300009553 | Bacteria | 1823 |
| 273 | Ga0105239_10007939 | 3300010375 | Bacteria | 12129 |
| 274 | Ga0105239_10011468 | 3300010375 | Bacteria | 9884 |
| 275 | Ga0105246_10002040 | 3300011119 | Bacteria | 12194 |
| 276 | Ga0157373_10040211 | 3300013100 | Bacteria | 3347 |
| 277 | Ga0157371_10008314 | 3300013102 | Bacteria | 8286 |
| 278 | Ga0157371_10266337 | 3300013102 | Bacteria | 1236 |
| 279 | Ga0157370_10058079 | 3300013104 | Bacteria | 3677 |
| 280 | Ga0157370_10161055 | 3300013104 | Bacteria | 2088 |
| 281 | Ga0157369_10005855 | 3300013105 | Bacteria | 14284 |
| 282 | Ga0157374_10000452 | 3300013296 | Bacteria | 37355 |
| 283 | Ga0157374_10026788 | 3300013296 | Bacteria | 5191 |
| 284 | Ga0157374_10065714 | 3300013296 | Bacteria | 3407 |
| 285 | Ga0157374_10333689 | 3300013296 | Bacteria | 1504 |
| 286 | Ga0157378_10000872 | 3300013297 | Bacteria | 27839 |
| 287 | Ga0157378_10062596 | 3300013297 | Bacteria | 3323 |
| 288 | Ga0157378_10365575 | 3300013297 | Bacteria | 1413 |
| 289 | Ga0157378_10394722 | 3300013297 | Bacteria | 1362 |
| 290 | Ga0163162_10000796 | 3300013306 | Bacteria | 29342 |
| 291 | Ga0157372_10008710 | 3300013307 | Bacteria | 10774 |
| 292 | Ga0157372_10054142 | 3300013307 | Bacteria | 4475 |
| 293 | Ga0157372_10124519 | 3300013307 | Bacteria | 2963 |
| 294 | Ga0157375_10004563 | 3300013308 | Bacteria | 12034 |
| 295 | Ga0157375_10109327 | 3300013308 | Bacteria | 2860 |
| 296 | Ga0157375_10625201 | 3300013308 | Bacteria | 1235 |
| 297 | Ga0163163_10191746 | 3300014325 | Bacteria | 2092 |
| 298 | Ga0157380_10015191 | 3300014326 | Bacteria | 5654 |
| 299 | Ga0157380_10309619 | 3300014326 | Bacteria | 1459 |
| 300 | Ga0157377_10000538 | 3300014745 | Bacteria | 16011 |
| 301 | Ga0157379_10004942 | 3300014968 | Bacteria | 11442 |
| 302 | Ga0157376_10002295 | 3300014969 | Bacteria | 12921 |
| 303 | Ga0157376_10356693 | 3300014969 | Bacteria | 1401 |
| 304 | Ga0163161_10000499 | 3300017792 | Bacteria | 32280 |
| 305 | Ga0163161_10303267 | 3300017792 | Bacteria | 1258 |
| 306 | Ga0206356_10556735 | 3300020070 | Bacteria | 1106 |
| 307 | Ga0206354_11444921 | 3300020081 | Bacteria | 1596 |
| 308 | Ga0206353_10552086 | 3300020082 | Bacteria | 1081 |
| 309 | Ga0206353_10987334 | 3300020082 | Bacteria | 1940 |
| 310 | Ga0213876_10005419 | 3300021384 | Bacteria | 7023 |
| 311 | Ga0209233_1020069 | 3300025261 | Bacteria | 1760 |
| 312 | Ga0207673_1000072 | 3300025290 | Bacteria | 8779 |
| 313 | Ga0209758_1000616 | 3300025297 | Bacteria | 54936 |
| 314 | Ga0207426_1000420 | 3300025302 | Bacteria | 69895 |
| 315 | Ga0207697_10000252 | 3300025315 | Bacteria | 29548 |
| 316 | Ga0207682_10000029 | 3300025893 | Bacteria | 57930 |
| 317 | Ga0207692_10006712 | 3300025898 | Bacteria | 4678 |
| 318 | Ga0207692_10075086 | 3300025898 | Bacteria | 1792 |
| 319 | Ga0207692_10261499 | 3300025898 | Bacteria | 1041 |
| 320 | Ga0207710_10001576 | 3300025900 | Bacteria | 11198 |
| 321 | Ga0207710_10002176 | 3300025900 | Bacteria | 9215 |
| 322 | Ga0207710_10164322 | 3300025900 | Bacteria | 1083 |
| 323 | Ga0207688_10000020 | 3300025901 | Bacteria | 51200 |
| 324 | Ga0207688_10093665 | 3300025901 | Bacteria | 1728 |
| 325 | Ga0207688_10308730 | 3300025901 | Bacteria | 968 |
| 326 | Ga0207680_10001555 | 3300025903 | Bacteria | 10815 |
| 327 | Ga0207680_10124811 | 3300025903 | Bacteria | 1688 |
| 328 | Ga0207680_10203482 | 3300025903 | Bacteria | 1350 |
| 329 | Ga0207647_10001753 | 3300025904 | Bacteria | 16640 |
| 330 | Ga0207645_10000108 | 3300025907 | Bacteria | 61630 |
| 331 | Ga0207645_10057516 | 3300025907 | Bacteria | 2483 |
| 332 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 333 | Ga0207654_10004211 | 3300025911 | Bacteria | 7261 |
| 334 | Ga0207707_10014616 | 3300025912 | Bacteria | 6839 |
| 335 | Ga0207707_10137962 | 3300025912 | Bacteria | 2132 |
| 336 | Ga0207695_10018913 | 3300025913 | Bacteria | 7947 |
| 337 | Ga0207695_10038814 | 3300025913 | Bacteria | 5122 |
| 338 | Ga0207695_10185078 | 3300025913 | Bacteria | 2002 |
| 339 | Ga0207695_10399314 | 3300025913 | Bacteria | 1259 |
| 340 | Ga0207671_10031026 | 3300025914 | Bacteria | 3985 |
| 341 | Ga0207671_10152873 | 3300025914 | Bacteria | 1784 |
| 342 | Ga0207693_10017047 | 3300025915 | Bacteria | 5799 |
| 343 | Ga0207693_10071211 | 3300025915 | Bacteria | 2720 |
| 344 | Ga0207693_10120847 | 3300025915 | Bacteria | 2057 |
| 345 | Ga0207693_10206099 | 3300025915 | Bacteria | 1546 |
| 346 | Ga0207663_10147759 | 3300025916 | Bacteria | 1645 |
| 347 | Ga0207663_10210790 | 3300025916 | Bacteria | 1408 |
| 348 | Ga0207660_10000543 | 3300025917 | Bacteria | 25357 |
| 349 | Ga0207662_10005777 | 3300025918 | Bacteria | 6621 |
| 350 | Ga0207657_10004676 | 3300025919 | Bacteria | 14449 |
| 351 | Ga0207657_10016668 | 3300025919 | Bacteria | 7080 |
| 352 | Ga0207657_10103241 | 3300025919 | Bacteria | 2363 |
| 353 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 354 | Ga0207649_10139493 | 3300025920 | Bacteria | 1657 |
| 355 | Ga0207652_10006960 | 3300025921 | Bacteria | 9111 |
| 356 | Ga0207652_10013118 | 3300025921 | Bacteria | 6709 |
| 357 | Ga0207652_10070361 | 3300025921 | Bacteria | 3038 |
| 358 | Ga0207681_10001187 | 3300025923 | Bacteria | 16757 |
| 359 | Ga0207694_10086806 | 3300025924 | Bacteria | 2464 |
| 360 | Ga0207694_10139021 | 3300025924 | Bacteria | 1952 |
| 361 | Ga0207650_10001534 | 3300025925 | Bacteria | 16557 |
| 362 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 363 | Ga0207659_10192498 | 3300025926 | Bacteria | 1624 |
| 364 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 365 | Ga0207687_10020799 | 3300025927 | Bacteria | 4354 |
| 366 | Ga0207700_10001257 | 3300025928 | Bacteria | 14436 |
| 367 | Ga0207700_10013859 | 3300025928 | Bacteria | 5264 |
| 368 | Ga0207700_10116961 | 3300025928 | Bacteria | 2155 |
| 369 | Ga0207700_10175241 | 3300025928 | Bacteria | 1792 |
| 370 | Ga0207664_10042991 | 3300025929 | Bacteria | 3531 |
| 371 | Ga0207664_10074898 | 3300025929 | Bacteria | 2736 |
| 372 | Ga0207664_10142206 | 3300025929 | Bacteria | 2031 |
| 373 | Ga0207644_10000194 | 3300025931 | Bacteria | 43567 |
| 374 | Ga0207644_10013156 | 3300025931 | Bacteria | 5509 |
| 375 | Ga0207644_10253326 | 3300025931 | Bacteria | 1405 |
| 376 | Ga0207644_10273889 | 3300025931 | Bacteria | 1353 |
| 377 | Ga0207690_10000225 | 3300025932 | Bacteria | 42706 |
| 378 | Ga0207690_10273120 | 3300025932 | Bacteria | 1314 |
| 379 | Ga0207706_10004628 | 3300025933 | Bacteria | 12903 |
| 380 | Ga0207706_10118069 | 3300025933 | Bacteria | 2333 |
| 381 | Ga0207706_10145008 | 3300025933 | Bacteria | 2089 |
| 382 | Ga0207686_10007051 | 3300025934 | Bacteria | 6046 |
| 383 | Ga0207686_10162213 | 3300025934 | Bacteria | 1568 |
| 384 | Ga0207686_10165301 | 3300025934 | Bacteria | 1555 |
| 385 | Ga0207709_10000291 | 3300025935 | Bacteria | 56621 |
| 386 | Ga0207670_10000434 | 3300025936 | Bacteria | 23430 |
| 387 | Ga0207670_10021555 | 3300025936 | Bacteria | 3978 |
| 388 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 389 | Ga0207704_10000438 | 3300025938 | Bacteria | 18608 |
| 390 | Ga0207704_10076485 | 3300025938 | Bacteria | 2145 |
| 391 | Ga0207665_10001157 | 3300025939 | Bacteria | 17725 |
| 392 | Ga0207665_10028871 | 3300025939 | Bacteria | 3667 |
| 393 | Ga0207665_10105265 | 3300025939 | Bacteria | 1975 |
| 394 | Ga0207691_10001047 | 3300025940 | Bacteria | 27463 |
| 395 | Ga0207691_10097584 | 3300025940 | Bacteria | 2626 |
| 396 | Ga0207691_10159480 | 3300025940 | Bacteria | 1980 |
| 397 | Ga0207691_10240356 | 3300025940 | Bacteria | 1566 |
| 398 | Ga0207711_10002887 | 3300025941 | Bacteria | 15057 |
| 399 | Ga0207711_10044822 | 3300025941 | Bacteria | 3777 |
| 400 | Ga0207711_10113298 | 3300025941 | Bacteria | 2414 |
| 401 | Ga0207711_10163067 | 3300025941 | Bacteria | 2019 |
| 402 | Ga0207711_10480654 | 3300025941 | Bacteria | 1157 |
| 403 | Ga0207689_10001160 | 3300025942 | Bacteria | 25357 |
| 404 | Ga0207661_10000126 | 3300025944 | Bacteria | 48665 |
| 405 | Ga0207661_10142887 | 3300025944 | Bacteria | 2061 |
| 406 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 407 | Ga0207679_10017686 | 3300025945 | Bacteria | 4760 |
| 408 | Ga0207679_10131260 | 3300025945 | Bacteria | 2010 |
| 409 | Ga0207679_10305927 | 3300025945 | Bacteria | 1372 |
| 410 | Ga0207679_10416359 | 3300025945 | Bacteria | 1185 |
| 411 | Ga0207667_10000392 | 3300025949 | Bacteria | 59118 |
| 412 | Ga0207667_10018494 | 3300025949 | Bacteria | 7812 |
| 413 | Ga0207667_10023513 | 3300025949 | Bacteria | 6785 |
| 414 | Ga0207667_10106775 | 3300025949 | Bacteria | 2888 |
| 415 | Ga0207667_10169337 | 3300025949 | Bacteria | 2245 |
| 416 | Ga0207651_10001232 | 3300025960 | Bacteria | 11489 |
| 417 | Ga0207651_10094796 | 3300025960 | Bacteria | 2196 |
| 418 | Ga0207651_10339791 | 3300025960 | Bacteria | 1261 |
| 419 | Ga0207712_10002654 | 3300025961 | Bacteria | 11451 |
| 420 | Ga0207712_10257325 | 3300025961 | Bacteria | 1414 |
| 421 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 422 | Ga0207668_10082572 | 3300025972 | Bacteria | 2335 |
| 423 | Ga0207640_10001994 | 3300025981 | Bacteria | 11014 |
| 424 | Ga0207658_10001093 | 3300025986 | Bacteria | 21888 |
| 425 | Ga0207658_10014381 | 3300025986 | Bacteria | 5420 |
| 426 | Ga0207658_10339899 | 3300025986 | Bacteria | 1304 |
| 427 | Ga0207677_10000229 | 3300026023 | Bacteria | 44154 |
| 428 | Ga0207677_10107305 | 3300026023 | Bacteria | 2071 |
| 429 | Ga0207703_10012519 | 3300026035 | Bacteria | 6612 |
| 430 | Ga0207703_10059566 | 3300026035 | Bacteria | 3119 |
| 431 | Ga0207703_10133147 | 3300026035 | Bacteria | 2149 |
| 432 | Ga0207639_10002735 | 3300026041 | Bacteria | 11838 |
| 433 | Ga0207639_10069768 | 3300026041 | Bacteria | 2743 |
| 434 | Ga0207639_10074245 | 3300026041 | Bacteria | 2669 |
| 435 | Ga0207678_10000403 | 3300026067 | Bacteria | 39172 |
| 436 | Ga0207678_10044346 | 3300026067 | Bacteria | 3847 |
| 437 | Ga0207678_10066998 | 3300026067 | Bacteria | 3082 |
| 438 | Ga0207678_10071985 | 3300026067 | Bacteria | 2963 |
| 439 | Ga0207678_10201644 | 3300026067 | Bacteria | 1701 |
| 440 | Ga0207678_10390069 | 3300026067 | Bacteria | 1204 |
| 441 | Ga0207708_10090192 | 3300026075 | Bacteria | 2363 |
| 442 | Ga0207708_10246082 | 3300026075 | Bacteria | 1439 |
| 443 | Ga0207702_10001378 | 3300026078 | Bacteria | 24247 |
| 444 | Ga0207702_10034279 | 3300026078 | Bacteria | 4243 |
| 445 | Ga0207702_10124924 | 3300026078 | Bacteria | 2308 |
| 446 | Ga0207702_10174951 | 3300026078 | Bacteria | 1971 |
| 447 | Ga0207641_10163831 | 3300026088 | Bacteria | 2023 |
| 448 | Ga0207641_10237584 | 3300026088 | Bacteria | 1696 |
| 449 | Ga0207648_10001244 | 3300026089 | Bacteria | 28553 |
| 450 | Ga0207648_10030687 | 3300026089 | Bacteria | 4757 |
| 451 | Ga0207676_10000672 | 3300026095 | Bacteria | 27349 |
| 452 | Ga0207676_10010659 | 3300026095 | Bacteria | 6555 |
| 453 | Ga0207676_10013475 | 3300026095 | Bacteria | 5873 |
| 454 | Ga0207676_10023642 | 3300026095 | Bacteria | 4537 |
| 455 | Ga0207676_10255784 | 3300026095 | Bacteria | 1579 |
| 456 | Ga0207674_10001968 | 3300026116 | Bacteria | 26001 |
| 457 | Ga0207674_10031314 | 3300026116 | Bacteria | 5588 |
| 458 | Ga0207674_10051024 | 3300026116 | Bacteria | 4223 |
| 459 | Ga0207674_10189055 | 3300026116 | Bacteria | 2009 |
| 460 | Ga0207674_10190575 | 3300026116 | Bacteria | 2000 |
| 461 | Ga0207674_10258499 | 3300026116 | Bacteria | 1688 |
| 462 | Ga0207674_10550757 | 3300026116 | Bacteria | 1114 |
| 463 | Ga0207675_100048673 | 3300026118 | Bacteria | 3956 |
| 464 | Ga0207675_100132497 | 3300026118 | Bacteria | 2363 |
| 465 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 466 | Ga0207683_10080952 | 3300026121 | Bacteria | 2882 |
| 467 | Ga0207683_10091941 | 3300026121 | Bacteria | 2703 |
| 468 | Ga0207683_10136341 | 3300026121 | Bacteria | 2209 |
| 469 | Ga0207683_10145961 | 3300026121 | Bacteria | 2133 |
| 470 | Ga0207698_10042171 | 3300026142 | Bacteria | 3406 |
| 471 | Ga0207698_10074280 | 3300026142 | Bacteria | 2712 |
| 472 | Ga0207698_10082670 | 3300026142 | Bacteria | 2597 |
| 473 | Ga0209973_1009382 | 3300027252 | Bacteria | 1138 |
| 474 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 475 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 476 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 477 | Ga0209967_1009745 | 3300027364 | Bacteria | 1334 |
| 478 | Ga0209970_1004643 | 3300027614 | Bacteria | 2274 |
| 479 | Ga0210002_1000151 | 3300027617 | Bacteria | 10314 |
| 480 | Ga0209983_1002418 | 3300027665 | Bacteria | 4091 |
| 481 | Ga0209966_1002008 | 3300027695 | Bacteria | 3404 |
| 482 | Ga0209974_10018966 | 3300027876 | Bacteria | 2281 |
| 483 | Ga0209974_10054896 | 3300027876 | Bacteria | 1343 |
| 484 | Ga0209974_10061656 | 3300027876 | Bacteria | 1270 |
| 485 | Ga0207428_10000352 | 3300027907 | Bacteria | 59444 |
| 486 | Ga0268266_10002169 | 3300028379 | Bacteria | 21507 |
| 487 | Ga0268266_10003979 | 3300028379 | Bacteria | 14332 |
| 488 | Ga0268266_10111381 | 3300028379 | Bacteria | 2425 |
| 489 | Ga0268266_10155077 | 3300028379 | Bacteria | 2068 |
| 490 | Ga0268265_10000410 | 3300028380 | Bacteria | 45939 |
| 491 | Ga0268265_10106730 | 3300028380 | Bacteria | 2275 |
| 492 | Ga0268265_10182536 | 3300028380 | Bacteria | 1804 |
| 493 | Ga0268265_10436397 | 3300028380 | Bacteria | 1220 |
| 494 | Ga0268265_10672524 | 3300028380 | Bacteria | 997 |
| 495 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 496 | Ga0268264_10001567 | 3300028381 | Bacteria | 21210 |
| 497 | Ga0268264_10473333 | 3300028381 | Bacteria | 1217 |
| 498 | Ga0307517_10074981 | 3300028786 | Bacteria | 2974 |
| 499 | Ga0307517_10204464 | 3300028786 | Bacteria | 1228 |
| 500 | Ga0265338_10054112 | 3300028800 | Bacteria | 3583 |
| 501 | Ga0265325_10000141 | 3300031241 | Bacteria | 50291 |
| 502 | Ga0265325_10011173 | 3300031241 | Bacteria | 5167 |
| 503 | Ga0265340_10039425 | 3300031247 | Bacteria | 2331 |
| 504 | Ga0265316_10076472 | 3300031344 | Bacteria | 2572 |
| 505 | Ga0265316_10087704 | 3300031344 | Bacteria | 2377 |
| 506 | Ga0307513_10245025 | 3300031456 | Bacteria | 1594 |
| 507 | Ga0307509_10134992 | 3300031507 | Bacteria | 2415 |
| 508 | Ga0307408_100102075 | 3300031548 | Bacteria | 2187 |
| 509 | Ga0265313_10000008 | 3300031595 | Bacteria | 173405 |
| 510 | Ga0265313_10007607 | 3300031595 | Bacteria | 7354 |
| 511 | Ga0265313_10007635 | 3300031595 | Bacteria | 7334 |
| 512 | Ga0265313_10055574 | 3300031595 | Bacteria | 1875 |
| 513 | Ga0265314_10003949 | 3300031711 | Bacteria | 14062 |
| 514 | Ga0265314_10068326 | 3300031711 | Bacteria | 2389 |
| 515 | Ga0265342_10000912 | 3300031712 | Bacteria | 29335 |
| 516 | Ga0307516_10090465 | 3300031730 | Bacteria | 2889 |
| 517 | Ga0307407_10062753 | 3300031903 | Bacteria | 2178 |
| 518 | Ga0307411_10334840 | 3300032005 | Bacteria | 1228 |
| 519 | Ga0307415_100198287 | 3300032126 | Bacteria | 1590 |
| 520 | Ga0316583_10067483 | 3300032133 | Bacteria | 1252 |
| 521 | Ga0307510_10010287 | 3300033180 | Bacteria | 11113 |
| 522 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 523 | Ga0373930_0006816 | 3300034816 | Bacteria | 1946 |
| 524 | Ga0373926_0002177 | 3300035083 | Bacteria | 6173 |
| 525 | Ga0373926_0026925 | 3300035083 | Bacteria | 2013 |
| 526 | Ga0373928_0004025 | 3300035084 | Bacteria | 2805 |
| 527 | Ga0373928_0013398 | 3300035084 | Bacteria | 1646 |
| 528 | Ga0373929_0003944 | 3300035085 | Bacteria | 2658 |
| 529 | Ga0373934_0004922 | 3300035086 | Bacteria | 4945 |
| 530 | Ga0373934_0006581 | 3300035086 | Bacteria | 4310 |
| 531 | Ga0373940_0001866 | 3300035088 | Bacteria | 3956 |
| 532 | Ga0373944_0002474 | 3300035089 | Bacteria | 4696 |
| 533 | Ga0373944_0056352 | 3300035089 | Bacteria | 1250 |
| 534 | Ga0373949_0004067 | 3300035090 | Bacteria | 3387 |
| 535 | Ga0373951_0008754 | 3300035091 | Bacteria | 2281 |
| 536 | Ga0373951_0020349 | 3300035091 | Bacteria | 1518 |
| 537 | Ga0373952_0001062 | 3300035092 | Bacteria | 5024 |
| 538 | Ga0373923_0010862 | 3300035111 | Bacteria | 3325 |
| 539 | Ga0373923_0032130 | 3300035111 | Bacteria | 2119 |
| 540 | Ga0373923_0039425 | 3300035111 | Bacteria | 1940 |
| 541 | Ga0373932_0009450 | 3300035112 | Bacteria | 2344 |
| 542 | Ga0373936_0003212 | 3300035113 | Bacteria | 6130 |
| 543 | Ga0373936_0021839 | 3300035113 | Bacteria | 2490 |
| 544 | Ga0373939_0000706 | 3300035114 | Bacteria | 8274 |
| 545 | Ga0373939_0072659 | 3300035114 | Bacteria | 1124 |
| 546 | Ga0373941_0007982 | 3300035115 | Bacteria | 2612 |
| 547 | Ga0373941_0032927 | 3300035115 | Bacteria | 1554 |
| 548 | Ga0373945_0006425 | 3300035116 | Bacteria | 3791 |
| 549 | Ga0373953_0009788 | 3300035117 | Bacteria | 3314 |
| 550 | Ga0373954_0064983 | 3300035118 | Bacteria | 1726 |
| 551 | Ga0373956_0009825 | 3300035119 | Bacteria | 3898 |
| 552 | Ga0373956_0019299 | 3300035119 | Bacteria | 2890 |
| 553 | Ga0373943_0002977 | 3300035170 | Bacteria | 7688 |
| 554 | Ga0373946_0006715 | 3300035171 | Bacteria | 4180 |
| 555 | Ga0373946_0037007 | 3300035171 | Bacteria | 1982 |
| 556 | Ga0373946_0077953 | 3300035171 | Bacteria | 1445 |
| 557 | Ga0373955_0003281 | 3300035172 | Bacteria | 7094 |
| 558 | Ga0373955_0009848 | 3300035172 | Bacteria | 4495 |
| 559 | Ga0373955_0048173 | 3300035172 | Bacteria | 2310 |
| 560 | Ga0373961_0006819 | 3300035241 | Bacteria | 2746 |
| 561 | Ga0373961_0049321 | 3300035241 | Bacteria | 1244 |
| 562 | Ga0373961_0063469 | 3300035241 | Bacteria | 1127 |
| 563 | Ga0373962_0000258 | 3300035242 | Bacteria | 11309 |
| 564 | Ga0373962_0015271 | 3300035242 | Bacteria | 1967 |
| 565 | Ga0373924_0004203 | 3300035410 | Bacteria | 5018 |
| 566 | Ga0373931_0005613 | 3300035691 | Bacteria | 5819 |
| 567 | Ga0373931_0017116 | 3300035691 | Bacteria | 3578 |
| 568 | Ga0373935_0000046 | 3300035692 | Bacteria | 48734 |
| 569 | Ga0373935_0012931 | 3300035692 | Bacteria | 5029 |
| 570 | Ga0373935_0175368 | 3300035692 | Bacteria | 1469 |
| 571 | Ga0373927_0000209 | 3300035695 | Bacteria | 46820 |
| 572 | Ga0373927_0020410 | 3300035695 | Bacteria | 4344 |
| 573 | Ga0373927_0084080 | 3300035695 | Bacteria | 2064 |
| 574 | Ga0373927_0182326 | 3300035695 | Bacteria | 1377 |
| 575 | Ga0373927_0196592 | 3300035695 | Bacteria | 1323 |
| 576 | Ga0373927_0373028 | 3300035695 | Bacteria | 941 |
| 577 | Ga0373933_0003160 | 3300035724 | Bacteria | 9199 |
| 578 | Ga0373933_0036726 | 3300035724 | Bacteria | 2870 |
| 579 | Ga0373933_0040475 | 3300035724 | Bacteria | 2746 |
| 580 | Ga0373933_0063278 | 3300035724 | Bacteria | 2236 |
| 581 | Ga0373933_0103089 | 3300035724 | Bacteria | 1772 |
| 582 | Ga0373947_0002886 | 3300035725 | Bacteria | 10264 |
| 583 | Ga0373947_0296030 | 3300035725 | Bacteria | 1078 |
| 584 | Ga0373937_0012815 | 3300036401 | Bacteria | 7383 |
| 585 | Ga0373937_0023444 | 3300036401 | Bacteria | 5556 |
| 586 | Ga0373937_0040665 | 3300036401 | Bacteria | 4238 |
| 587 | Ga0373937_0045771 | 3300036401 | Bacteria | 3999 |
| 588 | Ga0373937_0133441 | 3300036401 | Bacteria | 2320 |
| 589 | Ga0373937_0202587 | 3300036401 | Bacteria | 1866 |
| 590 | Ga0373937_0572521 | 3300036401 | Bacteria | 1073 |
| 591 | Ga0372808_008217 | 3300036459 | Bacteria | 1443 |
| 592 | Ga0373925_0005099 | 3300037068 | Bacteria | 9835 |
| 593 | Ga0373925_0037718 | 3300037068 | Bacteria | 3569 |
| 594 | Ga0373925_0126389 | 3300037068 | Bacteria | 1990 |
| 595 | Ga0373925_0370250 | 3300037068 | Bacteria | 1165 |
| 596 | Ga0395900_0005151 | 3300037418 | Bacteria | 13732 |
| 597 | Ga0395900_0105347 | 3300037418 | Bacteria | 2897 |
| 598 | Ga0395898_0003493 | 3300037466 | Bacteria | 17565 |
| 599 | Ga0395898_0036540 | 3300037466 | Bacteria | 4877 |
| 600 | Ga0395901_0043590 | 3300038443 | Bacteria | 4653 |
| 601 | Ga0436365_0911459 | 3300039437 | Bacteria | 3343 |
| 602 | Ga0436365_1148686 | 3300039437 | Bacteria | 18630 |
| 603 | Ga0436365_1181233 | 3300039437 | Bacteria | 4977 |
| 604 | Ga0436365_1422081 | 3300039437 | Bacteria | 3254 |
| 605 | Ga0436363_0927837 | 3300039450 | Bacteria | 5750 |
| 606 | Ga0451793_1659208 | 3300041452 | Bacteria | 2586 |
| 607 | Ga0451800_1674697 | 3300041459 | Bacteria | 1001 |
| 608 | Ga0451807_0850701 | 3300041486 | Bacteria | 2875 |
| 609 | Ga0451807_1403845 | 3300041486 | Bacteria | 1097 |
| 610 | Ga0439445_0045246 | 3300042004 | Bacteria | 1177 |
| 611 | Ga0466963_0091246 | 3300044694 | Bacteria | 2075 |
| 612 | Ga0466963_0092478 | 3300044694 | Bacteria | 2061 |
| 613 | Ga0466963_0109353 | 3300044694 | Bacteria | 1896 |
| 614 | Ga0495617_053834 | 3300046452 | Bacteria | 1336 |
| 615 | Ga0495592_0000513 | 3300046454 | Bacteria | 28143 |
| 616 | Ga0495592_0008115 | 3300046454 | Bacteria | 7885 |
| 617 | Ga0495592_0169782 | 3300046454 | Bacteria | 1495 |
| 618 | Ga0495603_0000153 | 3300046455 | Bacteria | 34539 |
| 619 | Ga0495603_0035918 | 3300046455 | Bacteria | 2975 |
| 620 | Ga0495629_0007084 | 3300046459 | Bacteria | 8262 |
| 621 | Ga0495629_0033278 | 3300046459 | Bacteria | 3647 |
| 622 | Ga0495638_0028639 | 3300046460 | Bacteria | 3594 |
| 623 | Ga0495641_0008708 | 3300046461 | Bacteria | 6137 |
| 624 | Ga0495641_0094615 | 3300046461 | Bacteria | 1334 |
| 625 | Ga0495651_0025967 | 3300046462 | Bacteria | 4560 |
| 626 | Ga0495651_0027931 | 3300046462 | Bacteria | 4398 |
| 627 | Ga0495651_0204633 | 3300046462 | Bacteria | 1379 |
| 628 | Ga0495653_0000912 | 3300046463 | Bacteria | 22874 |
| 629 | Ga0495653_0019530 | 3300046463 | Bacteria | 5495 |
| 630 | Ga0495653_0026746 | 3300046463 | Bacteria | 4624 |
| 631 | Ga0495653_0095109 | 3300046463 | Bacteria | 2170 |
| 632 | Ga0495653_0105670 | 3300046463 | Bacteria | 2032 |
| 633 | Ga0495580_0000246 | 3300046472 | Bacteria | 43076 |
| 634 | Ga0495580_0026873 | 3300046472 | Bacteria | 4192 |
| 635 | Ga0495580_0098423 | 3300046472 | Bacteria | 2034 |
| 636 | Ga0495582_0000686 | 3300046473 | Bacteria | 18641 |
| 637 | Ga0495582_0033766 | 3300046473 | Bacteria | 2813 |
| 638 | Ga0495639_0000799 | 3300046475 | Bacteria | 14377 |
| 639 | Ga0495662_0029283 | 3300046476 | Bacteria | 2659 |
| 640 | Ga0495662_0043882 | 3300046476 | Bacteria | 2158 |
| 641 | Ga0495662_0074205 | 3300046476 | Bacteria | 1650 |
| 642 | Ga0495664_0015494 | 3300046477 | Bacteria | 4334 |
| 643 | Ga0495664_0051228 | 3300046477 | Bacteria | 2451 |
| 644 | Ga0495664_0073934 | 3300046477 | Bacteria | 2038 |
| 645 | Ga0495664_0085121 | 3300046477 | Bacteria | 1898 |
| 646 | Ga0495584_0006986 | 3300046491 | Bacteria | 5897 |
| 647 | Ga0495584_0103335 | 3300046491 | Bacteria | 1441 |
| 648 | Ga0495585_0004083 | 3300046492 | Bacteria | 9592 |
| 649 | Ga0495594_0000243 | 3300046499 | Bacteria | 26402 |
| 650 | Ga0495594_0057740 | 3300046499 | Bacteria | 2143 |
| 651 | Ga0495607_0038217 | 3300046501 | Bacteria | 2877 |
| 652 | Ga0495606_0232159 | 3300046507 | Bacteria | 1033 |
| 653 | Ga0495608_0008983 | 3300046511 | Bacteria | 6987 |
| 654 | Ga0495608_0022196 | 3300046511 | Bacteria | 4350 |
| 655 | Ga0495608_0281239 | 3300046511 | Bacteria | 1033 |
| 656 | Ga0495618_0002089 | 3300046514 | Bacteria | 13103 |
| 657 | Ga0495618_0104308 | 3300046514 | Bacteria | 1815 |
| 658 | Ga0495620_0019530 | 3300046515 | Bacteria | 3330 |
| 659 | Ga0495628_0011083 | 3300046516 | Bacteria | 7628 |
| 660 | Ga0495628_0034712 | 3300046516 | Bacteria | 4056 |
| 661 | Ga0495628_0054964 | 3300046516 | Bacteria | 3137 |
| 662 | Ga0495630_0062267 | 3300046517 | Bacteria | 2802 |
| 663 | Ga0495630_0123501 | 3300046517 | Bacteria | 1964 |
| 664 | Ga0495630_0565085 | 3300046517 | Bacteria | 872 |
| 665 | Ga0495632_0000006 | 3300046519 | Bacteria | 345883 |
| 666 | Ga0495632_0155594 | 3300046519 | Bacteria | 1055 |
| 667 | Ga0495637_0000784 | 3300046520 | Bacteria | 21358 |
| 668 | Ga0495643_0000021 | 3300046522 | Bacteria | 293465 |
| 669 | Ga0495644_0003549 | 3300046523 | Bacteria | 6164 |
| 670 | Ga0495648_0038726 | 3300046524 | Bacteria | 3044 |
| 671 | Ga0495648_0069726 | 3300046524 | Bacteria | 2045 |
| 672 | Ga0495663_0000008 | 3300046525 | Bacteria | 260614 |
| 673 | Ga0495663_0020493 | 3300046525 | Bacteria | 1898 |
| 674 | Ga0495666_0100331 | 3300046526 | Bacteria | 1364 |
| 675 | Ga0495652_0028963 | 3300046529 | Bacteria | 4865 |
| 676 | Ga0495652_0040789 | 3300046529 | Bacteria | 4012 |
| 677 | Ga0495652_0195762 | 3300046529 | Bacteria | 1538 |
| 678 | Ga0495665_0000341 | 3300046531 | Bacteria | 23627 |
| 679 | Ga0495665_0011091 | 3300046531 | Bacteria | 4877 |
| 680 | Ga0495665_0205783 | 3300046531 | Bacteria | 1019 |
| 681 | Ga0495640_0000521 | 3300046533 | Bacteria | 28196 |
| 682 | Ga0495640_0067780 | 3300046533 | Bacteria | 2403 |
| 683 | Ga0495640_0138997 | 3300046533 | Bacteria | 1566 |
| 684 | Ga0495640_0155157 | 3300046533 | Bacteria | 1469 |
| 685 | Ga0495586_0182752 | 3300046535 | Bacteria | 1186 |
| 686 | Ga0495587_0113466 | 3300046536 | Bacteria | 1555 |
| 687 | Ga0495587_0130609 | 3300046536 | Bacteria | 1436 |
| 688 | Ga0495598_0029638 | 3300046537 | Bacteria | 1527 |
| 689 | Ga0495609_0030375 | 3300046538 | Bacteria | 2459 |
| 690 | Ga0495645_0001151 | 3300046543 | Bacteria | 17952 |
| 691 | Ga0495645_0075566 | 3300046543 | Bacteria | 2425 |
| 692 | Ga0495645_0080582 | 3300046543 | Bacteria | 2336 |
| 693 | Ga0495622_0006107 | 3300046557 | Bacteria | 5596 |
| 694 | Ga0495622_0011002 | 3300046557 | Bacteria | 4175 |
| 695 | Ga0495633_0000247 | 3300046558 | Bacteria | 64533 |
| 696 | Ga0495633_0001265 | 3300046558 | Bacteria | 20151 |
| 697 | Ga0495633_0018376 | 3300046558 | Bacteria | 3551 |
| 698 | Ga0495667_0027764 | 3300046559 | Bacteria | 3811 |
| 699 | Ga0495667_0033180 | 3300046559 | Bacteria | 3455 |
| 700 | Ga0495667_0116845 | 3300046559 | Bacteria | 1723 |
| 701 | Ga0495656_0000297 | 3300046615 | Bacteria | 17243 |
| 702 | Ga0495656_0057004 | 3300046615 | Bacteria | 1690 |
| 703 | Ga0495656_0221867 | 3300046615 | Bacteria | 945 |
| 704 | Ga0495668_0194952 | 3300046616 | Bacteria | 1109 |
| 705 | Ga0495634_0006489 | 3300046642 | Bacteria | 8886 |
| 706 | Ga0495611_0031638 | 3300046648 | Bacteria | 2330 |
| 707 | Ga0495611_0177172 | 3300046648 | Bacteria | 996 |
| 708 | Ga0495635_0000470 | 3300046663 | Bacteria | 25525 |
| 709 | Ga0495635_0011642 | 3300046663 | Bacteria | 6164 |
| 710 | Ga0495659_0008457 | 3300046664 | Bacteria | 3275 |
| 711 | Ga0495588_0007378 | 3300046674 | Bacteria | 4999 |
| 712 | Ga0495588_0008423 | 3300046674 | Bacteria | 4732 |
| 713 | Ga0495657_0009329 | 3300046675 | Bacteria | 7447 |
| 714 | Ga0495657_0064306 | 3300046675 | Bacteria | 2417 |
| 715 | Ga0495657_0135465 | 3300046675 | Bacteria | 1539 |
| 716 | Ga0495599_0018304 | 3300046678 | Bacteria | 4365 |
| 717 | Ga0495599_0125811 | 3300046678 | Bacteria | 1593 |
| 718 | Ga0495623_0017571 | 3300046679 | Bacteria | 4620 |
| 719 | Ga0495646_0009857 | 3300046680 | Bacteria | 6070 |
| 720 | Ga0495646_0014448 | 3300046680 | Bacteria | 5021 |
| 721 | Ga0495647_0002355 | 3300046681 | Bacteria | 5935 |
| 722 | Ga0495647_0024406 | 3300046681 | Bacteria | 2201 |
| 723 | Ga0495647_0074420 | 3300046681 | Bacteria | 1365 |
| 724 | Ga0495658_0003407 | 3300046683 | Bacteria | 7873 |
| 725 | Ga0495669_0018118 | 3300046684 | Bacteria | 3025 |
| 726 | Ga0495613_0079747 | 3300046689 | Bacteria | 2380 |
| 727 | Ga0495624_0000144 | 3300046690 | Bacteria | 51509 |
| 728 | Ga0495624_0231186 | 3300046690 | Bacteria | 1120 |
| 729 | Ga0495670_0002440 | 3300046691 | Bacteria | 9182 |
| 730 | Ga0495670_0012052 | 3300046691 | Bacteria | 4254 |
| 731 | Ga0495671_0000017 | 3300046692 | Bacteria | 293465 |
| 732 | Ga0495589_0022874 | 3300046794 | Bacteria | 3187 |
| 733 | Ga0495589_0027347 | 3300046794 | Bacteria | 2884 |
| 734 | Ga0495600_0075284 | 3300046809 | Bacteria | 2204 |
| 735 | Ga0495600_0114453 | 3300046809 | Bacteria | 1756 |
| 736 | Ga0495581_0000223 | 3300047315 | Bacteria | 26718 |
| 737 | Ga0495604_0006502 | 3300047317 | Bacteria | 9261 |
| 738 | Ga0495604_0010832 | 3300047317 | Bacteria | 7242 |
| 739 | Ga0495604_0028443 | 3300047317 | Bacteria | 4447 |
| 740 | Ga0495674_0000700 | 3300047319 | Bacteria | 31695 |
| 741 | Ga0495674_0050715 | 3300047319 | Bacteria | 3661 |
| 742 | Ga0495676_0012616 | 3300047321 | Bacteria | 7606 |
| 743 | Ga0495676_0052101 | 3300047321 | Bacteria | 3269 |
| 744 | Ga0495676_0088961 | 3300047321 | Bacteria | 2314 |
| 745 | Ga0495680_0133466 | 3300047322 | Bacteria | 1822 |
| 746 | Ga0495673_0045725 | 3300047469 | Bacteria | 1944 |
| 747 | Ga0495681_0054630 | 3300047470 | Bacteria | 1865 |
| 748 | Ga0495684_0008189 | 3300047471 | Bacteria | 8090 |
| 749 | Ga0495684_0019592 | 3300047471 | Bacteria | 5213 |
| 750 | Ga0495684_0070264 | 3300047471 | Bacteria | 2662 |
| 751 | Ga0495686_0154635 | 3300047472 | Bacteria | 1344 |
| 752 | Ga0495593_0000007 | 3300047673 | Bacteria | 87657 |
| 753 | Ga0495593_0053018 | 3300047673 | Bacteria | 2141 |
| 754 | Ga0495593_0109969 | 3300047673 | Bacteria | 1408 |
| 755 | Ga0495602_0046224 | 3300048088 | Bacteria | 3934 |
| 756 | Ga0495602_0064510 | 3300048088 | Bacteria | 3166 |
| 757 | Ga0495602_0262997 | 3300048088 | Bacteria | 1279 |
| 758 | Ga0495614_0064488 | 3300048089 | Bacteria | 1575 |
| 759 | Ga0496100_0001439 | 3300048903 | Bacteria | 11651 |
| 760 | Ga0496100_0042849 | 3300048903 | Bacteria | 2892 |
| 761 | Ga0496101_0000171 | 3300048904 | Bacteria | 53757 |
| 762 | Ga0496101_0014780 | 3300048904 | Bacteria | 5251 |
| 763 | Ga0496101_0067795 | 3300048904 | Bacteria | 2606 |
| 764 | Ga0496101_0097188 | 3300048904 | Bacteria | 2199 |
| 765 | Ga0496101_0106117 | 3300048904 | Bacteria | 2109 |
| 766 | Ga0496101_0198928 | 3300048904 | Bacteria | 1548 |
| 767 | Ga0496102_0004728 | 3300048905 | Bacteria | 11530 |
| 768 | Ga0496102_0062018 | 3300048905 | Bacteria | 3423 |
| 769 | Ga0496102_0072433 | 3300048905 | Bacteria | 3166 |
| 770 | Ga0496102_0170807 | 3300048905 | Bacteria | 2047 |
| 771 | Ga0496103_0001994 | 3300048906 | Bacteria | 13160 |
| 772 | Ga0496103_0033981 | 3300048906 | Bacteria | 3117 |
| 773 | Ga0496103_0051430 | 3300048906 | Bacteria | 2550 |
| 774 | Ga0496103_0130948 | 3300048906 | Bacteria | 1602 |
| 775 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 776 | Ga0496104_0086181 | 3300048907 | Bacteria | 2998 |
| 777 | Ga0496104_0226813 | 3300048907 | Bacteria | 1780 |
| 778 | Ga0496104_0255365 | 3300048907 | Bacteria | 1665 |
| 779 | Ga0496104_0313519 | 3300048907 | Bacteria | 1481 |
| 780 | Ga0496104_0324287 | 3300048907 | Bacteria | 1453 |
| 781 | Ga0496105_0000130 | 3300048908 | Bacteria | 50576 |
| 782 | Ga0496105_0016996 | 3300048908 | Bacteria | 5822 |
| 783 | Ga0496105_0086060 | 3300048908 | Bacteria | 2597 |
| 784 | Ga0496106_0000581 | 3300048909 | Bacteria | 26118 |
| 785 | Ga0496106_0031601 | 3300048909 | Bacteria | 3946 |
| 786 | Ga0496106_0107536 | 3300048909 | Bacteria | 2169 |
| 787 | Ga0496106_0145671 | 3300048909 | Bacteria | 1865 |
| 788 | Ga0496107_0000224 | 3300048910 | Bacteria | 29999 |
| 789 | Ga0496107_0016922 | 3300048910 | Bacteria | 5126 |
| 790 | Ga0496108_0000547 | 3300048911 | Bacteria | 29390 |
| 791 | Ga0496108_0031606 | 3300048911 | Bacteria | 4393 |
| 792 | Ga0496108_0051587 | 3300048911 | Bacteria | 3446 |
| 793 | Ga0496108_0071071 | 3300048911 | Bacteria | 2936 |
| 794 | Ga0496108_0153649 | 3300048911 | Bacteria | 1986 |
| 795 | Ga0496109_0000384 | 3300048912 | Bacteria | 40091 |
| 796 | Ga0496109_0014332 | 3300048912 | Bacteria | 6898 |
| 797 | Ga0496109_0045791 | 3300048912 | Bacteria | 3971 |
| 798 | Ga0496109_0173137 | 3300048912 | Bacteria | 2025 |
| 799 | Ga0496109_0449569 | 3300048912 | Bacteria | 1217 |
| 800 | Ga0496109_0605465 | 3300048912 | Bacteria | 1032 |
| 801 | Ga0496110_0008712 | 3300048913 | Bacteria | 8169 |
| 802 | Ga0496110_0018951 | 3300048913 | Bacteria | 5782 |
| 803 | Ga0496110_0101203 | 3300048913 | Bacteria | 2583 |
| 804 | Ga0496111_0005888 | 3300048914 | Bacteria | 7904 |
| 805 | Ga0496111_0081880 | 3300048914 | Bacteria | 2357 |
| 806 | Ga0496111_0227857 | 3300048914 | Bacteria | 1384 |
| 807 | Ga0496112_0087114 | 3300048915 | Bacteria | 3090 |
| 808 | Ga0496112_0095365 | 3300048915 | Bacteria | 2945 |
| 809 | Ga0496112_0226817 | 3300048915 | Bacteria | 1823 |
| 810 | Ga0496113_0122603 | 3300048916 | Bacteria | 2033 |
| 811 | Ga0496114_0004538 | 3300048917 | Bacteria | 10780 |
| 812 | Ga0496114_0009885 | 3300048917 | Bacteria | 7582 |
| 813 | Ga0496114_0027436 | 3300048917 | Bacteria | 4665 |
| 814 | Ga0496114_0061841 | 3300048917 | Bacteria | 3133 |
| 815 | Ga0496114_0346705 | 3300048917 | Bacteria | 1313 |
| 816 | Ga0496115_0000826 | 3300048918 | Bacteria | 22686 |
| 817 | Ga0496115_0115152 | 3300048918 | Bacteria | 2210 |
| 818 | Ga0496117_0053499 | 3300048920 | Bacteria | 2836 |
| 819 | Ga0496118_0027463 | 3300048921 | Bacteria | 4816 |
| 820 | Ga0496119_0048946 | 3300048922 | Bacteria | 2617 |
| 821 | Ga0496121_0003211 | 3300048924 | Bacteria | 23523 |
| 822 | Ga0496121_0039220 | 3300048924 | Bacteria | 4179 |
| 823 | Ga0496121_0046169 | 3300048924 | Bacteria | 3731 |
| 824 | Ga0496121_0048197 | 3300048924 | Bacteria | 3627 |
| 825 | Ga0496121_0161441 | 3300048924 | Bacteria | 1638 |
| 826 | Ga0496121_0247341 | 3300048924 | Bacteria | 1239 |
| 827 | Ga0496125_0019978 | 3300048928 | Bacteria | 6298 |
| 828 | Ga0496125_0108084 | 3300048928 | Bacteria | 2025 |
| 829 | Ga0496125_0116572 | 3300048928 | Bacteria | 1918 |
| 830 | Ga0496126_0027170 | 3300048929 | Bacteria | 5471 |
| 831 | Ga0496126_0030950 | 3300048929 | Bacteria | 5062 |
| 832 | Ga0496126_0040378 | 3300048929 | Bacteria | 4325 |
| 833 | Ga0496126_0060648 | 3300048929 | Bacteria | 3401 |
| 834 | Ga0496126_0157417 | 3300048929 | Bacteria | 1943 |
| 835 | Ga0495678_079984 | 3300049459 | Bacteria | 1176 |
| 836 | Ga0495682_0105118 | 3300049460 | Bacteria | 1012 |
| 837 | Ga0501031_0004917 | 3300049568 | Bacteria | 8682 |
| 838 | Ga0501031_0013835 | 3300049568 | Bacteria | 5257 |
| 839 | Ga0501032_0152192 | 3300049569 | Bacteria | 1520 |
| 840 | Ga0501032_0177883 | 3300049569 | Bacteria | 1393 |
| 841 | Ga0501033_0018842 | 3300049570 | Bacteria | 5219 |
| 842 | Ga0501034_0000374 | 3300049571 | Bacteria | 76280 |
| 843 | Ga0501034_0044836 | 3300049571 | Bacteria | 4470 |
| 844 | Ga0501034_0082021 | 3300049571 | Bacteria | 3227 |
| 845 | Ga0501034_0213838 | 3300049571 | Bacteria | 1882 |
| 846 | Ga0501037_0042826 | 3300049573 | Bacteria | 3327 |
| 847 | Ga0501037_0050928 | 3300049573 | Bacteria | 3029 |
| 848 | Ga0501037_0156941 | 3300049573 | Bacteria | 1623 |
| 849 | Ga0501037_0180327 | 3300049573 | Bacteria | 1498 |
| 850 | Ga0501038_0008546 | 3300049574 | Bacteria | 9402 |
| 851 | Ga0501038_0027921 | 3300049574 | Bacteria | 5015 |
| 852 | Ga0501038_0056927 | 3300049574 | Bacteria | 3357 |
| 853 | Ga0501038_0076965 | 3300049574 | Bacteria | 2817 |
| 854 | Ga0501039_0066565 | 3300049575 | Bacteria | 2796 |
| 855 | Ga0501039_0085658 | 3300049575 | Bacteria | 2454 |
| 856 | Ga0501042_0000540 | 3300049578 | Bacteria | 19832 |
| 857 | Ga0501043_0064916 | 3300049579 | Bacteria | 2866 |
| 858 | Ga0501047_0026583 | 3300049581 | Bacteria | 5569 |
| 859 | Ga0501047_0131910 | 3300049581 | Bacteria | 2378 |
| 860 | Ga0501047_0211521 | 3300049581 | Bacteria | 1798 |
| 861 | Ga0501047_0337754 | 3300049581 | Bacteria | 1344 |
| 862 | Ga0501048_0004376 | 3300049582 | Bacteria | 10754 |
| 863 | Ga0501048_0028790 | 3300049582 | Bacteria | 4032 |
| 864 | Ga0501067_0016188 | 3300049583 | Bacteria | 4121 |
| 865 | Ga0501067_0113207 | 3300049583 | Bacteria | 1509 |
| 866 | Ga0501068_0003581 | 3300049584 | Bacteria | 8390 |
| 867 | Ga0501068_0060938 | 3300049584 | Bacteria | 2291 |
| 868 | Ga0501070_0011451 | 3300049586 | Bacteria | 7494 |
| 869 | Ga0501070_0048479 | 3300049586 | Bacteria | 3528 |
| 870 | Ga0501070_0054294 | 3300049586 | Bacteria | 3323 |
| 871 | Ga0501070_0097039 | 3300049586 | Bacteria | 2438 |
| 872 | Ga0501070_0109225 | 3300049586 | Bacteria | 2285 |
| 873 | Ga0501070_0207521 | 3300049586 | Bacteria | 1609 |
| 874 | Ga0501070_0446074 | 3300049586 | Bacteria | 1043 |
| 875 | Ga0501071_0005036 | 3300049587 | Bacteria | 8452 |
| 876 | Ga0501071_0038623 | 3300049587 | Bacteria | 3412 |
| 877 | Ga0501071_0083933 | 3300049587 | Bacteria | 2334 |
| 878 | Ga0501073_0030477 | 3300049589 | Bacteria | 3851 |
| 879 | Ga0501073_0052182 | 3300049589 | Bacteria | 2863 |
| 880 | Ga0501074_0091026 | 3300049590 | Bacteria | 2184 |
| 881 | Ga0501074_0100324 | 3300049590 | Bacteria | 2072 |
| 882 | Ga0501077_0204245 | 3300049593 | Bacteria | 1255 |
| 883 | Ga0501079_0004156 | 3300049741 | Bacteria | 10725 |
| 884 | Ga0501079_0201545 | 3300049741 | Bacteria | 1554 |
| 885 | Ga0501080_0028227 | 3300049742 | Bacteria | 5218 |
| 886 | Ga0501080_0113590 | 3300049742 | Bacteria | 2511 |
| 887 | Ga0501080_0266947 | 3300049742 | Bacteria | 1558 |
| 888 | Ga0501083_0009046 | 3300049744 | Bacteria | 7032 |
| 889 | Ga0501083_0081573 | 3300049744 | Bacteria | 2144 |
| 890 | Ga0501083_0098641 | 3300049744 | Bacteria | 1927 |
| 891 | Ga0501083_0147005 | 3300049744 | Bacteria | 1543 |
| 892 | Ga0501035_0000859 | 3300049822 | Bacteria | 32391 |
| 893 | Ga0501035_0148087 | 3300049822 | Bacteria | 2038 |
| 894 | Ga0501044_0128910 | 3300049823 | Bacteria | 2525 |
| 895 | Ga0501044_0210315 | 3300049823 | Bacteria | 1899 |
| 896 | Ga0501044_0321533 | 3300049823 | Bacteria | 1471 |
| 897 | Ga0501044_0406915 | 3300049823 | Bacteria | 1272 |
| 898 | Ga0501045_0028721 | 3300049824 | Bacteria | 4013 |
| 899 | Ga0501045_0239732 | 3300049824 | Bacteria | 1350 |
| 900 | nmdc:mga03683_132339_c1 | 3300050489 | Bacteria | 1116 |
| 901 | nmdc:mga03683_25287_c1 | 3300050489 | Bacteria | 2330 |
| 902 | nmdc:mga03n38_63288_c1 | 3300050490 | Bacteria | 1690 |
| 903 | nmdc:mga0yw44_141276_c1 | 3300050492 | Bacteria | 1565 |
| 904 | nmdc:mga06z11_12623_c1 | 3300050494 | Bacteria | 3680 |
| 905 | nmdc:mga04h51_8061_c1 | 3300050495 | Bacteria | 2806 |
| 906 | nmdc:mga0qj67_43999_c1 | 3300050509 | Bacteria | 3517 |
| 907 | nmdc:mga08y16_203714_c1 | 3300050511 | Bacteria | 2050 |
| 908 | nmdc:mga08y16_257184_c1 | 3300050511 | Bacteria | 1804 |
| 909 | nmdc:mga0n895_165280_c1 | 3300050512 | Bacteria | 2245 |
| 910 | nmdc:mga0n895_744324_c1 | 3300050512 | Bacteria | 974 |
| 911 | nmdc:mga0rr50_258245_c1 | 3300050513 | Bacteria | 1449 |
| 912 | nmdc:mga08x19_180973_c1 | 3300050514 | Bacteria | 1439 |
| 913 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 914 | nmdc:mga08x19_88601_c1 | 3300050514 | Bacteria | 2040 |
| 915 | Ga0495601_0000237 | 3300053077 | Bacteria | 29469 |
| 916 | Ga0495601_0003203 | 3300053077 | Bacteria | 9363 |
| 917 | Ga0495601_0011542 | 3300053077 | Bacteria | 5291 |
| 918 | Ga0495601_0019726 | 3300053077 | Bacteria | 4115 |
| 919 | Ga0495612_0000563 | 3300053078 | Bacteria | 14886 |
| 920 | Ga0495612_0003858 | 3300053078 | Bacteria | 6224 |
| 921 | Ga0495612_0011052 | 3300053078 | Bacteria | 3644 |
| 922 | Ga0495612_0025831 | 3300053078 | Bacteria | 2359 |
| 923 | Ga0495612_0029435 | 3300053078 | Bacteria | 2212 |
| 924 | Ga0495655_0021718 | 3300053083 | Bacteria | 1457 |
| 925 | Ga0495595_0006203 | 3300053084 | Bacteria | 4864 |
| 926 | Ga0495595_0008416 | 3300053084 | Bacteria | 4231 |
| 927 | Ga0495595_0022604 | 3300053084 | Bacteria | 2761 |
| 928 | Ga0495595_0232034 | 3300053084 | Bacteria | 922 |
| 929 | Ga0495619_0000343 | 3300053085 | Bacteria | 32522 |
| 930 | Ga0495619_0006532 | 3300053085 | Bacteria | 7381 |
| 931 | Ga0495619_0006775 | 3300053085 | Bacteria | 7246 |
| 932 | Ga0495619_0279132 | 3300053085 | Bacteria | 1157 |
| 933 | Ga0500595_001229 | 3300053119 | Bacteria | 14141 |
| 934 | Ga0500577_0016765 | 3300053142 | Bacteria | 2318 |
| 935 | Ga0500577_0079634 | 3300053142 | Bacteria | 1303 |
| 936 | Ga0500588_0041124 | 3300053146 | Bacteria | 1393 |
| 937 | Ga0500589_096076 | 3300053147 | Bacteria | 1295 |
| 938 | Ga0501084_0153751 | 3300054114 | Bacteria | 1940 |
| 939 | Ga0501084_0259381 | 3300054114 | Bacteria | 1467 |
| 940 | Ga0501082_0049053 | 3300060353 | Bacteria | 3640 |
| 941 | Ga0501082_0049262 | 3300060353 | Bacteria | 3632 |
| 942 | Ga0501082_0547648 | 3300060353 | Bacteria | 1012 |
| 943 | Ga0466962_0161774 | 3300061719 | Bacteria | 1088 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_1403845 | Ga0451807_1403845_371_1087 | 236 |
| 2 | 3300046514 | Ga0495618_0002089 | Ga0495618_0002089_6239_7081 | 244 |
| 3 | 3300046642 | Ga0495634_0006489 | Ga0495634_0006489_1950_2792 | 244 |
| 4 | 3300003214 | JGI25165J46597_1006892 | JGI25165J46597_10068922 | 266 |
| 5 | 3300025261 | Ga0209233_1020069 | Ga0209233_10200692 | 266 |
| 6 | 3300042004 | Ga0439445_0045246 | Ga0439445_0045246_39_851 | 266 |
| 7 | 3300046517 | Ga0495630_0565085 | Ga0495630_0565085_37_852 | 270 |
| 8 | 3300003320 | rootH2_10046910 | rootH2_100469105 | 272 |
| 9 | 3300033442 | Ga0315911_1000008 | Ga0315911_1000008213 | 272 |
| 10 | 3300046524 | Ga0495648_0069726 | Ga0495648_0069726_638_1459 | 272 |
| 11 | 3300053078 | Ga0495612_0029435 | Ga0495612_0029435_470_1309 | 278 |
| 12 | 3300041452 | Ga0451793_1659208 | Ga0451793_1659208_410_1267 | 282 |
| 13 | 3300041486 | Ga0451807_0850701 | Ga0451807_0850701_209_1066 | 282 |
| 14 | 3300005471 | Ga0070698_100183770 | Ga0070698_1001837703 | 283 |
| 15 | 3300047317 | Ga0495604_0028443 | Ga0495604_0028443_2373_3239 | 283 |
| 16 | 3300049744 | Ga0501083_0098641 | Ga0501083_0098641_417_1331 | 284 |
| 17 | 3300005563 | Ga0068855_100000244 | Ga0068855_1000002449 | 285 |
| 18 | 3300025949 | Ga0207667_10000392 | Ga0207667_1000039228 | 285 |
| 19 | 3300031730 | Ga0307516_10090465 | Ga0307516_100904653 | 285 |
| 20 | 3300003320 | rootH2_10045331 | rootH2_100453311 | 286 |
| 21 | 3300005436 | Ga0070713_100219622 | Ga0070713_1002196221 | 286 |
| 22 | 3300049581 | Ga0501047_0026583 | Ga0501047_0026583_724_1611 | 286 |
| 23 | 3300049823 | Ga0501044_0321533 | Ga0501044_0321533_486_1373 | 286 |
| 24 | 3300046491 | Ga0495584_0103335 | Ga0495584_0103335_90_974 | 287 |
| 25 | 3300049586 | Ga0501070_0011451 | Ga0501070_0011451_5247_6134 | 288 |
| 26 | iso_pu_bacteria | 2744054611 | 2744955300 | 288 |
| 27 | 3300044694 | Ga0466963_0091246 | Ga0466963_0091246_416_1285 | 289 |
| 28 | iso_pu_bacteria | 2513237104 | 2513718143 | 289 |
| 29 | iso_pu_bacteria | 2513237137 | 2513863320 | 289 |
| 30 | iso_pu_bacteria | 2513237145 | 2513922584 | 289 |
| 31 | iso_pu_bacteria | 2517572143 | 2517888934 | 289 |
| 32 | iso_pu_bacteria | 2524023210 | 2524466953 | 289 |
| 33 | iso_pu_bacteria | 2721755755 | 2723841718 | 289 |
| 34 | iso_pu_bacteria | 2791355199 | 2793080847 | 289 |
| 35 | iso_pu_bacteria | 2876808645 | 2876808980 | 289 |
| 36 | iso_pu_bacteria | 2879110137 | 2879113420 | 289 |
| 37 | iso_pu_bacteria | 2881665667 | 2881668106 | 289 |
| 38 | iso_pu_bacteria | 2885383462 | 2885390396 | 289 |
| 39 | iso_pu_bacteria | 2904699407 | 2904708538 | 289 |
| 40 | iso_pu_bacteria | 2906610324 | 2906613985 | 289 |
| 41 | iso_pu_bacteria | 2908739725 | 2908747539 | 289 |
| 42 | iso_pu_bacteria | 2922386360 | 2922392503 | 289 |
| 43 | iso_pu_bacteria | 2935630451 | 2935637048 | 289 |
| 44 | iso_pu_bacteria | 2941507105 | 2941513685 | 289 |
| 45 | iso_pu_bacteria | 2941515067 | 2941521648 | 289 |
| 46 | iso_pu_bacteria | 2941523033 | 2941529403 | 289 |
| 47 | iso_pu_bacteria | 8006933436 | 8006936119 | 289 |
| 48 | iso_pu_bacteria | 8006964411 | 8006967536 | 289 |
| 49 | iso_pu_bacteria | 8006973647 | 8006976046 | 289 |
| 50 | iso_pu_bacteria | 8006984368 | 8006990999 | 289 |
| 51 | iso_pu_bacteria | 8056681323 | 8056687156 | 289 |
| 52 | iso_pu_bacteria | 8056689827 | 8056691034 | 289 |
| 53 | 3300021384 | Ga0213876_10005419 | Ga0213876_100054193 | 290 |
| 54 | 3300032005 | Ga0307411_10334840 | Ga0307411_103348402 | 290 |
| 55 | 3300039437 | Ga0436365_1148686 | Ga0436365_1148686_11724_12596 | 290 |
| 56 | 3300049571 | Ga0501034_0000374 | Ga0501034_0000374_37121_37993 | 290 |
| 57 | 3300049586 | Ga0501070_0097039 | Ga0501070_0097039_615_1487 | 290 |
| 58 | 3300049742 | Ga0501080_0113590 | Ga0501080_0113590_1501_2373 | 290 |
| 59 | 3300049744 | Ga0501083_0081573 | Ga0501083_0081573_286_1158 | 290 |
| 60 | 3300060353 | Ga0501082_0547648 | Ga0501082_0547648_23_895 | 290 |
| 61 | iso_pu_bacteria | 2643221547 | 2643758171 | 290 |
| 62 | 3300039450 | Ga0436363_0927837 | Ga0436363_0927837_875_1783 | 291 |
| 63 | 3300005343 | Ga0070687_100323504 | Ga0070687_1003235041 | 292 |
| 64 | 3300031595 | Ga0265313_10055574 | Ga0265313_100555743 | 292 |
| 65 | 3300001989 | JGI24739J22299_10000897 | JGI24739J22299_100008974 | 293 |
| 66 | 3300001990 | JGI24737J22298_10009404 | JGI24737J22298_100094045 | 293 |
| 67 | 3300002067 | JGI24735J21928_10003487 | JGI24735J21928_100034872 | 293 |
| 68 | 3300003215 | JGI25153J46596_10038430 | JGI25153J46596_100384302 | 293 |
| 69 | 3300003354 | JGI25160J50197_1014601 | JGI25160J50197_10146013 | 293 |
| 70 | 3300005328 | Ga0070676_10068867 | Ga0070676_100688673 | 293 |
| 71 | 3300005336 | Ga0070680_100012038 | Ga0070680_1000120383 | 293 |
| 72 | 3300005339 | Ga0070660_100003272 | Ga0070660_10000327211 | 293 |
| 73 | 3300005344 | Ga0070661_100127357 | Ga0070661_1001273572 | 293 |
| 74 | 3300005347 | Ga0070668_100051792 | Ga0070668_1000517923 | 293 |
| 75 | 3300005356 | Ga0070674_100213607 | Ga0070674_1002136072 | 293 |
| 76 | 3300005364 | Ga0070673_100134138 | Ga0070673_1001341382 | 293 |
| 77 | 3300005366 | Ga0070659_100108095 | Ga0070659_1001080951 | 293 |
| 78 | 3300005366 | Ga0070659_100115234 | Ga0070659_1001152342 | 293 |
| 79 | 3300005366 | Ga0070659_100159673 | Ga0070659_1001596731 | 293 |
| 80 | 3300005435 | Ga0070714_100103577 | Ga0070714_1001035774 | 293 |
| 81 | 3300005435 | Ga0070714_100256895 | Ga0070714_1002568952 | 293 |
| 82 | 3300005436 | Ga0070713_100043089 | Ga0070713_1000430895 | 293 |
| 83 | 3300005439 | Ga0070711_100172289 | Ga0070711_1001722892 | 293 |
| 84 | 3300005440 | Ga0070705_100341336 | Ga0070705_1003413361 | 293 |
| 85 | 3300005441 | Ga0070700_100107815 | Ga0070700_1001078151 | 293 |
| 86 | 3300005456 | Ga0070678_100025297 | Ga0070678_1000252974 | 293 |
| 87 | 3300005456 | Ga0070678_100227291 | Ga0070678_1002272912 | 293 |
| 88 | 3300005457 | Ga0070662_100090457 | Ga0070662_1000904574 | 293 |
| 89 | 3300005457 | Ga0070662_100220942 | Ga0070662_1002209422 | 293 |
| 90 | 3300005471 | Ga0070698_100108778 | Ga0070698_1001087782 | 293 |
| 91 | 3300005518 | Ga0070699_100078736 | Ga0070699_1000787362 | 293 |
| 92 | 3300005530 | Ga0070679_100026893 | Ga0070679_1000268935 | 293 |
| 93 | 3300005544 | Ga0070686_100272537 | Ga0070686_1002725371 | 293 |
| 94 | 3300005548 | Ga0070665_100146816 | Ga0070665_1001468162 | 293 |
| 95 | 3300005563 | Ga0068855_100040189 | Ga0068855_1000401897 | 293 |
| 96 | 3300005563 | Ga0068855_100047984 | Ga0068855_1000479847 | 293 |
| 97 | 3300005563 | Ga0068855_100059558 | Ga0068855_1000595582 | 293 |
| 98 | 3300005563 | Ga0068855_100129068 | Ga0068855_1001290684 | 293 |
| 99 | 3300005563 | Ga0068855_100245280 | Ga0068855_1002452803 | 293 |
| 100 | 3300005564 | Ga0070664_100263518 | Ga0070664_1002635182 | 293 |
| 101 | 3300005577 | Ga0068857_100018470 | Ga0068857_1000184706 | 293 |
| 102 | 3300005577 | Ga0068857_100160864 | Ga0068857_1001608643 | 293 |
| 103 | 3300005577 | Ga0068857_100751487 | Ga0068857_1007514871 | 293 |
| 104 | 3300005614 | Ga0068856_100069733 | Ga0068856_1000697334 | 293 |
| 105 | 3300005614 | Ga0068856_100103133 | Ga0068856_1001031332 | 293 |
| 106 | 3300005614 | Ga0068856_100120811 | Ga0068856_1001208113 | 293 |
| 107 | 3300005718 | Ga0068866_10097364 | Ga0068866_100973642 | 293 |
| 108 | 3300005719 | Ga0068861_100036887 | Ga0068861_1000368873 | 293 |
| 109 | 3300005719 | Ga0068861_100099380 | Ga0068861_1000993802 | 293 |
| 110 | 3300005842 | Ga0068858_100138508 | Ga0068858_1001385085 | 293 |
| 111 | 3300005843 | Ga0068860_100105682 | Ga0068860_1001056822 | 293 |
| 112 | 3300005844 | Ga0068862_100039735 | Ga0068862_1000397354 | 293 |
| 113 | 3300005844 | Ga0068862_100500322 | Ga0068862_1005003222 | 293 |
| 114 | 3300005937 | Ga0081455_10011795 | Ga0081455_1001179510 | 293 |
| 115 | 3300005937 | Ga0081455_10075776 | Ga0081455_100757762 | 293 |
| 116 | 3300005981 | Ga0081538_10149572 | Ga0081538_101495721 | 293 |
| 117 | 3300005983 | Ga0081540_1004206 | Ga0081540_10042064 | 293 |
| 118 | 3300005985 | Ga0081539_10018244 | Ga0081539_100182445 | 293 |
| 119 | 3300006042 | Ga0075368_10010605 | Ga0075368_100106053 | 293 |
| 120 | 3300006051 | Ga0075364_10142245 | Ga0075364_101422453 | 293 |
| 121 | 3300006175 | Ga0070712_100031650 | Ga0070712_1000316505 | 293 |
| 122 | 3300006175 | Ga0070712_100132686 | Ga0070712_1001326863 | 293 |
| 123 | 3300006178 | Ga0075367_10153160 | Ga0075367_101531602 | 293 |
| 124 | 3300006186 | Ga0075369_10061791 | Ga0075369_100617912 | 293 |
| 125 | 3300006353 | Ga0075370_10034531 | Ga0075370_100345312 | 293 |
| 126 | 3300006353 | Ga0075370_10146369 | Ga0075370_101463692 | 293 |
| 127 | 3300006358 | Ga0068871_100053613 | Ga0068871_1000536135 | 293 |
| 128 | 3300006871 | Ga0075434_100095961 | Ga0075434_1000959615 | 293 |
| 129 | 3300006881 | Ga0068865_100357595 | Ga0068865_1003575952 | 293 |
| 130 | 3300009093 | Ga0105240_10004853 | Ga0105240_1000485318 | 293 |
| 131 | 3300009093 | Ga0105240_10559793 | Ga0105240_105597932 | 293 |
| 132 | 3300009094 | Ga0111539_10329681 | Ga0111539_103296812 | 293 |
| 133 | 3300009098 | Ga0105245_10152826 | Ga0105245_101528262 | 293 |
| 134 | 3300009098 | Ga0105245_10512549 | Ga0105245_105125491 | 293 |
| 135 | 3300009101 | Ga0105247_10266445 | Ga0105247_102664451 | 293 |
| 136 | 3300009101 | Ga0105247_10348041 | Ga0105247_103480412 | 293 |
| 137 | 3300009148 | Ga0105243_10130712 | Ga0105243_101307122 | 293 |
| 138 | 3300009174 | Ga0105241_10060625 | Ga0105241_100606252 | 293 |
| 139 | 3300009176 | Ga0105242_10221084 | Ga0105242_102210843 | 293 |
| 140 | 3300009177 | Ga0105248_10038164 | Ga0105248_100381647 | 293 |
| 141 | 3300009545 | Ga0105237_10044970 | Ga0105237_100449706 | 293 |
| 142 | 3300009545 | Ga0105237_10112288 | Ga0105237_101122881 | 293 |
| 143 | 3300009545 | Ga0105237_10151426 | Ga0105237_101514263 | 293 |
| 144 | 3300009551 | Ga0105238_10027365 | Ga0105238_100273656 | 293 |
| 145 | 3300009551 | Ga0105238_10111585 | Ga0105238_101115854 | 293 |
| 146 | 3300009553 | Ga0105249_10231262 | Ga0105249_102312624 | 293 |
| 147 | 3300010375 | Ga0105239_10011468 | Ga0105239_1001146810 | 293 |
| 148 | 3300013296 | Ga0157374_10065714 | Ga0157374_100657145 | 293 |
| 149 | 3300013297 | Ga0157378_10365575 | Ga0157378_103655752 | 293 |
| 150 | 3300013307 | Ga0157372_10054142 | Ga0157372_100541423 | 293 |
| 151 | 3300013307 | Ga0157372_10124519 | Ga0157372_101245193 | 293 |
| 152 | 3300013308 | Ga0157375_10625201 | Ga0157375_106252011 | 293 |
| 153 | 3300014326 | Ga0157380_10309619 | Ga0157380_103096193 | 293 |
| 154 | 3300017792 | Ga0163161_10303267 | Ga0163161_103032671 | 293 |
| 155 | 3300020082 | Ga0206353_10552086 | Ga0206353_105520862 | 293 |
| 156 | 3300025297 | Ga0209758_1000616 | Ga0209758_10006168 | 293 |
| 157 | 3300025302 | Ga0207426_1000420 | Ga0207426_10004204 | 293 |
| 158 | 3300025900 | Ga0207710_10164322 | Ga0207710_101643221 | 293 |
| 159 | 3300025901 | Ga0207688_10093665 | Ga0207688_100936652 | 293 |
| 160 | 3300025901 | Ga0207688_10308730 | Ga0207688_103087301 | 293 |
| 161 | 3300025904 | Ga0207647_10001753 | Ga0207647_100017536 | 293 |
| 162 | 3300025913 | Ga0207695_10038814 | Ga0207695_100388147 | 293 |
| 163 | 3300025913 | Ga0207695_10399314 | Ga0207695_103993142 | 293 |
| 164 | 3300025914 | Ga0207671_10031026 | Ga0207671_100310263 | 293 |
| 165 | 3300025914 | Ga0207671_10152873 | Ga0207671_101528732 | 293 |
| 166 | 3300025915 | Ga0207693_10017047 | Ga0207693_100170474 | 293 |
| 167 | 3300025915 | Ga0207693_10206099 | Ga0207693_102060993 | 293 |
| 168 | 3300025916 | Ga0207663_10147759 | Ga0207663_101477592 | 293 |
| 169 | 3300025919 | Ga0207657_10004676 | Ga0207657_1000467611 | 293 |
| 170 | 3300025920 | Ga0207649_10139493 | Ga0207649_101394931 | 293 |
| 171 | 3300025921 | Ga0207652_10006960 | Ga0207652_100069605 | 293 |
| 172 | 3300025924 | Ga0207694_10086806 | Ga0207694_100868062 | 293 |
| 173 | 3300025924 | Ga0207694_10139021 | Ga0207694_101390213 | 293 |
| 174 | 3300025927 | Ga0207687_10020799 | Ga0207687_100207993 | 293 |
| 175 | 3300025928 | Ga0207700_10013859 | Ga0207700_100138596 | 293 |
| 176 | 3300025929 | Ga0207664_10042991 | Ga0207664_100429912 | 293 |
| 177 | 3300025931 | Ga0207644_10253326 | Ga0207644_102533262 | 293 |
| 178 | 3300025933 | Ga0207706_10004628 | Ga0207706_100046284 | 293 |
| 179 | 3300025933 | Ga0207706_10145008 | Ga0207706_101450081 | 293 |
| 180 | 3300025934 | Ga0207686_10162213 | Ga0207686_101622133 | 293 |
| 181 | 3300025940 | Ga0207691_10097584 | Ga0207691_100975843 | 293 |
| 182 | 3300025945 | Ga0207679_10131260 | Ga0207679_101312604 | 293 |
| 183 | 3300025945 | Ga0207679_10305927 | Ga0207679_103059271 | 293 |
| 184 | 3300025945 | Ga0207679_10416359 | Ga0207679_104163592 | 293 |
| 185 | 3300025949 | Ga0207667_10023513 | Ga0207667_100235137 | 293 |
| 186 | 3300025949 | Ga0207667_10106775 | Ga0207667_101067754 | 293 |
| 187 | 3300025949 | Ga0207667_10169337 | Ga0207667_101693372 | 293 |
| 188 | 3300025960 | Ga0207651_10094796 | Ga0207651_100947962 | 293 |
| 189 | 3300025960 | Ga0207651_10339791 | Ga0207651_103397912 | 293 |
| 190 | 3300025961 | Ga0207712_10257325 | Ga0207712_102573252 | 293 |
| 191 | 3300025986 | Ga0207658_10339899 | Ga0207658_103398991 | 293 |
| 192 | 3300026023 | Ga0207677_10107305 | Ga0207677_101073052 | 293 |
| 193 | 3300026035 | Ga0207703_10059566 | Ga0207703_100595665 | 293 |
| 194 | 3300026041 | Ga0207639_10074245 | Ga0207639_100742453 | 293 |
| 195 | 3300026067 | Ga0207678_10044346 | Ga0207678_100443463 | 293 |
| 196 | 3300026067 | Ga0207678_10066998 | Ga0207678_100669984 | 293 |
| 197 | 3300026067 | Ga0207678_10201644 | Ga0207678_102016441 | 293 |
| 198 | 3300026078 | Ga0207702_10034279 | Ga0207702_100342793 | 293 |
| 199 | 3300026078 | Ga0207702_10124924 | Ga0207702_101249243 | 293 |
| 200 | 3300026078 | Ga0207702_10174951 | Ga0207702_101749513 | 293 |
| 201 | 3300026089 | Ga0207648_10030687 | Ga0207648_100306872 | 293 |
| 202 | 3300026095 | Ga0207676_10255784 | Ga0207676_102557841 | 293 |
| 203 | 3300026116 | Ga0207674_10031314 | Ga0207674_100313147 | 293 |
| 204 | 3300026116 | Ga0207674_10190575 | Ga0207674_101905754 | 293 |
| 205 | 3300026116 | Ga0207674_10550757 | Ga0207674_105507571 | 293 |
| 206 | 3300026118 | Ga0207675_100048673 | Ga0207675_1000486733 | 293 |
| 207 | 3300026121 | Ga0207683_10080952 | Ga0207683_100809522 | 293 |
| 208 | 3300026121 | Ga0207683_10136341 | Ga0207683_101363412 | 293 |
| 209 | 3300026142 | Ga0207698_10074280 | Ga0207698_100742802 | 293 |
| 210 | 3300026142 | Ga0207698_10082670 | Ga0207698_100826702 | 293 |
| 211 | 3300027296 | Ga0209389_1000033 | Ga0209389_1000033108 | 293 |
| 212 | 3300027357 | Ga0209589_1000040 | Ga0209589_1000040108 | 293 |
| 213 | 3300027361 | Ga0209489_100045 | Ga0209489_100045120 | 293 |
| 214 | 3300028379 | Ga0268266_10002169 | Ga0268266_1000216910 | 293 |
| 215 | 3300028380 | Ga0268265_10106730 | Ga0268265_101067303 | 293 |
| 216 | 3300028380 | Ga0268265_10182536 | Ga0268265_101825362 | 293 |
| 217 | 3300028380 | Ga0268265_10672524 | Ga0268265_106725241 | 293 |
| 218 | 3300028381 | Ga0268264_10000062 | Ga0268264_10000062148 | 293 |
| 219 | 3300028786 | Ga0307517_10074981 | Ga0307517_100749812 | 293 |
| 220 | 3300028786 | Ga0307517_10204464 | Ga0307517_102044642 | 293 |
| 221 | 3300031241 | Ga0265325_10011173 | Ga0265325_100111732 | 293 |
| 222 | 3300031344 | Ga0265316_10087704 | Ga0265316_100877045 | 293 |
| 223 | 3300031456 | Ga0307513_10245025 | Ga0307513_102450253 | 293 |
| 224 | 3300031507 | Ga0307509_10134992 | Ga0307509_101349922 | 293 |
| 225 | 3300031548 | Ga0307408_100102075 | Ga0307408_1001020754 | 293 |
| 226 | 3300031595 | Ga0265313_10000008 | Ga0265313_1000000868 | 293 |
| 227 | 3300031595 | Ga0265313_10007635 | Ga0265313_100076359 | 293 |
| 228 | 3300031711 | Ga0265314_10003949 | Ga0265314_1000394910 | 293 |
| 229 | 3300031711 | Ga0265314_10068326 | Ga0265314_100683265 | 293 |
| 230 | 3300031712 | Ga0265342_10000912 | Ga0265342_1000091226 | 293 |
| 231 | 3300031903 | Ga0307407_10062753 | Ga0307407_100627532 | 293 |
| 232 | 3300032126 | Ga0307415_100198287 | Ga0307415_1001982871 | 293 |
| 233 | 3300033180 | Ga0307510_10010287 | Ga0307510_1001028712 | 293 |
| 234 | 3300035113 | Ga0373936_0003212 | Ga0373936_0003212_504_1388 | 293 |
| 235 | 3300035170 | Ga0373943_0002977 | Ga0373943_0002977_1448_2332 | 293 |
| 236 | 3300035171 | Ga0373946_0037007 | Ga0373946_0037007_149_1033 | 293 |
| 237 | 3300035172 | Ga0373955_0048173 | Ga0373955_0048173_948_1832 | 293 |
| 238 | 3300035241 | Ga0373961_0063469 | Ga0373961_0063469_91_975 | 293 |
| 239 | 3300035692 | Ga0373935_0000046 | Ga0373935_0000046_17449_18333 | 293 |
| 240 | 3300035695 | Ga0373927_0000209 | Ga0373927_0000209_5290_6174 | 293 |
| 241 | 3300035695 | Ga0373927_0182326 | Ga0373927_0182326_420_1304 | 293 |
| 242 | 3300035695 | Ga0373927_0373028 | Ga0373927_0373028_19_903 | 293 |
| 243 | 3300035724 | Ga0373933_0063278 | Ga0373933_0063278_136_1020 | 293 |
| 244 | 3300035725 | Ga0373947_0002886 | Ga0373947_0002886_4690_5574 | 293 |
| 245 | 3300035725 | Ga0373947_0296030 | Ga0373947_0296030_66_950 | 293 |
| 246 | 3300036401 | Ga0373937_0023444 | Ga0373937_0023444_1622_2506 | 293 |
| 247 | 3300036459 | Ga0372808_008217 | Ga0372808_008217_548_1432 | 293 |
| 248 | 3300037068 | Ga0373925_0005099 | Ga0373925_0005099_2314_3198 | 293 |
| 249 | 3300037068 | Ga0373925_0126389 | Ga0373925_0126389_159_1043 | 293 |
| 250 | 3300037418 | Ga0395900_0005151 | Ga0395900_0005151_7619_8503 | 293 |
| 251 | 3300037466 | Ga0395898_0003493 | Ga0395898_0003493_5279_6163 | 293 |
| 252 | 3300038443 | Ga0395901_0043590 | Ga0395901_0043590_1078_1962 | 293 |
| 253 | 3300039437 | Ga0436365_0911459 | Ga0436365_0911459_1254_2135 | 293 |
| 254 | 3300039437 | Ga0436365_1422081 | Ga0436365_1422081_1024_1905 | 293 |
| 255 | 3300041459 | Ga0451800_1674697 | Ga0451800_1674697_59_943 | 293 |
| 256 | 3300046452 | Ga0495617_053834 | Ga0495617_053834_413_1297 | 293 |
| 257 | 3300046455 | Ga0495603_0000153 | Ga0495603_0000153_21024_21908 | 293 |
| 258 | 3300046459 | Ga0495629_0007084 | Ga0495629_0007084_401_1285 | 293 |
| 259 | 3300046461 | Ga0495641_0008708 | Ga0495641_0008708_5127_6011 | 293 |
| 260 | 3300046462 | Ga0495651_0025967 | Ga0495651_0025967_1740_2624 | 293 |
| 261 | 3300046463 | Ga0495653_0105670 | Ga0495653_0105670_983_1867 | 293 |
| 262 | 3300046472 | Ga0495580_0000246 | Ga0495580_0000246_30657_31541 | 293 |
| 263 | 3300046473 | Ga0495582_0000686 | Ga0495582_0000686_17689_18573 | 293 |
| 264 | 3300046475 | Ga0495639_0000799 | Ga0495639_0000799_6162_7046 | 293 |
| 265 | 3300046476 | Ga0495662_0074205 | Ga0495662_0074205_287_1171 | 293 |
| 266 | 3300046477 | Ga0495664_0015494 | Ga0495664_0015494_781_1665 | 293 |
| 267 | 3300046477 | Ga0495664_0085121 | Ga0495664_0085121_101_985 | 293 |
| 268 | 3300046499 | Ga0495594_0000243 | Ga0495594_0000243_7460_8344 | 293 |
| 269 | 3300046499 | Ga0495594_0057740 | Ga0495594_0057740_912_1796 | 293 |
| 270 | 3300046507 | Ga0495606_0232159 | Ga0495606_0232159_17_901 | 293 |
| 271 | 3300046515 | Ga0495620_0019530 | Ga0495620_0019530_923_1807 | 293 |
| 272 | 3300046516 | Ga0495628_0054964 | Ga0495628_0054964_1323_2207 | 293 |
| 273 | 3300046517 | Ga0495630_0123501 | Ga0495630_0123501_932_1816 | 293 |
| 274 | 3300046519 | Ga0495632_0155594 | Ga0495632_0155594_31_915 | 293 |
| 275 | 3300046525 | Ga0495663_0020493 | Ga0495663_0020493_806_1690 | 293 |
| 276 | 3300046526 | Ga0495666_0100331 | Ga0495666_0100331_84_968 | 293 |
| 277 | 3300046529 | Ga0495652_0040789 | Ga0495652_0040789_164_1048 | 293 |
| 278 | 3300046531 | Ga0495665_0000341 | Ga0495665_0000341_16238_17122 | 293 |
| 279 | 3300046533 | Ga0495640_0000521 | Ga0495640_0000521_12197_13081 | 293 |
| 280 | 3300046535 | Ga0495586_0182752 | Ga0495586_0182752_120_1004 | 293 |
| 281 | 3300046538 | Ga0495609_0030375 | Ga0495609_0030375_1357_2241 | 293 |
| 282 | 3300046557 | Ga0495622_0011002 | Ga0495622_0011002_1348_2232 | 293 |
| 283 | 3300046559 | Ga0495667_0033180 | Ga0495667_0033180_238_1122 | 293 |
| 284 | 3300046559 | Ga0495667_0116845 | Ga0495667_0116845_532_1416 | 293 |
| 285 | 3300046615 | Ga0495656_0057004 | Ga0495656_0057004_403_1287 | 293 |
| 286 | 3300046615 | Ga0495656_0221867 | Ga0495656_0221867_20_904 | 293 |
| 287 | 3300046616 | Ga0495668_0194952 | Ga0495668_0194952_88_972 | 293 |
| 288 | 3300046648 | Ga0495611_0177172 | Ga0495611_0177172_58_942 | 293 |
| 289 | 3300046663 | Ga0495635_0000470 | Ga0495635_0000470_14126_15010 | 293 |
| 290 | 3300046674 | Ga0495588_0007378 | Ga0495588_0007378_1899_2783 | 293 |
| 291 | 3300046678 | Ga0495599_0125811 | Ga0495599_0125811_386_1270 | 293 |
| 292 | 3300046680 | Ga0495646_0014448 | Ga0495646_0014448_630_1514 | 293 |
| 293 | 3300046681 | Ga0495647_0002355 | Ga0495647_0002355_5031_5915 | 293 |
| 294 | 3300046681 | Ga0495647_0024406 | Ga0495647_0024406_883_1767 | 293 |
| 295 | 3300046683 | Ga0495658_0003407 | Ga0495658_0003407_4677_5561 | 293 |
| 296 | 3300046684 | Ga0495669_0018118 | Ga0495669_0018118_1633_2517 | 293 |
| 297 | 3300046690 | Ga0495624_0000144 | Ga0495624_0000144_4798_5682 | 293 |
| 298 | 3300046690 | Ga0495624_0231186 | Ga0495624_0231186_82_966 | 293 |
| 299 | 3300046691 | Ga0495670_0012052 | Ga0495670_0012052_2945_3829 | 293 |
| 300 | 3300046794 | Ga0495589_0022874 | Ga0495589_0022874_1443_2327 | 293 |
| 301 | 3300047315 | Ga0495581_0000223 | Ga0495581_0000223_17689_18573 | 293 |
| 302 | 3300047319 | Ga0495674_0000700 | Ga0495674_0000700_12645_13529 | 293 |
| 303 | 3300047321 | Ga0495676_0012616 | Ga0495676_0012616_747_1631 | 293 |
| 304 | 3300047321 | Ga0495676_0088961 | Ga0495676_0088961_1043_1927 | 293 |
| 305 | 3300047322 | Ga0495680_0133466 | Ga0495680_0133466_807_1691 | 293 |
| 306 | 3300047469 | Ga0495673_0045725 | Ga0495673_0045725_351_1235 | 293 |
| 307 | 3300047471 | Ga0495684_0019592 | Ga0495684_0019592_4269_5153 | 293 |
| 308 | 3300047472 | Ga0495686_0154635 | Ga0495686_0154635_247_1131 | 293 |
| 309 | 3300047673 | Ga0495593_0000007 | Ga0495593_0000007_46124_47008 | 293 |
| 310 | 3300048089 | Ga0495614_0064488 | Ga0495614_0064488_159_1043 | 293 |
| 311 | 3300048904 | Ga0496101_0097188 | Ga0496101_0097188_1193_2077 | 293 |
| 312 | 3300048904 | Ga0496101_0106117 | Ga0496101_0106117_440_1324 | 293 |
| 313 | 3300048905 | Ga0496102_0072433 | Ga0496102_0072433_1302_2186 | 293 |
| 314 | 3300048905 | Ga0496102_0170807 | Ga0496102_0170807_259_1143 | 293 |
| 315 | 3300048906 | Ga0496103_0130948 | Ga0496103_0130948_708_1592 | 293 |
| 316 | 3300048907 | Ga0496104_0324287 | Ga0496104_0324287_86_970 | 293 |
| 317 | 3300048908 | Ga0496105_0086060 | Ga0496105_0086060_1522_2406 | 293 |
| 318 | 3300048909 | Ga0496106_0031601 | Ga0496106_0031601_1822_2706 | 293 |
| 319 | 3300048912 | Ga0496109_0045791 | Ga0496109_0045791_2415_3299 | 293 |
| 320 | 3300048912 | Ga0496109_0605465 | Ga0496109_0605465_80_964 | 293 |
| 321 | 3300048913 | Ga0496110_0101203 | Ga0496110_0101203_960_1844 | 293 |
| 322 | 3300048914 | Ga0496111_0227857 | Ga0496111_0227857_94_978 | 293 |
| 323 | 3300048915 | Ga0496112_0095365 | Ga0496112_0095365_1825_2709 | 293 |
| 324 | 3300048917 | Ga0496114_0061841 | Ga0496114_0061841_1443_2327 | 293 |
| 325 | 3300048917 | Ga0496114_0346705 | Ga0496114_0346705_389_1285 | 293 |
| 326 | 3300048920 | Ga0496117_0053499 | Ga0496117_0053499_1644_2528 | 293 |
| 327 | 3300048921 | Ga0496118_0027463 | Ga0496118_0027463_3014_3898 | 293 |
| 328 | 3300048922 | Ga0496119_0048946 | Ga0496119_0048946_1349_2233 | 293 |
| 329 | 3300048924 | Ga0496121_0003211 | Ga0496121_0003211_11845_12729 | 293 |
| 330 | 3300048924 | Ga0496121_0039220 | Ga0496121_0039220_1996_2880 | 293 |
| 331 | 3300048924 | Ga0496121_0046169 | Ga0496121_0046169_1652_2536 | 293 |
| 332 | 3300048924 | Ga0496121_0048197 | Ga0496121_0048197_835_1719 | 293 |
| 333 | 3300048924 | Ga0496121_0161441 | Ga0496121_0161441_697_1581 | 293 |
| 334 | 3300048928 | Ga0496125_0019978 | Ga0496125_0019978_1145_2029 | 293 |
| 335 | 3300048928 | Ga0496125_0116572 | Ga0496125_0116572_474_1358 | 293 |
| 336 | 3300048929 | Ga0496126_0030950 | Ga0496126_0030950_2203_3087 | 293 |
| 337 | 3300048929 | Ga0496126_0040378 | Ga0496126_0040378_769_1653 | 293 |
| 338 | 3300048929 | Ga0496126_0060648 | Ga0496126_0060648_961_1845 | 293 |
| 339 | 3300049459 | Ga0495678_079984 | Ga0495678_079984_102_986 | 293 |
| 340 | 3300049460 | Ga0495682_0105118 | Ga0495682_0105118_36_920 | 293 |
| 341 | 3300049568 | Ga0501031_0004917 | Ga0501031_0004917_3851_4738 | 293 |
| 342 | 3300049568 | Ga0501031_0013835 | Ga0501031_0013835_577_1461 | 293 |
| 343 | 3300049569 | Ga0501032_0152192 | Ga0501032_0152192_178_1062 | 293 |
| 344 | 3300049569 | Ga0501032_0177883 | Ga0501032_0177883_440_1324 | 293 |
| 345 | 3300049570 | Ga0501033_0018842 | Ga0501033_0018842_275_1156 | 293 |
| 346 | 3300049571 | Ga0501034_0044836 | Ga0501034_0044836_2709_3590 | 293 |
| 347 | 3300049571 | Ga0501034_0082021 | Ga0501034_0082021_2313_3194 | 293 |
| 348 | 3300049571 | Ga0501034_0213838 | Ga0501034_0213838_74_958 | 293 |
| 349 | 3300049573 | Ga0501037_0042826 | Ga0501037_0042826_967_1854 | 293 |
| 350 | 3300049573 | Ga0501037_0156941 | Ga0501037_0156941_77_961 | 293 |
| 351 | 3300049573 | Ga0501037_0180327 | Ga0501037_0180327_312_1196 | 293 |
| 352 | 3300049574 | Ga0501038_0008546 | Ga0501038_0008546_685_1569 | 293 |
| 353 | 3300049574 | Ga0501038_0056927 | Ga0501038_0056927_1249_2133 | 293 |
| 354 | 3300049574 | Ga0501038_0076965 | Ga0501038_0076965_283_1170 | 293 |
| 355 | 3300049575 | Ga0501039_0066565 | Ga0501039_0066565_1030_1914 | 293 |
| 356 | 3300049578 | Ga0501042_0000540 | Ga0501042_0000540_4872_5756 | 293 |
| 357 | 3300049579 | Ga0501043_0064916 | Ga0501043_0064916_741_1625 | 293 |
| 358 | 3300049581 | Ga0501047_0337754 | Ga0501047_0337754_353_1237 | 293 |
| 359 | 3300049582 | Ga0501048_0004376 | Ga0501048_0004376_145_1029 | 293 |
| 360 | 3300049583 | Ga0501067_0016188 | Ga0501067_0016188_2186_3070 | 293 |
| 361 | 3300049584 | Ga0501068_0060938 | Ga0501068_0060938_141_1025 | 293 |
| 362 | 3300049586 | Ga0501070_0048479 | Ga0501070_0048479_568_1449 | 293 |
| 363 | 3300049586 | Ga0501070_0054294 | Ga0501070_0054294_1310_2191 | 293 |
| 364 | 3300049586 | Ga0501070_0207521 | Ga0501070_0207521_439_1332 | 293 |
| 365 | 3300049586 | Ga0501070_0446074 | Ga0501070_0446074_144_1028 | 293 |
| 366 | 3300049587 | Ga0501071_0038623 | Ga0501071_0038623_1231_2112 | 293 |
| 367 | 3300049587 | Ga0501071_0083933 | Ga0501071_0083933_1251_2135 | 293 |
| 368 | 3300049589 | Ga0501073_0052182 | Ga0501073_0052182_1097_1981 | 293 |
| 369 | 3300049590 | Ga0501074_0100324 | Ga0501074_0100324_235_1116 | 293 |
| 370 | 3300049593 | Ga0501077_0204245 | Ga0501077_0204245_312_1196 | 293 |
| 371 | 3300049741 | Ga0501079_0004156 | Ga0501079_0004156_5157_6041 | 293 |
| 372 | 3300049742 | Ga0501080_0028227 | Ga0501080_0028227_577_1461 | 293 |
| 373 | 3300049744 | Ga0501083_0009046 | Ga0501083_0009046_72_956 | 293 |
| 374 | 3300049822 | Ga0501035_0000859 | Ga0501035_0000859_14449_15441 | 293 |
| 375 | 3300049822 | Ga0501035_0148087 | Ga0501035_0148087_528_1412 | 293 |
| 376 | 3300049823 | Ga0501044_0128910 | Ga0501044_0128910_1061_1942 | 293 |
| 377 | 3300049823 | Ga0501044_0210315 | Ga0501044_0210315_530_1414 | 293 |
| 378 | 3300049823 | Ga0501044_0406915 | Ga0501044_0406915_148_1041 | 293 |
| 379 | 3300049824 | Ga0501045_0028721 | Ga0501045_0028721_1447_2331 | 293 |
| 380 | 3300050489 | nmdc:mga03683_25287_c1 | nmdc:mga03683_25287_c1_49_933 | 293 |
| 381 | 3300050490 | nmdc:mga03n38_63288_c1 | nmdc:mga03n38_63288_c1_527_1411 | 293 |
| 382 | 3300050492 | nmdc:mga0yw44_141276_c1 | nmdc:mga0yw44_141276_c1_34_918 | 293 |
| 383 | 3300050495 | nmdc:mga04h51_8061_c1 | nmdc:mga04h51_8061_c1_1749_2633 | 293 |
| 384 | 3300053077 | Ga0495601_0019726 | Ga0495601_0019726_3149_4030 | 293 |
| 385 | 3300053085 | Ga0495619_0279132 | Ga0495619_0279132_163_1044 | 293 |
| 386 | 3300053119 | Ga0500595_001229 | Ga0500595_001229_619_1503 | 293 |
| 387 | 3300053142 | Ga0500577_0016765 | Ga0500577_0016765_911_1795 | 293 |
| 388 | 3300053142 | Ga0500577_0079634 | Ga0500577_0079634_319_1203 | 293 |
| 389 | 3300053146 | Ga0500588_0041124 | Ga0500588_0041124_75_959 | 293 |
| 390 | 3300053147 | Ga0500589_096076 | Ga0500589_096076_74_958 | 293 |
| 391 | 3300054114 | Ga0501084_0259381 | Ga0501084_0259381_295_1179 | 293 |
| 392 | 3300060353 | Ga0501082_0049262 | Ga0501082_0049262_1078_1962 | 293 |
| 393 | iso_pu_bacteria | 2524023228 | 2524537367 | 293 |
| 394 | 3300001978 | JGI24747J21853_1000169 | JGI24747J21853_10001695 | 294 |
| 395 | 3300001979 | JGI24740J21852_10022911 | JGI24740J21852_100229112 | 294 |
| 396 | 3300001989 | JGI24739J22299_10001524 | JGI24739J22299_100015242 | 294 |
| 397 | 3300001989 | JGI24739J22299_10003887 | JGI24739J22299_100038874 | 294 |
| 398 | 3300001990 | JGI24737J22298_10017120 | JGI24737J22298_100171204 | 294 |
| 399 | 3300002070 | JGI24750J21931_1000745 | JGI24750J21931_10007456 | 294 |
| 400 | 3300002073 | JGI24745J21846_1000061 | JGI24745J21846_10000613 | 294 |
| 401 | 3300002074 | JGI24748J21848_1000185 | JGI24748J21848_10001853 | 294 |
| 402 | 3300002075 | JGI24738J21930_10000067 | JGI24738J21930_1000006717 | 294 |
| 403 | 3300002076 | JGI24749J21850_1001798 | JGI24749J21850_10017983 | 294 |
| 404 | 3300002126 | JGI24035J26624_1000005 | JGI24035J26624_100000517 | 294 |
| 405 | 3300002126 | JGI24035J26624_1000190 | JGI24035J26624_10001906 | 294 |
| 406 | 3300002155 | JGI24033J26618_1000613 | JGI24033J26618_10006131 | 294 |
| 407 | 3300002239 | JGI24034J26672_10000951 | JGI24034J26672_100009515 | 294 |
| 408 | 3300002244 | JGI24742J22300_10000153 | JGI24742J22300_100001538 | 294 |
| 409 | 3300005290 | Ga0065712_10130182 | Ga0065712_101301823 | 294 |
| 410 | 3300005293 | Ga0065715_10008690 | Ga0065715_100086902 | 294 |
| 411 | 3300005295 | Ga0065707_10268785 | Ga0065707_102687851 | 294 |
| 412 | 3300005328 | Ga0070676_10000332 | Ga0070676_100003322 | 294 |
| 413 | 3300005328 | Ga0070676_10066999 | Ga0070676_100669993 | 294 |
| 414 | 3300005329 | Ga0070683_100004171 | Ga0070683_10000417112 | 294 |
| 415 | 3300005330 | Ga0070690_100005079 | Ga0070690_1000050798 | 294 |
| 416 | 3300005330 | Ga0070690_100046391 | Ga0070690_1000463915 | 294 |
| 417 | 3300005331 | Ga0070670_100023341 | Ga0070670_1000233412 | 294 |
| 418 | 3300005333 | Ga0070677_10000258 | Ga0070677_1000025813 | 294 |
| 419 | 3300005334 | Ga0068869_100000510 | Ga0068869_10000051017 | 294 |
| 420 | 3300005335 | Ga0070666_10004570 | Ga0070666_100045708 | 294 |
| 421 | 3300005335 | Ga0070666_10019282 | Ga0070666_100192826 | 294 |
| 422 | 3300005336 | Ga0070680_100001476 | Ga0070680_10000147617 | 294 |
| 423 | 3300005337 | Ga0070682_100003255 | Ga0070682_1000032552 | 294 |
| 424 | 3300005338 | Ga0068868_100000148 | Ga0068868_10000014826 | 294 |
| 425 | 3300005339 | Ga0070660_100001314 | Ga0070660_10000131413 | 294 |
| 426 | 3300005340 | Ga0070689_100001783 | Ga0070689_1000017838 | 294 |
| 427 | 3300005340 | Ga0070689_100014799 | Ga0070689_1000147992 | 294 |
| 428 | 3300005341 | Ga0070691_10035255 | Ga0070691_100352554 | 294 |
| 429 | 3300005343 | Ga0070687_100000318 | Ga0070687_1000003188 | 294 |
| 430 | 3300005344 | Ga0070661_100000768 | Ga0070661_10000076815 | 294 |
| 431 | 3300005345 | Ga0070692_10011615 | Ga0070692_100116153 | 294 |
| 432 | 3300005347 | Ga0070668_100093298 | Ga0070668_1000932984 | 294 |
| 433 | 3300005347 | Ga0070668_100137565 | Ga0070668_1001375652 | 294 |
| 434 | 3300005353 | Ga0070669_100003445 | Ga0070669_1000034452 | 294 |
| 435 | 3300005354 | Ga0070675_100001491 | Ga0070675_10000149117 | 294 |
| 436 | 3300005354 | Ga0070675_100108142 | Ga0070675_1001081424 | 294 |
| 437 | 3300005354 | Ga0070675_100174255 | Ga0070675_1001742554 | 294 |
| 438 | 3300005355 | Ga0070671_100003997 | Ga0070671_1000039974 | 294 |
| 439 | 3300005355 | Ga0070671_100043030 | Ga0070671_1000430302 | 294 |
| 440 | 3300005355 | Ga0070671_100352254 | Ga0070671_1003522542 | 294 |
| 441 | 3300005356 | Ga0070674_100001355 | Ga0070674_10000135513 | 294 |
| 442 | 3300005356 | Ga0070674_100139731 | Ga0070674_1001397314 | 294 |
| 443 | 3300005364 | Ga0070673_100000670 | Ga0070673_1000006708 | 294 |
| 444 | 3300005364 | Ga0070673_100008314 | Ga0070673_1000083148 | 294 |
| 445 | 3300005364 | Ga0070673_100053400 | Ga0070673_1000534002 | 294 |
| 446 | 3300005365 | Ga0070688_100031440 | Ga0070688_1000314402 | 294 |
| 447 | 3300005365 | Ga0070688_100070770 | Ga0070688_1000707702 | 294 |
| 448 | 3300005366 | Ga0070659_100001400 | Ga0070659_10000140017 | 294 |
| 449 | 3300005366 | Ga0070659_100064806 | Ga0070659_1000648065 | 294 |
| 450 | 3300005367 | Ga0070667_100002340 | Ga0070667_10000234013 | 294 |
| 451 | 3300005367 | Ga0070667_100061422 | Ga0070667_1000614225 | 294 |
| 452 | 3300005406 | Ga0070703_10013030 | Ga0070703_100130302 | 294 |
| 453 | 3300005434 | Ga0070709_10022655 | Ga0070709_100226553 | 294 |
| 454 | 3300005436 | Ga0070713_100000838 | Ga0070713_10000083818 | 294 |
| 455 | 3300005436 | Ga0070713_100015088 | Ga0070713_1000150884 | 294 |
| 456 | 3300005436 | Ga0070713_100129808 | Ga0070713_1001298083 | 294 |
| 457 | 3300005436 | Ga0070713_100205600 | Ga0070713_1002056002 | 294 |
| 458 | 3300005437 | Ga0070710_10003726 | Ga0070710_100037268 | 294 |
| 459 | 3300005437 | Ga0070710_10012469 | Ga0070710_100124694 | 294 |
| 460 | 3300005437 | Ga0070710_10049287 | Ga0070710_100492872 | 294 |
| 461 | 3300005438 | Ga0070701_10019659 | Ga0070701_100196592 | 294 |
| 462 | 3300005438 | Ga0070701_10128181 | Ga0070701_101281812 | 294 |
| 463 | 3300005439 | Ga0070711_100028348 | Ga0070711_1000283484 | 294 |
| 464 | 3300005439 | Ga0070711_100043244 | Ga0070711_1000432445 | 294 |
| 465 | 3300005439 | Ga0070711_100055772 | Ga0070711_1000557726 | 294 |
| 466 | 3300005440 | Ga0070705_100001500 | Ga0070705_1000015002 | 294 |
| 467 | 3300005441 | Ga0070700_100001568 | Ga0070700_10000156812 | 294 |
| 468 | 3300005445 | Ga0070708_100105830 | Ga0070708_1001058302 | 294 |
| 469 | 3300005445 | Ga0070708_100193052 | Ga0070708_1001930522 | 294 |
| 470 | 3300005455 | Ga0070663_100001857 | Ga0070663_1000018572 | 294 |
| 471 | 3300005456 | Ga0070678_100000391 | Ga0070678_10000039113 | 294 |
| 472 | 3300005456 | Ga0070678_100015738 | Ga0070678_1000157386 | 294 |
| 473 | 3300005458 | Ga0070681_10006791 | Ga0070681_1000679112 | 294 |
| 474 | 3300005459 | Ga0068867_100006925 | Ga0068867_1000069257 | 294 |
| 475 | 3300005466 | Ga0070685_10003877 | Ga0070685_100038775 | 294 |
| 476 | 3300005466 | Ga0070685_10008554 | Ga0070685_100085547 | 294 |
| 477 | 3300005530 | Ga0070679_100142520 | Ga0070679_1001425202 | 294 |
| 478 | 3300005530 | Ga0070679_100299590 | Ga0070679_1002995902 | 294 |
| 479 | 3300005535 | Ga0070684_100000101 | Ga0070684_10000010117 | 294 |
| 480 | 3300005535 | Ga0070684_100074894 | Ga0070684_1000748941 | 294 |
| 481 | 3300005539 | Ga0068853_100116865 | Ga0068853_1001168652 | 294 |
| 482 | 3300005539 | Ga0068853_100251458 | Ga0068853_1002514583 | 294 |
| 483 | 3300005543 | Ga0070672_100000016 | Ga0070672_10000001661 | 294 |
| 484 | 3300005543 | Ga0070672_100259453 | Ga0070672_1002594532 | 294 |
| 485 | 3300005544 | Ga0070686_100008745 | Ga0070686_1000087456 | 294 |
| 486 | 3300005544 | Ga0070686_100018037 | Ga0070686_1000180374 | 294 |
| 487 | 3300005545 | Ga0070695_100000225 | Ga0070695_10000022527 | 294 |
| 488 | 3300005545 | Ga0070695_100004140 | Ga0070695_1000041403 | 294 |
| 489 | 3300005546 | Ga0070696_100002898 | Ga0070696_10000289812 | 294 |
| 490 | 3300005546 | Ga0070696_100382194 | Ga0070696_1003821941 | 294 |
| 491 | 3300005547 | Ga0070693_100000138 | Ga0070693_10000013827 | 294 |
| 492 | 3300005547 | Ga0070693_100289511 | Ga0070693_1002895111 | 294 |
| 493 | 3300005548 | Ga0070665_100164185 | Ga0070665_1001641853 | 294 |
| 494 | 3300005548 | Ga0070665_100172093 | Ga0070665_1001720934 | 294 |
| 495 | 3300005549 | Ga0070704_100082859 | Ga0070704_1000828594 | 294 |
| 496 | 3300005563 | Ga0068855_100023959 | Ga0068855_1000239595 | 294 |
| 497 | 3300005564 | Ga0070664_100000067 | Ga0070664_10000006765 | 294 |
| 498 | 3300005564 | Ga0070664_100039135 | Ga0070664_1000391353 | 294 |
| 499 | 3300005577 | Ga0068857_100000275 | Ga0068857_10000027512 | 294 |
| 500 | 3300005577 | Ga0068857_100066582 | Ga0068857_1000665824 | 294 |
| 501 | 3300005577 | Ga0068857_100176512 | Ga0068857_1001765124 | 294 |
| 502 | 3300005577 | Ga0068857_100258758 | Ga0068857_1002587582 | 294 |
| 503 | 3300005578 | Ga0068854_100002271 | Ga0068854_1000022712 | 294 |
| 504 | 3300005578 | Ga0068854_100162112 | Ga0068854_1001621122 | 294 |
| 505 | 3300005578 | Ga0068854_100420622 | Ga0068854_1004206221 | 294 |
| 506 | 3300005614 | Ga0068856_100001016 | Ga0068856_10000101622 | 294 |
| 507 | 3300005615 | Ga0070702_100000175 | Ga0070702_1000001758 | 294 |
| 508 | 3300005615 | Ga0070702_100125218 | Ga0070702_1001252182 | 294 |
| 509 | 3300005616 | Ga0068852_100000611 | Ga0068852_1000006118 | 294 |
| 510 | 3300005617 | Ga0068859_100002948 | Ga0068859_1000029482 | 294 |
| 511 | 3300005617 | Ga0068859_100124564 | Ga0068859_1001245644 | 294 |
| 512 | 3300005617 | Ga0068859_100179054 | Ga0068859_1001790544 | 294 |
| 513 | 3300005618 | Ga0068864_100000234 | Ga0068864_1000002349 | 294 |
| 514 | 3300005618 | Ga0068864_100021303 | Ga0068864_1000213036 | 294 |
| 515 | 3300005618 | Ga0068864_100025360 | Ga0068864_1000253607 | 294 |
| 516 | 3300005718 | Ga0068866_10002227 | Ga0068866_100022274 | 294 |
| 517 | 3300005718 | Ga0068866_10021000 | Ga0068866_100210003 | 294 |
| 518 | 3300005719 | Ga0068861_100044242 | Ga0068861_1000442424 | 294 |
| 519 | 3300005840 | Ga0068870_10000009 | Ga0068870_1000000939 | 294 |
| 520 | 3300005841 | Ga0068863_100001729 | Ga0068863_10000172915 | 294 |
| 521 | 3300005841 | Ga0068863_100142449 | Ga0068863_1001424492 | 294 |
| 522 | 3300005841 | Ga0068863_100533685 | Ga0068863_1005336852 | 294 |
| 523 | 3300005842 | Ga0068858_100001059 | Ga0068858_1000010592 | 294 |
| 524 | 3300005843 | Ga0068860_100003167 | Ga0068860_1000031672 | 294 |
| 525 | 3300005843 | Ga0068860_100377212 | Ga0068860_1003772121 | 294 |
| 526 | 3300005844 | Ga0068862_100019397 | Ga0068862_1000193976 | 294 |
| 527 | 3300006028 | Ga0070717_10004993 | Ga0070717_100049936 | 294 |
| 528 | 3300006028 | Ga0070717_10099451 | Ga0070717_100994513 | 294 |
| 529 | 3300006048 | Ga0075363_100082898 | Ga0075363_1000828982 | 294 |
| 530 | 3300006163 | Ga0070715_10017080 | Ga0070715_100170804 | 294 |
| 531 | 3300006163 | Ga0070715_10026067 | Ga0070715_100260674 | 294 |
| 532 | 3300006173 | Ga0070716_100003280 | Ga0070716_1000032803 | 294 |
| 533 | 3300006175 | Ga0070712_100004136 | Ga0070712_1000041365 | 294 |
| 534 | 3300006175 | Ga0070712_100023829 | Ga0070712_1000238296 | 294 |
| 535 | 3300006175 | Ga0070712_100039495 | Ga0070712_1000394953 | 294 |
| 536 | 3300006178 | Ga0075367_10013106 | Ga0075367_100131061 | 294 |
| 537 | 3300006178 | Ga0075367_10091430 | Ga0075367_100914304 | 294 |
| 538 | 3300006186 | Ga0075369_10150760 | Ga0075369_101507601 | 294 |
| 539 | 3300006237 | Ga0097621_100006760 | Ga0097621_1000067609 | 294 |
| 540 | 3300006358 | Ga0068871_100000012 | Ga0068871_10000001264 | 294 |
| 541 | 3300006358 | Ga0068871_100014044 | Ga0068871_1000140442 | 294 |
| 542 | 3300006358 | Ga0068871_100108554 | Ga0068871_1001085542 | 294 |
| 543 | 3300006846 | Ga0075430_100072654 | Ga0075430_1000726542 | 294 |
| 544 | 3300006871 | Ga0075434_100147219 | Ga0075434_1001472194 | 294 |
| 545 | 3300006881 | Ga0068865_100000355 | Ga0068865_10000035527 | 294 |
| 546 | 3300006881 | Ga0068865_100005877 | Ga0068865_1000058773 | 294 |
| 547 | 3300006914 | Ga0075436_100006210 | Ga0075436_1000062107 | 294 |
| 548 | 3300006914 | Ga0075436_100007339 | Ga0075436_1000073398 | 294 |
| 549 | 3300006931 | Ga0097620_100002948 | Ga0097620_1000029482 | 294 |
| 550 | 3300006931 | Ga0097620_100124548 | Ga0097620_1001245484 | 294 |
| 551 | 3300006931 | Ga0097620_100179052 | Ga0097620_1001790524 | 294 |
| 552 | 3300007076 | Ga0075435_100099820 | Ga0075435_1000998206 | 294 |
| 553 | 3300009011 | Ga0105251_10017705 | Ga0105251_100177053 | 294 |
| 554 | 3300009093 | Ga0105240_10022674 | Ga0105240_100226748 | 294 |
| 555 | 3300009093 | Ga0105240_10087262 | Ga0105240_100872621 | 294 |
| 556 | 3300009093 | Ga0105240_10185858 | Ga0105240_101858583 | 294 |
| 557 | 3300009093 | Ga0105240_10519388 | Ga0105240_105193881 | 294 |
| 558 | 3300009094 | Ga0111539_10141004 | Ga0111539_101410042 | 294 |
| 559 | 3300009098 | Ga0105245_10000409 | Ga0105245_1000040917 | 294 |
| 560 | 3300009101 | Ga0105247_10004080 | Ga0105247_100040809 | 294 |
| 561 | 3300009101 | Ga0105247_10009067 | Ga0105247_100090673 | 294 |
| 562 | 3300009101 | Ga0105247_10038738 | Ga0105247_100387382 | 294 |
| 563 | 3300009101 | Ga0105247_10091424 | Ga0105247_100914242 | 294 |
| 564 | 3300009148 | Ga0105243_10004202 | Ga0105243_1000420212 | 294 |
| 565 | 3300009148 | Ga0105243_10543975 | Ga0105243_105439751 | 294 |
| 566 | 3300009174 | Ga0105241_10000053 | Ga0105241_100000532 | 294 |
| 567 | 3300009174 | Ga0105241_10010799 | Ga0105241_100107999 | 294 |
| 568 | 3300009176 | Ga0105242_10011250 | Ga0105242_100112502 | 294 |
| 569 | 3300009176 | Ga0105242_10044930 | Ga0105242_100449305 | 294 |
| 570 | 3300009177 | Ga0105248_10000309 | Ga0105248_1000030950 | 294 |
| 571 | 3300009177 | Ga0105248_10116016 | Ga0105248_101160163 | 294 |
| 572 | 3300009177 | Ga0105248_10176677 | Ga0105248_101766772 | 294 |
| 573 | 3300009177 | Ga0105248_10256225 | Ga0105248_102562254 | 294 |
| 574 | 3300009177 | Ga0105248_10424316 | Ga0105248_104243162 | 294 |
| 575 | 3300009545 | Ga0105237_10176114 | Ga0105237_101761143 | 294 |
| 576 | 3300009553 | Ga0105249_10003451 | Ga0105249_100034512 | 294 |
| 577 | 3300010375 | Ga0105239_10007939 | Ga0105239_1000793913 | 294 |
| 578 | 3300011119 | Ga0105246_10002040 | Ga0105246_100020402 | 294 |
| 579 | 3300013100 | Ga0157373_10040211 | Ga0157373_100402113 | 294 |
| 580 | 3300013102 | Ga0157371_10008314 | Ga0157371_100083149 | 294 |
| 581 | 3300013102 | Ga0157371_10266337 | Ga0157371_102663371 | 294 |
| 582 | 3300013104 | Ga0157370_10058079 | Ga0157370_100580792 | 294 |
| 583 | 3300013104 | Ga0157370_10161055 | Ga0157370_101610553 | 294 |
| 584 | 3300013105 | Ga0157369_10005855 | Ga0157369_100058558 | 294 |
| 585 | 3300013296 | Ga0157374_10000452 | Ga0157374_1000045221 | 294 |
| 586 | 3300013296 | Ga0157374_10026788 | Ga0157374_100267888 | 294 |
| 587 | 3300013296 | Ga0157374_10333689 | Ga0157374_103336893 | 294 |
| 588 | 3300013297 | Ga0157378_10000872 | Ga0157378_100008723 | 294 |
| 589 | 3300013297 | Ga0157378_10062596 | Ga0157378_100625963 | 294 |
| 590 | 3300013297 | Ga0157378_10394722 | Ga0157378_103947222 | 294 |
| 591 | 3300013306 | Ga0163162_10000796 | Ga0163162_100007962 | 294 |
| 592 | 3300013307 | Ga0157372_10008710 | Ga0157372_1000871011 | 294 |
| 593 | 3300013308 | Ga0157375_10004563 | Ga0157375_1000456313 | 294 |
| 594 | 3300013308 | Ga0157375_10109327 | Ga0157375_101093272 | 294 |
| 595 | 3300014325 | Ga0163163_10191746 | Ga0163163_101917462 | 294 |
| 596 | 3300014326 | Ga0157380_10015191 | Ga0157380_100151916 | 294 |
| 597 | 3300014745 | Ga0157377_10000538 | Ga0157377_1000053816 | 294 |
| 598 | 3300014968 | Ga0157379_10004942 | Ga0157379_100049424 | 294 |
| 599 | 3300014969 | Ga0157376_10002295 | Ga0157376_1000229513 | 294 |
| 600 | 3300014969 | Ga0157376_10356693 | Ga0157376_103566931 | 294 |
| 601 | 3300017792 | Ga0163161_10000499 | Ga0163161_1000049927 | 294 |
| 602 | 3300020070 | Ga0206356_10556735 | Ga0206356_105567352 | 294 |
| 603 | 3300020081 | Ga0206354_11444921 | Ga0206354_114449211 | 294 |
| 604 | 3300020082 | Ga0206353_10987334 | Ga0206353_109873342 | 294 |
| 605 | 3300025290 | Ga0207673_1000072 | Ga0207673_10000723 | 294 |
| 606 | 3300025315 | Ga0207697_10000252 | Ga0207697_1000025232 | 294 |
| 607 | 3300025893 | Ga0207682_10000029 | Ga0207682_100000292 | 294 |
| 608 | 3300025898 | Ga0207692_10006712 | Ga0207692_100067122 | 294 |
| 609 | 3300025898 | Ga0207692_10075086 | Ga0207692_100750863 | 294 |
| 610 | 3300025898 | Ga0207692_10261499 | Ga0207692_102614991 | 294 |
| 611 | 3300025900 | Ga0207710_10001576 | Ga0207710_100015764 | 294 |
| 612 | 3300025900 | Ga0207710_10002176 | Ga0207710_100021767 | 294 |
| 613 | 3300025901 | Ga0207688_10000020 | Ga0207688_1000002014 | 294 |
| 614 | 3300025903 | Ga0207680_10001555 | Ga0207680_100015552 | 294 |
| 615 | 3300025903 | Ga0207680_10124811 | Ga0207680_101248112 | 294 |
| 616 | 3300025903 | Ga0207680_10203482 | Ga0207680_102034822 | 294 |
| 617 | 3300025907 | Ga0207645_10000108 | Ga0207645_1000010840 | 294 |
| 618 | 3300025907 | Ga0207645_10057516 | Ga0207645_100575164 | 294 |
| 619 | 3300025908 | Ga0207643_10000044 | Ga0207643_1000004471 | 294 |
| 620 | 3300025911 | Ga0207654_10004211 | Ga0207654_100042117 | 294 |
| 621 | 3300025912 | Ga0207707_10014616 | Ga0207707_100146167 | 294 |
| 622 | 3300025912 | Ga0207707_10137962 | Ga0207707_101379625 | 294 |
| 623 | 3300025913 | Ga0207695_10018913 | Ga0207695_100189137 | 294 |
| 624 | 3300025913 | Ga0207695_10185078 | Ga0207695_101850782 | 294 |
| 625 | 3300025915 | Ga0207693_10071211 | Ga0207693_100712113 | 294 |
| 626 | 3300025915 | Ga0207693_10120847 | Ga0207693_101208472 | 294 |
| 627 | 3300025916 | Ga0207663_10210790 | Ga0207663_102107901 | 294 |
| 628 | 3300025917 | Ga0207660_10000543 | Ga0207660_1000054321 | 294 |
| 629 | 3300025918 | Ga0207662_10005777 | Ga0207662_100057777 | 294 |
| 630 | 3300025919 | Ga0207657_10016668 | Ga0207657_100166685 | 294 |
| 631 | 3300025919 | Ga0207657_10103241 | Ga0207657_101032412 | 294 |
| 632 | 3300025920 | Ga0207649_10000057 | Ga0207649_1000005745 | 294 |
| 633 | 3300025921 | Ga0207652_10013118 | Ga0207652_100131187 | 294 |
| 634 | 3300025921 | Ga0207652_10070361 | Ga0207652_100703612 | 294 |
| 635 | 3300025923 | Ga0207681_10001187 | Ga0207681_1000118712 | 294 |
| 636 | 3300025925 | Ga0207650_10001534 | Ga0207650_100015343 | 294 |
| 637 | 3300025926 | Ga0207659_10000028 | Ga0207659_1000002889 | 294 |
| 638 | 3300025926 | Ga0207659_10192498 | Ga0207659_101924982 | 294 |
| 639 | 3300025927 | Ga0207687_10000061 | Ga0207687_1000006183 | 294 |
| 640 | 3300025928 | Ga0207700_10001257 | Ga0207700_100012574 | 294 |
| 641 | 3300025928 | Ga0207700_10116961 | Ga0207700_101169612 | 294 |
| 642 | 3300025928 | Ga0207700_10175241 | Ga0207700_101752413 | 294 |
| 643 | 3300025929 | Ga0207664_10074898 | Ga0207664_100748983 | 294 |
| 644 | 3300025929 | Ga0207664_10142206 | Ga0207664_101422062 | 294 |
| 645 | 3300025931 | Ga0207644_10000194 | Ga0207644_1000019434 | 294 |
| 646 | 3300025931 | Ga0207644_10013156 | Ga0207644_100131567 | 294 |
| 647 | 3300025931 | Ga0207644_10273889 | Ga0207644_102738892 | 294 |
| 648 | 3300025932 | Ga0207690_10000225 | Ga0207690_1000022543 | 294 |
| 649 | 3300025932 | Ga0207690_10273120 | Ga0207690_102731202 | 294 |
| 650 | 3300025933 | Ga0207706_10118069 | Ga0207706_101180692 | 294 |
| 651 | 3300025934 | Ga0207686_10007051 | Ga0207686_100070516 | 294 |
| 652 | 3300025934 | Ga0207686_10165301 | Ga0207686_101653013 | 294 |
| 653 | 3300025935 | Ga0207709_10000291 | Ga0207709_1000029142 | 294 |
| 654 | 3300025936 | Ga0207670_10000434 | Ga0207670_1000043416 | 294 |
| 655 | 3300025936 | Ga0207670_10021555 | Ga0207670_100215554 | 294 |
| 656 | 3300025937 | Ga0207669_10000019 | Ga0207669_10000019110 | 294 |
| 657 | 3300025938 | Ga0207704_10000438 | Ga0207704_100004382 | 294 |
| 658 | 3300025938 | Ga0207704_10076485 | Ga0207704_100764854 | 294 |
| 659 | 3300025939 | Ga0207665_10001157 | Ga0207665_100011575 | 294 |
| 660 | 3300025939 | Ga0207665_10028871 | Ga0207665_100288713 | 294 |
| 661 | 3300025939 | Ga0207665_10105265 | Ga0207665_101052654 | 294 |
| 662 | 3300025940 | Ga0207691_10001047 | Ga0207691_1000104728 | 294 |
| 663 | 3300025940 | Ga0207691_10159480 | Ga0207691_101594804 | 294 |
| 664 | 3300025940 | Ga0207691_10240356 | Ga0207691_102403563 | 294 |
| 665 | 3300025941 | Ga0207711_10002887 | Ga0207711_100028879 | 294 |
| 666 | 3300025941 | Ga0207711_10044822 | Ga0207711_100448225 | 294 |
| 667 | 3300025941 | Ga0207711_10113298 | Ga0207711_101132983 | 294 |
| 668 | 3300025941 | Ga0207711_10163067 | Ga0207711_101630672 | 294 |
| 669 | 3300025941 | Ga0207711_10480654 | Ga0207711_104806542 | 294 |
| 670 | 3300025942 | Ga0207689_10001160 | Ga0207689_1000116012 | 294 |
| 671 | 3300025944 | Ga0207661_10000126 | Ga0207661_1000012626 | 294 |
| 672 | 3300025944 | Ga0207661_10142887 | Ga0207661_101428874 | 294 |
| 673 | 3300025945 | Ga0207679_10000026 | Ga0207679_10000026113 | 294 |
| 674 | 3300025945 | Ga0207679_10017686 | Ga0207679_100176862 | 294 |
| 675 | 3300025949 | Ga0207667_10018494 | Ga0207667_100184945 | 294 |
| 676 | 3300025960 | Ga0207651_10001232 | Ga0207651_100012322 | 294 |
| 677 | 3300025961 | Ga0207712_10002654 | Ga0207712_1000265413 | 294 |
| 678 | 3300025972 | Ga0207668_10000049 | Ga0207668_1000004986 | 294 |
| 679 | 3300025972 | Ga0207668_10082572 | Ga0207668_100825723 | 294 |
| 680 | 3300025981 | Ga0207640_10001994 | Ga0207640_100019943 | 294 |
| 681 | 3300025986 | Ga0207658_10001093 | Ga0207658_100010937 | 294 |
| 682 | 3300025986 | Ga0207658_10014381 | Ga0207658_100143814 | 294 |
| 683 | 3300026023 | Ga0207677_10000229 | Ga0207677_1000022912 | 294 |
| 684 | 3300026035 | Ga0207703_10012519 | Ga0207703_100125195 | 294 |
| 685 | 3300026035 | Ga0207703_10133147 | Ga0207703_101331473 | 294 |
| 686 | 3300026041 | Ga0207639_10002735 | Ga0207639_1000273513 | 294 |
| 687 | 3300026041 | Ga0207639_10069768 | Ga0207639_100697682 | 294 |
| 688 | 3300026067 | Ga0207678_10000403 | Ga0207678_1000040328 | 294 |
| 689 | 3300026067 | Ga0207678_10071985 | Ga0207678_100719853 | 294 |
| 690 | 3300026067 | Ga0207678_10390069 | Ga0207678_103900691 | 294 |
| 691 | 3300026075 | Ga0207708_10090192 | Ga0207708_100901924 | 294 |
| 692 | 3300026075 | Ga0207708_10246082 | Ga0207708_102460822 | 294 |
| 693 | 3300026078 | Ga0207702_10001378 | Ga0207702_1000137822 | 294 |
| 694 | 3300026088 | Ga0207641_10163831 | Ga0207641_101638312 | 294 |
| 695 | 3300026088 | Ga0207641_10237584 | Ga0207641_102375842 | 294 |
| 696 | 3300026089 | Ga0207648_10001244 | Ga0207648_100012442 | 294 |
| 697 | 3300026095 | Ga0207676_10000672 | Ga0207676_1000067224 | 294 |
| 698 | 3300026095 | Ga0207676_10010659 | Ga0207676_100106595 | 294 |
| 699 | 3300026095 | Ga0207676_10013475 | Ga0207676_100134757 | 294 |
| 700 | 3300026095 | Ga0207676_10023642 | Ga0207676_100236425 | 294 |
| 701 | 3300026116 | Ga0207674_10001968 | Ga0207674_1000196818 | 294 |
| 702 | 3300026116 | Ga0207674_10051024 | Ga0207674_100510244 | 294 |
| 703 | 3300026116 | Ga0207674_10189055 | Ga0207674_101890552 | 294 |
| 704 | 3300026116 | Ga0207674_10258499 | Ga0207674_102584992 | 294 |
| 705 | 3300026118 | Ga0207675_100132497 | Ga0207675_1001324974 | 294 |
| 706 | 3300026121 | Ga0207683_10000034 | Ga0207683_1000003486 | 294 |
| 707 | 3300026121 | Ga0207683_10091941 | Ga0207683_100919413 | 294 |
| 708 | 3300026121 | Ga0207683_10145961 | Ga0207683_101459613 | 294 |
| 709 | 3300026142 | Ga0207698_10042171 | Ga0207698_100421712 | 294 |
| 710 | 3300027252 | Ga0209973_1009382 | Ga0209973_10093822 | 294 |
| 711 | 3300027364 | Ga0209967_1009745 | Ga0209967_10097452 | 294 |
| 712 | 3300027614 | Ga0209970_1004643 | Ga0209970_10046433 | 294 |
| 713 | 3300027617 | Ga0210002_1000151 | Ga0210002_10001512 | 294 |
| 714 | 3300027665 | Ga0209983_1002418 | Ga0209983_10024182 | 294 |
| 715 | 3300027695 | Ga0209966_1002008 | Ga0209966_10020082 | 294 |
| 716 | 3300027876 | Ga0209974_10018966 | Ga0209974_100189663 | 294 |
| 717 | 3300027876 | Ga0209974_10054896 | Ga0209974_100548962 | 294 |
| 718 | 3300027876 | Ga0209974_10061656 | Ga0209974_100616561 | 294 |
| 719 | 3300027907 | Ga0207428_10000352 | Ga0207428_100003525 | 294 |
| 720 | 3300028379 | Ga0268266_10003979 | Ga0268266_100039798 | 294 |
| 721 | 3300028379 | Ga0268266_10111381 | Ga0268266_101113813 | 294 |
| 722 | 3300028379 | Ga0268266_10155077 | Ga0268266_101550772 | 294 |
| 723 | 3300028380 | Ga0268265_10000410 | Ga0268265_1000041045 | 294 |
| 724 | 3300028380 | Ga0268265_10436397 | Ga0268265_104363971 | 294 |
| 725 | 3300028381 | Ga0268264_10001567 | Ga0268264_1000156713 | 294 |
| 726 | 3300028381 | Ga0268264_10473333 | Ga0268264_104733331 | 294 |
| 727 | 3300028800 | Ga0265338_10054112 | Ga0265338_100541122 | 294 |
| 728 | 3300031241 | Ga0265325_10000141 | Ga0265325_100001416 | 294 |
| 729 | 3300031247 | Ga0265340_10039425 | Ga0265340_100394254 | 294 |
| 730 | 3300031344 | Ga0265316_10076472 | Ga0265316_100764724 | 294 |
| 731 | 3300031595 | Ga0265313_10007607 | Ga0265313_100076075 | 294 |
| 732 | 3300032133 | Ga0316583_10067483 | Ga0316583_100674832 | 294 |
| 733 | 3300034816 | Ga0373930_0006816 | Ga0373930_0006816_393_1277 | 294 |
| 734 | 3300035083 | Ga0373926_0002177 | Ga0373926_0002177_925_1809 | 294 |
| 735 | 3300035083 | Ga0373926_0026925 | Ga0373926_0026925_834_1718 | 294 |
| 736 | 3300035084 | Ga0373928_0004025 | Ga0373928_0004025_11_895 | 294 |
| 737 | 3300035084 | Ga0373928_0013398 | Ga0373928_0013398_474_1358 | 294 |
| 738 | 3300035085 | Ga0373929_0003944 | Ga0373929_0003944_280_1164 | 294 |
| 739 | 3300035086 | Ga0373934_0004922 | Ga0373934_0004922_310_1194 | 294 |
| 740 | 3300035086 | Ga0373934_0006581 | Ga0373934_0006581_2523_3407 | 294 |
| 741 | 3300035088 | Ga0373940_0001866 | Ga0373940_0001866_2807_3691 | 294 |
| 742 | 3300035089 | Ga0373944_0002474 | Ga0373944_0002474_3568_4452 | 294 |
| 743 | 3300035089 | Ga0373944_0056352 | Ga0373944_0056352_154_1038 | 294 |
| 744 | 3300035090 | Ga0373949_0004067 | Ga0373949_0004067_1905_2789 | 294 |
| 745 | 3300035091 | Ga0373951_0008754 | Ga0373951_0008754_431_1315 | 294 |
| 746 | 3300035091 | Ga0373951_0020349 | Ga0373951_0020349_245_1129 | 294 |
| 747 | 3300035092 | Ga0373952_0001062 | Ga0373952_0001062_3561_4445 | 294 |
| 748 | 3300035111 | Ga0373923_0010862 | Ga0373923_0010862_373_1257 | 294 |
| 749 | 3300035111 | Ga0373923_0032130 | Ga0373923_0032130_1172_2056 | 294 |
| 750 | 3300035111 | Ga0373923_0039425 | Ga0373923_0039425_932_1816 | 294 |
| 751 | 3300035112 | Ga0373932_0009450 | Ga0373932_0009450_414_1298 | 294 |
| 752 | 3300035113 | Ga0373936_0021839 | Ga0373936_0021839_816_1700 | 294 |
| 753 | 3300035114 | Ga0373939_0000706 | Ga0373939_0000706_55_939 | 294 |
| 754 | 3300035114 | Ga0373939_0072659 | Ga0373939_0072659_31_915 | 294 |
| 755 | 3300035115 | Ga0373941_0007982 | Ga0373941_0007982_1707_2591 | 294 |
| 756 | 3300035115 | Ga0373941_0032927 | Ga0373941_0032927_72_956 | 294 |
| 757 | 3300035116 | Ga0373945_0006425 | Ga0373945_0006425_36_920 | 294 |
| 758 | 3300035117 | Ga0373953_0009788 | Ga0373953_0009788_1724_2608 | 294 |
| 759 | 3300035118 | Ga0373954_0064983 | Ga0373954_0064983_560_1444 | 294 |
| 760 | 3300035119 | Ga0373956_0009825 | Ga0373956_0009825_1212_2096 | 294 |
| 761 | 3300035119 | Ga0373956_0019299 | Ga0373956_0019299_1832_2716 | 294 |
| 762 | 3300035171 | Ga0373946_0006715 | Ga0373946_0006715_2164_3048 | 294 |
| 763 | 3300035171 | Ga0373946_0077953 | Ga0373946_0077953_539_1423 | 294 |
| 764 | 3300035172 | Ga0373955_0003281 | Ga0373955_0003281_4870_5754 | 294 |
| 765 | 3300035172 | Ga0373955_0009848 | Ga0373955_0009848_2140_3024 | 294 |
| 766 | 3300035241 | Ga0373961_0006819 | Ga0373961_0006819_365_1249 | 294 |
| 767 | 3300035241 | Ga0373961_0049321 | Ga0373961_0049321_85_969 | 294 |
| 768 | 3300035242 | Ga0373962_0000258 | Ga0373962_0000258_571_1455 | 294 |
| 769 | 3300035242 | Ga0373962_0015271 | Ga0373962_0015271_1043_1927 | 294 |
| 770 | 3300035410 | Ga0373924_0004203 | Ga0373924_0004203_2992_3876 | 294 |
| 771 | 3300035691 | Ga0373931_0005613 | Ga0373931_0005613_1393_2277 | 294 |
| 772 | 3300035691 | Ga0373931_0017116 | Ga0373931_0017116_1688_2572 | 294 |
| 773 | 3300035692 | Ga0373935_0012931 | Ga0373935_0012931_3471_4355 | 294 |
| 774 | 3300035692 | Ga0373935_0175368 | Ga0373935_0175368_312_1196 | 294 |
| 775 | 3300035695 | Ga0373927_0020410 | Ga0373927_0020410_228_1112 | 294 |
| 776 | 3300035695 | Ga0373927_0084080 | Ga0373927_0084080_719_1606 | 294 |
| 777 | 3300035695 | Ga0373927_0196592 | Ga0373927_0196592_215_1099 | 294 |
| 778 | 3300035724 | Ga0373933_0003160 | Ga0373933_0003160_6581_7465 | 294 |
| 779 | 3300035724 | Ga0373933_0036726 | Ga0373933_0036726_1060_1944 | 294 |
| 780 | 3300035724 | Ga0373933_0040475 | Ga0373933_0040475_833_1717 | 294 |
| 781 | 3300035724 | Ga0373933_0103089 | Ga0373933_0103089_16_900 | 294 |
| 782 | 3300036401 | Ga0373937_0012815 | Ga0373937_0012815_4851_5735 | 294 |
| 783 | 3300036401 | Ga0373937_0040665 | Ga0373937_0040665_2909_3793 | 294 |
| 784 | 3300036401 | Ga0373937_0045771 | Ga0373937_0045771_2998_3882 | 294 |
| 785 | 3300036401 | Ga0373937_0133441 | Ga0373937_0133441_553_1437 | 294 |
| 786 | 3300036401 | Ga0373937_0202587 | Ga0373937_0202587_406_1293 | 294 |
| 787 | 3300036401 | Ga0373937_0572521 | Ga0373937_0572521_80_964 | 294 |
| 788 | 3300037068 | Ga0373925_0037718 | Ga0373925_0037718_2276_3160 | 294 |
| 789 | 3300037068 | Ga0373925_0370250 | Ga0373925_0370250_46_930 | 294 |
| 790 | 3300037418 | Ga0395900_0105347 | Ga0395900_0105347_815_1702 | 294 |
| 791 | 3300037466 | Ga0395898_0036540 | Ga0395898_0036540_1723_2610 | 294 |
| 792 | 3300039437 | Ga0436365_1181233 | Ga0436365_1181233_754_1638 | 294 |
| 793 | 3300044694 | Ga0466963_0092478 | Ga0466963_0092478_927_1811 | 294 |
| 794 | 3300044694 | Ga0466963_0109353 | Ga0466963_0109353_921_1808 | 294 |
| 795 | 3300046454 | Ga0495592_0000513 | Ga0495592_0000513_24569_25453 | 294 |
| 796 | 3300046454 | Ga0495592_0008115 | Ga0495592_0008115_3719_4603 | 294 |
| 797 | 3300046454 | Ga0495592_0169782 | Ga0495592_0169782_392_1276 | 294 |
| 798 | 3300046455 | Ga0495603_0035918 | Ga0495603_0035918_1549_2433 | 294 |
| 799 | 3300046459 | Ga0495629_0033278 | Ga0495629_0033278_642_1526 | 294 |
| 800 | 3300046460 | Ga0495638_0028639 | Ga0495638_0028639_1462_2370 | 294 |
| 801 | 3300046461 | Ga0495641_0094615 | Ga0495641_0094615_21_905 | 294 |
| 802 | 3300046462 | Ga0495651_0027931 | Ga0495651_0027931_2777_3661 | 294 |
| 803 | 3300046462 | Ga0495651_0204633 | Ga0495651_0204633_478_1362 | 294 |
| 804 | 3300046463 | Ga0495653_0000912 | Ga0495653_0000912_21917_22801 | 294 |
| 805 | 3300046463 | Ga0495653_0019530 | Ga0495653_0019530_334_1218 | 294 |
| 806 | 3300046463 | Ga0495653_0026746 | Ga0495653_0026746_3587_4471 | 294 |
| 807 | 3300046463 | Ga0495653_0095109 | Ga0495653_0095109_674_1558 | 294 |
| 808 | 3300046472 | Ga0495580_0026873 | Ga0495580_0026873_1889_2773 | 294 |
| 809 | 3300046472 | Ga0495580_0098423 | Ga0495580_0098423_366_1250 | 294 |
| 810 | 3300046473 | Ga0495582_0033766 | Ga0495582_0033766_1769_2653 | 294 |
| 811 | 3300046476 | Ga0495662_0029283 | Ga0495662_0029283_554_1438 | 294 |
| 812 | 3300046476 | Ga0495662_0043882 | Ga0495662_0043882_855_1739 | 294 |
| 813 | 3300046477 | Ga0495664_0051228 | Ga0495664_0051228_403_1287 | 294 |
| 814 | 3300046477 | Ga0495664_0073934 | Ga0495664_0073934_802_1686 | 294 |
| 815 | 3300046491 | Ga0495584_0006986 | Ga0495584_0006986_721_1629 | 294 |
| 816 | 3300046492 | Ga0495585_0004083 | Ga0495585_0004083_6993_7877 | 294 |
| 817 | 3300046501 | Ga0495607_0038217 | Ga0495607_0038217_1155_2039 | 294 |
| 818 | 3300046511 | Ga0495608_0008983 | Ga0495608_0008983_2471_3355 | 294 |
| 819 | 3300046511 | Ga0495608_0022196 | Ga0495608_0022196_3019_3903 | 294 |
| 820 | 3300046511 | Ga0495608_0281239 | Ga0495608_0281239_49_933 | 294 |
| 821 | 3300046514 | Ga0495618_0104308 | Ga0495618_0104308_87_971 | 294 |
| 822 | 3300046516 | Ga0495628_0011083 | Ga0495628_0011083_5923_6807 | 294 |
| 823 | 3300046516 | Ga0495628_0034712 | Ga0495628_0034712_651_1535 | 294 |
| 824 | 3300046517 | Ga0495630_0062267 | Ga0495630_0062267_1894_2778 | 294 |
| 825 | 3300046519 | Ga0495632_0000006 | Ga0495632_0000006_326559_327455 | 294 |
| 826 | 3300046520 | Ga0495637_0000784 | Ga0495637_0000784_1368_2264 | 294 |
| 827 | 3300046522 | Ga0495643_0000021 | Ga0495643_0000021_61027_61923 | 294 |
| 828 | 3300046523 | Ga0495644_0003549 | Ga0495644_0003549_4293_5177 | 294 |
| 829 | 3300046524 | Ga0495648_0038726 | Ga0495648_0038726_599_1495 | 294 |
| 830 | 3300046525 | Ga0495663_0000008 | Ga0495663_0000008_18429_19325 | 294 |
| 831 | 3300046529 | Ga0495652_0028963 | Ga0495652_0028963_3335_4219 | 294 |
| 832 | 3300046529 | Ga0495652_0195762 | Ga0495652_0195762_238_1122 | 294 |
| 833 | 3300046531 | Ga0495665_0011091 | Ga0495665_0011091_3201_4085 | 294 |
| 834 | 3300046531 | Ga0495665_0205783 | Ga0495665_0205783_18_902 | 294 |
| 835 | 3300046533 | Ga0495640_0067780 | Ga0495640_0067780_1375_2259 | 294 |
| 836 | 3300046533 | Ga0495640_0138997 | Ga0495640_0138997_445_1329 | 294 |
| 837 | 3300046533 | Ga0495640_0155157 | Ga0495640_0155157_25_909 | 294 |
| 838 | 3300046536 | Ga0495587_0113466 | Ga0495587_0113466_40_924 | 294 |
| 839 | 3300046536 | Ga0495587_0130609 | Ga0495587_0130609_239_1123 | 294 |
| 840 | 3300046537 | Ga0495598_0029638 | Ga0495598_0029638_442_1326 | 294 |
| 841 | 3300046543 | Ga0495645_0001151 | Ga0495645_0001151_642_1526 | 294 |
| 842 | 3300046543 | Ga0495645_0075566 | Ga0495645_0075566_751_1635 | 294 |
| 843 | 3300046543 | Ga0495645_0080582 | Ga0495645_0080582_1160_2044 | 294 |
| 844 | 3300046557 | Ga0495622_0006107 | Ga0495622_0006107_4376_5260 | 294 |
| 845 | 3300046558 | Ga0495633_0000247 | Ga0495633_0000247_4340_5236 | 294 |
| 846 | 3300046558 | Ga0495633_0001265 | Ga0495633_0001265_5699_6595 | 294 |
| 847 | 3300046558 | Ga0495633_0018376 | Ga0495633_0018376_1314_2198 | 294 |
| 848 | 3300046559 | Ga0495667_0027764 | Ga0495667_0027764_1209_2093 | 294 |
| 849 | 3300046615 | Ga0495656_0000297 | Ga0495656_0000297_998_1882 | 294 |
| 850 | 3300046648 | Ga0495611_0031638 | Ga0495611_0031638_977_1861 | 294 |
| 851 | 3300046663 | Ga0495635_0011642 | Ga0495635_0011642_445_1329 | 294 |
| 852 | 3300046664 | Ga0495659_0008457 | Ga0495659_0008457_510_1394 | 294 |
| 853 | 3300046674 | Ga0495588_0008423 | Ga0495588_0008423_1058_1942 | 294 |
| 854 | 3300046675 | Ga0495657_0009329 | Ga0495657_0009329_2082_2966 | 294 |
| 855 | 3300046675 | Ga0495657_0064306 | Ga0495657_0064306_940_1824 | 294 |
| 856 | 3300046675 | Ga0495657_0135465 | Ga0495657_0135465_444_1328 | 294 |
| 857 | 3300046678 | Ga0495599_0018304 | Ga0495599_0018304_2454_3338 | 294 |
| 858 | 3300046679 | Ga0495623_0017571 | Ga0495623_0017571_2662_3546 | 294 |
| 859 | 3300046680 | Ga0495646_0009857 | Ga0495646_0009857_4375_5259 | 294 |
| 860 | 3300046681 | Ga0495647_0074420 | Ga0495647_0074420_29_913 | 294 |
| 861 | 3300046689 | Ga0495613_0079747 | Ga0495613_0079747_1131_2015 | 294 |
| 862 | 3300046691 | Ga0495670_0002440 | Ga0495670_0002440_1560_2444 | 294 |
| 863 | 3300046692 | Ga0495671_0000017 | Ga0495671_0000017_231543_232439 | 294 |
| 864 | 3300046794 | Ga0495589_0027347 | Ga0495589_0027347_1900_2784 | 294 |
| 865 | 3300046809 | Ga0495600_0075284 | Ga0495600_0075284_1057_1941 | 294 |
| 866 | 3300046809 | Ga0495600_0114453 | Ga0495600_0114453_639_1523 | 294 |
| 867 | 3300047317 | Ga0495604_0006502 | Ga0495604_0006502_8146_9030 | 294 |
| 868 | 3300047317 | Ga0495604_0010832 | Ga0495604_0010832_3569_4453 | 294 |
| 869 | 3300047319 | Ga0495674_0050715 | Ga0495674_0050715_366_1250 | 294 |
| 870 | 3300047321 | Ga0495676_0052101 | Ga0495676_0052101_2360_3244 | 294 |
| 871 | 3300047470 | Ga0495681_0054630 | Ga0495681_0054630_884_1780 | 294 |
| 872 | 3300047471 | Ga0495684_0008189 | Ga0495684_0008189_4395_5279 | 294 |
| 873 | 3300047471 | Ga0495684_0070264 | Ga0495684_0070264_842_1726 | 294 |
| 874 | 3300047673 | Ga0495593_0053018 | Ga0495593_0053018_1105_1989 | 294 |
| 875 | 3300047673 | Ga0495593_0109969 | Ga0495593_0109969_434_1318 | 294 |
| 876 | 3300048088 | Ga0495602_0046224 | Ga0495602_0046224_1777_2661 | 294 |
| 877 | 3300048088 | Ga0495602_0064510 | Ga0495602_0064510_971_1855 | 294 |
| 878 | 3300048088 | Ga0495602_0262997 | Ga0495602_0262997_132_1016 | 294 |
| 879 | 3300048903 | Ga0496100_0001439 | Ga0496100_0001439_5076_5960 | 294 |
| 880 | 3300048903 | Ga0496100_0042849 | Ga0496100_0042849_1630_2607 | 294 |
| 881 | 3300048904 | Ga0496101_0000171 | Ga0496101_0000171_15572_16456 | 294 |
| 882 | 3300048904 | Ga0496101_0014780 | Ga0496101_0014780_2624_3601 | 294 |
| 883 | 3300048904 | Ga0496101_0067795 | Ga0496101_0067795_410_1294 | 294 |
| 884 | 3300048904 | Ga0496101_0198928 | Ga0496101_0198928_519_1403 | 294 |
| 885 | 3300048905 | Ga0496102_0004728 | Ga0496102_0004728_250_1134 | 294 |
| 886 | 3300048905 | Ga0496102_0062018 | Ga0496102_0062018_2330_3214 | 294 |
| 887 | 3300048906 | Ga0496103_0001994 | Ga0496103_0001994_802_1686 | 294 |
| 888 | 3300048906 | Ga0496103_0033981 | Ga0496103_0033981_1710_2594 | 294 |
| 889 | 3300048906 | Ga0496103_0051430 | Ga0496103_0051430_1423_2307 | 294 |
| 890 | 3300048907 | Ga0496104_0000067 | Ga0496104_0000067_71023_71907 | 294 |
| 891 | 3300048907 | Ga0496104_0086181 | Ga0496104_0086181_46_930 | 294 |
| 892 | 3300048907 | Ga0496104_0226813 | Ga0496104_0226813_597_1481 | 294 |
| 893 | 3300048907 | Ga0496104_0255365 | Ga0496104_0255365_600_1484 | 294 |
| 894 | 3300048907 | Ga0496104_0313519 | Ga0496104_0313519_146_1030 | 294 |
| 895 | 3300048908 | Ga0496105_0000130 | Ga0496105_0000130_14306_15190 | 294 |
| 896 | 3300048908 | Ga0496105_0016996 | Ga0496105_0016996_573_1457 | 294 |
| 897 | 3300048909 | Ga0496106_0000581 | Ga0496106_0000581_5818_6702 | 294 |
| 898 | 3300048909 | Ga0496106_0107536 | Ga0496106_0107536_373_1257 | 294 |
| 899 | 3300048909 | Ga0496106_0145671 | Ga0496106_0145671_614_1498 | 294 |
| 900 | 3300048910 | Ga0496107_0000224 | Ga0496107_0000224_27851_28735 | 294 |
| 901 | 3300048910 | Ga0496107_0016922 | Ga0496107_0016922_192_1076 | 294 |
| 902 | 3300048911 | Ga0496108_0000547 | Ga0496108_0000547_13379_14263 | 294 |
| 903 | 3300048911 | Ga0496108_0031606 | Ga0496108_0031606_2910_3794 | 294 |
| 904 | 3300048911 | Ga0496108_0051587 | Ga0496108_0051587_49_933 | 294 |
| 905 | 3300048911 | Ga0496108_0071071 | Ga0496108_0071071_827_1711 | 294 |
| 906 | 3300048911 | Ga0496108_0153649 | Ga0496108_0153649_677_1561 | 294 |
| 907 | 3300048912 | Ga0496109_0000384 | Ga0496109_0000384_8472_9356 | 294 |
| 908 | 3300048912 | Ga0496109_0014332 | Ga0496109_0014332_885_1769 | 294 |
| 909 | 3300048912 | Ga0496109_0173137 | Ga0496109_0173137_648_1532 | 294 |
| 910 | 3300048912 | Ga0496109_0449569 | Ga0496109_0449569_27_911 | 294 |
| 911 | 3300048913 | Ga0496110_0008712 | Ga0496110_0008712_7114_7998 | 294 |
| 912 | 3300048913 | Ga0496110_0018951 | Ga0496110_0018951_2261_3145 | 294 |
| 913 | 3300048914 | Ga0496111_0005888 | Ga0496111_0005888_6176_7060 | 294 |
| 914 | 3300048914 | Ga0496111_0081880 | Ga0496111_0081880_1031_1915 | 294 |
| 915 | 3300048915 | Ga0496112_0087114 | Ga0496112_0087114_1829_2713 | 294 |
| 916 | 3300048915 | Ga0496112_0226817 | Ga0496112_0226817_439_1323 | 294 |
| 917 | 3300048916 | Ga0496113_0122603 | Ga0496113_0122603_681_1565 | 294 |
| 918 | 3300048917 | Ga0496114_0004538 | Ga0496114_0004538_7937_8821 | 294 |
| 919 | 3300048917 | Ga0496114_0009885 | Ga0496114_0009885_443_1327 | 294 |
| 920 | 3300048917 | Ga0496114_0027436 | Ga0496114_0027436_3233_4210 | 294 |
| 921 | 3300048918 | Ga0496115_0000826 | Ga0496115_0000826_12061_12945 | 294 |
| 922 | 3300048918 | Ga0496115_0115152 | Ga0496115_0115152_286_1263 | 294 |
| 923 | 3300048924 | Ga0496121_0247341 | Ga0496121_0247341_121_1005 | 294 |
| 924 | 3300048928 | Ga0496125_0108084 | Ga0496125_0108084_973_1857 | 294 |
| 925 | 3300048929 | Ga0496126_0027170 | Ga0496126_0027170_4269_5156 | 294 |
| 926 | 3300048929 | Ga0496126_0157417 | Ga0496126_0157417_1021_1908 | 294 |
| 927 | 3300049573 | Ga0501037_0050928 | Ga0501037_0050928_2133_3017 | 294 |
| 928 | 3300049574 | Ga0501038_0027921 | Ga0501038_0027921_496_1380 | 294 |
| 929 | 3300049575 | Ga0501039_0085658 | Ga0501039_0085658_1059_1943 | 294 |
| 930 | 3300049581 | Ga0501047_0131910 | Ga0501047_0131910_686_1570 | 294 |
| 931 | 3300049581 | Ga0501047_0211521 | Ga0501047_0211521_374_1258 | 294 |
| 932 | 3300049582 | Ga0501048_0028790 | Ga0501048_0028790_2925_3809 | 294 |
| 933 | 3300049583 | Ga0501067_0113207 | Ga0501067_0113207_537_1451 | 294 |
| 934 | 3300049584 | Ga0501068_0003581 | Ga0501068_0003581_716_1600 | 294 |
| 935 | 3300049586 | Ga0501070_0109225 | Ga0501070_0109225_716_1600 | 294 |
| 936 | 3300049587 | Ga0501071_0005036 | Ga0501071_0005036_4960_5844 | 294 |
| 937 | 3300049589 | Ga0501073_0030477 | Ga0501073_0030477_2397_3281 | 294 |
| 938 | 3300049590 | Ga0501074_0091026 | Ga0501074_0091026_665_1549 | 294 |
| 939 | 3300049741 | Ga0501079_0201545 | Ga0501079_0201545_643_1527 | 294 |
| 940 | 3300049742 | Ga0501080_0266947 | Ga0501080_0266947_247_1134 | 294 |
| 941 | 3300049744 | Ga0501083_0147005 | Ga0501083_0147005_200_1084 | 294 |
| 942 | 3300049824 | Ga0501045_0239732 | Ga0501045_0239732_187_1071 | 294 |
| 943 | 3300050489 | nmdc:mga03683_132339_c1 | nmdc:mga03683_132339_c1_192_1076 | 294 |
| 944 | 3300050494 | nmdc:mga06z11_12623_c1 | nmdc:mga06z11_12623_c1_877_1761 | 294 |
| 945 | 3300050509 | nmdc:mga0qj67_43999_c1 | nmdc:mga0qj67_43999_c1_1748_2632 | 294 |
| 946 | 3300050511 | nmdc:mga08y16_203714_c1 | nmdc:mga08y16_203714_c1_831_1718 | 294 |
| 947 | 3300050511 | nmdc:mga08y16_257184_c1 | nmdc:mga08y16_257184_c1_543_1427 | 294 |
| 948 | 3300050512 | nmdc:mga0n895_165280_c1 | nmdc:mga0n895_165280_c1_781_1665 | 294 |
| 949 | 3300050512 | nmdc:mga0n895_744324_c1 | nmdc:mga0n895_744324_c1_39_923 | 294 |
| 950 | 3300050513 | nmdc:mga0rr50_258245_c1 | nmdc:mga0rr50_258245_c1_118_1002 | 294 |
| 951 | 3300050514 | nmdc:mga08x19_180973_c1 | nmdc:mga08x19_180973_c1_516_1400 | 294 |
| 952 | 3300050514 | nmdc:mga08x19_18_c1 | nmdc:mga08x19_18_c1_99492_100376 | 294 |
| 953 | 3300050514 | nmdc:mga08x19_88601_c1 | nmdc:mga08x19_88601_c1_503_1387 | 294 |
| 954 | 3300053077 | Ga0495601_0000237 | Ga0495601_0000237_24056_24940 | 294 |
| 955 | 3300053077 | Ga0495601_0003203 | Ga0495601_0003203_1150_2034 | 294 |
| 956 | 3300053077 | Ga0495601_0011542 | Ga0495601_0011542_4311_5195 | 294 |
| 957 | 3300053078 | Ga0495612_0000563 | Ga0495612_0000563_406_1290 | 294 |
| 958 | 3300053078 | Ga0495612_0003858 | Ga0495612_0003858_207_1091 | 294 |
| 959 | 3300053078 | Ga0495612_0011052 | Ga0495612_0011052_1959_2843 | 294 |
| 960 | 3300053078 | Ga0495612_0025831 | Ga0495612_0025831_875_1759 | 294 |
| 961 | 3300053083 | Ga0495655_0021718 | Ga0495655_0021718_242_1126 | 294 |
| 962 | 3300053084 | Ga0495595_0006203 | Ga0495595_0006203_784_1668 | 294 |
| 963 | 3300053084 | Ga0495595_0008416 | Ga0495595_0008416_1814_2698 | 294 |
| 964 | 3300053084 | Ga0495595_0022604 | Ga0495595_0022604_300_1184 | 294 |
| 965 | 3300053084 | Ga0495595_0232034 | Ga0495595_0232034_22_906 | 294 |
| 966 | 3300053085 | Ga0495619_0000343 | Ga0495619_0000343_12454_13338 | 294 |
| 967 | 3300053085 | Ga0495619_0006532 | Ga0495619_0006532_3073_3957 | 294 |
| 968 | 3300053085 | Ga0495619_0006775 | Ga0495619_0006775_5076_5960 | 294 |
| 969 | 3300054114 | Ga0501084_0153751 | Ga0501084_0153751_25_909 | 294 |
| 970 | 3300060353 | Ga0501082_0049053 | Ga0501082_0049053_989_1873 | 294 |
| 971 | 3300061719 | Ga0466962_0161774 | Ga0466962_0161774_125_1009 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF02882
THF_DHG_CYH_C
Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
159
321
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a5o-assembly2.cif.gz_D | crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) | 0.9799 | 2 | 283 |
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.9758 | 2 | 286 |
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.969 | 2 | 286 |
| 4a26-assembly1.cif.gz_A | the crystal structure of leishmania major n5,n10- methylenetetrahydrofolate dehydrogenase/cyclohydrolase | 0.967 | 2 | 290 |
| 6v6y-assembly1.cif.gz_A-2 | crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) | 0.9662 | 1 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9975 | 34 | 114 | 3.40.50.10860 |
| af_A0A0R0F3H3_60_174_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9948 | 13 | 125 | 3.40.50.10860 |
| af_K7KYI8_1_78_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9897 | 27 | 103 | 3.40.50.720 |
| 3l07A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9888 | 32 | 115 | 3.40.50.10860 |
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9854 | 34 | 114 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382NA53-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9996 | 1 | 110 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
| AF-J6DD83-F1-model_v4 | Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9954 | 1 | 116 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A3R7R7X4-F1-model_v4 | Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] | 0.9945 | 1 | 290 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A418NSJ9-F1-model_v4 | Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] | 0.9942 | 3 | 288 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A1Y3G7C1-F1-model_v4 | Methenyltetrahydrofolate cyclohydrolase | 0.9932 | 1 | 201 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar