F487124
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 971 | 422 | 965 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0006658|Ga0373936_0006658_269_1315 |
| Length | 348 |
| Sequence | MTSSATPFFERLCPRMTKKNDDQNDLTRLTMKICVAGQGAFGQKHLDALKRIPEVEVTSLVGGNQDATAQVAKKYGVPHFTGELAEGIKRADAVILTTPTKLHFRQGEQVMRAGKHVLVEIPVTDSVADAEALVKIAKATGVVAMGGHVRRFNPSHQWVHKRIQKGELKIQQMDVQTYFFRRKNINAAGQPRSWTDHLLWHHAAHTIDLFQYQAGETISDCYAVQGPIHPQLNIAMDMGIVAKTPSGAVLTLSLSFNNDGPLGSFFRYICDNGTYKAYYDDLSDGKDNKIDLSKVDVSMDGIELEDREFIAAIKQKRGPNASLAALLPCMHVLGRLEKIVDPQRNAHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 3 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 4 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 5 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 6 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 7 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 238 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 240 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 271 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 272 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 273 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 274 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 275 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 276 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 277 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 283 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 398 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 413 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 415 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 419 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.31 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.4 |
| Nodule | 0.1 |
| Rhizoplane | 8.65 |
| Rhizosphere | 84.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2628462 | 2162886007 | Bacteria | 3593 |
| 2 | SwRhRL2b_contig_58648 | 2162886007 | Bacteria | 3931 |
| 3 | JGI24746J21847_1002925 | 3300001977 | Bacteria | 2685 |
| 4 | JGI24743J22301_10008228 | 3300001991 | Bacteria | 1826 |
| 5 | JGI24738J21930_10002238 | 3300002075 | Bacteria | 5135 |
| 6 | JGI24034J26672_10016529 | 3300002239 | Bacteria | 1137 |
| 7 | JGI25406J46586_10019988 | 3300003203 | Bacteria | 2719 |
| 8 | JGI25153J46596_10001063 | 3300003215 | Bacteria | 16760 |
| 9 | rootL2_10020853 | 3300003322 | Bacteria | 2646 |
| 10 | JGI25405J52794_10017961 | 3300003911 | Bacteria | 1409 |
| 11 | Ga0055543_1018963 | 3300004625 | Bacteria | 1278 |
| 12 | Ga0065704_10113311 | 3300005289 | Bacteria | 1915 |
| 13 | Ga0065715_10280549 | 3300005293 | Bacteria | 1074 |
| 14 | Ga0065707_10099655 | 3300005295 | Bacteria | 2989 |
| 15 | Ga0065707_10133474 | 3300005295 | Bacteria | 1880 |
| 16 | Ga0065707_10153752 | 3300005295 | Bacteria | 1630 |
| 17 | Ga0070658_10000534 | 3300005327 | Bacteria | 33047 |
| 18 | Ga0070676_10154994 | 3300005328 | Bacteria | 1469 |
| 19 | Ga0070690_100000216 | 3300005330 | Bacteria | 30017 |
| 20 | Ga0070690_100012374 | 3300005330 | Bacteria | 5021 |
| 21 | Ga0070690_100068462 | 3300005330 | Bacteria | 2302 |
| 22 | Ga0070690_100373498 | 3300005330 | Bacteria | 1041 |
| 23 | Ga0070670_100081469 | 3300005331 | Bacteria | 2781 |
| 24 | Ga0070670_100098177 | 3300005331 | Bacteria | 2520 |
| 25 | Ga0070670_100153016 | 3300005331 | Bacteria | 1996 |
| 26 | Ga0070677_10007082 | 3300005333 | Bacteria | 3734 |
| 27 | Ga0070677_10023218 | 3300005333 | Bacteria | 2294 |
| 28 | Ga0068869_100000759 | 3300005334 | Bacteria | 18318 |
| 29 | Ga0068869_100242126 | 3300005334 | Bacteria | 1437 |
| 30 | Ga0070666_10010599 | 3300005335 | Bacteria | 5767 |
| 31 | Ga0070666_10064004 | 3300005335 | Bacteria | 2494 |
| 32 | Ga0070666_10114932 | 3300005335 | Bacteria | 1864 |
| 33 | Ga0070680_100003121 | 3300005336 | Bacteria | 12304 |
| 34 | Ga0070680_100006895 | 3300005336 | Bacteria | 8661 |
| 35 | Ga0070680_100008902 | 3300005336 | Bacteria | 7695 |
| 36 | Ga0070682_100004786 | 3300005337 | Bacteria | 7521 |
| 37 | Ga0068868_100004312 | 3300005338 | Bacteria | 9964 |
| 38 | Ga0068868_100005010 | 3300005338 | Bacteria | 9304 |
| 39 | Ga0068868_100051086 | 3300005338 | Bacteria | 3250 |
| 40 | Ga0070660_100138867 | 3300005339 | Bacteria | 1948 |
| 41 | Ga0070689_100000399 | 3300005340 | Bacteria | 25458 |
| 42 | Ga0070689_100006563 | 3300005340 | Bacteria | 8068 |
| 43 | Ga0070689_100053981 | 3300005340 | Bacteria | 3111 |
| 44 | Ga0070689_100148812 | 3300005340 | Bacteria | 1887 |
| 45 | Ga0070691_10000528 | 3300005341 | Bacteria | 14397 |
| 46 | Ga0070691_10062583 | 3300005341 | Bacteria | 1792 |
| 47 | Ga0070687_100000604 | 3300005343 | Bacteria | 11929 |
| 48 | Ga0070692_10002623 | 3300005345 | Bacteria | 7019 |
| 49 | Ga0070692_10057329 | 3300005345 | Bacteria | 2042 |
| 50 | Ga0070668_100213743 | 3300005347 | Bacteria | 1587 |
| 51 | Ga0070669_100013431 | 3300005353 | Bacteria | 5822 |
| 52 | Ga0070669_100085688 | 3300005353 | Bacteria | 2352 |
| 53 | Ga0070675_100011655 | 3300005354 | Bacteria | 6889 |
| 54 | Ga0070675_100076146 | 3300005354 | Bacteria | 2790 |
| 55 | Ga0070675_100141421 | 3300005354 | Bacteria | 2057 |
| 56 | Ga0070671_100001928 | 3300005355 | Bacteria | 15902 |
| 57 | Ga0070671_100019910 | 3300005355 | Bacteria | 5467 |
| 58 | Ga0070671_100023857 | 3300005355 | Bacteria | 5006 |
| 59 | Ga0070671_100054746 | 3300005355 | Bacteria | 3317 |
| 60 | Ga0070674_100000456 | 3300005356 | Bacteria | 20586 |
| 61 | Ga0070674_100159480 | 3300005356 | Bacteria | 1710 |
| 62 | Ga0070673_100026117 | 3300005364 | Bacteria | 4308 |
| 63 | Ga0070673_100066945 | 3300005364 | Bacteria | 2871 |
| 64 | Ga0070673_100145316 | 3300005364 | Bacteria | 2004 |
| 65 | Ga0070688_100022931 | 3300005365 | Bacteria | 3665 |
| 66 | Ga0070667_100012483 | 3300005367 | Bacteria | 7029 |
| 67 | Ga0070667_100027609 | 3300005367 | Bacteria | 4723 |
| 68 | Ga0070714_100007015 | 3300005435 | Bacteria | 8732 |
| 69 | Ga0070714_100021227 | 3300005435 | Bacteria | 5312 |
| 70 | Ga0070714_100186416 | 3300005435 | Bacteria | 1891 |
| 71 | Ga0070714_100346423 | 3300005435 | Bacteria | 1395 |
| 72 | Ga0070713_100005924 | 3300005436 | Bacteria | 8405 |
| 73 | Ga0070713_100043906 | 3300005436 | Bacteria | 3657 |
| 74 | Ga0070713_100321600 | 3300005436 | Bacteria | 1429 |
| 75 | Ga0070710_10005399 | 3300005437 | Bacteria | 6069 |
| 76 | Ga0070701_10129194 | 3300005438 | Bacteria | 1434 |
| 77 | Ga0070701_10227212 | 3300005438 | Bacteria | 1116 |
| 78 | Ga0070711_100010002 | 3300005439 | Bacteria | 5853 |
| 79 | Ga0070711_100023557 | 3300005439 | Bacteria | 4006 |
| 80 | Ga0070711_100034687 | 3300005439 | Bacteria | 3367 |
| 81 | Ga0070711_100164991 | 3300005439 | Bacteria | 1683 |
| 82 | Ga0070711_100495344 | 3300005439 | Bacteria | 1007 |
| 83 | Ga0070705_100000554 | 3300005440 | Bacteria | 21689 |
| 84 | Ga0070705_100072555 | 3300005440 | Bacteria | 2086 |
| 85 | Ga0070705_100149842 | 3300005440 | Bacteria | 1546 |
| 86 | Ga0070705_100292763 | 3300005440 | Bacteria | 1163 |
| 87 | Ga0070700_100000281 | 3300005441 | Bacteria | 27271 |
| 88 | Ga0070700_100044716 | 3300005441 | Bacteria | 2729 |
| 89 | Ga0070694_100000565 | 3300005444 | Bacteria | 20475 |
| 90 | Ga0070694_100070278 | 3300005444 | Bacteria | 2410 |
| 91 | Ga0070678_100035789 | 3300005456 | Bacteria | 3470 |
| 92 | Ga0070678_100184370 | 3300005456 | Bacteria | 1711 |
| 93 | Ga0070678_100292960 | 3300005456 | Bacteria | 1380 |
| 94 | Ga0070681_10001127 | 3300005458 | Bacteria | 22938 |
| 95 | Ga0070681_10118881 | 3300005458 | Bacteria | 2579 |
| 96 | Ga0070681_10154948 | 3300005458 | Bacteria | 2216 |
| 97 | Ga0070681_10320812 | 3300005458 | Bacteria | 1459 |
| 98 | Ga0070681_10414014 | 3300005458 | Bacteria | 1260 |
| 99 | Ga0068867_100000206 | 3300005459 | Bacteria | 39309 |
| 100 | Ga0068867_100103433 | 3300005459 | Bacteria | 2178 |
| 101 | Ga0070685_10005577 | 3300005466 | Bacteria | 6386 |
| 102 | Ga0070685_10146707 | 3300005466 | Bacteria | 1491 |
| 103 | Ga0070706_100306244 | 3300005467 | Bacteria | 1482 |
| 104 | Ga0070707_100128303 | 3300005468 | Bacteria | 2465 |
| 105 | Ga0070707_100602851 | 3300005468 | Bacteria | 1061 |
| 106 | Ga0070698_100365274 | 3300005471 | Bacteria | 1375 |
| 107 | Ga0070699_100184203 | 3300005518 | Bacteria | 1854 |
| 108 | Ga0070699_100276236 | 3300005518 | Bacteria | 1504 |
| 109 | Ga0070679_100003183 | 3300005530 | Bacteria | 15003 |
| 110 | Ga0070679_100034844 | 3300005530 | Bacteria | 4992 |
| 111 | Ga0070679_100149712 | 3300005530 | Bacteria | 2311 |
| 112 | Ga0070697_100121192 | 3300005536 | Bacteria | 2188 |
| 113 | Ga0070697_100180798 | 3300005536 | Bacteria | 1788 |
| 114 | Ga0068853_100063354 | 3300005539 | Bacteria | 3202 |
| 115 | Ga0070672_100268961 | 3300005543 | Bacteria | 1439 |
| 116 | Ga0070672_100293793 | 3300005543 | Bacteria | 1376 |
| 117 | Ga0070672_100314723 | 3300005543 | Bacteria | 1329 |
| 118 | Ga0070686_100000711 | 3300005544 | Bacteria | 19359 |
| 119 | Ga0070695_100000281 | 3300005545 | Bacteria | 25630 |
| 120 | Ga0070696_100004140 | 3300005546 | Bacteria | 9667 |
| 121 | Ga0070696_100010174 | 3300005546 | Bacteria | 6296 |
| 122 | Ga0070693_100000162 | 3300005547 | Bacteria | 30827 |
| 123 | Ga0070693_100364173 | 3300005547 | Bacteria | 993 |
| 124 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 125 | Ga0070665_100000169 | 3300005548 | Bacteria | 118043 |
| 126 | Ga0070665_100030114 | 3300005548 | Bacteria | 5461 |
| 127 | Ga0070665_100190176 | 3300005548 | Bacteria | 2054 |
| 128 | Ga0070704_100010913 | 3300005549 | Bacteria | 5540 |
| 129 | Ga0070704_100039001 | 3300005549 | Bacteria | 3258 |
| 130 | Ga0070704_100059317 | 3300005549 | Bacteria | 2729 |
| 131 | Ga0068855_100000265 | 3300005563 | Bacteria | 65271 |
| 132 | Ga0068855_100105928 | 3300005563 | Bacteria | 3233 |
| 133 | Ga0068855_100197575 | 3300005563 | Bacteria | 2266 |
| 134 | Ga0068857_100030804 | 3300005577 | Bacteria | 4739 |
| 135 | Ga0068856_100316903 | 3300005614 | Bacteria | 1577 |
| 136 | Ga0068856_100327474 | 3300005614 | Bacteria | 1549 |
| 137 | Ga0070702_100000093 | 3300005615 | Bacteria | 26493 |
| 138 | Ga0068859_100003739 | 3300005617 | Bacteria | 15512 |
| 139 | Ga0068859_100045750 | 3300005617 | Bacteria | 4397 |
| 140 | Ga0068859_100185952 | 3300005617 | Bacteria | 2161 |
| 141 | Ga0068859_100695399 | 3300005617 | Bacteria | 1108 |
| 142 | Ga0068864_100046863 | 3300005618 | Bacteria | 3710 |
| 143 | Ga0068866_10000256 | 3300005718 | Bacteria | 24958 |
| 144 | Ga0068861_100000355 | 3300005719 | Bacteria | 26109 |
| 145 | Ga0068870_10022034 | 3300005840 | Bacteria | 3126 |
| 146 | Ga0068870_10137642 | 3300005840 | Bacteria | 1425 |
| 147 | Ga0068863_100005225 | 3300005841 | Bacteria | 12813 |
| 148 | Ga0068863_100008798 | 3300005841 | Bacteria | 9858 |
| 149 | Ga0068863_100078963 | 3300005841 | Bacteria | 3117 |
| 150 | Ga0068863_100089193 | 3300005841 | Bacteria | 2923 |
| 151 | Ga0068863_100132536 | 3300005841 | Bacteria | 2379 |
| 152 | Ga0068858_100008078 | 3300005842 | Bacteria | 10133 |
| 153 | Ga0068858_100025135 | 3300005842 | Bacteria | 5542 |
| 154 | Ga0068860_100002594 | 3300005843 | Bacteria | 18905 |
| 155 | Ga0068860_100011906 | 3300005843 | Bacteria | 8573 |
| 156 | Ga0068860_100048947 | 3300005843 | Bacteria | 4028 |
| 157 | Ga0068860_100245021 | 3300005843 | Bacteria | 1744 |
| 158 | Ga0068860_100274649 | 3300005843 | Bacteria | 1646 |
| 159 | Ga0068862_100000381 | 3300005844 | Bacteria | 47919 |
| 160 | Ga0068862_100134173 | 3300005844 | Bacteria | 2193 |
| 161 | Ga0081455_10071704 | 3300005937 | Bacteria | 2870 |
| 162 | Ga0081538_10000697 | 3300005981 | Bacteria | 36894 |
| 163 | Ga0081538_10017125 | 3300005981 | Bacteria | 5516 |
| 164 | Ga0081540_1001984 | 3300005983 | Bacteria | 17080 |
| 165 | Ga0081540_1002003 | 3300005983 | Bacteria | 17000 |
| 166 | Ga0081540_1003649 | 3300005983 | Bacteria | 12076 |
| 167 | Ga0081540_1017724 | 3300005983 | Bacteria | 4398 |
| 168 | Ga0081540_1036127 | 3300005983 | Bacteria | 2639 |
| 169 | Ga0081540_1050173 | 3300005983 | Bacteria | 2075 |
| 170 | Ga0081539_10002187 | 3300005985 | Bacteria | 28690 |
| 171 | Ga0081539_10036902 | 3300005985 | Bacteria | 2917 |
| 172 | Ga0070717_10014290 | 3300006028 | Bacteria | 6106 |
| 173 | Ga0075363_100013539 | 3300006048 | Bacteria | 3957 |
| 174 | Ga0075364_10005843 | 3300006051 | Bacteria | 7184 |
| 175 | Ga0075364_10073975 | 3300006051 | Bacteria | 2246 |
| 176 | Ga0070715_10000633 | 3300006163 | Bacteria | 9317 |
| 177 | Ga0070715_10002046 | 3300006163 | Bacteria | 6082 |
| 178 | Ga0070715_10027128 | 3300006163 | Bacteria | 2285 |
| 179 | Ga0070716_100006982 | 3300006173 | Bacteria | 5536 |
| 180 | Ga0070716_100065105 | 3300006173 | Bacteria | 2121 |
| 181 | Ga0070716_100072447 | 3300006173 | Bacteria | 2029 |
| 182 | Ga0070712_100002594 | 3300006175 | Bacteria | 11168 |
| 183 | Ga0070712_100008343 | 3300006175 | Bacteria | 6514 |
| 184 | Ga0070712_100028995 | 3300006175 | Bacteria | 3708 |
| 185 | Ga0070712_100038140 | 3300006175 | Bacteria | 3282 |
| 186 | Ga0070712_100047227 | 3300006175 | Bacteria | 2979 |
| 187 | Ga0070712_100110880 | 3300006175 | Bacteria | 2047 |
| 188 | Ga0070712_100158867 | 3300006175 | Bacteria | 1744 |
| 189 | Ga0075362_10002160 | 3300006177 | Bacteria | 6508 |
| 190 | Ga0075362_10040981 | 3300006177 | Bacteria | 2040 |
| 191 | Ga0075367_10067123 | 3300006178 | Bacteria | 2150 |
| 192 | Ga0075367_10118426 | 3300006178 | Bacteria | 1630 |
| 193 | Ga0075369_10015935 | 3300006186 | Bacteria | 3025 |
| 194 | Ga0075366_10000931 | 3300006195 | Bacteria | 14208 |
| 195 | Ga0075366_10022054 | 3300006195 | Bacteria | 3703 |
| 196 | Ga0075366_10031321 | 3300006195 | Bacteria | 3129 |
| 197 | Ga0097621_100000303 | 3300006237 | Bacteria | 33347 |
| 198 | Ga0097621_100095350 | 3300006237 | Bacteria | 2495 |
| 199 | Ga0097621_100110302 | 3300006237 | Bacteria | 2324 |
| 200 | Ga0097621_100343669 | 3300006237 | Bacteria | 1325 |
| 201 | Ga0097621_100405247 | 3300006237 | Bacteria | 1222 |
| 202 | Ga0068871_100000925 | 3300006358 | Bacteria | 19583 |
| 203 | Ga0068871_100011094 | 3300006358 | Bacteria | 6604 |
| 204 | Ga0068871_100046071 | 3300006358 | Bacteria | 3511 |
| 205 | Ga0068871_100182244 | 3300006358 | Bacteria | 1805 |
| 206 | Ga0068871_100184289 | 3300006358 | Bacteria | 1795 |
| 207 | Ga0068871_100240442 | 3300006358 | Bacteria | 1574 |
| 208 | Ga0075428_100000083 | 3300006844 | Bacteria | 78689 |
| 209 | Ga0075428_100113402 | 3300006844 | Bacteria | 2953 |
| 210 | Ga0075428_100284076 | 3300006844 | Bacteria | 1780 |
| 211 | Ga0075430_100000163 | 3300006846 | Bacteria | 43947 |
| 212 | Ga0075430_100055653 | 3300006846 | Bacteria | 3326 |
| 213 | Ga0075431_100087790 | 3300006847 | Bacteria | 3209 |
| 214 | Ga0075433_10003177 | 3300006852 | Bacteria | 12656 |
| 215 | Ga0075434_100000064 | 3300006871 | Bacteria | 54394 |
| 216 | Ga0075434_100092271 | 3300006871 | Bacteria | 3030 |
| 217 | Ga0075429_100001065 | 3300006880 | Bacteria | 21974 |
| 218 | Ga0068865_100008534 | 3300006881 | Bacteria | 6333 |
| 219 | Ga0068865_100093321 | 3300006881 | Bacteria | 2188 |
| 220 | Ga0075436_100005135 | 3300006914 | Bacteria | 9013 |
| 221 | Ga0075436_100016682 | 3300006914 | Bacteria | 5027 |
| 222 | Ga0097620_100003738 | 3300006931 | Bacteria | 15512 |
| 223 | Ga0097620_100045750 | 3300006931 | Bacteria | 4397 |
| 224 | Ga0097620_100185959 | 3300006931 | Bacteria | 2161 |
| 225 | Ga0097620_100695358 | 3300006931 | Bacteria | 1108 |
| 226 | Ga0099826_10035411 | 3300006948 | Bacteria | 3551 |
| 227 | Ga0075435_100000586 | 3300007076 | Bacteria | 22266 |
| 228 | Ga0075435_100302692 | 3300007076 | Bacteria | 1367 |
| 229 | Ga0099795_10029911 | 3300007788 | Bacteria | 1865 |
| 230 | Ga0099795_10076325 | 3300007788 | Bacteria | 1274 |
| 231 | Ga0105251_10004488 | 3300009011 | Bacteria | 9471 |
| 232 | Ga0105240_10000369 | 3300009093 | Bacteria | 84513 |
| 233 | Ga0105245_10000696 | 3300009098 | Bacteria | 30300 |
| 234 | Ga0105245_10002702 | 3300009098 | Bacteria | 15962 |
| 235 | Ga0105245_10011796 | 3300009098 | Bacteria | 7603 |
| 236 | Ga0105245_10167384 | 3300009098 | Bacteria | 2090 |
| 237 | Ga0105247_10019849 | 3300009101 | Bacteria | 4037 |
| 238 | Ga0105247_10109570 | 3300009101 | Bacteria | 1775 |
| 239 | Ga0114129_10000210 | 3300009147 | Bacteria | 65476 |
| 240 | Ga0114129_10087181 | 3300009147 | Bacteria | 4329 |
| 241 | Ga0105243_10000631 | 3300009148 | Bacteria | 34959 |
| 242 | Ga0105243_10153892 | 3300009148 | Bacteria | 1976 |
| 243 | Ga0105243_10173670 | 3300009148 | Bacteria | 1869 |
| 244 | Ga0105243_10197316 | 3300009148 | Bacteria | 1763 |
| 245 | Ga0105242_10003476 | 3300009176 | Bacteria | 12246 |
| 246 | Ga0105242_10009816 | 3300009176 | Bacteria | 7334 |
| 247 | Ga0105242_10020603 | 3300009176 | Bacteria | 5172 |
| 248 | Ga0105242_10088017 | 3300009176 | Bacteria | 2608 |
| 249 | Ga0105248_10465993 | 3300009177 | Bacteria | 1424 |
| 250 | Ga0105237_10024199 | 3300009545 | Bacteria | 6213 |
| 251 | Ga0105237_10183495 | 3300009545 | Bacteria | 2092 |
| 252 | Ga0105237_10456475 | 3300009545 | Bacteria | 1284 |
| 253 | Ga0105249_10003937 | 3300009553 | Bacteria | 12818 |
| 254 | Ga0099796_10000419 | 3300010159 | Bacteria | 7045 |
| 255 | Ga0105239_10123372 | 3300010375 | Bacteria | 2878 |
| 256 | Ga0105239_10253032 | 3300010375 | Bacteria | 1979 |
| 257 | Ga0105246_10229808 | 3300011119 | Bacteria | 1460 |
| 258 | Ga0105246_10422784 | 3300011119 | Bacteria | 1113 |
| 259 | Ga0157370_10010690 | 3300013104 | Bacteria | 9656 |
| 260 | Ga0157369_10002769 | 3300013105 | Bacteria | 20942 |
| 261 | Ga0157369_10213752 | 3300013105 | Bacteria | 2021 |
| 262 | Ga0157369_10359901 | 3300013105 | Bacteria | 1511 |
| 263 | Ga0157374_10012098 | 3300013296 | Bacteria | 7494 |
| 264 | Ga0157378_10001488 | 3300013297 | Bacteria | 21162 |
| 265 | Ga0163162_10030087 | 3300013306 | Bacteria | 5379 |
| 266 | Ga0163162_10065362 | 3300013306 | Bacteria | 3684 |
| 267 | Ga0163162_10342000 | 3300013306 | Bacteria | 1629 |
| 268 | Ga0157372_10507890 | 3300013307 | Bacteria | 1405 |
| 269 | Ga0157375_10020483 | 3300013308 | Bacteria | 6043 |
| 270 | Ga0157375_10117196 | 3300013308 | Bacteria | 2768 |
| 271 | Ga0157375_10957914 | 3300013308 | Bacteria | 997 |
| 272 | Ga0163163_10001830 | 3300014325 | Bacteria | 17956 |
| 273 | Ga0163163_10275912 | 3300014325 | Bacteria | 1732 |
| 274 | Ga0157380_10017000 | 3300014326 | Bacteria | 5373 |
| 275 | Ga0157380_10019019 | 3300014326 | Bacteria | 5112 |
| 276 | Ga0182008_10146347 | 3300014497 | Bacteria | 1184 |
| 277 | Ga0157379_10016937 | 3300014968 | Bacteria | 6412 |
| 278 | Ga0157376_10013769 | 3300014969 | Bacteria | 6047 |
| 279 | Ga0182007_10071314 | 3300015262 | Bacteria | 1138 |
| 280 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 281 | Ga0163161_10238579 | 3300017792 | Bacteria | 1413 |
| 282 | Ga0163161_10291552 | 3300017792 | Bacteria | 1283 |
| 283 | Ga0206350_10617166 | 3300020080 | Bacteria | 1254 |
| 284 | Ga0206350_11377320 | 3300020080 | Bacteria | 1270 |
| 285 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 286 | Ga0213872_10009977 | 3300021361 | Bacteria | 4533 |
| 287 | Ga0213872_10039685 | 3300021361 | Bacteria | 2148 |
| 288 | Ga0213876_10024910 | 3300021384 | Bacteria | 3159 |
| 289 | Ga0213876_10102662 | 3300021384 | Bacteria | 1516 |
| 290 | Ga0213875_10036455 | 3300021388 | Bacteria | 2319 |
| 291 | Ga0228598_1002924 | 3300024227 | Bacteria | 3708 |
| 292 | Ga0209758_1000079 | 3300025297 | Bacteria | 262874 |
| 293 | Ga0207713_1002844 | 3300025735 | Bacteria | 12178 |
| 294 | Ga0207653_10008178 | 3300025885 | Bacteria | 3261 |
| 295 | Ga0207682_10000543 | 3300025893 | Bacteria | 17394 |
| 296 | Ga0207682_10003858 | 3300025893 | Bacteria | 6429 |
| 297 | Ga0207642_10095412 | 3300025899 | Bacteria | 1480 |
| 298 | Ga0207710_10013829 | 3300025900 | Bacteria | 3398 |
| 299 | Ga0207680_10015096 | 3300025903 | Bacteria | 4021 |
| 300 | Ga0207680_10177686 | 3300025903 | Bacteria | 1438 |
| 301 | Ga0207647_10057890 | 3300025904 | Bacteria | 2375 |
| 302 | Ga0207685_10004756 | 3300025905 | Bacteria | 3495 |
| 303 | Ga0207685_10021335 | 3300025905 | Bacteria | 2169 |
| 304 | Ga0207699_10012944 | 3300025906 | Bacteria | 4254 |
| 305 | Ga0207699_10029996 | 3300025906 | Bacteria | 3039 |
| 306 | Ga0207699_10235555 | 3300025906 | Bacteria | 1255 |
| 307 | Ga0207645_10025828 | 3300025907 | Bacteria | 3799 |
| 308 | Ga0207645_10027950 | 3300025907 | Bacteria | 3641 |
| 309 | Ga0207643_10001848 | 3300025908 | Bacteria | 11707 |
| 310 | Ga0207705_10002747 | 3300025909 | Bacteria | 13484 |
| 311 | Ga0207684_10011372 | 3300025910 | Bacteria | 7790 |
| 312 | Ga0207684_10195609 | 3300025910 | Bacteria | 1744 |
| 313 | Ga0207684_10274560 | 3300025910 | Bacteria | 1454 |
| 314 | Ga0207707_10006531 | 3300025912 | Bacteria | 10178 |
| 315 | Ga0207707_10062009 | 3300025912 | Bacteria | 3253 |
| 316 | Ga0207707_10116094 | 3300025912 | Bacteria | 2339 |
| 317 | Ga0207707_10217828 | 3300025912 | Bacteria | 1662 |
| 318 | Ga0207695_10014477 | 3300025913 | Bacteria | 9337 |
| 319 | Ga0207693_10000068 | 3300025915 | Bacteria | 91004 |
| 320 | Ga0207693_10000855 | 3300025915 | Bacteria | 27188 |
| 321 | Ga0207693_10007507 | 3300025915 | Bacteria | 8954 |
| 322 | Ga0207693_10023422 | 3300025915 | Bacteria | 4903 |
| 323 | Ga0207693_10101537 | 3300025915 | Bacteria | 2256 |
| 324 | Ga0207663_10007458 | 3300025916 | Bacteria | 5673 |
| 325 | Ga0207660_10003314 | 3300025917 | Bacteria | 10518 |
| 326 | Ga0207660_10010746 | 3300025917 | Bacteria | 5949 |
| 327 | Ga0207662_10000257 | 3300025918 | Bacteria | 24677 |
| 328 | Ga0207662_10009537 | 3300025918 | Bacteria | 5347 |
| 329 | Ga0207657_10182571 | 3300025919 | Bacteria | 1695 |
| 330 | Ga0207652_10014091 | 3300025921 | Bacteria | 6473 |
| 331 | Ga0207652_10054007 | 3300025921 | Bacteria | 3453 |
| 332 | Ga0207652_10111925 | 3300025921 | Bacteria | 2421 |
| 333 | Ga0207652_10112577 | 3300025921 | Bacteria | 2415 |
| 334 | Ga0207652_10258852 | 3300025921 | Bacteria | 1569 |
| 335 | Ga0207646_10108859 | 3300025922 | Bacteria | 2486 |
| 336 | Ga0207681_10034479 | 3300025923 | Bacteria | 3328 |
| 337 | Ga0207681_10062274 | 3300025923 | Bacteria | 2568 |
| 338 | Ga0207650_10030542 | 3300025925 | Bacteria | 3882 |
| 339 | Ga0207650_10068465 | 3300025925 | Bacteria | 2666 |
| 340 | Ga0207650_10091002 | 3300025925 | Bacteria | 2330 |
| 341 | Ga0207659_10125838 | 3300025926 | Bacteria | 1971 |
| 342 | Ga0207659_10142786 | 3300025926 | Bacteria | 1860 |
| 343 | Ga0207659_10182438 | 3300025926 | Bacteria | 1664 |
| 344 | Ga0207659_10365432 | 3300025926 | Bacteria | 1200 |
| 345 | Ga0207659_10366032 | 3300025926 | Bacteria | 1199 |
| 346 | Ga0207687_10002535 | 3300025927 | Bacteria | 12403 |
| 347 | Ga0207687_10062110 | 3300025927 | Bacteria | 2640 |
| 348 | Ga0207687_10279310 | 3300025927 | Bacteria | 1338 |
| 349 | Ga0207700_10050072 | 3300025928 | Bacteria | 3111 |
| 350 | Ga0207700_10073659 | 3300025928 | Bacteria | 2638 |
| 351 | Ga0207700_10127448 | 3300025928 | Bacteria | 2073 |
| 352 | Ga0207700_10252912 | 3300025928 | Bacteria | 1506 |
| 353 | Ga0207700_10315408 | 3300025928 | Bacteria | 1354 |
| 354 | Ga0207664_10040999 | 3300025929 | Bacteria | 3604 |
| 355 | Ga0207664_10201736 | 3300025929 | Bacteria | 1717 |
| 356 | Ga0207664_10229820 | 3300025929 | Bacteria | 1612 |
| 357 | Ga0207644_10000409 | 3300025931 | Bacteria | 28023 |
| 358 | Ga0207644_10016411 | 3300025931 | Bacteria | 4981 |
| 359 | Ga0207644_10031985 | 3300025931 | Bacteria | 3669 |
| 360 | Ga0207644_10276929 | 3300025931 | Bacteria | 1346 |
| 361 | Ga0207706_10038152 | 3300025933 | Bacteria | 4262 |
| 362 | Ga0207706_10121373 | 3300025933 | Bacteria | 2298 |
| 363 | Ga0207686_10014985 | 3300025934 | Bacteria | 4327 |
| 364 | Ga0207709_10000662 | 3300025935 | Bacteria | 27921 |
| 365 | Ga0207709_10145655 | 3300025935 | Bacteria | 1634 |
| 366 | Ga0207670_10000333 | 3300025936 | Bacteria | 27980 |
| 367 | Ga0207670_10002665 | 3300025936 | Bacteria | 9390 |
| 368 | Ga0207670_10004310 | 3300025936 | Bacteria | 7639 |
| 369 | Ga0207670_10020940 | 3300025936 | Bacteria | 4025 |
| 370 | Ga0207670_10205270 | 3300025936 | Bacteria | 1499 |
| 371 | Ga0207669_10030218 | 3300025937 | Bacteria | 3008 |
| 372 | Ga0207669_10134855 | 3300025937 | Bacteria | 1703 |
| 373 | Ga0207669_10210730 | 3300025937 | Bacteria | 1418 |
| 374 | Ga0207704_10000798 | 3300025938 | Bacteria | 13929 |
| 375 | Ga0207704_10010936 | 3300025938 | Bacteria | 4448 |
| 376 | Ga0207704_10206684 | 3300025938 | Bacteria | 1441 |
| 377 | Ga0207704_10242318 | 3300025938 | Bacteria | 1348 |
| 378 | Ga0207665_10003244 | 3300025939 | Bacteria | 10891 |
| 379 | Ga0207665_10023145 | 3300025939 | Bacteria | 4091 |
| 380 | Ga0207665_10037567 | 3300025939 | Bacteria | 3224 |
| 381 | Ga0207691_10020089 | 3300025940 | Bacteria | 6318 |
| 382 | Ga0207691_10044610 | 3300025940 | Bacteria | 4080 |
| 383 | Ga0207691_10161849 | 3300025940 | Bacteria | 1963 |
| 384 | Ga0207711_10014397 | 3300025941 | Bacteria | 6568 |
| 385 | Ga0207711_10055281 | 3300025941 | Bacteria | 3408 |
| 386 | Ga0207711_10062514 | 3300025941 | Bacteria | 3211 |
| 387 | Ga0207711_10141067 | 3300025941 | Bacteria | 2168 |
| 388 | Ga0207689_10001220 | 3300025942 | Bacteria | 24704 |
| 389 | Ga0207689_10014839 | 3300025942 | Bacteria | 6614 |
| 390 | Ga0207689_10119685 | 3300025942 | Bacteria | 2166 |
| 391 | Ga0207689_10128018 | 3300025942 | Bacteria | 2088 |
| 392 | Ga0207689_10157051 | 3300025942 | Bacteria | 1875 |
| 393 | Ga0207679_10207272 | 3300025945 | Bacteria | 1642 |
| 394 | Ga0207667_10000029 | 3300025949 | Bacteria | 329192 |
| 395 | Ga0207667_10011463 | 3300025949 | Bacteria | 10301 |
| 396 | Ga0207667_10012740 | 3300025949 | Bacteria | 9659 |
| 397 | Ga0207651_10009279 | 3300025960 | Bacteria | 5373 |
| 398 | Ga0207651_10178410 | 3300025960 | Bacteria | 1682 |
| 399 | Ga0207712_10048334 | 3300025961 | Bacteria | 2959 |
| 400 | Ga0207668_10017068 | 3300025972 | Bacteria | 4541 |
| 401 | Ga0207668_10405555 | 3300025972 | Bacteria | 1153 |
| 402 | Ga0207640_10004352 | 3300025981 | Bacteria | 7673 |
| 403 | Ga0207658_10019851 | 3300025986 | Bacteria | 4650 |
| 404 | Ga0207658_10312615 | 3300025986 | Bacteria | 1357 |
| 405 | Ga0207677_10049518 | 3300026023 | Bacteria | 2836 |
| 406 | Ga0207678_10002574 | 3300026067 | Bacteria | 16522 |
| 407 | Ga0207708_10000993 | 3300026075 | Bacteria | 21204 |
| 408 | Ga0207708_10008364 | 3300026075 | Bacteria | 7659 |
| 409 | Ga0207708_10015584 | 3300026075 | Bacteria | 5700 |
| 410 | Ga0207702_10040209 | 3300026078 | Bacteria | 3920 |
| 411 | Ga0207702_10176628 | 3300026078 | Bacteria | 1963 |
| 412 | Ga0207702_10210465 | 3300026078 | Bacteria | 1807 |
| 413 | Ga0207702_10300355 | 3300026078 | Bacteria | 1524 |
| 414 | Ga0207641_10066100 | 3300026088 | Bacteria | 3095 |
| 415 | Ga0207641_10172491 | 3300026088 | Bacteria | 1975 |
| 416 | Ga0207648_10000840 | 3300026089 | Bacteria | 34588 |
| 417 | Ga0207648_10001304 | 3300026089 | Bacteria | 27765 |
| 418 | Ga0207648_10051080 | 3300026089 | Bacteria | 3613 |
| 419 | Ga0207676_10018327 | 3300026095 | Bacteria | 5088 |
| 420 | Ga0207676_10441243 | 3300026095 | Bacteria | 1225 |
| 421 | Ga0207674_10067184 | 3300026116 | Bacteria | 3610 |
| 422 | Ga0207674_10187815 | 3300026116 | Bacteria | 2017 |
| 423 | Ga0207675_100000900 | 3300026118 | Bacteria | 29714 |
| 424 | Ga0207675_100002492 | 3300026118 | Bacteria | 18230 |
| 425 | Ga0207675_100152416 | 3300026118 | Bacteria | 2201 |
| 426 | Ga0207675_100182211 | 3300026118 | Bacteria | 2011 |
| 427 | Ga0207683_10002913 | 3300026121 | Bacteria | 14927 |
| 428 | Ga0207683_10015669 | 3300026121 | Bacteria | 6452 |
| 429 | Ga0207683_10242126 | 3300026121 | Bacteria | 1645 |
| 430 | Ga0207683_10353005 | 3300026121 | Bacteria | 1350 |
| 431 | Ga0207698_10169618 | 3300026142 | Bacteria | 1920 |
| 432 | Ga0209969_1002388 | 3300027360 | Bacteria | 2597 |
| 433 | Ga0209967_1007468 | 3300027364 | Bacteria | 1495 |
| 434 | Ga0209179_1014773 | 3300027512 | Bacteria | 1439 |
| 435 | Ga0209968_1005378 | 3300027526 | Bacteria | 1927 |
| 436 | Ga0209999_1000224 | 3300027543 | Bacteria | 8056 |
| 437 | Ga0207428_10000321 | 3300027907 | Bacteria | 62664 |
| 438 | Ga0207428_10046915 | 3300027907 | Bacteria | 3471 |
| 439 | Ga0265357_1005616 | 3300028023 | Bacteria | 1165 |
| 440 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 441 | Ga0268266_10001173 | 3300028379 | Bacteria | 32393 |
| 442 | Ga0268265_10005803 | 3300028380 | Bacteria | 8422 |
| 443 | Ga0268265_10241621 | 3300028380 | Bacteria | 1594 |
| 444 | Ga0268265_10388220 | 3300028380 | Bacteria | 1286 |
| 445 | Ga0268264_10003658 | 3300028381 | Bacteria | 13220 |
| 446 | Ga0268264_10023040 | 3300028381 | Bacteria | 5081 |
| 447 | Ga0268264_10169224 | 3300028381 | Bacteria | 1975 |
| 448 | Ga0265337_1001602 | 3300028556 | Bacteria | 11051 |
| 449 | Ga0265334_10000375 | 3300028573 | Bacteria | 23930 |
| 450 | Ga0307515_10000292 | 3300028794 | Bacteria | 123160 |
| 451 | Ga0265338_10017937 | 3300028800 | Bacteria | 7601 |
| 452 | Ga0265760_10022541 | 3300031090 | Bacteria | 1825 |
| 453 | Ga0265330_10025350 | 3300031235 | Bacteria | 2688 |
| 454 | Ga0265332_10090049 | 3300031238 | Bacteria | 1298 |
| 455 | Ga0265320_10064213 | 3300031240 | Bacteria | 1744 |
| 456 | Ga0265325_10000649 | 3300031241 | Bacteria | 25279 |
| 457 | Ga0265325_10086558 | 3300031241 | Bacteria | 1550 |
| 458 | Ga0265325_10093049 | 3300031241 | Bacteria | 1484 |
| 459 | Ga0265329_10006400 | 3300031242 | Bacteria | 4672 |
| 460 | Ga0265340_10058038 | 3300031247 | Bacteria | 1859 |
| 461 | Ga0265340_10075674 | 3300031247 | Bacteria | 1590 |
| 462 | Ga0265340_10114843 | 3300031247 | Bacteria | 1242 |
| 463 | Ga0265339_10000269 | 3300031249 | Bacteria | 41988 |
| 464 | Ga0265339_10036335 | 3300031249 | Bacteria | 2758 |
| 465 | Ga0265316_10183496 | 3300031344 | Bacteria | 1557 |
| 466 | Ga0307408_100070914 | 3300031548 | Bacteria | 2574 |
| 467 | Ga0265313_10022761 | 3300031595 | Bacteria | 3391 |
| 468 | Ga0307508_10089616 | 3300031616 | Bacteria | 2661 |
| 469 | Ga0265314_10038574 | 3300031711 | Bacteria | 3449 |
| 470 | Ga0265314_10043616 | 3300031711 | Bacteria | 3187 |
| 471 | Ga0265342_10043768 | 3300031712 | Bacteria | 2700 |
| 472 | Ga0307405_10012768 | 3300031731 | Bacteria | 4461 |
| 473 | Ga0307413_10001952 | 3300031824 | Bacteria | 8191 |
| 474 | Ga0307406_10004403 | 3300031901 | Bacteria | 7660 |
| 475 | Ga0307407_10013466 | 3300031903 | Bacteria | 3971 |
| 476 | Ga0307412_10007438 | 3300031911 | Bacteria | 6212 |
| 477 | Ga0307414_10227671 | 3300032004 | Bacteria | 1535 |
| 478 | Ga0307411_10003851 | 3300032005 | Bacteria | 7067 |
| 479 | Ga0307415_100005865 | 3300032126 | Bacteria | 6568 |
| 480 | Ga0316583_10005706 | 3300032133 | Bacteria | 4476 |
| 481 | Ga0373930_0015062 | 3300034816 | Bacteria | 1448 |
| 482 | Ga0373926_0003071 | 3300035083 | Bacteria | 5358 |
| 483 | Ga0373926_0016641 | 3300035083 | Bacteria | 2518 |
| 484 | Ga0373928_0004469 | 3300035084 | Bacteria | 2666 |
| 485 | Ga0373929_0012853 | 3300035085 | Bacteria | 1596 |
| 486 | Ga0373940_0019433 | 3300035088 | Bacteria | 1716 |
| 487 | Ga0373944_0018964 | 3300035089 | Bacteria | 1969 |
| 488 | Ga0373944_0036368 | 3300035089 | Bacteria | 1504 |
| 489 | Ga0373944_0103233 | 3300035089 | Bacteria | 966 |
| 490 | Ga0373951_0005912 | 3300035091 | Bacteria | 2824 |
| 491 | Ga0373952_0003713 | 3300035092 | Bacteria | 2758 |
| 492 | Ga0373932_0001983 | 3300035112 | Bacteria | 5402 |
| 493 | Ga0373936_0006658 | 3300035113 | Bacteria | 4350 |
| 494 | Ga0373936_0029845 | 3300035113 | Bacteria | 2148 |
| 495 | Ga0373945_0000969 | 3300035116 | Bacteria | 8556 |
| 496 | Ga0373945_0003484 | 3300035116 | Bacteria | 4953 |
| 497 | Ga0373945_0006884 | 3300035116 | Bacteria | 3675 |
| 498 | Ga0373953_0020708 | 3300035117 | Bacteria | 2459 |
| 499 | Ga0373954_0032131 | 3300035118 | Bacteria | 2426 |
| 500 | Ga0373954_0056964 | 3300035118 | Bacteria | 1840 |
| 501 | Ga0373954_0125623 | 3300035118 | Bacteria | 1247 |
| 502 | Ga0373956_0026912 | 3300035119 | Bacteria | 2493 |
| 503 | Ga0373957_0037722 | 3300035120 | Bacteria | 1806 |
| 504 | Ga0373960_0033881 | 3300035121 | Bacteria | 1442 |
| 505 | Ga0373943_0000185 | 3300035170 | Bacteria | 24985 |
| 506 | Ga0373943_0014863 | 3300035170 | Bacteria | 3532 |
| 507 | Ga0373943_0083775 | 3300035170 | Bacteria | 1639 |
| 508 | Ga0373943_0152461 | 3300035170 | Bacteria | 1253 |
| 509 | Ga0373946_0000642 | 3300035171 | Bacteria | 11673 |
| 510 | Ga0373946_0174843 | 3300035171 | Bacteria | 1016 |
| 511 | Ga0373955_0001304 | 3300035172 | Bacteria | 10611 |
| 512 | Ga0373955_0002912 | 3300035172 | Bacteria | 7514 |
| 513 | Ga0373955_0003944 | 3300035172 | Bacteria | 6545 |
| 514 | Ga0373955_0068444 | 3300035172 | Bacteria | 1978 |
| 515 | Ga0373961_0006705 | 3300035241 | Bacteria | 2768 |
| 516 | Ga0373962_0012148 | 3300035242 | Bacteria | 2166 |
| 517 | Ga0373962_0019134 | 3300035242 | Bacteria | 1789 |
| 518 | Ga0373924_0008512 | 3300035410 | Bacteria | 3732 |
| 519 | Ga0373924_0020013 | 3300035410 | Bacteria | 2598 |
| 520 | Ga0373931_0000134 | 3300035691 | Bacteria | 33430 |
| 521 | Ga0373931_0054056 | 3300035691 | Bacteria | 2145 |
| 522 | Ga0373931_0140963 | 3300035691 | Bacteria | 1396 |
| 523 | Ga0373931_0179923 | 3300035691 | Bacteria | 1251 |
| 524 | Ga0373935_0000023 | 3300035692 | Bacteria | 61461 |
| 525 | Ga0373935_0010837 | 3300035692 | Bacteria | 5476 |
| 526 | Ga0373935_0039428 | 3300035692 | Bacteria | 2962 |
| 527 | Ga0373935_0124974 | 3300035692 | Bacteria | 1722 |
| 528 | Ga0373935_0163631 | 3300035692 | Bacteria | 1518 |
| 529 | Ga0373935_0176776 | 3300035692 | Bacteria | 1463 |
| 530 | Ga0373927_0000434 | 3300035695 | Bacteria | 32038 |
| 531 | Ga0373927_0013020 | 3300035695 | Bacteria | 5532 |
| 532 | Ga0373927_0020220 | 3300035695 | Bacteria | 4365 |
| 533 | Ga0373927_0041756 | 3300035695 | Bacteria | 2974 |
| 534 | Ga0373927_0051817 | 3300035695 | Bacteria | 2654 |
| 535 | Ga0373927_0070058 | 3300035695 | Bacteria | 2270 |
| 536 | Ga0373927_0072642 | 3300035695 | Bacteria | 2227 |
| 537 | Ga0373933_0001503 | 3300035724 | Bacteria | 13639 |
| 538 | Ga0373933_0006249 | 3300035724 | Bacteria | 6484 |
| 539 | Ga0373933_0011490 | 3300035724 | Bacteria | 4883 |
| 540 | Ga0373947_0000583 | 3300035725 | Bacteria | 21422 |
| 541 | Ga0373947_0017670 | 3300035725 | Bacteria | 4104 |
| 542 | Ga0373947_0070482 | 3300035725 | Bacteria | 2142 |
| 543 | Ga0373947_0208520 | 3300035725 | Bacteria | 1281 |
| 544 | Ga0373947_0213124 | 3300035725 | Bacteria | 1267 |
| 545 | Ga0373937_0000005 | 3300036401 | Bacteria | 199965 |
| 546 | Ga0373937_0003414 | 3300036401 | Bacteria | 13333 |
| 547 | Ga0373937_0008905 | 3300036401 | Bacteria | 8714 |
| 548 | Ga0373937_0009993 | 3300036401 | Bacteria | 8274 |
| 549 | Ga0373937_0010352 | 3300036401 | Bacteria | 8143 |
| 550 | Ga0373937_0091795 | 3300036401 | Bacteria | 2814 |
| 551 | Ga0373925_0000007 | 3300037068 | Bacteria | 257023 |
| 552 | Ga0373925_0000749 | 3300037068 | Bacteria | 29795 |
| 553 | Ga0373925_0030549 | 3300037068 | Bacteria | 3955 |
| 554 | Ga0373925_0104188 | 3300037068 | Bacteria | 2184 |
| 555 | Ga0373925_0107062 | 3300037068 | Bacteria | 2156 |
| 556 | Ga0373925_0132701 | 3300037068 | Bacteria | 1943 |
| 557 | Ga0373925_0330088 | 3300037068 | Bacteria | 1235 |
| 558 | Ga0395898_0152595 | 3300037466 | Bacteria | 2210 |
| 559 | Ga0395898_0182889 | 3300037466 | Bacteria | 2003 |
| 560 | Ga0436364_0611812 | 3300037853 | Bacteria | 1686 |
| 561 | Ga0436364_1488218 | 3300037853 | Bacteria | 1913 |
| 562 | Ga0436365_0053879 | 3300039437 | Bacteria | 2344 |
| 563 | Ga0436365_0072895 | 3300039437 | Bacteria | 53725 |
| 564 | Ga0436365_0120456 | 3300039437 | Bacteria | 3440 |
| 565 | Ga0436365_0395269 | 3300039437 | Bacteria | 1213 |
| 566 | Ga0436365_1548351 | 3300039437 | Bacteria | 1282 |
| 567 | Ga0436365_1582443 | 3300039437 | Bacteria | 6857 |
| 568 | Ga0436365_1849126 | 3300039437 | Bacteria | 3360 |
| 569 | Ga0436360_0157058 | 3300039438 | Bacteria | 1376 |
| 570 | Ga0436360_0793447 | 3300039438 | Bacteria | 1379 |
| 571 | Ga0436360_1115848 | 3300039438 | Bacteria | 1921 |
| 572 | Ga0436361_0028664 | 3300039447 | Bacteria | 69721 |
| 573 | Ga0436361_0081134 | 3300039447 | Bacteria | 1491 |
| 574 | Ga0436361_0200590 | 3300039447 | Bacteria | 2148 |
| 575 | Ga0436361_0328438 | 3300039447 | Bacteria | 1311 |
| 576 | Ga0436361_0340102 | 3300039447 | Bacteria | 1972 |
| 577 | Ga0436363_0460787 | 3300039450 | Bacteria | 1715 |
| 578 | Ga0436363_1144933 | 3300039450 | Bacteria | 1753 |
| 579 | Ga0436362_0233360 | 3300039453 | Bacteria | 1195 |
| 580 | Ga0436362_0463249 | 3300039453 | Bacteria | 4420 |
| 581 | Ga0436362_0742152 | 3300039453 | Bacteria | 1104 |
| 582 | Ga0436362_0992192 | 3300039453 | Bacteria | 2095 |
| 583 | Ga0436362_1187034 | 3300039453 | Bacteria | 1608 |
| 584 | Ga0451807_0095181 | 3300041486 | Bacteria | 3744 |
| 585 | Ga0439434_0000107 | 3300042435 | Bacteria | 21642 |
| 586 | Ga0439434_0027711 | 3300042435 | Bacteria | 1714 |
| 587 | Ga0439435_0000076 | 3300042436 | Bacteria | 11878 |
| 588 | Ga0451577_0000863 | 3300042876 | Bacteria | 45151 |
| 589 | Ga0451577_0100523 | 3300042876 | Bacteria | 2583 |
| 590 | Ga0466963_0016237 | 3300044694 | Bacteria | 4628 |
| 591 | Ga0466957_0067767 | 3300044842 | Bacteria | 2202 |
| 592 | Ga0466959_0064196 | 3300045049 | Bacteria | 2666 |
| 593 | Ga0451576_0001387 | 3300045051 | Bacteria | 41619 |
| 594 | Ga0466958_0000079 | 3300045836 | Bacteria | 29664 |
| 595 | Ga0495627_051507 | 3300046453 | Bacteria | 1237 |
| 596 | Ga0495592_0007203 | 3300046454 | Bacteria | 8333 |
| 597 | Ga0495592_0021131 | 3300046454 | Bacteria | 4949 |
| 598 | Ga0495592_0034241 | 3300046454 | Bacteria | 3829 |
| 599 | Ga0495592_0038795 | 3300046454 | Bacteria | 3582 |
| 600 | Ga0495592_0072080 | 3300046454 | Bacteria | 2514 |
| 601 | Ga0495592_0231287 | 3300046454 | Bacteria | 1231 |
| 602 | Ga0495603_0025282 | 3300046455 | Bacteria | 3591 |
| 603 | Ga0495603_0237504 | 3300046455 | Bacteria | 1050 |
| 604 | Ga0495629_0012162 | 3300046459 | Bacteria | 6236 |
| 605 | Ga0495629_0017119 | 3300046459 | Bacteria | 5199 |
| 606 | Ga0495629_0153118 | 3300046459 | Bacteria | 1602 |
| 607 | Ga0495638_0008417 | 3300046460 | Bacteria | 7317 |
| 608 | Ga0495638_0040866 | 3300046460 | Bacteria | 2937 |
| 609 | Ga0495641_0020520 | 3300046461 | Bacteria | 3347 |
| 610 | Ga0495651_0001105 | 3300046462 | Bacteria | 20821 |
| 611 | Ga0495651_0007669 | 3300046462 | Bacteria | 8251 |
| 612 | Ga0495651_0050378 | 3300046462 | Bacteria | 3212 |
| 613 | Ga0495653_0000308 | 3300046463 | Bacteria | 39628 |
| 614 | Ga0495653_0001999 | 3300046463 | Bacteria | 16036 |
| 615 | Ga0495580_0001449 | 3300046472 | Bacteria | 20800 |
| 616 | Ga0495580_0058208 | 3300046472 | Bacteria | 2718 |
| 617 | Ga0495580_0110115 | 3300046472 | Bacteria | 1912 |
| 618 | Ga0495580_0139388 | 3300046472 | Bacteria | 1681 |
| 619 | Ga0495580_0189984 | 3300046472 | Bacteria | 1417 |
| 620 | Ga0495639_0013308 | 3300046475 | Bacteria | 3552 |
| 621 | Ga0495662_0008076 | 3300046476 | Bacteria | 5186 |
| 622 | Ga0495662_0010733 | 3300046476 | Bacteria | 4479 |
| 623 | Ga0495662_0054256 | 3300046476 | Bacteria | 1936 |
| 624 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 625 | Ga0495664_0001762 | 3300046477 | Bacteria | 11503 |
| 626 | Ga0495584_0164884 | 3300046491 | Bacteria | 1126 |
| 627 | Ga0495583_0000840 | 3300046506 | Bacteria | 37393 |
| 628 | Ga0495606_0003584 | 3300046507 | Bacteria | 16361 |
| 629 | Ga0495608_0000072 | 3300046511 | Bacteria | 76887 |
| 630 | Ga0495608_0001418 | 3300046511 | Bacteria | 17055 |
| 631 | Ga0495618_0000019 | 3300046514 | Bacteria | 136770 |
| 632 | Ga0495618_0003872 | 3300046514 | Bacteria | 9249 |
| 633 | Ga0495618_0017589 | 3300046514 | Bacteria | 4384 |
| 634 | Ga0495628_0000015 | 3300046516 | Bacteria | 198912 |
| 635 | Ga0495628_0104293 | 3300046516 | Bacteria | 2185 |
| 636 | Ga0495628_0198013 | 3300046516 | Bacteria | 1514 |
| 637 | Ga0495630_0027301 | 3300046517 | Bacteria | 4233 |
| 638 | Ga0495630_0029121 | 3300046517 | Bacteria | 4105 |
| 639 | Ga0495630_0142109 | 3300046517 | Bacteria | 1825 |
| 640 | Ga0495663_0017948 | 3300046525 | Bacteria | 2012 |
| 641 | Ga0495666_0040519 | 3300046526 | Bacteria | 2258 |
| 642 | Ga0495666_0110666 | 3300046526 | Bacteria | 1290 |
| 643 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 644 | Ga0495652_0024988 | 3300046529 | Bacteria | 5286 |
| 645 | Ga0495665_0013808 | 3300046531 | Bacteria | 4362 |
| 646 | Ga0495665_0039593 | 3300046531 | Bacteria | 2510 |
| 647 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 648 | Ga0495640_0007626 | 3300046533 | Bacteria | 8505 |
| 649 | Ga0495640_0007854 | 3300046533 | Bacteria | 8388 |
| 650 | Ga0495640_0036736 | 3300046533 | Bacteria | 3459 |
| 651 | Ga0495640_0063367 | 3300046533 | Bacteria | 2504 |
| 652 | Ga0495640_0232222 | 3300046533 | Bacteria | 1160 |
| 653 | Ga0495586_0001019 | 3300046535 | Bacteria | 15828 |
| 654 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 655 | Ga0495587_0000718 | 3300046536 | Bacteria | 22128 |
| 656 | Ga0495587_0211790 | 3300046536 | Bacteria | 1094 |
| 657 | Ga0495598_0029042 | 3300046537 | Bacteria | 1538 |
| 658 | Ga0495621_0053406 | 3300046539 | Bacteria | 1451 |
| 659 | Ga0495645_0002525 | 3300046543 | Bacteria | 12424 |
| 660 | Ga0495645_0010377 | 3300046543 | Bacteria | 6527 |
| 661 | Ga0495645_0061883 | 3300046543 | Bacteria | 2712 |
| 662 | Ga0495667_0000021 | 3300046559 | Bacteria | 180625 |
| 663 | Ga0495667_0015887 | 3300046559 | Bacteria | 5090 |
| 664 | Ga0495667_0047937 | 3300046559 | Bacteria | 2821 |
| 665 | Ga0495667_0069839 | 3300046559 | Bacteria | 2292 |
| 666 | Ga0495667_0247884 | 3300046559 | Bacteria | 1134 |
| 667 | Ga0495656_0011244 | 3300046615 | Bacteria | 3283 |
| 668 | Ga0495656_0122948 | 3300046615 | Bacteria | 1227 |
| 669 | Ga0495668_0188938 | 3300046616 | Bacteria | 1128 |
| 670 | Ga0495634_0000251 | 3300046642 | Bacteria | 50728 |
| 671 | Ga0495634_0004679 | 3300046642 | Bacteria | 10644 |
| 672 | Ga0495634_0005356 | 3300046642 | Bacteria | 9887 |
| 673 | Ga0495634_0008363 | 3300046642 | Bacteria | 7713 |
| 674 | Ga0495634_0031218 | 3300046642 | Bacteria | 3671 |
| 675 | Ga0495634_0147046 | 3300046642 | Bacteria | 1492 |
| 676 | Ga0495625_0073164 | 3300046660 | Bacteria | 2403 |
| 677 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 678 | Ga0495635_0013586 | 3300046663 | Bacteria | 5698 |
| 679 | Ga0495635_0309483 | 3300046663 | Bacteria | 1058 |
| 680 | Ga0495588_0014197 | 3300046674 | Bacteria | 3809 |
| 681 | Ga0495657_0000486 | 3300046675 | Bacteria | 37325 |
| 682 | Ga0495657_0004121 | 3300046675 | Bacteria | 11643 |
| 683 | Ga0495657_0094272 | 3300046675 | Bacteria | 1915 |
| 684 | Ga0495599_0000203 | 3300046678 | Bacteria | 39491 |
| 685 | Ga0495599_0061678 | 3300046678 | Bacteria | 2342 |
| 686 | Ga0495599_0121767 | 3300046678 | Bacteria | 1621 |
| 687 | Ga0495623_0000058 | 3300046679 | Bacteria | 68197 |
| 688 | Ga0495623_0014685 | 3300046679 | Bacteria | 5065 |
| 689 | Ga0495623_0040238 | 3300046679 | Bacteria | 2985 |
| 690 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 691 | Ga0495646_0118020 | 3300046680 | Bacteria | 1504 |
| 692 | Ga0495647_0002041 | 3300046681 | Bacteria | 6316 |
| 693 | Ga0495647_0019408 | 3300046681 | Bacteria | 2430 |
| 694 | Ga0495647_0061291 | 3300046681 | Bacteria | 1485 |
| 695 | Ga0495647_0063946 | 3300046681 | Bacteria | 1458 |
| 696 | Ga0495658_0006634 | 3300046683 | Bacteria | 5688 |
| 697 | Ga0495658_0021666 | 3300046683 | Bacteria | 3391 |
| 698 | Ga0495613_0032385 | 3300046689 | Bacteria | 3883 |
| 699 | Ga0495613_0044368 | 3300046689 | Bacteria | 3290 |
| 700 | Ga0495613_0270040 | 3300046689 | Bacteria | 1183 |
| 701 | Ga0495624_0019722 | 3300046690 | Bacteria | 4495 |
| 702 | Ga0495624_0043998 | 3300046690 | Bacteria | 2847 |
| 703 | Ga0495624_0066538 | 3300046690 | Bacteria | 2249 |
| 704 | Ga0495624_0110338 | 3300046690 | Bacteria | 1692 |
| 705 | Ga0495624_0226103 | 3300046690 | Bacteria | 1134 |
| 706 | Ga0495670_0078096 | 3300046691 | Bacteria | 1684 |
| 707 | Ga0495670_0089661 | 3300046691 | Bacteria | 1573 |
| 708 | Ga0495600_0000002 | 3300046809 | Bacteria | 186597 |
| 709 | Ga0495600_0006243 | 3300046809 | Bacteria | 7235 |
| 710 | Ga0495600_0071440 | 3300046809 | Bacteria | 2267 |
| 711 | Ga0495581_0018810 | 3300047315 | Bacteria | 4010 |
| 712 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 713 | Ga0495604_0003884 | 3300047317 | Bacteria | 11896 |
| 714 | Ga0495604_0173303 | 3300047317 | Bacteria | 1515 |
| 715 | Ga0495674_0000018 | 3300047319 | Bacteria | 204024 |
| 716 | Ga0495674_0001596 | 3300047319 | Bacteria | 22233 |
| 717 | Ga0495674_0006703 | 3300047319 | Bacteria | 11034 |
| 718 | Ga0495674_0069384 | 3300047319 | Bacteria | 3048 |
| 719 | Ga0495672_0033481 | 3300047320 | Bacteria | 3183 |
| 720 | Ga0495672_0041858 | 3300047320 | Bacteria | 2767 |
| 721 | Ga0495676_0004556 | 3300047321 | Bacteria | 12679 |
| 722 | Ga0495676_0048763 | 3300047321 | Bacteria | 3411 |
| 723 | Ga0495676_0069526 | 3300047321 | Bacteria | 2716 |
| 724 | Ga0495680_0001109 | 3300047322 | Bacteria | 29730 |
| 725 | Ga0495680_0010419 | 3300047322 | Bacteria | 8294 |
| 726 | Ga0495683_0137760 | 3300047323 | Bacteria | 1146 |
| 727 | Ga0495675_0003039 | 3300047444 | Bacteria | 10087 |
| 728 | Ga0495675_0004157 | 3300047444 | Bacteria | 8756 |
| 729 | Ga0495675_0075237 | 3300047444 | Bacteria | 2128 |
| 730 | Ga0495679_040933 | 3300047446 | Bacteria | 1438 |
| 731 | Ga0495685_049860 | 3300047447 | Bacteria | 1421 |
| 732 | Ga0495684_0000010 | 3300047471 | Bacteria | 198915 |
| 733 | Ga0495684_0007596 | 3300047471 | Bacteria | 8388 |
| 734 | Ga0495684_0011645 | 3300047471 | Bacteria | 6790 |
| 735 | Ga0495684_0027615 | 3300047471 | Bacteria | 4357 |
| 736 | Ga0495684_0048735 | 3300047471 | Bacteria | 3238 |
| 737 | Ga0495686_0000606 | 3300047472 | Bacteria | 49623 |
| 738 | Ga0495593_0007996 | 3300047673 | Bacteria | 6157 |
| 739 | Ga0495593_0048567 | 3300047673 | Bacteria | 2255 |
| 740 | Ga0495593_0121493 | 3300047673 | Bacteria | 1329 |
| 741 | Ga0495602_0013088 | 3300048088 | Bacteria | 8484 |
| 742 | Ga0495602_0049699 | 3300048088 | Bacteria | 3754 |
| 743 | Ga0495602_0284528 | 3300048088 | Bacteria | 1216 |
| 744 | Ga0496100_0005463 | 3300048903 | Bacteria | 6850 |
| 745 | Ga0496100_0023107 | 3300048903 | Bacteria | 3772 |
| 746 | Ga0496100_0098803 | 3300048903 | Bacteria | 2007 |
| 747 | Ga0496101_0001025 | 3300048904 | Bacteria | 16469 |
| 748 | Ga0496101_0008677 | 3300048904 | Bacteria | 6646 |
| 749 | Ga0496101_0020913 | 3300048904 | Bacteria | 4489 |
| 750 | Ga0496101_0227973 | 3300048904 | Bacteria | 1447 |
| 751 | Ga0496102_0001685 | 3300048905 | Bacteria | 19401 |
| 752 | Ga0496102_0010694 | 3300048905 | Bacteria | 7904 |
| 753 | Ga0496102_0041079 | 3300048905 | Bacteria | 4187 |
| 754 | Ga0496102_0087737 | 3300048905 | Bacteria | 2874 |
| 755 | Ga0496102_0151094 | 3300048905 | Bacteria | 2182 |
| 756 | Ga0496103_0012080 | 3300048906 | Bacteria | 5130 |
| 757 | Ga0496103_0045036 | 3300048906 | Bacteria | 2721 |
| 758 | Ga0496103_0372135 | 3300048906 | Bacteria | 918 |
| 759 | Ga0496104_0003048 | 3300048907 | Bacteria | 14438 |
| 760 | Ga0496104_0012586 | 3300048907 | Bacteria | 7613 |
| 761 | Ga0496104_0020110 | 3300048907 | Bacteria | 6117 |
| 762 | Ga0496104_0125825 | 3300048907 | Bacteria | 2461 |
| 763 | Ga0496104_0235547 | 3300048907 | Bacteria | 1742 |
| 764 | Ga0496104_0307706 | 3300048907 | Bacteria | 1497 |
| 765 | Ga0496104_0427971 | 3300048907 | Bacteria | 1235 |
| 766 | Ga0496104_0504321 | 3300048907 | Bacteria | 1121 |
| 767 | Ga0496105_0005567 | 3300048908 | Bacteria | 9565 |
| 768 | Ga0496105_0005922 | 3300048908 | Bacteria | 9329 |
| 769 | Ga0496105_0011176 | 3300048908 | Bacteria | 7082 |
| 770 | Ga0496105_0050257 | 3300048908 | Bacteria | 3444 |
| 771 | Ga0496105_0060568 | 3300048908 | Bacteria | 3123 |
| 772 | Ga0496105_0092139 | 3300048908 | Bacteria | 2502 |
| 773 | Ga0496105_0129449 | 3300048908 | Bacteria | 2081 |
| 774 | Ga0496105_0136590 | 3300048908 | Bacteria | 2020 |
| 775 | Ga0496106_0010565 | 3300048909 | Bacteria | 6819 |
| 776 | Ga0496106_0023192 | 3300048909 | Bacteria | 4610 |
| 777 | Ga0496106_0051071 | 3300048909 | Bacteria | 3117 |
| 778 | Ga0496106_0177004 | 3300048909 | Bacteria | 1692 |
| 779 | Ga0496106_0286611 | 3300048909 | Bacteria | 1320 |
| 780 | Ga0496107_0007469 | 3300048910 | Bacteria | 7535 |
| 781 | Ga0496107_0015009 | 3300048910 | Bacteria | 5425 |
| 782 | Ga0496108_0002364 | 3300048911 | Bacteria | 15107 |
| 783 | Ga0496108_0029304 | 3300048911 | Bacteria | 4556 |
| 784 | Ga0496108_0050992 | 3300048911 | Bacteria | 3466 |
| 785 | Ga0496108_0079831 | 3300048911 | Bacteria | 2770 |
| 786 | Ga0496108_0169416 | 3300048911 | Bacteria | 1889 |
| 787 | Ga0496109_0001638 | 3300048912 | Bacteria | 18700 |
| 788 | Ga0496109_0002461 | 3300048912 | Bacteria | 15523 |
| 789 | Ga0496109_0011159 | 3300048912 | Bacteria | 7707 |
| 790 | Ga0496109_0029136 | 3300048912 | Bacteria | 4942 |
| 791 | Ga0496109_0051551 | 3300048912 | Bacteria | 3748 |
| 792 | Ga0496109_0105357 | 3300048912 | Bacteria | 2619 |
| 793 | Ga0496109_0373964 | 3300048912 | Bacteria | 1346 |
| 794 | Ga0496110_0003528 | 3300048913 | Bacteria | 12009 |
| 795 | Ga0496110_0011641 | 3300048913 | Bacteria | 7212 |
| 796 | Ga0496110_0037760 | 3300048913 | Bacteria | 4199 |
| 797 | Ga0496110_0144854 | 3300048913 | Bacteria | 2148 |
| 798 | Ga0496110_0179453 | 3300048913 | Bacteria | 1922 |
| 799 | Ga0496111_0003518 | 3300048914 | Bacteria | 9693 |
| 800 | Ga0496111_0005819 | 3300048914 | Bacteria | 7950 |
| 801 | Ga0496111_0017449 | 3300048914 | Bacteria | 4963 |
| 802 | Ga0496111_0018422 | 3300048914 | Bacteria | 4838 |
| 803 | Ga0496111_0027735 | 3300048914 | Bacteria | 4009 |
| 804 | Ga0496111_0147169 | 3300048914 | Bacteria | 1746 |
| 805 | Ga0496111_0265230 | 3300048914 | Bacteria | 1274 |
| 806 | Ga0496112_0037915 | 3300048915 | Bacteria | 4707 |
| 807 | Ga0496112_0039123 | 3300048915 | Bacteria | 4632 |
| 808 | Ga0496112_0067536 | 3300048915 | Bacteria | 3529 |
| 809 | Ga0496112_0122371 | 3300048915 | Bacteria | 2572 |
| 810 | Ga0496112_0135215 | 3300048915 | Bacteria | 2436 |
| 811 | Ga0496112_0154557 | 3300048915 | Bacteria | 2261 |
| 812 | Ga0496112_0157700 | 3300048915 | Bacteria | 2236 |
| 813 | Ga0496112_0355360 | 3300048915 | Bacteria | 1407 |
| 814 | Ga0496112_0366697 | 3300048915 | Bacteria | 1382 |
| 815 | Ga0496113_0000175 | 3300048916 | Bacteria | 28436 |
| 816 | Ga0496113_0001647 | 3300048916 | Bacteria | 12592 |
| 817 | Ga0496113_0030542 | 3300048916 | Bacteria | 3901 |
| 818 | Ga0496113_0030825 | 3300048916 | Bacteria | 3886 |
| 819 | Ga0496113_0337568 | 3300048916 | Unclassified | 1208 |
| 820 | Ga0496114_0027134 | 3300048917 | Bacteria | 4690 |
| 821 | Ga0496114_0057372 | 3300048917 | Bacteria | 3251 |
| 822 | Ga0496114_0085526 | 3300048917 | Bacteria | 2671 |
| 823 | Ga0496115_0023215 | 3300048918 | Bacteria | 4813 |
| 824 | Ga0496115_0084063 | 3300048918 | Bacteria | 2595 |
| 825 | Ga0496115_0159650 | 3300048918 | Bacteria | 1863 |
| 826 | Ga0496115_0235455 | 3300048918 | Bacteria | 1509 |
| 827 | Ga0496117_0022967 | 3300048920 | Bacteria | 4989 |
| 828 | Ga0496117_0087606 | 3300048920 | Bacteria | 2017 |
| 829 | Ga0496118_0027984 | 3300048921 | Bacteria | 4759 |
| 830 | Ga0496118_0037082 | 3300048921 | Bacteria | 3929 |
| 831 | Ga0496118_0048685 | 3300048921 | Bacteria | 3269 |
| 832 | Ga0496121_0009918 | 3300048924 | Bacteria | 10841 |
| 833 | Ga0496124_0006822 | 3300048927 | Bacteria | 12323 |
| 834 | Ga0496124_0191576 | 3300048927 | Bacteria | 1564 |
| 835 | Ga0496126_0035095 | 3300048929 | Bacteria | 4703 |
| 836 | Ga0496126_0039717 | 3300048929 | Bacteria | 4365 |
| 837 | Ga0501294_004642 | 3300049517 | Bacteria | 1295 |
| 838 | Ga0501031_0001402 | 3300049568 | Bacteria | 14899 |
| 839 | Ga0501033_0017562 | 3300049570 | Bacteria | 5405 |
| 840 | Ga0501034_0218199 | 3300049571 | Bacteria | 1860 |
| 841 | Ga0501036_0009279 | 3300049572 | Bacteria | 8085 |
| 842 | Ga0501036_0022892 | 3300049572 | Bacteria | 5260 |
| 843 | Ga0501038_0030524 | 3300049574 | Bacteria | 4768 |
| 844 | Ga0501038_0142363 | 3300049574 | Bacteria | 1961 |
| 845 | Ga0501039_0001656 | 3300049575 | Bacteria | 16415 |
| 846 | Ga0501039_0019439 | 3300049575 | Bacteria | 5208 |
| 847 | Ga0501040_0055715 | 3300049576 | Bacteria | 2712 |
| 848 | Ga0501041_0000600 | 3300049577 | Bacteria | 18846 |
| 849 | Ga0501041_0009888 | 3300049577 | Bacteria | 5617 |
| 850 | Ga0501041_0047078 | 3300049577 | Bacteria | 2625 |
| 851 | Ga0501042_0004577 | 3300049578 | Bacteria | 8827 |
| 852 | Ga0501042_0044082 | 3300049578 | Bacteria | 3178 |
| 853 | Ga0501043_0027712 | 3300049579 | Bacteria | 4447 |
| 854 | Ga0501043_0041339 | 3300049579 | Bacteria | 3622 |
| 855 | Ga0501046_0000126 | 3300049580 | Bacteria | 81334 |
| 856 | Ga0501046_0001057 | 3300049580 | Bacteria | 26945 |
| 857 | Ga0501046_0363357 | 3300049580 | Bacteria | 1049 |
| 858 | Ga0501047_0000160 | 3300049581 | Bacteria | 81946 |
| 859 | Ga0501047_0332725 | 3300049581 | Bacteria | 1357 |
| 860 | Ga0501048_0000040 | 3300049582 | Bacteria | 63031 |
| 861 | Ga0501048_0011924 | 3300049582 | Bacteria | 6480 |
| 862 | Ga0501048_0028075 | 3300049582 | Bacteria | 4086 |
| 863 | Ga0501048_0184491 | 3300049582 | Bacteria | 1479 |
| 864 | Ga0501069_0012334 | 3300049585 | Bacteria | 4541 |
| 865 | Ga0501070_0104679 | 3300049586 | Bacteria | 2339 |
| 866 | Ga0501070_0242388 | 3300049586 | Bacteria | 1475 |
| 867 | Ga0501071_0044976 | 3300049587 | Bacteria | 3168 |
| 868 | Ga0501071_0051424 | 3300049587 | Bacteria | 2969 |
| 869 | Ga0501071_0344170 | 3300049587 | Bacteria | 1134 |
| 870 | Ga0501072_0001862 | 3300049588 | Bacteria | 15708 |
| 871 | Ga0501072_0016678 | 3300049588 | Bacteria | 5643 |
| 872 | Ga0501072_0025063 | 3300049588 | Bacteria | 4644 |
| 873 | Ga0501072_0280682 | 3300049588 | Bacteria | 1325 |
| 874 | Ga0501073_0111896 | 3300049589 | Bacteria | 1894 |
| 875 | Ga0501074_0013084 | 3300049590 | Bacteria | 6031 |
| 876 | Ga0501074_0025976 | 3300049590 | Bacteria | 4247 |
| 877 | Ga0501075_0003996 | 3300049591 | Bacteria | 9947 |
| 878 | Ga0501075_0069220 | 3300049591 | Bacteria | 2667 |
| 879 | Ga0501076_0000348 | 3300049592 | Bacteria | 28519 |
| 880 | Ga0501076_0018281 | 3300049592 | Bacteria | 5341 |
| 881 | Ga0501076_0031097 | 3300049592 | Bacteria | 4162 |
| 882 | Ga0501076_0152057 | 3300049592 | Bacteria | 1883 |
| 883 | Ga0501225_0008565 | 3300049705 | Bacteria | 2931 |
| 884 | Ga0501079_0000859 | 3300049741 | Bacteria | 20782 |
| 885 | Ga0501079_0125204 | 3300049741 | Bacteria | 1999 |
| 886 | Ga0501080_0066965 | 3300049742 | Bacteria | 3340 |
| 887 | Ga0501081_0000131 | 3300049743 | Bacteria | 33122 |
| 888 | Ga0501081_0018251 | 3300049743 | Bacteria | 4657 |
| 889 | Ga0501081_0089723 | 3300049743 | Bacteria | 2160 |
| 890 | Ga0501083_0062007 | 3300049744 | Bacteria | 2496 |
| 891 | Ga0501272_006773 | 3300049769 | Bacteria | 1230 |
| 892 | Ga0501035_0379950 | 3300049822 | Bacteria | 1178 |
| 893 | Ga0501044_0000743 | 3300049823 | Bacteria | 39318 |
| 894 | Ga0501044_0139155 | 3300049823 | Bacteria | 2416 |
| 895 | Ga0501044_0289665 | 3300049823 | Bacteria | 1569 |
| 896 | Ga0501045_0004944 | 3300049824 | Bacteria | 9234 |
| 897 | Ga0501045_0014083 | 3300049824 | Bacteria | 5663 |
| 898 | Ga0501045_0018427 | 3300049824 | Bacteria | 4965 |
| 899 | Ga0501045_0083981 | 3300049824 | Bacteria | 2349 |
| 900 | nmdc:mga03683_20525_c1 | 3300050489 | Bacteria | 2536 |
| 901 | nmdc:mga00v17_107895_c1 | 3300050491 | Bacteria | 1764 |
| 902 | nmdc:mga00v17_188780_c1 | 3300050491 | Bacteria | 1331 |
| 903 | nmdc:mga0k408_12633_c1 | 3300050493 | Bacteria | 4616 |
| 904 | nmdc:mga0k408_2138_c1 | 3300050493 | Bacteria | 10590 |
| 905 | nmdc:mga0k408_23217_c1 | 3300050493 | Bacteria | 3497 |
| 906 | nmdc:mga06z11_104161_c1 | 3300050494 | Bacteria | 1562 |
| 907 | nmdc:mga06z11_148497_c1 | 3300050494 | Bacteria | 1331 |
| 908 | nmdc:mga07m45_64254_c1 | 3300050496 | Bacteria | 2082 |
| 909 | nmdc:mga07m45_97530_c1 | 3300050496 | Bacteria | 1687 |
| 910 | nmdc:mga05p37_132_c1 | 3300050507 | Bacteria | 68371 |
| 911 | nmdc:mga05p37_261301_c1 | 3300050507 | Bacteria | 2072 |
| 912 | nmdc:mga05p37_673219_c1 | 3300050507 | Bacteria | 1155 |
| 913 | nmdc:mga09592_418_c1 | 3300050508 | Bacteria | 31192 |
| 914 | nmdc:mga08y16_108320_c1 | 3300050511 | Bacteria | 2892 |
| 915 | nmdc:mga08y16_425018_c1 | 3300050511 | Bacteria | 1357 |
| 916 | nmdc:mga08y16_9476_c1 | 3300050511 | Bacteria | 10220 |
| 917 | nmdc:mga0n895_109188_c1 | 3300050512 | Bacteria | 2782 |
| 918 | nmdc:mga0n895_252410_c1 | 3300050512 | Bacteria | 1790 |
| 919 | nmdc:mga0n895_290807_c1 | 3300050512 | Bacteria | 1657 |
| 920 | nmdc:mga0n895_40845_c1 | 3300050512 | Bacteria | 4507 |
| 921 | nmdc:mga0n895_468_c1 | 3300050512 | Bacteria | 27132 |
| 922 | nmdc:mga0n895_93917_c1 | 3300050512 | Bacteria | 3003 |
| 923 | nmdc:mga0rr50_145_c1 | 3300050513 | Bacteria | 39313 |
| 924 | nmdc:mga0rr50_89121_c1 | 3300050513 | Bacteria | 2398 |
| 925 | nmdc:mga08x19_14066_c1 | 3300050514 | Bacteria | 4849 |
| 926 | nmdc:mga08x19_522_c1 | 3300050514 | Bacteria | 25573 |
| 927 | nmdc:mga0a205_11596_c1 | 3300050515 | Bacteria | 8121 |
| 928 | nmdc:mga0a205_54289_c1 | 3300050515 | Bacteria | 3868 |
| 929 | nmdc:mga0sz30_20124_c1 | 3300050516 | Bacteria | 2690 |
| 930 | nmdc:mga0sz30_60152_c1 | 3300050516 | Bacteria | 1140 |
| 931 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 932 | Ga0495601_0000243 | 3300053077 | Bacteria | 29083 |
| 933 | Ga0495601_0016790 | 3300053077 | Bacteria | 4439 |
| 934 | Ga0495601_0022082 | 3300053077 | Bacteria | 3905 |
| 935 | Ga0495601_0025060 | 3300053077 | Bacteria | 3676 |
| 936 | Ga0495601_0152994 | 3300053077 | Bacteria | 1506 |
| 937 | Ga0495601_0164211 | 3300053077 | Bacteria | 1451 |
| 938 | Ga0495612_0000063 | 3300053078 | Bacteria | 48104 |
| 939 | Ga0495612_0001332 | 3300053078 | Bacteria | 10178 |
| 940 | Ga0495612_0006769 | 3300053078 | Bacteria | 4694 |
| 941 | Ga0495612_0009391 | 3300053078 | Bacteria | 3969 |
| 942 | Ga0495595_0002319 | 3300053084 | Bacteria | 7421 |
| 943 | Ga0495595_0046083 | 3300053084 | Bacteria | 2007 |
| 944 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 945 | Ga0495619_0004170 | 3300053085 | Bacteria | 9234 |
| 946 | Ga0495619_0112964 | 3300053085 | Bacteria | 1857 |
| 947 | Ga0500578_0178410 | 3300053086 | Bacteria | 1310 |
| 948 | Ga0500643_063804 | 3300053087 | Bacteria | 1030 |
| 949 | Ga0500583_0164039 | 3300053092 | Bacteria | 1107 |
| 950 | Ga0500641_0003400 | 3300053096 | Bacteria | 5626 |
| 951 | Ga0500555_000886 | 3300053103 | Bacteria | 10651 |
| 952 | Ga0500595_016248 | 3300053119 | Bacteria | 2776 |
| 953 | Ga0500652_000023 | 3300053131 | Bacteria | 116316 |
| 954 | Ga0501084_0064199 | 3300054114 | Bacteria | 3073 |
| 955 | Ga0501084_0071132 | 3300054114 | Bacteria | 2913 |
| 956 | Ga0501084_0090900 | 3300054114 | Bacteria | 2563 |
| 957 | Ga0501084_0159463 | 3300054114 | Bacteria | 1903 |
| 958 | Ga0501084_0479070 | 3300054114 | Bacteria | 1052 |
| 959 | Ga0590071_008354 | 3300059421 | Bacteria | 2440 |
| 960 | Ga0501082_0000205 | 3300060353 | Bacteria | 51540 |
| 961 | Ga0501082_0008926 | 3300060353 | Bacteria | 8651 |
| 962 | Ga0501082_0025577 | 3300060353 | Bacteria | 5087 |
| 963 | Ga0501082_0144096 | 3300060353 | Bacteria | 2068 |
| 964 | Ga0530510_0000425 | 3300061734 | Bacteria | 27205 |
| 965 | Ga0530510_0057591 | 3300061734 | Bacteria | 2808 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0084063 | Ga0496115_0084063_1765_2550 | 260 |
| 2 | 3300005983 | Ga0081540_1017724 | Ga0081540_10177244 | 274 |
| 3 | 3300004625 | Ga0055543_1018963 | Ga0055543_10189632 | 283 |
| 4 | 3300013308 | Ga0157375_10957914 | Ga0157375_109579141 | 285 |
| 5 | 3300046663 | Ga0495635_0309483 | Ga0495635_0309483_11_874 | 287 |
| 6 | 3300048906 | Ga0496103_0372135 | Ga0496103_0372135_38_901 | 287 |
| 7 | 3300035089 | Ga0373944_0103233 | Ga0373944_0103233_90_956 | 288 |
| 8 | 3300006195 | Ga0075366_10031321 | Ga0075366_100313214 | 291 |
| 9 | 3300005983 | Ga0081540_1003649 | Ga0081540_10036493 | 293 |
| 10 | 3300031344 | Ga0265316_10183496 | Ga0265316_101834962 | 293 |
| 11 | 3300031711 | Ga0265314_10038574 | Ga0265314_100385743 | 293 |
| 12 | 3300032133 | Ga0316583_10005706 | Ga0316583_100057063 | 295 |
| 13 | 3300039447 | Ga0436361_0328438 | Ga0436361_0328438_306_1259 | 303 |
| 14 | 3300028794 | Ga0307515_10000292 | Ga0307515_100002922 | 304 |
| 15 | 3300039447 | Ga0436361_0340102 | Ga0436361_0340102_142_1101 | 304 |
| 16 | 3300048908 | Ga0496105_0050257 | Ga0496105_0050257_692_1612 | 304 |
| 17 | 3300025927 | Ga0207687_10062110 | Ga0207687_100621103 | 306 |
| 18 | 3300049517 | Ga0501294_004642 | Ga0501294_004642_163_1122 | 306 |
| 19 | 3300049705 | Ga0501225_0008565 | Ga0501225_0008565_1196_2155 | 306 |
| 20 | 3300039438 | Ga0436360_0157058 | Ga0436360_0157058_305_1255 | 307 |
| 21 | 3300049769 | Ga0501272_006773 | Ga0501272_006773_214_1173 | 307 |
| 22 | 3300005983 | Ga0081540_1002003 | Ga0081540_10020035 | 309 |
| 23 | 3300037853 | Ga0436364_0611812 | Ga0436364_0611812_545_1507 | 309 |
| 24 | 3300031616 | Ga0307508_10089616 | Ga0307508_100896162 | 310 |
| 25 | 3300036401 | Ga0373937_0008905 | Ga0373937_0008905_5223_6179 | 310 |
| 26 | 3300048918 | Ga0496115_0159650 | Ga0496115_0159650_47_1030 | 310 |
| 27 | 3300014497 | Ga0182008_10146347 | Ga0182008_101463471 | 311 |
| 28 | iso_pu_bacteria | 2928115317 | 2928117050 | 312 |
| 29 | 3300003322 | rootL2_10020853 | rootL2_100208531 | 313 |
| 30 | 3300005327 | Ga0070658_10000534 | Ga0070658_1000053419 | 313 |
| 31 | 3300005333 | Ga0070677_10023218 | Ga0070677_100232183 | 313 |
| 32 | 3300005354 | Ga0070675_100011655 | Ga0070675_1000116554 | 313 |
| 33 | 3300005438 | Ga0070701_10227212 | Ga0070701_102272121 | 313 |
| 34 | 3300005456 | Ga0070678_100184370 | Ga0070678_1001843702 | 313 |
| 35 | 3300005563 | Ga0068855_100197575 | Ga0068855_1001975752 | 313 |
| 36 | 3300005614 | Ga0068856_100316903 | Ga0068856_1003169032 | 313 |
| 37 | 3300006358 | Ga0068871_100240442 | Ga0068871_1002404422 | 313 |
| 38 | 3300009093 | Ga0105240_10000369 | Ga0105240_1000036961 | 313 |
| 39 | 3300015683 | Ga0183362_10002 | Ga0183362_10002607 | 313 |
| 40 | 3300021388 | Ga0213875_10036455 | Ga0213875_100364552 | 313 |
| 41 | 3300025893 | Ga0207682_10003858 | Ga0207682_100038585 | 313 |
| 42 | 3300025909 | Ga0207705_10002747 | Ga0207705_100027477 | 313 |
| 43 | 3300025913 | Ga0207695_10014477 | Ga0207695_100144774 | 313 |
| 44 | 3300025921 | Ga0207652_10014091 | Ga0207652_100140915 | 313 |
| 45 | 3300025926 | Ga0207659_10125838 | Ga0207659_101258382 | 313 |
| 46 | 3300025926 | Ga0207659_10366032 | Ga0207659_103660322 | 313 |
| 47 | 3300025937 | Ga0207669_10030218 | Ga0207669_100302184 | 313 |
| 48 | 3300025940 | Ga0207691_10020089 | Ga0207691_100200892 | 313 |
| 49 | 3300026075 | Ga0207708_10015584 | Ga0207708_100155842 | 313 |
| 50 | 3300026078 | Ga0207702_10300355 | Ga0207702_103003552 | 313 |
| 51 | 3300026116 | Ga0207674_10067184 | Ga0207674_100671842 | 313 |
| 52 | 3300026116 | Ga0207674_10187815 | Ga0207674_101878152 | 313 |
| 53 | 3300026121 | Ga0207683_10002913 | Ga0207683_1000291314 | 313 |
| 54 | 3300031548 | Ga0307408_100070914 | Ga0307408_1000709142 | 313 |
| 55 | 3300031731 | Ga0307405_10012768 | Ga0307405_100127685 | 313 |
| 56 | 3300031824 | Ga0307413_10001952 | Ga0307413_100019528 | 313 |
| 57 | 3300031901 | Ga0307406_10004403 | Ga0307406_100044031 | 313 |
| 58 | 3300031903 | Ga0307407_10013466 | Ga0307407_100134664 | 313 |
| 59 | 3300031911 | Ga0307412_10007438 | Ga0307412_100074382 | 313 |
| 60 | 3300032004 | Ga0307414_10227671 | Ga0307414_102276712 | 313 |
| 61 | 3300032005 | Ga0307411_10003851 | Ga0307411_100038512 | 313 |
| 62 | 3300032126 | Ga0307415_100005865 | Ga0307415_1000058654 | 313 |
| 63 | 3300039437 | Ga0436365_0120456 | Ga0436365_0120456_451_1398 | 313 |
| 64 | 3300045836 | Ga0466958_0000079 | Ga0466958_0000079_13881_14822 | 313 |
| 65 | 3300046507 | Ga0495606_0003584 | Ga0495606_0003584_1309_2250 | 313 |
| 66 | 3300047472 | Ga0495686_0000606 | Ga0495686_0000606_30940_31893 | 313 |
| 67 | 3300048905 | Ga0496102_0001685 | Ga0496102_0001685_427_1374 | 313 |
| 68 | 3300048927 | Ga0496124_0191576 | Ga0496124_0191576_361_1302 | 313 |
| 69 | 3300050493 | nmdc:mga0k408_23217_c1 | nmdc:mga0k408_23217_c1_109_1062 | 313 |
| 70 | 3300053087 | Ga0500643_063804 | Ga0500643_063804_38_979 | 313 |
| 71 | 3300005577 | Ga0068857_100030804 | Ga0068857_1000308043 | 314 |
| 72 | 3300010375 | Ga0105239_10123372 | Ga0105239_101233722 | 314 |
| 73 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001217 | 314 |
| 74 | 3300021384 | Ga0213876_10024910 | Ga0213876_100249104 | 314 |
| 75 | 3300039437 | Ga0436365_0072895 | Ga0436365_0072895_16729_17676 | 314 |
| 76 | 3300039447 | Ga0436361_0028664 | Ga0436361_0028664_56357_57310 | 314 |
| 77 | 3300039453 | Ga0436362_0992192 | Ga0436362_0992192_816_1763 | 314 |
| 78 | 3300046460 | Ga0495638_0008417 | Ga0495638_0008417_3234_4190 | 314 |
| 79 | 3300048921 | Ga0496118_0037082 | Ga0496118_0037082_2851_3807 | 314 |
| 80 | 3300049571 | Ga0501034_0218199 | Ga0501034_0218199_382_1335 | 314 |
| 81 | 3300049823 | Ga0501044_0289665 | Ga0501044_0289665_163_1116 | 314 |
| 82 | 3300002075 | JGI24738J21930_10002238 | JGI24738J21930_100022384 | 315 |
| 83 | 3300005354 | Ga0070675_100141421 | Ga0070675_1001414212 | 315 |
| 84 | 3300005456 | Ga0070678_100292960 | Ga0070678_1002929601 | 315 |
| 85 | 3300005468 | Ga0070707_100602851 | Ga0070707_1006028511 | 315 |
| 86 | 3300005543 | Ga0070672_100293793 | Ga0070672_1002937931 | 315 |
| 87 | 3300005548 | Ga0070665_100000011 | Ga0070665_10000001195 | 315 |
| 88 | 3300005563 | Ga0068855_100000265 | Ga0068855_10000026526 | 315 |
| 89 | 3300005840 | Ga0068870_10137642 | Ga0068870_101376422 | 315 |
| 90 | 3300005841 | Ga0068863_100078963 | Ga0068863_1000789633 | 315 |
| 91 | 3300005841 | Ga0068863_100132536 | Ga0068863_1001325362 | 315 |
| 92 | 3300006237 | Ga0097621_100110302 | Ga0097621_1001103022 | 315 |
| 93 | 3300006358 | Ga0068871_100182244 | Ga0068871_1001822442 | 315 |
| 94 | 3300006358 | Ga0068871_100184289 | Ga0068871_1001842892 | 315 |
| 95 | 3300006871 | Ga0075434_100092271 | Ga0075434_1000922712 | 315 |
| 96 | 3300006881 | Ga0068865_100008534 | Ga0068865_1000085344 | 315 |
| 97 | 3300009148 | Ga0105243_10173670 | Ga0105243_101736702 | 315 |
| 98 | 3300009176 | Ga0105242_10088017 | Ga0105242_100880172 | 315 |
| 99 | 3300013306 | Ga0163162_10065362 | Ga0163162_100653622 | 315 |
| 100 | 3300013308 | Ga0157375_10117196 | Ga0157375_101171964 | 315 |
| 101 | 3300014325 | Ga0163163_10275912 | Ga0163163_102759122 | 315 |
| 102 | 3300014326 | Ga0157380_10019019 | Ga0157380_100190194 | 315 |
| 103 | 3300017792 | Ga0163161_10238579 | Ga0163161_102385792 | 315 |
| 104 | 3300021361 | Ga0213872_10039685 | Ga0213872_100396852 | 315 |
| 105 | 3300025937 | Ga0207669_10134855 | Ga0207669_101348552 | 315 |
| 106 | 3300025938 | Ga0207704_10242318 | Ga0207704_102423182 | 315 |
| 107 | 3300025940 | Ga0207691_10044610 | Ga0207691_100446105 | 315 |
| 108 | 3300025949 | Ga0207667_10000029 | Ga0207667_1000002939 | 315 |
| 109 | 3300025960 | Ga0207651_10178410 | Ga0207651_101784102 | 315 |
| 110 | 3300026078 | Ga0207702_10210465 | Ga0207702_102104652 | 315 |
| 111 | 3300026088 | Ga0207641_10066100 | Ga0207641_100661002 | 315 |
| 112 | 3300026118 | Ga0207675_100152416 | Ga0207675_1001524162 | 315 |
| 113 | 3300026121 | Ga0207683_10353005 | Ga0207683_103530051 | 315 |
| 114 | 3300028379 | Ga0268266_10000063 | Ga0268266_1000006392 | 315 |
| 115 | 3300039437 | Ga0436365_1849126 | Ga0436365_1849126_1577_2527 | 315 |
| 116 | 3300039447 | Ga0436361_0081134 | Ga0436361_0081134_99_1058 | 315 |
| 117 | 3300039447 | Ga0436361_0200590 | Ga0436361_0200590_394_1353 | 315 |
| 118 | 3300042876 | Ga0451577_0000863 | Ga0451577_0000863_38841_39800 | 315 |
| 119 | 3300046506 | Ga0495583_0000840 | Ga0495583_0000840_5658_6605 | 315 |
| 120 | 3300046660 | Ga0495625_0073164 | Ga0495625_0073164_178_1137 | 315 |
| 121 | 3300046691 | Ga0495670_0089661 | Ga0495670_0089661_495_1442 | 315 |
| 122 | 3300049580 | Ga0501046_0000126 | Ga0501046_0000126_44666_45631 | 315 |
| 123 | 3300049581 | Ga0501047_0000160 | Ga0501047_0000160_35704_36669 | 315 |
| 124 | 3300049582 | Ga0501048_0000040 | Ga0501048_0000040_17338_18303 | 315 |
| 125 | 3300049824 | Ga0501045_0004944 | Ga0501045_0004944_5591_6556 | 315 |
| 126 | 3300050511 | nmdc:mga08y16_425018_c1 | nmdc:mga08y16_425018_c1_116_1087 | 315 |
| 127 | 3300050512 | nmdc:mga0n895_40845_c1 | nmdc:mga0n895_40845_c1_2458_3405 | 315 |
| 128 | 3300053103 | Ga0500555_000886 | Ga0500555_000886_8790_9737 | 315 |
| 129 | iso_pu_bacteria | 2842718218 | 2842719397 | 315 |
| 130 | iso_pu_bacteria | 2904479285 | 2904482832 | 315 |
| 131 | iso_pu_bacteria | 2974320154 | 2974321326 | 315 |
| 132 | 3300001977 | JGI24746J21847_1002925 | JGI24746J21847_10029252 | 316 |
| 133 | 3300001991 | JGI24743J22301_10008228 | JGI24743J22301_100082282 | 316 |
| 134 | 3300002239 | JGI24034J26672_10016529 | JGI24034J26672_100165291 | 316 |
| 135 | 3300003203 | JGI25406J46586_10019988 | JGI25406J46586_100199882 | 316 |
| 136 | 3300003215 | JGI25153J46596_10001063 | JGI25153J46596_1000106318 | 316 |
| 137 | 3300003911 | JGI25405J52794_10017961 | JGI25405J52794_100179611 | 316 |
| 138 | 3300005289 | Ga0065704_10113311 | Ga0065704_101133112 | 316 |
| 139 | 3300005293 | Ga0065715_10280549 | Ga0065715_102805491 | 316 |
| 140 | 3300005295 | Ga0065707_10133474 | Ga0065707_101334742 | 316 |
| 141 | 3300005295 | Ga0065707_10153752 | Ga0065707_101537522 | 316 |
| 142 | 3300005328 | Ga0070676_10154994 | Ga0070676_101549942 | 316 |
| 143 | 3300005330 | Ga0070690_100000216 | Ga0070690_1000002166 | 316 |
| 144 | 3300005330 | Ga0070690_100012374 | Ga0070690_1000123744 | 316 |
| 145 | 3300005330 | Ga0070690_100068462 | Ga0070690_1000684622 | 316 |
| 146 | 3300005330 | Ga0070690_100373498 | Ga0070690_1003734981 | 316 |
| 147 | 3300005331 | Ga0070670_100081469 | Ga0070670_1000814693 | 316 |
| 148 | 3300005331 | Ga0070670_100153016 | Ga0070670_1001530162 | 316 |
| 149 | 3300005333 | Ga0070677_10007082 | Ga0070677_100070821 | 316 |
| 150 | 3300005334 | Ga0068869_100000759 | Ga0068869_1000007591 | 316 |
| 151 | 3300005334 | Ga0068869_100242126 | Ga0068869_1002421262 | 316 |
| 152 | 3300005335 | Ga0070666_10010599 | Ga0070666_100105992 | 316 |
| 153 | 3300005335 | Ga0070666_10114932 | Ga0070666_101149323 | 316 |
| 154 | 3300005336 | Ga0070680_100003121 | Ga0070680_1000031214 | 316 |
| 155 | 3300005336 | Ga0070680_100006895 | Ga0070680_1000068955 | 316 |
| 156 | 3300005336 | Ga0070680_100008902 | Ga0070680_1000089023 | 316 |
| 157 | 3300005337 | Ga0070682_100004786 | Ga0070682_10000478610 | 316 |
| 158 | 3300005338 | Ga0068868_100004312 | Ga0068868_1000043126 | 316 |
| 159 | 3300005338 | Ga0068868_100005010 | Ga0068868_1000050105 | 316 |
| 160 | 3300005339 | Ga0070660_100138867 | Ga0070660_1001388671 | 316 |
| 161 | 3300005340 | Ga0070689_100000399 | Ga0070689_10000039913 | 316 |
| 162 | 3300005340 | Ga0070689_100006563 | Ga0070689_1000065632 | 316 |
| 163 | 3300005340 | Ga0070689_100053981 | Ga0070689_1000539811 | 316 |
| 164 | 3300005340 | Ga0070689_100148812 | Ga0070689_1001488122 | 316 |
| 165 | 3300005341 | Ga0070691_10000528 | Ga0070691_100005289 | 316 |
| 166 | 3300005341 | Ga0070691_10062583 | Ga0070691_100625831 | 316 |
| 167 | 3300005343 | Ga0070687_100000604 | Ga0070687_1000006047 | 316 |
| 168 | 3300005345 | Ga0070692_10002623 | Ga0070692_100026231 | 316 |
| 169 | 3300005345 | Ga0070692_10057329 | Ga0070692_100573291 | 316 |
| 170 | 3300005353 | Ga0070669_100085688 | Ga0070669_1000856882 | 316 |
| 171 | 3300005354 | Ga0070675_100076146 | Ga0070675_1000761461 | 316 |
| 172 | 3300005355 | Ga0070671_100019910 | Ga0070671_1000199102 | 316 |
| 173 | 3300005355 | Ga0070671_100023857 | Ga0070671_1000238575 | 316 |
| 174 | 3300005355 | Ga0070671_100054746 | Ga0070671_1000547462 | 316 |
| 175 | 3300005356 | Ga0070674_100000456 | Ga0070674_10000045615 | 316 |
| 176 | 3300005356 | Ga0070674_100159480 | Ga0070674_1001594801 | 316 |
| 177 | 3300005364 | Ga0070673_100026117 | Ga0070673_1000261175 | 316 |
| 178 | 3300005364 | Ga0070673_100066945 | Ga0070673_1000669452 | 316 |
| 179 | 3300005364 | Ga0070673_100145316 | Ga0070673_1001453162 | 316 |
| 180 | 3300005365 | Ga0070688_100022931 | Ga0070688_1000229314 | 316 |
| 181 | 3300005435 | Ga0070714_100007015 | Ga0070714_1000070158 | 316 |
| 182 | 3300005435 | Ga0070714_100021227 | Ga0070714_1000212273 | 316 |
| 183 | 3300005435 | Ga0070714_100186416 | Ga0070714_1001864162 | 316 |
| 184 | 3300005435 | Ga0070714_100346423 | Ga0070714_1003464231 | 316 |
| 185 | 3300005436 | Ga0070713_100005924 | Ga0070713_1000059244 | 316 |
| 186 | 3300005436 | Ga0070713_100043906 | Ga0070713_1000439062 | 316 |
| 187 | 3300005436 | Ga0070713_100321600 | Ga0070713_1003216002 | 316 |
| 188 | 3300005437 | Ga0070710_10005399 | Ga0070710_100053993 | 316 |
| 189 | 3300005438 | Ga0070701_10129194 | Ga0070701_101291942 | 316 |
| 190 | 3300005439 | Ga0070711_100010002 | Ga0070711_1000100026 | 316 |
| 191 | 3300005439 | Ga0070711_100023557 | Ga0070711_1000235571 | 316 |
| 192 | 3300005439 | Ga0070711_100034687 | Ga0070711_1000346873 | 316 |
| 193 | 3300005439 | Ga0070711_100164991 | Ga0070711_1001649912 | 316 |
| 194 | 3300005439 | Ga0070711_100495344 | Ga0070711_1004953441 | 316 |
| 195 | 3300005440 | Ga0070705_100000554 | Ga0070705_10000055416 | 316 |
| 196 | 3300005440 | Ga0070705_100072555 | Ga0070705_1000725552 | 316 |
| 197 | 3300005440 | Ga0070705_100149842 | Ga0070705_1001498422 | 316 |
| 198 | 3300005440 | Ga0070705_100292763 | Ga0070705_1002927632 | 316 |
| 199 | 3300005441 | Ga0070700_100000281 | Ga0070700_10000028111 | 316 |
| 200 | 3300005441 | Ga0070700_100044716 | Ga0070700_1000447163 | 316 |
| 201 | 3300005444 | Ga0070694_100000565 | Ga0070694_1000005659 | 316 |
| 202 | 3300005444 | Ga0070694_100070278 | Ga0070694_1000702783 | 316 |
| 203 | 3300005456 | Ga0070678_100035789 | Ga0070678_1000357891 | 316 |
| 204 | 3300005458 | Ga0070681_10001127 | Ga0070681_1000112711 | 316 |
| 205 | 3300005458 | Ga0070681_10118881 | Ga0070681_101188812 | 316 |
| 206 | 3300005458 | Ga0070681_10154948 | Ga0070681_101549483 | 316 |
| 207 | 3300005458 | Ga0070681_10320812 | Ga0070681_103208122 | 316 |
| 208 | 3300005458 | Ga0070681_10414014 | Ga0070681_104140142 | 316 |
| 209 | 3300005459 | Ga0068867_100000206 | Ga0068867_1000002067 | 316 |
| 210 | 3300005459 | Ga0068867_100103433 | Ga0068867_1001034331 | 316 |
| 211 | 3300005466 | Ga0070685_10005577 | Ga0070685_100055777 | 316 |
| 212 | 3300005467 | Ga0070706_100306244 | Ga0070706_1003062441 | 316 |
| 213 | 3300005468 | Ga0070707_100128303 | Ga0070707_1001283032 | 316 |
| 214 | 3300005471 | Ga0070698_100365274 | Ga0070698_1003652742 | 316 |
| 215 | 3300005518 | Ga0070699_100184203 | Ga0070699_1001842032 | 316 |
| 216 | 3300005518 | Ga0070699_100276236 | Ga0070699_1002762361 | 316 |
| 217 | 3300005530 | Ga0070679_100003183 | Ga0070679_1000031832 | 316 |
| 218 | 3300005530 | Ga0070679_100034844 | Ga0070679_1000348446 | 316 |
| 219 | 3300005530 | Ga0070679_100149712 | Ga0070679_1001497122 | 316 |
| 220 | 3300005536 | Ga0070697_100121192 | Ga0070697_1001211922 | 316 |
| 221 | 3300005536 | Ga0070697_100180798 | Ga0070697_1001807982 | 316 |
| 222 | 3300005539 | Ga0068853_100063354 | Ga0068853_1000633543 | 316 |
| 223 | 3300005543 | Ga0070672_100268961 | Ga0070672_1002689611 | 316 |
| 224 | 3300005543 | Ga0070672_100314723 | Ga0070672_1003147232 | 316 |
| 225 | 3300005544 | Ga0070686_100000711 | Ga0070686_1000007119 | 316 |
| 226 | 3300005545 | Ga0070695_100000281 | Ga0070695_10000028111 | 316 |
| 227 | 3300005546 | Ga0070696_100004140 | Ga0070696_1000041407 | 316 |
| 228 | 3300005546 | Ga0070696_100010174 | Ga0070696_1000101747 | 316 |
| 229 | 3300005547 | Ga0070693_100000162 | Ga0070693_10000016219 | 316 |
| 230 | 3300005547 | Ga0070693_100364173 | Ga0070693_1003641731 | 316 |
| 231 | 3300005548 | Ga0070665_100030114 | Ga0070665_1000301145 | 316 |
| 232 | 3300005548 | Ga0070665_100190176 | Ga0070665_1001901762 | 316 |
| 233 | 3300005549 | Ga0070704_100010913 | Ga0070704_1000109133 | 316 |
| 234 | 3300005549 | Ga0070704_100039001 | Ga0070704_1000390012 | 316 |
| 235 | 3300005549 | Ga0070704_100059317 | Ga0070704_1000593173 | 316 |
| 236 | 3300005563 | Ga0068855_100105928 | Ga0068855_1001059284 | 316 |
| 237 | 3300005614 | Ga0068856_100327474 | Ga0068856_1003274742 | 316 |
| 238 | 3300005615 | Ga0070702_100000093 | Ga0070702_10000009319 | 316 |
| 239 | 3300005617 | Ga0068859_100003739 | Ga0068859_10000373912 | 316 |
| 240 | 3300005617 | Ga0068859_100045750 | Ga0068859_1000457504 | 316 |
| 241 | 3300005617 | Ga0068859_100185952 | Ga0068859_1001859522 | 316 |
| 242 | 3300005617 | Ga0068859_100695399 | Ga0068859_1006953991 | 316 |
| 243 | 3300005618 | Ga0068864_100046863 | Ga0068864_1000468634 | 316 |
| 244 | 3300005718 | Ga0068866_10000256 | Ga0068866_1000025614 | 316 |
| 245 | 3300005719 | Ga0068861_100000355 | Ga0068861_10000035510 | 316 |
| 246 | 3300005840 | Ga0068870_10022034 | Ga0068870_100220341 | 316 |
| 247 | 3300005841 | Ga0068863_100089193 | Ga0068863_1000891932 | 316 |
| 248 | 3300005842 | Ga0068858_100008078 | Ga0068858_1000080785 | 316 |
| 249 | 3300005842 | Ga0068858_100025135 | Ga0068858_1000251352 | 316 |
| 250 | 3300005843 | Ga0068860_100002594 | Ga0068860_10000259416 | 316 |
| 251 | 3300005843 | Ga0068860_100048947 | Ga0068860_1000489472 | 316 |
| 252 | 3300005843 | Ga0068860_100245021 | Ga0068860_1002450212 | 316 |
| 253 | 3300005843 | Ga0068860_100274649 | Ga0068860_1002746492 | 316 |
| 254 | 3300005844 | Ga0068862_100000381 | Ga0068862_10000038115 | 316 |
| 255 | 3300005844 | Ga0068862_100134173 | Ga0068862_1001341732 | 316 |
| 256 | 3300005937 | Ga0081455_10071704 | Ga0081455_100717042 | 316 |
| 257 | 3300005981 | Ga0081538_10000697 | Ga0081538_1000069718 | 316 |
| 258 | 3300005981 | Ga0081538_10017125 | Ga0081538_100171255 | 316 |
| 259 | 3300005983 | Ga0081540_1001984 | Ga0081540_10019847 | 316 |
| 260 | 3300005983 | Ga0081540_1036127 | Ga0081540_10361272 | 316 |
| 261 | 3300005983 | Ga0081540_1050173 | Ga0081540_10501732 | 316 |
| 262 | 3300005985 | Ga0081539_10002187 | Ga0081539_100021873 | 316 |
| 263 | 3300005985 | Ga0081539_10036902 | Ga0081539_100369022 | 316 |
| 264 | 3300006028 | Ga0070717_10014290 | Ga0070717_100142901 | 316 |
| 265 | 3300006048 | Ga0075363_100013539 | Ga0075363_1000135394 | 316 |
| 266 | 3300006051 | Ga0075364_10005843 | Ga0075364_100058432 | 316 |
| 267 | 3300006051 | Ga0075364_10073975 | Ga0075364_100739752 | 316 |
| 268 | 3300006163 | Ga0070715_10000633 | Ga0070715_100006333 | 316 |
| 269 | 3300006163 | Ga0070715_10002046 | Ga0070715_100020462 | 316 |
| 270 | 3300006163 | Ga0070715_10027128 | Ga0070715_100271282 | 316 |
| 271 | 3300006173 | Ga0070716_100006982 | Ga0070716_1000069823 | 316 |
| 272 | 3300006173 | Ga0070716_100065105 | Ga0070716_1000651052 | 316 |
| 273 | 3300006173 | Ga0070716_100072447 | Ga0070716_1000724472 | 316 |
| 274 | 3300006175 | Ga0070712_100002594 | Ga0070712_1000025948 | 316 |
| 275 | 3300006175 | Ga0070712_100008343 | Ga0070712_1000083434 | 316 |
| 276 | 3300006175 | Ga0070712_100028995 | Ga0070712_1000289953 | 316 |
| 277 | 3300006175 | Ga0070712_100038140 | Ga0070712_1000381403 | 316 |
| 278 | 3300006175 | Ga0070712_100047227 | Ga0070712_1000472272 | 316 |
| 279 | 3300006175 | Ga0070712_100110880 | Ga0070712_1001108801 | 316 |
| 280 | 3300006175 | Ga0070712_100158867 | Ga0070712_1001588672 | 316 |
| 281 | 3300006177 | Ga0075362_10002160 | Ga0075362_100021602 | 316 |
| 282 | 3300006177 | Ga0075362_10040981 | Ga0075362_100409812 | 316 |
| 283 | 3300006178 | Ga0075367_10067123 | Ga0075367_100671232 | 316 |
| 284 | 3300006178 | Ga0075367_10118426 | Ga0075367_101184261 | 316 |
| 285 | 3300006186 | Ga0075369_10015935 | Ga0075369_100159353 | 316 |
| 286 | 3300006195 | Ga0075366_10000931 | Ga0075366_100009312 | 316 |
| 287 | 3300006195 | Ga0075366_10022054 | Ga0075366_100220543 | 316 |
| 288 | 3300006237 | Ga0097621_100000303 | Ga0097621_10000030312 | 316 |
| 289 | 3300006237 | Ga0097621_100343669 | Ga0097621_1003436692 | 316 |
| 290 | 3300006237 | Ga0097621_100405247 | Ga0097621_1004052472 | 316 |
| 291 | 3300006358 | Ga0068871_100000925 | Ga0068871_10000092518 | 316 |
| 292 | 3300006358 | Ga0068871_100046071 | Ga0068871_1000460713 | 316 |
| 293 | 3300006844 | Ga0075428_100000083 | Ga0075428_10000008348 | 316 |
| 294 | 3300006844 | Ga0075428_100113402 | Ga0075428_1001134023 | 316 |
| 295 | 3300006844 | Ga0075428_100284076 | Ga0075428_1002840763 | 316 |
| 296 | 3300006846 | Ga0075430_100000163 | Ga0075430_10000016331 | 316 |
| 297 | 3300006846 | Ga0075430_100055653 | Ga0075430_1000556533 | 316 |
| 298 | 3300006847 | Ga0075431_100087790 | Ga0075431_1000877902 | 316 |
| 299 | 3300006852 | Ga0075433_10003177 | Ga0075433_100031775 | 316 |
| 300 | 3300006871 | Ga0075434_100000064 | Ga0075434_10000006429 | 316 |
| 301 | 3300006880 | Ga0075429_100001065 | Ga0075429_1000010657 | 316 |
| 302 | 3300006881 | Ga0068865_100093321 | Ga0068865_1000933211 | 316 |
| 303 | 3300006914 | Ga0075436_100005135 | Ga0075436_1000051359 | 316 |
| 304 | 3300006914 | Ga0075436_100016682 | Ga0075436_1000166823 | 316 |
| 305 | 3300006931 | Ga0097620_100003738 | Ga0097620_10000373812 | 316 |
| 306 | 3300006931 | Ga0097620_100045750 | Ga0097620_1000457504 | 316 |
| 307 | 3300006931 | Ga0097620_100185959 | Ga0097620_1001859592 | 316 |
| 308 | 3300006931 | Ga0097620_100695358 | Ga0097620_1006953581 | 316 |
| 309 | 3300006948 | Ga0099826_10035411 | Ga0099826_100354113 | 316 |
| 310 | 3300007076 | Ga0075435_100000586 | Ga0075435_10000058610 | 316 |
| 311 | 3300007076 | Ga0075435_100302692 | Ga0075435_1003026922 | 316 |
| 312 | 3300007788 | Ga0099795_10029911 | Ga0099795_100299112 | 316 |
| 313 | 3300007788 | Ga0099795_10076325 | Ga0099795_100763252 | 316 |
| 314 | 3300009098 | Ga0105245_10000696 | Ga0105245_100006967 | 316 |
| 315 | 3300009098 | Ga0105245_10002702 | Ga0105245_100027028 | 316 |
| 316 | 3300009098 | Ga0105245_10011796 | Ga0105245_100117965 | 316 |
| 317 | 3300009098 | Ga0105245_10167384 | Ga0105245_101673842 | 316 |
| 318 | 3300009101 | Ga0105247_10019849 | Ga0105247_100198494 | 316 |
| 319 | 3300009101 | Ga0105247_10109570 | Ga0105247_101095702 | 316 |
| 320 | 3300009147 | Ga0114129_10000210 | Ga0114129_100002104 | 316 |
| 321 | 3300009147 | Ga0114129_10087181 | Ga0114129_100871814 | 316 |
| 322 | 3300009148 | Ga0105243_10000631 | Ga0105243_1000063116 | 316 |
| 323 | 3300009148 | Ga0105243_10153892 | Ga0105243_101538922 | 316 |
| 324 | 3300009148 | Ga0105243_10197316 | Ga0105243_101973162 | 316 |
| 325 | 3300009176 | Ga0105242_10003476 | Ga0105242_1000347613 | 316 |
| 326 | 3300009176 | Ga0105242_10020603 | Ga0105242_100206032 | 316 |
| 327 | 3300009177 | Ga0105248_10465993 | Ga0105248_104659932 | 316 |
| 328 | 3300009545 | Ga0105237_10024199 | Ga0105237_100241996 | 316 |
| 329 | 3300009545 | Ga0105237_10183495 | Ga0105237_101834952 | 316 |
| 330 | 3300009545 | Ga0105237_10456475 | Ga0105237_104564752 | 316 |
| 331 | 3300009553 | Ga0105249_10003937 | Ga0105249_100039377 | 316 |
| 332 | 3300010159 | Ga0099796_10000419 | Ga0099796_100004195 | 316 |
| 333 | 3300010375 | Ga0105239_10253032 | Ga0105239_102530322 | 316 |
| 334 | 3300011119 | Ga0105246_10229808 | Ga0105246_102298082 | 316 |
| 335 | 3300011119 | Ga0105246_10422784 | Ga0105246_104227842 | 316 |
| 336 | 3300013104 | Ga0157370_10010690 | Ga0157370_1001069010 | 316 |
| 337 | 3300013105 | Ga0157369_10002769 | Ga0157369_1000276913 | 316 |
| 338 | 3300013105 | Ga0157369_10213752 | Ga0157369_102137522 | 316 |
| 339 | 3300013296 | Ga0157374_10012098 | Ga0157374_100120982 | 316 |
| 340 | 3300013297 | Ga0157378_10001488 | Ga0157378_100014883 | 316 |
| 341 | 3300013306 | Ga0163162_10030087 | Ga0163162_100300875 | 316 |
| 342 | 3300013306 | Ga0163162_10342000 | Ga0163162_103420002 | 316 |
| 343 | 3300013307 | Ga0157372_10507890 | Ga0157372_105078902 | 316 |
| 344 | 3300015262 | Ga0182007_10071314 | Ga0182007_100713141 | 316 |
| 345 | 3300017792 | Ga0163161_10291552 | Ga0163161_102915521 | 316 |
| 346 | 3300020080 | Ga0206350_10617166 | Ga0206350_106171662 | 316 |
| 347 | 3300020080 | Ga0206350_11377320 | Ga0206350_113773202 | 316 |
| 348 | 3300021361 | Ga0213872_10009977 | Ga0213872_100099775 | 316 |
| 349 | 3300021384 | Ga0213876_10102662 | Ga0213876_101026621 | 316 |
| 350 | 3300024227 | Ga0228598_1002924 | Ga0228598_10029242 | 316 |
| 351 | 3300025297 | Ga0209758_1000079 | Ga0209758_100007921 | 316 |
| 352 | 3300025885 | Ga0207653_10008178 | Ga0207653_100081781 | 316 |
| 353 | 3300025893 | Ga0207682_10000543 | Ga0207682_1000054314 | 316 |
| 354 | 3300025899 | Ga0207642_10095412 | Ga0207642_100954121 | 316 |
| 355 | 3300025900 | Ga0207710_10013829 | Ga0207710_100138291 | 316 |
| 356 | 3300025903 | Ga0207680_10177686 | Ga0207680_101776861 | 316 |
| 357 | 3300025904 | Ga0207647_10057890 | Ga0207647_100578902 | 316 |
| 358 | 3300025905 | Ga0207685_10004756 | Ga0207685_100047562 | 316 |
| 359 | 3300025905 | Ga0207685_10021335 | Ga0207685_100213352 | 316 |
| 360 | 3300025906 | Ga0207699_10012944 | Ga0207699_100129443 | 316 |
| 361 | 3300025906 | Ga0207699_10029996 | Ga0207699_100299962 | 316 |
| 362 | 3300025906 | Ga0207699_10235555 | Ga0207699_102355552 | 316 |
| 363 | 3300025907 | Ga0207645_10025828 | Ga0207645_100258282 | 316 |
| 364 | 3300025907 | Ga0207645_10027950 | Ga0207645_100279502 | 316 |
| 365 | 3300025908 | Ga0207643_10001848 | Ga0207643_1000184810 | 316 |
| 366 | 3300025910 | Ga0207684_10011372 | Ga0207684_100113726 | 316 |
| 367 | 3300025910 | Ga0207684_10274560 | Ga0207684_102745601 | 316 |
| 368 | 3300025912 | Ga0207707_10006531 | Ga0207707_100065317 | 316 |
| 369 | 3300025912 | Ga0207707_10062009 | Ga0207707_100620093 | 316 |
| 370 | 3300025912 | Ga0207707_10116094 | Ga0207707_101160943 | 316 |
| 371 | 3300025912 | Ga0207707_10217828 | Ga0207707_102178282 | 316 |
| 372 | 3300025915 | Ga0207693_10000068 | Ga0207693_1000006821 | 316 |
| 373 | 3300025915 | Ga0207693_10000855 | Ga0207693_1000085516 | 316 |
| 374 | 3300025915 | Ga0207693_10007507 | Ga0207693_100075072 | 316 |
| 375 | 3300025915 | Ga0207693_10023422 | Ga0207693_100234224 | 316 |
| 376 | 3300025915 | Ga0207693_10101537 | Ga0207693_101015372 | 316 |
| 377 | 3300025916 | Ga0207663_10007458 | Ga0207663_100074585 | 316 |
| 378 | 3300025917 | Ga0207660_10003314 | Ga0207660_100033147 | 316 |
| 379 | 3300025917 | Ga0207660_10010746 | Ga0207660_100107462 | 316 |
| 380 | 3300025918 | Ga0207662_10000257 | Ga0207662_1000025710 | 316 |
| 381 | 3300025918 | Ga0207662_10009537 | Ga0207662_100095372 | 316 |
| 382 | 3300025919 | Ga0207657_10182571 | Ga0207657_101825712 | 316 |
| 383 | 3300025921 | Ga0207652_10054007 | Ga0207652_100540072 | 316 |
| 384 | 3300025921 | Ga0207652_10111925 | Ga0207652_101119251 | 316 |
| 385 | 3300025921 | Ga0207652_10112577 | Ga0207652_101125773 | 316 |
| 386 | 3300025921 | Ga0207652_10258852 | Ga0207652_102588521 | 316 |
| 387 | 3300025922 | Ga0207646_10108859 | Ga0207646_101088592 | 316 |
| 388 | 3300025923 | Ga0207681_10062274 | Ga0207681_100622742 | 316 |
| 389 | 3300025925 | Ga0207650_10068465 | Ga0207650_100684653 | 316 |
| 390 | 3300025925 | Ga0207650_10091002 | Ga0207650_100910022 | 316 |
| 391 | 3300025926 | Ga0207659_10142786 | Ga0207659_101427863 | 316 |
| 392 | 3300025926 | Ga0207659_10182438 | Ga0207659_101824382 | 316 |
| 393 | 3300025926 | Ga0207659_10365432 | Ga0207659_103654322 | 316 |
| 394 | 3300025927 | Ga0207687_10002535 | Ga0207687_100025358 | 316 |
| 395 | 3300025927 | Ga0207687_10279310 | Ga0207687_102793102 | 316 |
| 396 | 3300025928 | Ga0207700_10050072 | Ga0207700_100500722 | 316 |
| 397 | 3300025928 | Ga0207700_10127448 | Ga0207700_101274481 | 316 |
| 398 | 3300025928 | Ga0207700_10252912 | Ga0207700_102529122 | 316 |
| 399 | 3300025928 | Ga0207700_10315408 | Ga0207700_103154082 | 316 |
| 400 | 3300025929 | Ga0207664_10040999 | Ga0207664_100409992 | 316 |
| 401 | 3300025929 | Ga0207664_10201736 | Ga0207664_102017362 | 316 |
| 402 | 3300025929 | Ga0207664_10229820 | Ga0207664_102298202 | 316 |
| 403 | 3300025931 | Ga0207644_10016411 | Ga0207644_100164114 | 316 |
| 404 | 3300025931 | Ga0207644_10031985 | Ga0207644_100319852 | 316 |
| 405 | 3300025931 | Ga0207644_10276929 | Ga0207644_102769292 | 316 |
| 406 | 3300025933 | Ga0207706_10038152 | Ga0207706_100381524 | 316 |
| 407 | 3300025933 | Ga0207706_10121373 | Ga0207706_101213732 | 316 |
| 408 | 3300025934 | Ga0207686_10014985 | Ga0207686_100149853 | 316 |
| 409 | 3300025935 | Ga0207709_10000662 | Ga0207709_1000066225 | 316 |
| 410 | 3300025935 | Ga0207709_10145655 | Ga0207709_101456551 | 316 |
| 411 | 3300025936 | Ga0207670_10000333 | Ga0207670_1000033317 | 316 |
| 412 | 3300025936 | Ga0207670_10002665 | Ga0207670_1000266512 | 316 |
| 413 | 3300025936 | Ga0207670_10004310 | Ga0207670_100043108 | 316 |
| 414 | 3300025936 | Ga0207670_10020940 | Ga0207670_100209401 | 316 |
| 415 | 3300025936 | Ga0207670_10205270 | Ga0207670_102052702 | 316 |
| 416 | 3300025937 | Ga0207669_10210730 | Ga0207669_102107301 | 316 |
| 417 | 3300025938 | Ga0207704_10000798 | Ga0207704_100007987 | 316 |
| 418 | 3300025938 | Ga0207704_10010936 | Ga0207704_100109365 | 316 |
| 419 | 3300025938 | Ga0207704_10206684 | Ga0207704_102066842 | 316 |
| 420 | 3300025939 | Ga0207665_10003244 | Ga0207665_100032445 | 316 |
| 421 | 3300025939 | Ga0207665_10023145 | Ga0207665_100231453 | 316 |
| 422 | 3300025939 | Ga0207665_10037567 | Ga0207665_100375673 | 316 |
| 423 | 3300025940 | Ga0207691_10161849 | Ga0207691_101618492 | 316 |
| 424 | 3300025941 | Ga0207711_10014397 | Ga0207711_100143977 | 316 |
| 425 | 3300025941 | Ga0207711_10055281 | Ga0207711_100552812 | 316 |
| 426 | 3300025941 | Ga0207711_10062514 | Ga0207711_100625143 | 316 |
| 427 | 3300025941 | Ga0207711_10141067 | Ga0207711_101410672 | 316 |
| 428 | 3300025942 | Ga0207689_10001220 | Ga0207689_1000122018 | 316 |
| 429 | 3300025942 | Ga0207689_10014839 | Ga0207689_100148393 | 316 |
| 430 | 3300025942 | Ga0207689_10119685 | Ga0207689_101196852 | 316 |
| 431 | 3300025942 | Ga0207689_10128018 | Ga0207689_101280182 | 316 |
| 432 | 3300025942 | Ga0207689_10157051 | Ga0207689_101570512 | 316 |
| 433 | 3300025945 | Ga0207679_10207272 | Ga0207679_102072722 | 316 |
| 434 | 3300025949 | Ga0207667_10011463 | Ga0207667_100114634 | 316 |
| 435 | 3300025949 | Ga0207667_10012740 | Ga0207667_100127408 | 316 |
| 436 | 3300025960 | Ga0207651_10009279 | Ga0207651_100092791 | 316 |
| 437 | 3300025961 | Ga0207712_10048334 | Ga0207712_100483341 | 316 |
| 438 | 3300025972 | Ga0207668_10405555 | Ga0207668_104055552 | 316 |
| 439 | 3300025981 | Ga0207640_10004352 | Ga0207640_100043522 | 316 |
| 440 | 3300026023 | Ga0207677_10049518 | Ga0207677_100495183 | 316 |
| 441 | 3300026067 | Ga0207678_10002574 | Ga0207678_100025743 | 316 |
| 442 | 3300026075 | Ga0207708_10000993 | Ga0207708_100009934 | 316 |
| 443 | 3300026075 | Ga0207708_10008364 | Ga0207708_100083642 | 316 |
| 444 | 3300026078 | Ga0207702_10040209 | Ga0207702_100402092 | 316 |
| 445 | 3300026078 | Ga0207702_10176628 | Ga0207702_101766282 | 316 |
| 446 | 3300026088 | Ga0207641_10172491 | Ga0207641_101724912 | 316 |
| 447 | 3300026089 | Ga0207648_10000840 | Ga0207648_1000084026 | 316 |
| 448 | 3300026089 | Ga0207648_10001304 | Ga0207648_1000130418 | 316 |
| 449 | 3300026089 | Ga0207648_10051080 | Ga0207648_100510803 | 316 |
| 450 | 3300026095 | Ga0207676_10018327 | Ga0207676_100183274 | 316 |
| 451 | 3300026095 | Ga0207676_10441243 | Ga0207676_104412431 | 316 |
| 452 | 3300026118 | Ga0207675_100000900 | Ga0207675_10000090018 | 316 |
| 453 | 3300026118 | Ga0207675_100002492 | Ga0207675_1000024927 | 316 |
| 454 | 3300026118 | Ga0207675_100182211 | Ga0207675_1001822112 | 316 |
| 455 | 3300026121 | Ga0207683_10015669 | Ga0207683_100156696 | 316 |
| 456 | 3300026121 | Ga0207683_10242126 | Ga0207683_102421262 | 316 |
| 457 | 3300026142 | Ga0207698_10169618 | Ga0207698_101696182 | 316 |
| 458 | 3300027360 | Ga0209969_1002388 | Ga0209969_10023882 | 316 |
| 459 | 3300027364 | Ga0209967_1007468 | Ga0209967_10074682 | 316 |
| 460 | 3300027512 | Ga0209179_1014773 | Ga0209179_10147732 | 316 |
| 461 | 3300027526 | Ga0209968_1005378 | Ga0209968_10053782 | 316 |
| 462 | 3300027543 | Ga0209999_1000224 | Ga0209999_10002245 | 316 |
| 463 | 3300027907 | Ga0207428_10000321 | Ga0207428_1000032150 | 316 |
| 464 | 3300027907 | Ga0207428_10046915 | Ga0207428_100469155 | 316 |
| 465 | 3300028023 | Ga0265357_1005616 | Ga0265357_10056161 | 316 |
| 466 | 3300028380 | Ga0268265_10005803 | Ga0268265_100058033 | 316 |
| 467 | 3300028380 | Ga0268265_10241621 | Ga0268265_102416212 | 316 |
| 468 | 3300028381 | Ga0268264_10023040 | Ga0268264_100230401 | 316 |
| 469 | 3300028381 | Ga0268264_10169224 | Ga0268264_101692241 | 316 |
| 470 | 3300028556 | Ga0265337_1001602 | Ga0265337_10016029 | 316 |
| 471 | 3300028573 | Ga0265334_10000375 | Ga0265334_1000037515 | 316 |
| 472 | 3300028800 | Ga0265338_10017937 | Ga0265338_100179377 | 316 |
| 473 | 3300031090 | Ga0265760_10022541 | Ga0265760_100225412 | 316 |
| 474 | 3300031235 | Ga0265330_10025350 | Ga0265330_100253502 | 316 |
| 475 | 3300031238 | Ga0265332_10090049 | Ga0265332_100900491 | 316 |
| 476 | 3300031240 | Ga0265320_10064213 | Ga0265320_100642132 | 316 |
| 477 | 3300031241 | Ga0265325_10000649 | Ga0265325_1000064920 | 316 |
| 478 | 3300031241 | Ga0265325_10086558 | Ga0265325_100865581 | 316 |
| 479 | 3300031241 | Ga0265325_10093049 | Ga0265325_100930492 | 316 |
| 480 | 3300031242 | Ga0265329_10006400 | Ga0265329_100064001 | 316 |
| 481 | 3300031247 | Ga0265340_10058038 | Ga0265340_100580382 | 316 |
| 482 | 3300031247 | Ga0265340_10075674 | Ga0265340_100756742 | 316 |
| 483 | 3300031247 | Ga0265340_10114843 | Ga0265340_101148431 | 316 |
| 484 | 3300031249 | Ga0265339_10000269 | Ga0265339_1000026938 | 316 |
| 485 | 3300031249 | Ga0265339_10036335 | Ga0265339_100363352 | 316 |
| 486 | 3300031595 | Ga0265313_10022761 | Ga0265313_100227611 | 316 |
| 487 | 3300031711 | Ga0265314_10043616 | Ga0265314_100436163 | 316 |
| 488 | 3300031712 | Ga0265342_10043768 | Ga0265342_100437682 | 316 |
| 489 | 3300034816 | Ga0373930_0015062 | Ga0373930_0015062_403_1359 | 316 |
| 490 | 3300035083 | Ga0373926_0003071 | Ga0373926_0003071_1776_2732 | 316 |
| 491 | 3300035083 | Ga0373926_0016641 | Ga0373926_0016641_1305_2261 | 316 |
| 492 | 3300035084 | Ga0373928_0004469 | Ga0373928_0004469_877_1833 | 316 |
| 493 | 3300035085 | Ga0373929_0012853 | Ga0373929_0012853_302_1258 | 316 |
| 494 | 3300035088 | Ga0373940_0019433 | Ga0373940_0019433_330_1286 | 316 |
| 495 | 3300035089 | Ga0373944_0018964 | Ga0373944_0018964_292_1248 | 316 |
| 496 | 3300035089 | Ga0373944_0036368 | Ga0373944_0036368_205_1161 | 316 |
| 497 | 3300035091 | Ga0373951_0005912 | Ga0373951_0005912_1416_2372 | 316 |
| 498 | 3300035092 | Ga0373952_0003713 | Ga0373952_0003713_1470_2426 | 316 |
| 499 | 3300035112 | Ga0373932_0001983 | Ga0373932_0001983_1745_2701 | 316 |
| 500 | 3300035113 | Ga0373936_0006658 | Ga0373936_0006658_269_1315 | 316 |
| 501 | 3300035113 | Ga0373936_0029845 | Ga0373936_0029845_600_1556 | 316 |
| 502 | 3300035116 | Ga0373945_0000969 | Ga0373945_0000969_3033_3989 | 316 |
| 503 | 3300035116 | Ga0373945_0003484 | Ga0373945_0003484_2308_3264 | 316 |
| 504 | 3300035116 | Ga0373945_0006884 | Ga0373945_0006884_167_1123 | 316 |
| 505 | 3300035117 | Ga0373953_0020708 | Ga0373953_0020708_266_1222 | 316 |
| 506 | 3300035118 | Ga0373954_0032131 | Ga0373954_0032131_715_1665 | 316 |
| 507 | 3300035118 | Ga0373954_0056964 | Ga0373954_0056964_761_1717 | 316 |
| 508 | 3300035118 | Ga0373954_0125623 | Ga0373954_0125623_17_967 | 316 |
| 509 | 3300035119 | Ga0373956_0026912 | Ga0373956_0026912_53_1009 | 316 |
| 510 | 3300035120 | Ga0373957_0037722 | Ga0373957_0037722_206_1156 | 316 |
| 511 | 3300035121 | Ga0373960_0033881 | Ga0373960_0033881_128_1084 | 316 |
| 512 | 3300035170 | Ga0373943_0000185 | Ga0373943_0000185_19460_20416 | 316 |
| 513 | 3300035170 | Ga0373943_0014863 | Ga0373943_0014863_1165_2115 | 316 |
| 514 | 3300035170 | Ga0373943_0083775 | Ga0373943_0083775_238_1194 | 316 |
| 515 | 3300035170 | Ga0373943_0152461 | Ga0373943_0152461_215_1171 | 316 |
| 516 | 3300035171 | Ga0373946_0000642 | Ga0373946_0000642_7866_8822 | 316 |
| 517 | 3300035171 | Ga0373946_0174843 | Ga0373946_0174843_24_980 | 316 |
| 518 | 3300035172 | Ga0373955_0001304 | Ga0373955_0001304_1124_2080 | 316 |
| 519 | 3300035172 | Ga0373955_0002912 | Ga0373955_0002912_3905_4861 | 316 |
| 520 | 3300035172 | Ga0373955_0003944 | Ga0373955_0003944_4959_5924 | 316 |
| 521 | 3300035172 | Ga0373955_0068444 | Ga0373955_0068444_267_1223 | 316 |
| 522 | 3300035241 | Ga0373961_0006705 | Ga0373961_0006705_117_1073 | 316 |
| 523 | 3300035242 | Ga0373962_0012148 | Ga0373962_0012148_101_1057 | 316 |
| 524 | 3300035242 | Ga0373962_0019134 | Ga0373962_0019134_606_1562 | 316 |
| 525 | 3300035410 | Ga0373924_0008512 | Ga0373924_0008512_717_1682 | 316 |
| 526 | 3300035410 | Ga0373924_0020013 | Ga0373924_0020013_718_1674 | 316 |
| 527 | 3300035691 | Ga0373931_0000134 | Ga0373931_0000134_19338_20294 | 316 |
| 528 | 3300035691 | Ga0373931_0054056 | Ga0373931_0054056_775_1731 | 316 |
| 529 | 3300035691 | Ga0373931_0140963 | Ga0373931_0140963_214_1170 | 316 |
| 530 | 3300035691 | Ga0373931_0179923 | Ga0373931_0179923_126_1082 | 316 |
| 531 | 3300035692 | Ga0373935_0000023 | Ga0373935_0000023_38360_39325 | 316 |
| 532 | 3300035692 | Ga0373935_0010837 | Ga0373935_0010837_3040_3996 | 316 |
| 533 | 3300035692 | Ga0373935_0039428 | Ga0373935_0039428_76_1032 | 316 |
| 534 | 3300035692 | Ga0373935_0124974 | Ga0373935_0124974_250_1296 | 316 |
| 535 | 3300035692 | Ga0373935_0163631 | Ga0373935_0163631_115_1074 | 316 |
| 536 | 3300035692 | Ga0373935_0176776 | Ga0373935_0176776_496_1452 | 316 |
| 537 | 3300035695 | Ga0373927_0000434 | Ga0373927_0000434_23242_24198 | 316 |
| 538 | 3300035695 | Ga0373927_0013020 | Ga0373927_0013020_2543_3499 | 316 |
| 539 | 3300035695 | Ga0373927_0020220 | Ga0373927_0020220_1617_2582 | 316 |
| 540 | 3300035695 | Ga0373927_0041756 | Ga0373927_0041756_1059_2015 | 316 |
| 541 | 3300035695 | Ga0373927_0051817 | Ga0373927_0051817_129_1079 | 316 |
| 542 | 3300035695 | Ga0373927_0070058 | Ga0373927_0070058_82_1038 | 316 |
| 543 | 3300035695 | Ga0373927_0072642 | Ga0373927_0072642_190_1146 | 316 |
| 544 | 3300035724 | Ga0373933_0001503 | Ga0373933_0001503_8689_9645 | 316 |
| 545 | 3300035724 | Ga0373933_0006249 | Ga0373933_0006249_4989_5945 | 316 |
| 546 | 3300035724 | Ga0373933_0011490 | Ga0373933_0011490_1936_2901 | 316 |
| 547 | 3300035725 | Ga0373947_0000583 | Ga0373947_0000583_7853_8809 | 316 |
| 548 | 3300035725 | Ga0373947_0017670 | Ga0373947_0017670_33_989 | 316 |
| 549 | 3300035725 | Ga0373947_0070482 | Ga0373947_0070482_1153_2109 | 316 |
| 550 | 3300035725 | Ga0373947_0208520 | Ga0373947_0208520_45_1001 | 316 |
| 551 | 3300035725 | Ga0373947_0213124 | Ga0373947_0213124_235_1245 | 316 |
| 552 | 3300036401 | Ga0373937_0000005 | Ga0373937_0000005_148914_149879 | 316 |
| 553 | 3300036401 | Ga0373937_0003414 | Ga0373937_0003414_10776_11726 | 316 |
| 554 | 3300036401 | Ga0373937_0009993 | Ga0373937_0009993_3784_4740 | 316 |
| 555 | 3300036401 | Ga0373937_0010352 | Ga0373937_0010352_2312_3268 | 316 |
| 556 | 3300036401 | Ga0373937_0091795 | Ga0373937_0091795_10_960 | 316 |
| 557 | 3300037068 | Ga0373925_0000007 | Ga0373925_0000007_50314_51279 | 316 |
| 558 | 3300037068 | Ga0373925_0000749 | Ga0373925_0000749_1676_2632 | 316 |
| 559 | 3300037068 | Ga0373925_0030549 | Ga0373925_0030549_900_1850 | 316 |
| 560 | 3300037068 | Ga0373925_0104188 | Ga0373925_0104188_482_1492 | 316 |
| 561 | 3300037068 | Ga0373925_0107062 | Ga0373925_0107062_54_1010 | 316 |
| 562 | 3300037068 | Ga0373925_0132701 | Ga0373925_0132701_51_1007 | 316 |
| 563 | 3300037068 | Ga0373925_0330088 | Ga0373925_0330088_80_1036 | 316 |
| 564 | 3300037466 | Ga0395898_0152595 | Ga0395898_0152595_575_1528 | 316 |
| 565 | 3300037466 | Ga0395898_0182889 | Ga0395898_0182889_757_1713 | 316 |
| 566 | 3300037853 | Ga0436364_1488218 | Ga0436364_1488218_630_1586 | 316 |
| 567 | 3300039437 | Ga0436365_0053879 | Ga0436365_0053879_87_1043 | 316 |
| 568 | 3300039437 | Ga0436365_0395269 | Ga0436365_0395269_170_1126 | 316 |
| 569 | 3300039437 | Ga0436365_1548351 | Ga0436365_1548351_143_1099 | 316 |
| 570 | 3300039437 | Ga0436365_1582443 | Ga0436365_1582443_685_1635 | 316 |
| 571 | 3300039438 | Ga0436360_0793447 | Ga0436360_0793447_203_1153 | 316 |
| 572 | 3300039438 | Ga0436360_1115848 | Ga0436360_1115848_883_1839 | 316 |
| 573 | 3300039450 | Ga0436363_0460787 | Ga0436363_0460787_610_1566 | 316 |
| 574 | 3300039450 | Ga0436363_1144933 | Ga0436363_1144933_592_1548 | 316 |
| 575 | 3300039453 | Ga0436362_0233360 | Ga0436362_0233360_28_981 | 316 |
| 576 | 3300039453 | Ga0436362_0742152 | Ga0436362_0742152_46_1002 | 316 |
| 577 | 3300039453 | Ga0436362_1187034 | Ga0436362_1187034_93_1055 | 316 |
| 578 | 3300042435 | Ga0439434_0000107 | Ga0439434_0000107_19204_20160 | 316 |
| 579 | 3300042435 | Ga0439434_0027711 | Ga0439434_0027711_533_1489 | 316 |
| 580 | 3300042436 | Ga0439435_0000076 | Ga0439435_0000076_4939_5895 | 316 |
| 581 | 3300042876 | Ga0451577_0100523 | Ga0451577_0100523_799_1755 | 316 |
| 582 | 3300044694 | Ga0466963_0016237 | Ga0466963_0016237_1510_2466 | 316 |
| 583 | 3300044842 | Ga0466957_0067767 | Ga0466957_0067767_833_1789 | 316 |
| 584 | 3300045049 | Ga0466959_0064196 | Ga0466959_0064196_301_1257 | 316 |
| 585 | 3300045051 | Ga0451576_0001387 | Ga0451576_0001387_14166_15122 | 316 |
| 586 | 3300046453 | Ga0495627_051507 | Ga0495627_051507_95_1051 | 316 |
| 587 | 3300046454 | Ga0495592_0007203 | Ga0495592_0007203_4865_5830 | 316 |
| 588 | 3300046454 | Ga0495592_0021131 | Ga0495592_0021131_2245_3201 | 316 |
| 589 | 3300046454 | Ga0495592_0034241 | Ga0495592_0034241_2503_3459 | 316 |
| 590 | 3300046454 | Ga0495592_0038795 | Ga0495592_0038795_1170_2126 | 316 |
| 591 | 3300046454 | Ga0495592_0072080 | Ga0495592_0072080_453_1409 | 316 |
| 592 | 3300046454 | Ga0495592_0231287 | Ga0495592_0231287_56_1012 | 316 |
| 593 | 3300046455 | Ga0495603_0025282 | Ga0495603_0025282_2266_3222 | 316 |
| 594 | 3300046455 | Ga0495603_0237504 | Ga0495603_0237504_58_1014 | 316 |
| 595 | 3300046459 | Ga0495629_0012162 | Ga0495629_0012162_1871_2827 | 316 |
| 596 | 3300046459 | Ga0495629_0017119 | Ga0495629_0017119_3970_4935 | 316 |
| 597 | 3300046459 | Ga0495629_0153118 | Ga0495629_0153118_484_1440 | 316 |
| 598 | 3300046460 | Ga0495638_0040866 | Ga0495638_0040866_618_1574 | 316 |
| 599 | 3300046461 | Ga0495641_0020520 | Ga0495641_0020520_2262_3218 | 316 |
| 600 | 3300046462 | Ga0495651_0001105 | Ga0495651_0001105_4198_5154 | 316 |
| 601 | 3300046462 | Ga0495651_0007669 | Ga0495651_0007669_2426_3391 | 316 |
| 602 | 3300046462 | Ga0495651_0050378 | Ga0495651_0050378_1689_2645 | 316 |
| 603 | 3300046463 | Ga0495653_0000308 | Ga0495653_0000308_33795_34760 | 316 |
| 604 | 3300046463 | Ga0495653_0001999 | Ga0495653_0001999_3238_4194 | 316 |
| 605 | 3300046472 | Ga0495580_0001449 | Ga0495580_0001449_13996_14946 | 316 |
| 606 | 3300046472 | Ga0495580_0058208 | Ga0495580_0058208_486_1442 | 316 |
| 607 | 3300046472 | Ga0495580_0110115 | Ga0495580_0110115_787_1746 | 316 |
| 608 | 3300046472 | Ga0495580_0139388 | Ga0495580_0139388_633_1589 | 316 |
| 609 | 3300046472 | Ga0495580_0189984 | Ga0495580_0189984_433_1389 | 316 |
| 610 | 3300046475 | Ga0495639_0013308 | Ga0495639_0013308_152_1108 | 316 |
| 611 | 3300046476 | Ga0495662_0008076 | Ga0495662_0008076_1180_2226 | 316 |
| 612 | 3300046476 | Ga0495662_0010733 | Ga0495662_0010733_271_1227 | 316 |
| 613 | 3300046476 | Ga0495662_0054256 | Ga0495662_0054256_17_973 | 316 |
| 614 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_508282_509247 | 316 |
| 615 | 3300046477 | Ga0495664_0001762 | Ga0495664_0001762_1726_2772 | 316 |
| 616 | 3300046491 | Ga0495584_0164884 | Ga0495584_0164884_160_1116 | 316 |
| 617 | 3300046511 | Ga0495608_0000072 | Ga0495608_0000072_33678_34643 | 316 |
| 618 | 3300046511 | Ga0495608_0001418 | Ga0495608_0001418_7679_8635 | 316 |
| 619 | 3300046514 | Ga0495618_0000019 | Ga0495618_0000019_73449_74414 | 316 |
| 620 | 3300046514 | Ga0495618_0003872 | Ga0495618_0003872_600_1556 | 316 |
| 621 | 3300046514 | Ga0495618_0017589 | Ga0495618_0017589_3091_4047 | 316 |
| 622 | 3300046516 | Ga0495628_0000015 | Ga0495628_0000015_4962_5927 | 316 |
| 623 | 3300046516 | Ga0495628_0104293 | Ga0495628_0104293_754_1710 | 316 |
| 624 | 3300046516 | Ga0495628_0198013 | Ga0495628_0198013_35_991 | 316 |
| 625 | 3300046517 | Ga0495630_0027301 | Ga0495630_0027301_732_1697 | 316 |
| 626 | 3300046517 | Ga0495630_0029121 | Ga0495630_0029121_82_1038 | 316 |
| 627 | 3300046517 | Ga0495630_0142109 | Ga0495630_0142109_107_1117 | 316 |
| 628 | 3300046525 | Ga0495663_0017948 | Ga0495663_0017948_283_1239 | 316 |
| 629 | 3300046526 | Ga0495666_0040519 | Ga0495666_0040519_154_1110 | 316 |
| 630 | 3300046526 | Ga0495666_0110666 | Ga0495666_0110666_41_997 | 316 |
| 631 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_265755_266720 | 316 |
| 632 | 3300046529 | Ga0495652_0024988 | Ga0495652_0024988_2537_3493 | 316 |
| 633 | 3300046531 | Ga0495665_0013808 | Ga0495665_0013808_2913_3869 | 316 |
| 634 | 3300046531 | Ga0495665_0039593 | Ga0495665_0039593_428_1384 | 316 |
| 635 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_452496_453461 | 316 |
| 636 | 3300046533 | Ga0495640_0007626 | Ga0495640_0007626_177_1136 | 316 |
| 637 | 3300046533 | Ga0495640_0007854 | Ga0495640_0007854_5701_6747 | 316 |
| 638 | 3300046533 | Ga0495640_0036736 | Ga0495640_0036736_17_973 | 316 |
| 639 | 3300046533 | Ga0495640_0063367 | Ga0495640_0063367_272_1231 | 316 |
| 640 | 3300046533 | Ga0495640_0232222 | Ga0495640_0232222_21_977 | 316 |
| 641 | 3300046535 | Ga0495586_0001019 | Ga0495586_0001019_1716_2672 | 316 |
| 642 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_524952_525917 | 316 |
| 643 | 3300046536 | Ga0495587_0000718 | Ga0495587_0000718_12787_13743 | 316 |
| 644 | 3300046536 | Ga0495587_0211790 | Ga0495587_0211790_92_1048 | 316 |
| 645 | 3300046537 | Ga0495598_0029042 | Ga0495598_0029042_529_1485 | 316 |
| 646 | 3300046539 | Ga0495621_0053406 | Ga0495621_0053406_205_1161 | 316 |
| 647 | 3300046543 | Ga0495645_0002525 | Ga0495645_0002525_4905_5870 | 316 |
| 648 | 3300046543 | Ga0495645_0010377 | Ga0495645_0010377_348_1358 | 316 |
| 649 | 3300046543 | Ga0495645_0061883 | Ga0495645_0061883_1065_2021 | 316 |
| 650 | 3300046559 | Ga0495667_0000021 | Ga0495667_0000021_129429_130394 | 316 |
| 651 | 3300046559 | Ga0495667_0015887 | Ga0495667_0015887_1556_2512 | 316 |
| 652 | 3300046559 | Ga0495667_0047937 | Ga0495667_0047937_561_1517 | 316 |
| 653 | 3300046559 | Ga0495667_0069839 | Ga0495667_0069839_154_1110 | 316 |
| 654 | 3300046559 | Ga0495667_0247884 | Ga0495667_0247884_130_1086 | 316 |
| 655 | 3300046615 | Ga0495656_0011244 | Ga0495656_0011244_1325_2281 | 316 |
| 656 | 3300046615 | Ga0495656_0122948 | Ga0495656_0122948_55_1011 | 316 |
| 657 | 3300046616 | Ga0495668_0188938 | Ga0495668_0188938_137_1093 | 316 |
| 658 | 3300046642 | Ga0495634_0000251 | Ga0495634_0000251_44883_45848 | 316 |
| 659 | 3300046642 | Ga0495634_0004679 | Ga0495634_0004679_7795_8751 | 316 |
| 660 | 3300046642 | Ga0495634_0005356 | Ga0495634_0005356_7126_8082 | 316 |
| 661 | 3300046642 | Ga0495634_0008363 | Ga0495634_0008363_6486_7532 | 316 |
| 662 | 3300046642 | Ga0495634_0031218 | Ga0495634_0031218_1368_2327 | 316 |
| 663 | 3300046642 | Ga0495634_0147046 | Ga0495634_0147046_272_1228 | 316 |
| 664 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_510763_511728 | 316 |
| 665 | 3300046663 | Ga0495635_0013586 | Ga0495635_0013586_2128_3084 | 316 |
| 666 | 3300046674 | Ga0495588_0014197 | Ga0495588_0014197_1944_2900 | 316 |
| 667 | 3300046675 | Ga0495657_0000486 | Ga0495657_0000486_7654_8619 | 316 |
| 668 | 3300046675 | Ga0495657_0004121 | Ga0495657_0004121_7222_8178 | 316 |
| 669 | 3300046675 | Ga0495657_0094272 | Ga0495657_0094272_700_1656 | 316 |
| 670 | 3300046678 | Ga0495599_0000203 | Ga0495599_0000203_4882_5847 | 316 |
| 671 | 3300046678 | Ga0495599_0061678 | Ga0495599_0061678_336_1292 | 316 |
| 672 | 3300046678 | Ga0495599_0121767 | Ga0495599_0121767_446_1402 | 316 |
| 673 | 3300046679 | Ga0495623_0000058 | Ga0495623_0000058_14552_15517 | 316 |
| 674 | 3300046679 | Ga0495623_0014685 | Ga0495623_0014685_2388_3344 | 316 |
| 675 | 3300046679 | Ga0495623_0040238 | Ga0495623_0040238_993_1943 | 316 |
| 676 | 3300046680 | Ga0495646_0000003 | Ga0495646_0000003_88751_89716 | 316 |
| 677 | 3300046680 | Ga0495646_0118020 | Ga0495646_0118020_471_1427 | 316 |
| 678 | 3300046681 | Ga0495647_0002041 | Ga0495647_0002041_5067_6023 | 316 |
| 679 | 3300046681 | Ga0495647_0019408 | Ga0495647_0019408_911_1867 | 316 |
| 680 | 3300046681 | Ga0495647_0061291 | Ga0495647_0061291_428_1384 | 316 |
| 681 | 3300046681 | Ga0495647_0063946 | Ga0495647_0063946_196_1146 | 316 |
| 682 | 3300046683 | Ga0495658_0006634 | Ga0495658_0006634_3679_4635 | 316 |
| 683 | 3300046683 | Ga0495658_0021666 | Ga0495658_0021666_1591_2547 | 316 |
| 684 | 3300046689 | Ga0495613_0032385 | Ga0495613_0032385_2328_3284 | 316 |
| 685 | 3300046689 | Ga0495613_0044368 | Ga0495613_0044368_753_1709 | 316 |
| 686 | 3300046689 | Ga0495613_0270040 | Ga0495613_0270040_183_1139 | 316 |
| 687 | 3300046690 | Ga0495624_0019722 | Ga0495624_0019722_2116_3081 | 316 |
| 688 | 3300046690 | Ga0495624_0043998 | Ga0495624_0043998_889_1845 | 316 |
| 689 | 3300046690 | Ga0495624_0066538 | Ga0495624_0066538_695_1651 | 316 |
| 690 | 3300046690 | Ga0495624_0110338 | Ga0495624_0110338_372_1331 | 316 |
| 691 | 3300046690 | Ga0495624_0226103 | Ga0495624_0226103_127_1083 | 316 |
| 692 | 3300046691 | Ga0495670_0078096 | Ga0495670_0078096_289_1245 | 316 |
| 693 | 3300046809 | Ga0495600_0000002 | Ga0495600_0000002_180746_181711 | 316 |
| 694 | 3300046809 | Ga0495600_0006243 | Ga0495600_0006243_5528_6484 | 316 |
| 695 | 3300046809 | Ga0495600_0071440 | Ga0495600_0071440_1096_2052 | 316 |
| 696 | 3300047315 | Ga0495581_0018810 | Ga0495581_0018810_631_1596 | 316 |
| 697 | 3300047317 | Ga0495604_0000001 | Ga0495604_0000001_702802_703767 | 316 |
| 698 | 3300047317 | Ga0495604_0003884 | Ga0495604_0003884_8404_9360 | 316 |
| 699 | 3300047317 | Ga0495604_0173303 | Ga0495604_0173303_144_1094 | 316 |
| 700 | 3300047319 | Ga0495674_0000018 | Ga0495674_0000018_198182_199147 | 316 |
| 701 | 3300047319 | Ga0495674_0001596 | Ga0495674_0001596_17227_18183 | 316 |
| 702 | 3300047319 | Ga0495674_0006703 | Ga0495674_0006703_8347_9393 | 316 |
| 703 | 3300047319 | Ga0495674_0069384 | Ga0495674_0069384_1846_2802 | 316 |
| 704 | 3300047320 | Ga0495672_0033481 | Ga0495672_0033481_201_1157 | 316 |
| 705 | 3300047320 | Ga0495672_0041858 | Ga0495672_0041858_329_1285 | 316 |
| 706 | 3300047321 | Ga0495676_0004556 | Ga0495676_0004556_6185_7141 | 316 |
| 707 | 3300047321 | Ga0495676_0048763 | Ga0495676_0048763_325_1281 | 316 |
| 708 | 3300047321 | Ga0495676_0069526 | Ga0495676_0069526_1077_2033 | 316 |
| 709 | 3300047322 | Ga0495680_0001109 | Ga0495680_0001109_12775_13731 | 316 |
| 710 | 3300047322 | Ga0495680_0010419 | Ga0495680_0010419_4875_5840 | 316 |
| 711 | 3300047323 | Ga0495683_0137760 | Ga0495683_0137760_47_1003 | 316 |
| 712 | 3300047444 | Ga0495675_0003039 | Ga0495675_0003039_2764_3720 | 316 |
| 713 | 3300047444 | Ga0495675_0004157 | Ga0495675_0004157_5058_6023 | 316 |
| 714 | 3300047444 | Ga0495675_0075237 | Ga0495675_0075237_400_1356 | 316 |
| 715 | 3300047446 | Ga0495679_040933 | Ga0495679_040933_323_1279 | 316 |
| 716 | 3300047447 | Ga0495685_049860 | Ga0495685_049860_17_973 | 316 |
| 717 | 3300047471 | Ga0495684_0000010 | Ga0495684_0000010_193078_194043 | 316 |
| 718 | 3300047471 | Ga0495684_0007596 | Ga0495684_0007596_1770_2816 | 316 |
| 719 | 3300047471 | Ga0495684_0011645 | Ga0495684_0011645_351_1307 | 316 |
| 720 | 3300047471 | Ga0495684_0027615 | Ga0495684_0027615_1070_2026 | 316 |
| 721 | 3300047471 | Ga0495684_0048735 | Ga0495684_0048735_511_1467 | 316 |
| 722 | 3300047673 | Ga0495593_0007996 | Ga0495593_0007996_3941_4906 | 316 |
| 723 | 3300047673 | Ga0495593_0048567 | Ga0495593_0048567_525_1481 | 316 |
| 724 | 3300047673 | Ga0495593_0121493 | Ga0495593_0121493_74_1030 | 316 |
| 725 | 3300048088 | Ga0495602_0013088 | Ga0495602_0013088_4882_5847 | 316 |
| 726 | 3300048088 | Ga0495602_0049699 | Ga0495602_0049699_1567_2517 | 316 |
| 727 | 3300048088 | Ga0495602_0284528 | Ga0495602_0284528_221_1177 | 316 |
| 728 | 3300048903 | Ga0496100_0005463 | Ga0496100_0005463_3088_4044 | 316 |
| 729 | 3300048903 | Ga0496100_0023107 | Ga0496100_0023107_854_1810 | 316 |
| 730 | 3300048903 | Ga0496100_0098803 | Ga0496100_0098803_620_1576 | 316 |
| 731 | 3300048904 | Ga0496101_0001025 | Ga0496101_0001025_7044_8000 | 316 |
| 732 | 3300048904 | Ga0496101_0008677 | Ga0496101_0008677_2334_3290 | 316 |
| 733 | 3300048904 | Ga0496101_0020913 | Ga0496101_0020913_149_1099 | 316 |
| 734 | 3300048904 | Ga0496101_0227973 | Ga0496101_0227973_64_1020 | 316 |
| 735 | 3300048905 | Ga0496102_0010694 | Ga0496102_0010694_4041_4997 | 316 |
| 736 | 3300048905 | Ga0496102_0041079 | Ga0496102_0041079_2491_3447 | 316 |
| 737 | 3300048905 | Ga0496102_0087737 | Ga0496102_0087737_1745_2701 | 316 |
| 738 | 3300048905 | Ga0496102_0151094 | Ga0496102_0151094_169_1125 | 316 |
| 739 | 3300048906 | Ga0496103_0045036 | Ga0496103_0045036_1229_2185 | 316 |
| 740 | 3300048907 | Ga0496104_0003048 | Ga0496104_0003048_6642_7598 | 316 |
| 741 | 3300048907 | Ga0496104_0012586 | Ga0496104_0012586_2300_3256 | 316 |
| 742 | 3300048907 | Ga0496104_0020110 | Ga0496104_0020110_2070_3026 | 316 |
| 743 | 3300048907 | Ga0496104_0125825 | Ga0496104_0125825_838_1794 | 316 |
| 744 | 3300048907 | Ga0496104_0235547 | Ga0496104_0235547_511_1467 | 316 |
| 745 | 3300048907 | Ga0496104_0427971 | Ga0496104_0427971_240_1190 | 316 |
| 746 | 3300048908 | Ga0496105_0005567 | Ga0496105_0005567_1178_2134 | 316 |
| 747 | 3300048908 | Ga0496105_0005922 | Ga0496105_0005922_6840_7796 | 316 |
| 748 | 3300048908 | Ga0496105_0011176 | Ga0496105_0011176_1533_2489 | 316 |
| 749 | 3300048908 | Ga0496105_0060568 | Ga0496105_0060568_789_1745 | 316 |
| 750 | 3300048908 | Ga0496105_0092139 | Ga0496105_0092139_273_1229 | 316 |
| 751 | 3300048908 | Ga0496105_0129449 | Ga0496105_0129449_801_1751 | 316 |
| 752 | 3300048908 | Ga0496105_0136590 | Ga0496105_0136590_455_1411 | 316 |
| 753 | 3300048909 | Ga0496106_0010565 | Ga0496106_0010565_3861_4811 | 316 |
| 754 | 3300048909 | Ga0496106_0023192 | Ga0496106_0023192_551_1507 | 316 |
| 755 | 3300048909 | Ga0496106_0051071 | Ga0496106_0051071_57_1013 | 316 |
| 756 | 3300048909 | Ga0496106_0177004 | Ga0496106_0177004_129_1085 | 316 |
| 757 | 3300048909 | Ga0496106_0286611 | Ga0496106_0286611_67_1023 | 316 |
| 758 | 3300048910 | Ga0496107_0007469 | Ga0496107_0007469_3495_4451 | 316 |
| 759 | 3300048910 | Ga0496107_0015009 | Ga0496107_0015009_3547_4497 | 316 |
| 760 | 3300048911 | Ga0496108_0002364 | Ga0496108_0002364_11289_12245 | 316 |
| 761 | 3300048911 | Ga0496108_0029304 | Ga0496108_0029304_907_1863 | 316 |
| 762 | 3300048911 | Ga0496108_0050992 | Ga0496108_0050992_2031_2987 | 316 |
| 763 | 3300048911 | Ga0496108_0079831 | Ga0496108_0079831_1331_2287 | 316 |
| 764 | 3300048911 | Ga0496108_0169416 | Ga0496108_0169416_579_1535 | 316 |
| 765 | 3300048912 | Ga0496109_0001638 | Ga0496109_0001638_670_1626 | 316 |
| 766 | 3300048912 | Ga0496109_0002461 | Ga0496109_0002461_3074_4030 | 316 |
| 767 | 3300048912 | Ga0496109_0029136 | Ga0496109_0029136_3216_4166 | 316 |
| 768 | 3300048912 | Ga0496109_0051551 | Ga0496109_0051551_1678_2634 | 316 |
| 769 | 3300048912 | Ga0496109_0105357 | Ga0496109_0105357_1610_2566 | 316 |
| 770 | 3300048912 | Ga0496109_0373964 | Ga0496109_0373964_148_1104 | 316 |
| 771 | 3300048913 | Ga0496110_0003528 | Ga0496110_0003528_2757_3713 | 316 |
| 772 | 3300048913 | Ga0496110_0011641 | Ga0496110_0011641_6144_7100 | 316 |
| 773 | 3300048913 | Ga0496110_0037760 | Ga0496110_0037760_3028_3987 | 316 |
| 774 | 3300048913 | Ga0496110_0144854 | Ga0496110_0144854_682_1638 | 316 |
| 775 | 3300048913 | Ga0496110_0179453 | Ga0496110_0179453_302_1258 | 316 |
| 776 | 3300048914 | Ga0496111_0003518 | Ga0496111_0003518_3032_3988 | 316 |
| 777 | 3300048914 | Ga0496111_0005819 | Ga0496111_0005819_1236_2192 | 316 |
| 778 | 3300048914 | Ga0496111_0017449 | Ga0496111_0017449_3132_4088 | 316 |
| 779 | 3300048914 | Ga0496111_0018422 | Ga0496111_0018422_1961_2920 | 316 |
| 780 | 3300048914 | Ga0496111_0027735 | Ga0496111_0027735_814_1770 | 316 |
| 781 | 3300048914 | Ga0496111_0147169 | Ga0496111_0147169_280_1236 | 316 |
| 782 | 3300048914 | Ga0496111_0265230 | Ga0496111_0265230_225_1181 | 316 |
| 783 | 3300048915 | Ga0496112_0037915 | Ga0496112_0037915_2458_3414 | 316 |
| 784 | 3300048915 | Ga0496112_0039123 | Ga0496112_0039123_2544_3500 | 316 |
| 785 | 3300048915 | Ga0496112_0067536 | Ga0496112_0067536_363_1313 | 316 |
| 786 | 3300048915 | Ga0496112_0122371 | Ga0496112_0122371_570_1526 | 316 |
| 787 | 3300048915 | Ga0496112_0135215 | Ga0496112_0135215_1103_2059 | 316 |
| 788 | 3300048915 | Ga0496112_0154557 | Ga0496112_0154557_76_1032 | 316 |
| 789 | 3300048915 | Ga0496112_0157700 | Ga0496112_0157700_196_1152 | 316 |
| 790 | 3300048915 | Ga0496112_0355360 | Ga0496112_0355360_266_1222 | 316 |
| 791 | 3300048915 | Ga0496112_0366697 | Ga0496112_0366697_36_986 | 316 |
| 792 | 3300048916 | Ga0496113_0000175 | Ga0496113_0000175_18868_19824 | 316 |
| 793 | 3300048916 | Ga0496113_0001647 | Ga0496113_0001647_8862_9818 | 316 |
| 794 | 3300048916 | Ga0496113_0030542 | Ga0496113_0030542_2827_3783 | 316 |
| 795 | 3300048916 | Ga0496113_0030825 | Ga0496113_0030825_1581_2531 | 316 |
| 796 | 3300048916 | Ga0496113_0337568 | Ga0496113_0337568_135_1091 | 316 |
| 797 | 3300048917 | Ga0496114_0027134 | Ga0496114_0027134_2668_3624 | 316 |
| 798 | 3300048917 | Ga0496114_0057372 | Ga0496114_0057372_1069_2025 | 316 |
| 799 | 3300048917 | Ga0496114_0085526 | Ga0496114_0085526_463_1419 | 316 |
| 800 | 3300048918 | Ga0496115_0023215 | Ga0496115_0023215_1997_2953 | 316 |
| 801 | 3300048918 | Ga0496115_0235455 | Ga0496115_0235455_34_984 | 316 |
| 802 | 3300048929 | Ga0496126_0039717 | Ga0496126_0039717_3283_4239 | 316 |
| 803 | 3300049568 | Ga0501031_0001402 | Ga0501031_0001402_10109_11065 | 316 |
| 804 | 3300049570 | Ga0501033_0017562 | Ga0501033_0017562_3482_4438 | 316 |
| 805 | 3300049572 | Ga0501036_0009279 | Ga0501036_0009279_2862_3818 | 316 |
| 806 | 3300049572 | Ga0501036_0022892 | Ga0501036_0022892_2030_2986 | 316 |
| 807 | 3300049574 | Ga0501038_0030524 | Ga0501038_0030524_1647_2603 | 316 |
| 808 | 3300049574 | Ga0501038_0142363 | Ga0501038_0142363_981_1937 | 316 |
| 809 | 3300049575 | Ga0501039_0001656 | Ga0501039_0001656_1670_2626 | 316 |
| 810 | 3300049575 | Ga0501039_0019439 | Ga0501039_0019439_2096_3052 | 316 |
| 811 | 3300049576 | Ga0501040_0055715 | Ga0501040_0055715_329_1285 | 316 |
| 812 | 3300049577 | Ga0501041_0000600 | Ga0501041_0000600_7177_8133 | 316 |
| 813 | 3300049577 | Ga0501041_0009888 | Ga0501041_0009888_2111_3067 | 316 |
| 814 | 3300049577 | Ga0501041_0047078 | Ga0501041_0047078_1478_2434 | 316 |
| 815 | 3300049578 | Ga0501042_0004577 | Ga0501042_0004577_1984_2940 | 316 |
| 816 | 3300049578 | Ga0501042_0044082 | Ga0501042_0044082_1803_2759 | 316 |
| 817 | 3300049579 | Ga0501043_0027712 | Ga0501043_0027712_3147_4103 | 316 |
| 818 | 3300049579 | Ga0501043_0041339 | Ga0501043_0041339_259_1215 | 316 |
| 819 | 3300049580 | Ga0501046_0001057 | Ga0501046_0001057_16115_17071 | 316 |
| 820 | 3300049580 | Ga0501046_0363357 | Ga0501046_0363357_31_987 | 316 |
| 821 | 3300049581 | Ga0501047_0332725 | Ga0501047_0332725_139_1095 | 316 |
| 822 | 3300049582 | Ga0501048_0011924 | Ga0501048_0011924_3940_4896 | 316 |
| 823 | 3300049582 | Ga0501048_0028075 | Ga0501048_0028075_1252_2208 | 316 |
| 824 | 3300049582 | Ga0501048_0184491 | Ga0501048_0184491_187_1143 | 316 |
| 825 | 3300049585 | Ga0501069_0012334 | Ga0501069_0012334_2171_3127 | 316 |
| 826 | 3300049586 | Ga0501070_0104679 | Ga0501070_0104679_1094_2050 | 316 |
| 827 | 3300049586 | Ga0501070_0242388 | Ga0501070_0242388_66_1022 | 316 |
| 828 | 3300049587 | Ga0501071_0044976 | Ga0501071_0044976_1028_1984 | 316 |
| 829 | 3300049587 | Ga0501071_0051424 | Ga0501071_0051424_298_1257 | 316 |
| 830 | 3300049587 | Ga0501071_0344170 | Ga0501071_0344170_153_1109 | 316 |
| 831 | 3300049588 | Ga0501072_0001862 | Ga0501072_0001862_3580_4536 | 316 |
| 832 | 3300049588 | Ga0501072_0016678 | Ga0501072_0016678_1789_2745 | 316 |
| 833 | 3300049588 | Ga0501072_0025063 | Ga0501072_0025063_2228_3187 | 316 |
| 834 | 3300049588 | Ga0501072_0280682 | Ga0501072_0280682_193_1149 | 316 |
| 835 | 3300049589 | Ga0501073_0111896 | Ga0501073_0111896_626_1576 | 316 |
| 836 | 3300049590 | Ga0501074_0013084 | Ga0501074_0013084_3541_4497 | 316 |
| 837 | 3300049590 | Ga0501074_0025976 | Ga0501074_0025976_1280_2236 | 316 |
| 838 | 3300049591 | Ga0501075_0003996 | Ga0501075_0003996_861_1817 | 316 |
| 839 | 3300049591 | Ga0501075_0069220 | Ga0501075_0069220_1377_2333 | 316 |
| 840 | 3300049592 | Ga0501076_0000348 | Ga0501076_0000348_7755_8711 | 316 |
| 841 | 3300049592 | Ga0501076_0018281 | Ga0501076_0018281_421_1377 | 316 |
| 842 | 3300049592 | Ga0501076_0031097 | Ga0501076_0031097_352_1308 | 316 |
| 843 | 3300049592 | Ga0501076_0152057 | Ga0501076_0152057_874_1830 | 316 |
| 844 | 3300049741 | Ga0501079_0000859 | Ga0501079_0000859_9951_10907 | 316 |
| 845 | 3300049741 | Ga0501079_0125204 | Ga0501079_0125204_621_1577 | 316 |
| 846 | 3300049742 | Ga0501080_0066965 | Ga0501080_0066965_102_1118 | 316 |
| 847 | 3300049743 | Ga0501081_0000131 | Ga0501081_0000131_23655_24611 | 316 |
| 848 | 3300049743 | Ga0501081_0018251 | Ga0501081_0018251_265_1224 | 316 |
| 849 | 3300049743 | Ga0501081_0089723 | Ga0501081_0089723_330_1286 | 316 |
| 850 | 3300049744 | Ga0501083_0062007 | Ga0501083_0062007_670_1686 | 316 |
| 851 | 3300049822 | Ga0501035_0379950 | Ga0501035_0379950_97_1053 | 316 |
| 852 | 3300049823 | Ga0501044_0000743 | Ga0501044_0000743_26851_27807 | 316 |
| 853 | 3300049823 | Ga0501044_0139155 | Ga0501044_0139155_726_1682 | 316 |
| 854 | 3300049824 | Ga0501045_0014083 | Ga0501045_0014083_1216_2172 | 316 |
| 855 | 3300049824 | Ga0501045_0018427 | Ga0501045_0018427_3160_4116 | 316 |
| 856 | 3300049824 | Ga0501045_0083981 | Ga0501045_0083981_331_1290 | 316 |
| 857 | 3300050489 | nmdc:mga03683_20525_c1 | nmdc:mga03683_20525_c1_327_1283 | 316 |
| 858 | 3300050491 | nmdc:mga00v17_107895_c1 | nmdc:mga00v17_107895_c1_626_1582 | 316 |
| 859 | 3300050491 | nmdc:mga00v17_188780_c1 | nmdc:mga00v17_188780_c1_343_1299 | 316 |
| 860 | 3300050493 | nmdc:mga0k408_12633_c1 | nmdc:mga0k408_12633_c1_1927_2883 | 316 |
| 861 | 3300050493 | nmdc:mga0k408_2138_c1 | nmdc:mga0k408_2138_c1_406_1362 | 316 |
| 862 | 3300050494 | nmdc:mga06z11_104161_c1 | nmdc:mga06z11_104161_c1_335_1291 | 316 |
| 863 | 3300050494 | nmdc:mga06z11_148497_c1 | nmdc:mga06z11_148497_c1_33_989 | 316 |
| 864 | 3300050496 | nmdc:mga07m45_64254_c1 | nmdc:mga07m45_64254_c1_384_1340 | 316 |
| 865 | 3300050496 | nmdc:mga07m45_97530_c1 | nmdc:mga07m45_97530_c1_672_1628 | 316 |
| 866 | 3300050507 | nmdc:mga05p37_132_c1 | nmdc:mga05p37_132_c1_33015_33971 | 316 |
| 867 | 3300050507 | nmdc:mga05p37_261301_c1 | nmdc:mga05p37_261301_c1_754_1710 | 316 |
| 868 | 3300050507 | nmdc:mga05p37_673219_c1 | nmdc:mga05p37_673219_c1_160_1116 | 316 |
| 869 | 3300050508 | nmdc:mga09592_418_c1 | nmdc:mga09592_418_c1_29245_30201 | 316 |
| 870 | 3300050511 | nmdc:mga08y16_108320_c1 | nmdc:mga08y16_108320_c1_333_1289 | 316 |
| 871 | 3300050511 | nmdc:mga08y16_9476_c1 | nmdc:mga08y16_9476_c1_7009_7965 | 316 |
| 872 | 3300050512 | nmdc:mga0n895_109188_c1 | nmdc:mga0n895_109188_c1_454_1410 | 316 |
| 873 | 3300050512 | nmdc:mga0n895_252410_c1 | nmdc:mga0n895_252410_c1_164_1120 | 316 |
| 874 | 3300050512 | nmdc:mga0n895_290807_c1 | nmdc:mga0n895_290807_c1_311_1267 | 316 |
| 875 | 3300050512 | nmdc:mga0n895_468_c1 | nmdc:mga0n895_468_c1_3262_4218 | 316 |
| 876 | 3300050512 | nmdc:mga0n895_93917_c1 | nmdc:mga0n895_93917_c1_1191_2147 | 316 |
| 877 | 3300050513 | nmdc:mga0rr50_145_c1 | nmdc:mga0rr50_145_c1_4083_5039 | 316 |
| 878 | 3300050513 | nmdc:mga0rr50_89121_c1 | nmdc:mga0rr50_89121_c1_1274_2230 | 316 |
| 879 | 3300050514 | nmdc:mga08x19_14066_c1 | nmdc:mga08x19_14066_c1_72_1028 | 316 |
| 880 | 3300050514 | nmdc:mga08x19_522_c1 | nmdc:mga08x19_522_c1_7876_8832 | 316 |
| 881 | 3300050515 | nmdc:mga0a205_11596_c1 | nmdc:mga0a205_11596_c1_4668_5624 | 316 |
| 882 | 3300050515 | nmdc:mga0a205_54289_c1 | nmdc:mga0a205_54289_c1_2394_3350 | 316 |
| 883 | 3300050516 | nmdc:mga0sz30_20124_c1 | nmdc:mga0sz30_20124_c1_83_1039 | 316 |
| 884 | 3300050516 | nmdc:mga0sz30_60152_c1 | nmdc:mga0sz30_60152_c1_60_1016 | 316 |
| 885 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_33675_34640 | 316 |
| 886 | 3300053077 | Ga0495601_0000243 | Ga0495601_0000243_4936_5895 | 316 |
| 887 | 3300053077 | Ga0495601_0016790 | Ga0495601_0016790_243_1199 | 316 |
| 888 | 3300053077 | Ga0495601_0022082 | Ga0495601_0022082_768_1724 | 316 |
| 889 | 3300053077 | Ga0495601_0025060 | Ga0495601_0025060_2092_3138 | 316 |
| 890 | 3300053077 | Ga0495601_0152994 | Ga0495601_0152994_152_1108 | 316 |
| 891 | 3300053077 | Ga0495601_0164211 | Ga0495601_0164211_371_1327 | 316 |
| 892 | 3300053078 | Ga0495612_0000063 | Ga0495612_0000063_42228_43193 | 316 |
| 893 | 3300053078 | Ga0495612_0001332 | Ga0495612_0001332_2477_3523 | 316 |
| 894 | 3300053078 | Ga0495612_0006769 | Ga0495612_0006769_2674_3630 | 316 |
| 895 | 3300053078 | Ga0495612_0009391 | Ga0495612_0009391_2721_3677 | 316 |
| 896 | 3300053084 | Ga0495595_0002319 | Ga0495595_0002319_4906_5871 | 316 |
| 897 | 3300053084 | Ga0495595_0046083 | Ga0495595_0046083_743_1699 | 316 |
| 898 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_33706_34671 | 316 |
| 899 | 3300053085 | Ga0495619_0004170 | Ga0495619_0004170_151_1197 | 316 |
| 900 | 3300053085 | Ga0495619_0112964 | Ga0495619_0112964_759_1715 | 316 |
| 901 | 3300053086 | Ga0500578_0178410 | Ga0500578_0178410_157_1113 | 316 |
| 902 | 3300053092 | Ga0500583_0164039 | Ga0500583_0164039_139_1095 | 316 |
| 903 | 3300053096 | Ga0500641_0003400 | Ga0500641_0003400_3274_4230 | 316 |
| 904 | 3300053119 | Ga0500595_016248 | Ga0500595_016248_736_1692 | 316 |
| 905 | 3300053131 | Ga0500652_000023 | Ga0500652_000023_44224_45180 | 316 |
| 906 | 3300054114 | Ga0501084_0064199 | Ga0501084_0064199_995_1951 | 316 |
| 907 | 3300054114 | Ga0501084_0071132 | Ga0501084_0071132_1723_2739 | 316 |
| 908 | 3300054114 | Ga0501084_0090900 | Ga0501084_0090900_1476_2432 | 316 |
| 909 | 3300054114 | Ga0501084_0159463 | Ga0501084_0159463_263_1222 | 316 |
| 910 | 3300054114 | Ga0501084_0479070 | Ga0501084_0479070_66_1022 | 316 |
| 911 | 3300059421 | Ga0590071_008354 | Ga0590071_008354_445_1401 | 316 |
| 912 | 3300060353 | Ga0501082_0000205 | Ga0501082_0000205_15014_15970 | 316 |
| 913 | 3300060353 | Ga0501082_0008926 | Ga0501082_0008926_4341_5297 | 316 |
| 914 | 3300060353 | Ga0501082_0025577 | Ga0501082_0025577_2155_3111 | 316 |
| 915 | 3300060353 | Ga0501082_0144096 | Ga0501082_0144096_1056_2012 | 316 |
| 916 | 3300061734 | Ga0530510_0000425 | Ga0530510_0000425_13663_14619 | 316 |
| 917 | 3300061734 | Ga0530510_0057591 | Ga0530510_0057591_1101_2057 | 316 |
| 918 | 3300005338 | Ga0068868_100051086 | Ga0068868_1000510862 | 317 |
| 919 | 3300005367 | Ga0070667_100012483 | Ga0070667_1000124832 | 317 |
| 920 | 3300005466 | Ga0070685_10146707 | Ga0070685_101467072 | 317 |
| 921 | 3300005841 | Ga0068863_100005225 | Ga0068863_1000052253 | 317 |
| 922 | 3300005843 | Ga0068860_100011906 | Ga0068860_1000119062 | 317 |
| 923 | 3300006237 | Ga0097621_100095350 | Ga0097621_1000953503 | 317 |
| 924 | 3300006358 | Ga0068871_100011094 | Ga0068871_1000110942 | 317 |
| 925 | 3300009176 | Ga0105242_10009816 | Ga0105242_100098167 | 317 |
| 926 | 3300013105 | Ga0157369_10359901 | Ga0157369_103599011 | 317 |
| 927 | 3300013308 | Ga0157375_10020483 | Ga0157375_100204832 | 317 |
| 928 | 3300014325 | Ga0163163_10001830 | Ga0163163_1000183014 | 317 |
| 929 | 3300014326 | Ga0157380_10017000 | Ga0157380_100170006 | 317 |
| 930 | 3300014968 | Ga0157379_10016937 | Ga0157379_100169373 | 317 |
| 931 | 3300014969 | Ga0157376_10013769 | Ga0157376_100137693 | 317 |
| 932 | 3300025928 | Ga0207700_10073659 | Ga0207700_100736594 | 317 |
| 933 | 3300025986 | Ga0207658_10312615 | Ga0207658_103126151 | 317 |
| 934 | 3300041486 | Ga0451807_0095181 | Ga0451807_0095181_452_1405 | 317 |
| 935 | 3300048907 | Ga0496104_0307706 | Ga0496104_0307706_347_1300 | 317 |
| 936 | 3300048912 | Ga0496109_0011159 | Ga0496109_0011159_2521_3474 | 317 |
| 937 | 3300039453 | Ga0436362_0463249 | Ga0436362_0463249_1248_2204 | 318 |
| 938 | iso_pu_bacteria | 2935390628 | 2935393018 | 318 |
| 939 | iso_pu_bacteria | 2997600082 | 2997605428 | 318 |
| 940 | 2162886007 | SwRhRL2b_contig_2628462 | SwRhRL2b_0060.00004610 | 319 |
| 941 | 2162886007 | SwRhRL2b_contig_58648 | SwRhRL2b_0969.00006930 | 319 |
| 942 | 3300005295 | Ga0065707_10099655 | Ga0065707_100996552 | 319 |
| 943 | 3300005331 | Ga0070670_100098177 | Ga0070670_1000981771 | 319 |
| 944 | 3300005335 | Ga0070666_10064004 | Ga0070666_100640043 | 319 |
| 945 | 3300005347 | Ga0070668_100213743 | Ga0070668_1002137431 | 319 |
| 946 | 3300005353 | Ga0070669_100013431 | Ga0070669_1000134314 | 319 |
| 947 | 3300005355 | Ga0070671_100001928 | Ga0070671_1000019284 | 319 |
| 948 | 3300005367 | Ga0070667_100027609 | Ga0070667_1000276092 | 319 |
| 949 | 3300005548 | Ga0070665_100000169 | Ga0070665_10000016975 | 319 |
| 950 | 3300005841 | Ga0068863_100008798 | Ga0068863_1000087987 | 319 |
| 951 | 3300009011 | Ga0105251_10004488 | Ga0105251_100044886 | 319 |
| 952 | 3300025735 | Ga0207713_1002844 | Ga0207713_10028447 | 319 |
| 953 | 3300025903 | Ga0207680_10015096 | Ga0207680_100150965 | 319 |
| 954 | 3300025910 | Ga0207684_10195609 | Ga0207684_101956093 | 319 |
| 955 | 3300025923 | Ga0207681_10034479 | Ga0207681_100344793 | 319 |
| 956 | 3300025925 | Ga0207650_10030542 | Ga0207650_100305424 | 319 |
| 957 | 3300025931 | Ga0207644_10000409 | Ga0207644_1000040917 | 319 |
| 958 | 3300025972 | Ga0207668_10017068 | Ga0207668_100170684 | 319 |
| 959 | 3300025986 | Ga0207658_10019851 | Ga0207658_100198514 | 319 |
| 960 | 3300028379 | Ga0268266_10001173 | Ga0268266_1000117324 | 319 |
| 961 | 3300028380 | Ga0268265_10388220 | Ga0268265_103882201 | 319 |
| 962 | 3300028381 | Ga0268264_10003658 | Ga0268264_100036584 | 319 |
| 963 | 3300048906 | Ga0496103_0012080 | Ga0496103_0012080_3557_4516 | 319 |
| 964 | 3300048907 | Ga0496104_0504321 | Ga0496104_0504321_25_1005 | 319 |
| 965 | 3300048920 | Ga0496117_0022967 | Ga0496117_0022967_392_1351 | 319 |
| 966 | 3300048920 | Ga0496117_0087606 | Ga0496117_0087606_898_1857 | 319 |
| 967 | 3300048921 | Ga0496118_0027984 | Ga0496118_0027984_830_1789 | 319 |
| 968 | 3300048921 | Ga0496118_0048685 | Ga0496118_0048685_2246_3205 | 319 |
| 969 | 3300048924 | Ga0496121_0009918 | Ga0496121_0009918_9636_10595 | 319 |
| 970 | 3300048927 | Ga0496124_0006822 | Ga0496124_0006822_9119_10078 | 319 |
| 971 | 3300048929 | Ga0496126_0035095 | Ga0496126_0035095_54_1013 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bvk-assembly2.cif.gz_B | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) | 0.8973 | 1 | 314 |
| 7bvj-assembly4.cif.gz_D | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.8884 | 1 | 314 |
| 7bvj-assembly3.cif.gz_C | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.8824 | 1 | 314 |
| 7bvk-assembly2.cif.gz_B | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) | 0.8776 | 1 | 314 |
| 7bvj-assembly4.cif.gz_D | udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) | 0.869 | 1 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PPX6_1_125_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9609 | 1 | 116 | 3.40.50.720 |
| 4hktB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9566 | 1 | 119 | 3.40.50.720 |
| 3ezyC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.956 | 1 | 119 | 3.40.50.720 |
| af_Q2G1E6_2_122_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9551 | 1 | 116 | 3.40.50.720 |
| af_Q04869_4_115_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9551 | 1 | 107 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0M678-F1-model_v4 | Dehydrogenase | 0.976 | 2 | 139 |
GO:0000166
|
| AF-A0A3A8SX78-F1-model_v4 | deleted | 0.9707 | 54 | 138 |
|
| AF-A0A1J5I439-F1-model_v4 | Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein | 0.9629 | 1 | 138 |
GO:0000166
|
| AF-A0A3N5KE09-F1-model_v4 | Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein | 0.9613 | 1 | 82 |
GO:0000166
|
| AF-A0A7W0GP34-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9599 | 1 | 138 |
GO:0000166
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar