F487124

General Info

Members Datasets Scaffolds Average Seq Length
971 422 965 318

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0006658|Ga0373936_0006658_269_1315
Length 348
Sequence MTSSATPFFERLCPRMTKKNDDQNDLTRLTMKICVAGQGAFGQKHLDALKRIPEVEVTSLVGGNQDATAQVAKKYGVPHFTGELAEGIKRADAVILTTPTKLHFRQGEQVMRAGKHVLVEIPVTDSVADAEALVKIAKATGVVAMGGHVRRFNPSHQWVHKRIQKGELKIQQMDVQTYFFRRKNINAAGQPRSWTDHLLWHHAAHTIDLFQYQAGETISDCYAVQGPIHPQLNIAMDMGIVAKTPSGAVLTLSLSFNNDGPLGSFFRYICDNGTYKAYYDDLSDGKDNKIDLSKVDVSMDGIELEDREFIAAIKQKRGPNASLAALLPCMHVLGRLEKIVDPQRNAHA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
3 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
4 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
5 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
6 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
7 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
238 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
239 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
240 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
241 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
245 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
258 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
271 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
344 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
395 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
398 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
399 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
400 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
401 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
407 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
408 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
409 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
410 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
411 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
412 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
413 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
414 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.31
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 0.1
Rhizoplane 8.65
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 3.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2628462 2162886007 Bacteria 3593
2 SwRhRL2b_contig_58648 2162886007 Bacteria 3931
3 JGI24746J21847_1002925 3300001977 Bacteria 2685
4 JGI24743J22301_10008228 3300001991 Bacteria 1826
5 JGI24738J21930_10002238 3300002075 Bacteria 5135
6 JGI24034J26672_10016529 3300002239 Bacteria 1137
7 JGI25406J46586_10019988 3300003203 Bacteria 2719
8 JGI25153J46596_10001063 3300003215 Bacteria 16760
9 rootL2_10020853 3300003322 Bacteria 2646
10 JGI25405J52794_10017961 3300003911 Bacteria 1409
11 Ga0055543_1018963 3300004625 Bacteria 1278
12 Ga0065704_10113311 3300005289 Bacteria 1915
13 Ga0065715_10280549 3300005293 Bacteria 1074
14 Ga0065707_10099655 3300005295 Bacteria 2989
15 Ga0065707_10133474 3300005295 Bacteria 1880
16 Ga0065707_10153752 3300005295 Bacteria 1630
17 Ga0070658_10000534 3300005327 Bacteria 33047
18 Ga0070676_10154994 3300005328 Bacteria 1469
19 Ga0070690_100000216 3300005330 Bacteria 30017
20 Ga0070690_100012374 3300005330 Bacteria 5021
21 Ga0070690_100068462 3300005330 Bacteria 2302
22 Ga0070690_100373498 3300005330 Bacteria 1041
23 Ga0070670_100081469 3300005331 Bacteria 2781
24 Ga0070670_100098177 3300005331 Bacteria 2520
25 Ga0070670_100153016 3300005331 Bacteria 1996
26 Ga0070677_10007082 3300005333 Bacteria 3734
27 Ga0070677_10023218 3300005333 Bacteria 2294
28 Ga0068869_100000759 3300005334 Bacteria 18318
29 Ga0068869_100242126 3300005334 Bacteria 1437
30 Ga0070666_10010599 3300005335 Bacteria 5767
31 Ga0070666_10064004 3300005335 Bacteria 2494
32 Ga0070666_10114932 3300005335 Bacteria 1864
33 Ga0070680_100003121 3300005336 Bacteria 12304
34 Ga0070680_100006895 3300005336 Bacteria 8661
35 Ga0070680_100008902 3300005336 Bacteria 7695
36 Ga0070682_100004786 3300005337 Bacteria 7521
37 Ga0068868_100004312 3300005338 Bacteria 9964
38 Ga0068868_100005010 3300005338 Bacteria 9304
39 Ga0068868_100051086 3300005338 Bacteria 3250
40 Ga0070660_100138867 3300005339 Bacteria 1948
41 Ga0070689_100000399 3300005340 Bacteria 25458
42 Ga0070689_100006563 3300005340 Bacteria 8068
43 Ga0070689_100053981 3300005340 Bacteria 3111
44 Ga0070689_100148812 3300005340 Bacteria 1887
45 Ga0070691_10000528 3300005341 Bacteria 14397
46 Ga0070691_10062583 3300005341 Bacteria 1792
47 Ga0070687_100000604 3300005343 Bacteria 11929
48 Ga0070692_10002623 3300005345 Bacteria 7019
49 Ga0070692_10057329 3300005345 Bacteria 2042
50 Ga0070668_100213743 3300005347 Bacteria 1587
51 Ga0070669_100013431 3300005353 Bacteria 5822
52 Ga0070669_100085688 3300005353 Bacteria 2352
53 Ga0070675_100011655 3300005354 Bacteria 6889
54 Ga0070675_100076146 3300005354 Bacteria 2790
55 Ga0070675_100141421 3300005354 Bacteria 2057
56 Ga0070671_100001928 3300005355 Bacteria 15902
57 Ga0070671_100019910 3300005355 Bacteria 5467
58 Ga0070671_100023857 3300005355 Bacteria 5006
59 Ga0070671_100054746 3300005355 Bacteria 3317
60 Ga0070674_100000456 3300005356 Bacteria 20586
61 Ga0070674_100159480 3300005356 Bacteria 1710
62 Ga0070673_100026117 3300005364 Bacteria 4308
63 Ga0070673_100066945 3300005364 Bacteria 2871
64 Ga0070673_100145316 3300005364 Bacteria 2004
65 Ga0070688_100022931 3300005365 Bacteria 3665
66 Ga0070667_100012483 3300005367 Bacteria 7029
67 Ga0070667_100027609 3300005367 Bacteria 4723
68 Ga0070714_100007015 3300005435 Bacteria 8732
69 Ga0070714_100021227 3300005435 Bacteria 5312
70 Ga0070714_100186416 3300005435 Bacteria 1891
71 Ga0070714_100346423 3300005435 Bacteria 1395
72 Ga0070713_100005924 3300005436 Bacteria 8405
73 Ga0070713_100043906 3300005436 Bacteria 3657
74 Ga0070713_100321600 3300005436 Bacteria 1429
75 Ga0070710_10005399 3300005437 Bacteria 6069
76 Ga0070701_10129194 3300005438 Bacteria 1434
77 Ga0070701_10227212 3300005438 Bacteria 1116
78 Ga0070711_100010002 3300005439 Bacteria 5853
79 Ga0070711_100023557 3300005439 Bacteria 4006
80 Ga0070711_100034687 3300005439 Bacteria 3367
81 Ga0070711_100164991 3300005439 Bacteria 1683
82 Ga0070711_100495344 3300005439 Bacteria 1007
83 Ga0070705_100000554 3300005440 Bacteria 21689
84 Ga0070705_100072555 3300005440 Bacteria 2086
85 Ga0070705_100149842 3300005440 Bacteria 1546
86 Ga0070705_100292763 3300005440 Bacteria 1163
87 Ga0070700_100000281 3300005441 Bacteria 27271
88 Ga0070700_100044716 3300005441 Bacteria 2729
89 Ga0070694_100000565 3300005444 Bacteria 20475
90 Ga0070694_100070278 3300005444 Bacteria 2410
91 Ga0070678_100035789 3300005456 Bacteria 3470
92 Ga0070678_100184370 3300005456 Bacteria 1711
93 Ga0070678_100292960 3300005456 Bacteria 1380
94 Ga0070681_10001127 3300005458 Bacteria 22938
95 Ga0070681_10118881 3300005458 Bacteria 2579
96 Ga0070681_10154948 3300005458 Bacteria 2216
97 Ga0070681_10320812 3300005458 Bacteria 1459
98 Ga0070681_10414014 3300005458 Bacteria 1260
99 Ga0068867_100000206 3300005459 Bacteria 39309
100 Ga0068867_100103433 3300005459 Bacteria 2178
101 Ga0070685_10005577 3300005466 Bacteria 6386
102 Ga0070685_10146707 3300005466 Bacteria 1491
103 Ga0070706_100306244 3300005467 Bacteria 1482
104 Ga0070707_100128303 3300005468 Bacteria 2465
105 Ga0070707_100602851 3300005468 Bacteria 1061
106 Ga0070698_100365274 3300005471 Bacteria 1375
107 Ga0070699_100184203 3300005518 Bacteria 1854
108 Ga0070699_100276236 3300005518 Bacteria 1504
109 Ga0070679_100003183 3300005530 Bacteria 15003
110 Ga0070679_100034844 3300005530 Bacteria 4992
111 Ga0070679_100149712 3300005530 Bacteria 2311
112 Ga0070697_100121192 3300005536 Bacteria 2188
113 Ga0070697_100180798 3300005536 Bacteria 1788
114 Ga0068853_100063354 3300005539 Bacteria 3202
115 Ga0070672_100268961 3300005543 Bacteria 1439
116 Ga0070672_100293793 3300005543 Bacteria 1376
117 Ga0070672_100314723 3300005543 Bacteria 1329
118 Ga0070686_100000711 3300005544 Bacteria 19359
119 Ga0070695_100000281 3300005545 Bacteria 25630
120 Ga0070696_100004140 3300005546 Bacteria 9667
121 Ga0070696_100010174 3300005546 Bacteria 6296
122 Ga0070693_100000162 3300005547 Bacteria 30827
123 Ga0070693_100364173 3300005547 Bacteria 993
124 Ga0070665_100000011 3300005548 Bacteria 525539
125 Ga0070665_100000169 3300005548 Bacteria 118043
126 Ga0070665_100030114 3300005548 Bacteria 5461
127 Ga0070665_100190176 3300005548 Bacteria 2054
128 Ga0070704_100010913 3300005549 Bacteria 5540
129 Ga0070704_100039001 3300005549 Bacteria 3258
130 Ga0070704_100059317 3300005549 Bacteria 2729
131 Ga0068855_100000265 3300005563 Bacteria 65271
132 Ga0068855_100105928 3300005563 Bacteria 3233
133 Ga0068855_100197575 3300005563 Bacteria 2266
134 Ga0068857_100030804 3300005577 Bacteria 4739
135 Ga0068856_100316903 3300005614 Bacteria 1577
136 Ga0068856_100327474 3300005614 Bacteria 1549
137 Ga0070702_100000093 3300005615 Bacteria 26493
138 Ga0068859_100003739 3300005617 Bacteria 15512
139 Ga0068859_100045750 3300005617 Bacteria 4397
140 Ga0068859_100185952 3300005617 Bacteria 2161
141 Ga0068859_100695399 3300005617 Bacteria 1108
142 Ga0068864_100046863 3300005618 Bacteria 3710
143 Ga0068866_10000256 3300005718 Bacteria 24958
144 Ga0068861_100000355 3300005719 Bacteria 26109
145 Ga0068870_10022034 3300005840 Bacteria 3126
146 Ga0068870_10137642 3300005840 Bacteria 1425
147 Ga0068863_100005225 3300005841 Bacteria 12813
148 Ga0068863_100008798 3300005841 Bacteria 9858
149 Ga0068863_100078963 3300005841 Bacteria 3117
150 Ga0068863_100089193 3300005841 Bacteria 2923
151 Ga0068863_100132536 3300005841 Bacteria 2379
152 Ga0068858_100008078 3300005842 Bacteria 10133
153 Ga0068858_100025135 3300005842 Bacteria 5542
154 Ga0068860_100002594 3300005843 Bacteria 18905
155 Ga0068860_100011906 3300005843 Bacteria 8573
156 Ga0068860_100048947 3300005843 Bacteria 4028
157 Ga0068860_100245021 3300005843 Bacteria 1744
158 Ga0068860_100274649 3300005843 Bacteria 1646
159 Ga0068862_100000381 3300005844 Bacteria 47919
160 Ga0068862_100134173 3300005844 Bacteria 2193
161 Ga0081455_10071704 3300005937 Bacteria 2870
162 Ga0081538_10000697 3300005981 Bacteria 36894
163 Ga0081538_10017125 3300005981 Bacteria 5516
164 Ga0081540_1001984 3300005983 Bacteria 17080
165 Ga0081540_1002003 3300005983 Bacteria 17000
166 Ga0081540_1003649 3300005983 Bacteria 12076
167 Ga0081540_1017724 3300005983 Bacteria 4398
168 Ga0081540_1036127 3300005983 Bacteria 2639
169 Ga0081540_1050173 3300005983 Bacteria 2075
170 Ga0081539_10002187 3300005985 Bacteria 28690
171 Ga0081539_10036902 3300005985 Bacteria 2917
172 Ga0070717_10014290 3300006028 Bacteria 6106
173 Ga0075363_100013539 3300006048 Bacteria 3957
174 Ga0075364_10005843 3300006051 Bacteria 7184
175 Ga0075364_10073975 3300006051 Bacteria 2246
176 Ga0070715_10000633 3300006163 Bacteria 9317
177 Ga0070715_10002046 3300006163 Bacteria 6082
178 Ga0070715_10027128 3300006163 Bacteria 2285
179 Ga0070716_100006982 3300006173 Bacteria 5536
180 Ga0070716_100065105 3300006173 Bacteria 2121
181 Ga0070716_100072447 3300006173 Bacteria 2029
182 Ga0070712_100002594 3300006175 Bacteria 11168
183 Ga0070712_100008343 3300006175 Bacteria 6514
184 Ga0070712_100028995 3300006175 Bacteria 3708
185 Ga0070712_100038140 3300006175 Bacteria 3282
186 Ga0070712_100047227 3300006175 Bacteria 2979
187 Ga0070712_100110880 3300006175 Bacteria 2047
188 Ga0070712_100158867 3300006175 Bacteria 1744
189 Ga0075362_10002160 3300006177 Bacteria 6508
190 Ga0075362_10040981 3300006177 Bacteria 2040
191 Ga0075367_10067123 3300006178 Bacteria 2150
192 Ga0075367_10118426 3300006178 Bacteria 1630
193 Ga0075369_10015935 3300006186 Bacteria 3025
194 Ga0075366_10000931 3300006195 Bacteria 14208
195 Ga0075366_10022054 3300006195 Bacteria 3703
196 Ga0075366_10031321 3300006195 Bacteria 3129
197 Ga0097621_100000303 3300006237 Bacteria 33347
198 Ga0097621_100095350 3300006237 Bacteria 2495
199 Ga0097621_100110302 3300006237 Bacteria 2324
200 Ga0097621_100343669 3300006237 Bacteria 1325
201 Ga0097621_100405247 3300006237 Bacteria 1222
202 Ga0068871_100000925 3300006358 Bacteria 19583
203 Ga0068871_100011094 3300006358 Bacteria 6604
204 Ga0068871_100046071 3300006358 Bacteria 3511
205 Ga0068871_100182244 3300006358 Bacteria 1805
206 Ga0068871_100184289 3300006358 Bacteria 1795
207 Ga0068871_100240442 3300006358 Bacteria 1574
208 Ga0075428_100000083 3300006844 Bacteria 78689
209 Ga0075428_100113402 3300006844 Bacteria 2953
210 Ga0075428_100284076 3300006844 Bacteria 1780
211 Ga0075430_100000163 3300006846 Bacteria 43947
212 Ga0075430_100055653 3300006846 Bacteria 3326
213 Ga0075431_100087790 3300006847 Bacteria 3209
214 Ga0075433_10003177 3300006852 Bacteria 12656
215 Ga0075434_100000064 3300006871 Bacteria 54394
216 Ga0075434_100092271 3300006871 Bacteria 3030
217 Ga0075429_100001065 3300006880 Bacteria 21974
218 Ga0068865_100008534 3300006881 Bacteria 6333
219 Ga0068865_100093321 3300006881 Bacteria 2188
220 Ga0075436_100005135 3300006914 Bacteria 9013
221 Ga0075436_100016682 3300006914 Bacteria 5027
222 Ga0097620_100003738 3300006931 Bacteria 15512
223 Ga0097620_100045750 3300006931 Bacteria 4397
224 Ga0097620_100185959 3300006931 Bacteria 2161
225 Ga0097620_100695358 3300006931 Bacteria 1108
226 Ga0099826_10035411 3300006948 Bacteria 3551
227 Ga0075435_100000586 3300007076 Bacteria 22266
228 Ga0075435_100302692 3300007076 Bacteria 1367
229 Ga0099795_10029911 3300007788 Bacteria 1865
230 Ga0099795_10076325 3300007788 Bacteria 1274
231 Ga0105251_10004488 3300009011 Bacteria 9471
232 Ga0105240_10000369 3300009093 Bacteria 84513
233 Ga0105245_10000696 3300009098 Bacteria 30300
234 Ga0105245_10002702 3300009098 Bacteria 15962
235 Ga0105245_10011796 3300009098 Bacteria 7603
236 Ga0105245_10167384 3300009098 Bacteria 2090
237 Ga0105247_10019849 3300009101 Bacteria 4037
238 Ga0105247_10109570 3300009101 Bacteria 1775
239 Ga0114129_10000210 3300009147 Bacteria 65476
240 Ga0114129_10087181 3300009147 Bacteria 4329
241 Ga0105243_10000631 3300009148 Bacteria 34959
242 Ga0105243_10153892 3300009148 Bacteria 1976
243 Ga0105243_10173670 3300009148 Bacteria 1869
244 Ga0105243_10197316 3300009148 Bacteria 1763
245 Ga0105242_10003476 3300009176 Bacteria 12246
246 Ga0105242_10009816 3300009176 Bacteria 7334
247 Ga0105242_10020603 3300009176 Bacteria 5172
248 Ga0105242_10088017 3300009176 Bacteria 2608
249 Ga0105248_10465993 3300009177 Bacteria 1424
250 Ga0105237_10024199 3300009545 Bacteria 6213
251 Ga0105237_10183495 3300009545 Bacteria 2092
252 Ga0105237_10456475 3300009545 Bacteria 1284
253 Ga0105249_10003937 3300009553 Bacteria 12818
254 Ga0099796_10000419 3300010159 Bacteria 7045
255 Ga0105239_10123372 3300010375 Bacteria 2878
256 Ga0105239_10253032 3300010375 Bacteria 1979
257 Ga0105246_10229808 3300011119 Bacteria 1460
258 Ga0105246_10422784 3300011119 Bacteria 1113
259 Ga0157370_10010690 3300013104 Bacteria 9656
260 Ga0157369_10002769 3300013105 Bacteria 20942
261 Ga0157369_10213752 3300013105 Bacteria 2021
262 Ga0157369_10359901 3300013105 Bacteria 1511
263 Ga0157374_10012098 3300013296 Bacteria 7494
264 Ga0157378_10001488 3300013297 Bacteria 21162
265 Ga0163162_10030087 3300013306 Bacteria 5379
266 Ga0163162_10065362 3300013306 Bacteria 3684
267 Ga0163162_10342000 3300013306 Bacteria 1629
268 Ga0157372_10507890 3300013307 Bacteria 1405
269 Ga0157375_10020483 3300013308 Bacteria 6043
270 Ga0157375_10117196 3300013308 Bacteria 2768
271 Ga0157375_10957914 3300013308 Bacteria 997
272 Ga0163163_10001830 3300014325 Bacteria 17956
273 Ga0163163_10275912 3300014325 Bacteria 1732
274 Ga0157380_10017000 3300014326 Bacteria 5373
275 Ga0157380_10019019 3300014326 Bacteria 5112
276 Ga0182008_10146347 3300014497 Bacteria 1184
277 Ga0157379_10016937 3300014968 Bacteria 6412
278 Ga0157376_10013769 3300014969 Bacteria 6047
279 Ga0182007_10071314 3300015262 Bacteria 1138
280 Ga0183362_10002 3300015683 Bacteria 1432711
281 Ga0163161_10238579 3300017792 Bacteria 1413
282 Ga0163161_10291552 3300017792 Bacteria 1283
283 Ga0206350_10617166 3300020080 Bacteria 1254
284 Ga0206350_11377320 3300020080 Bacteria 1270
285 Ga0213872_10000001 3300021361 Bacteria 662532
286 Ga0213872_10009977 3300021361 Bacteria 4533
287 Ga0213872_10039685 3300021361 Bacteria 2148
288 Ga0213876_10024910 3300021384 Bacteria 3159
289 Ga0213876_10102662 3300021384 Bacteria 1516
290 Ga0213875_10036455 3300021388 Bacteria 2319
291 Ga0228598_1002924 3300024227 Bacteria 3708
292 Ga0209758_1000079 3300025297 Bacteria 262874
293 Ga0207713_1002844 3300025735 Bacteria 12178
294 Ga0207653_10008178 3300025885 Bacteria 3261
295 Ga0207682_10000543 3300025893 Bacteria 17394
296 Ga0207682_10003858 3300025893 Bacteria 6429
297 Ga0207642_10095412 3300025899 Bacteria 1480
298 Ga0207710_10013829 3300025900 Bacteria 3398
299 Ga0207680_10015096 3300025903 Bacteria 4021
300 Ga0207680_10177686 3300025903 Bacteria 1438
301 Ga0207647_10057890 3300025904 Bacteria 2375
302 Ga0207685_10004756 3300025905 Bacteria 3495
303 Ga0207685_10021335 3300025905 Bacteria 2169
304 Ga0207699_10012944 3300025906 Bacteria 4254
305 Ga0207699_10029996 3300025906 Bacteria 3039
306 Ga0207699_10235555 3300025906 Bacteria 1255
307 Ga0207645_10025828 3300025907 Bacteria 3799
308 Ga0207645_10027950 3300025907 Bacteria 3641
309 Ga0207643_10001848 3300025908 Bacteria 11707
310 Ga0207705_10002747 3300025909 Bacteria 13484
311 Ga0207684_10011372 3300025910 Bacteria 7790
312 Ga0207684_10195609 3300025910 Bacteria 1744
313 Ga0207684_10274560 3300025910 Bacteria 1454
314 Ga0207707_10006531 3300025912 Bacteria 10178
315 Ga0207707_10062009 3300025912 Bacteria 3253
316 Ga0207707_10116094 3300025912 Bacteria 2339
317 Ga0207707_10217828 3300025912 Bacteria 1662
318 Ga0207695_10014477 3300025913 Bacteria 9337
319 Ga0207693_10000068 3300025915 Bacteria 91004
320 Ga0207693_10000855 3300025915 Bacteria 27188
321 Ga0207693_10007507 3300025915 Bacteria 8954
322 Ga0207693_10023422 3300025915 Bacteria 4903
323 Ga0207693_10101537 3300025915 Bacteria 2256
324 Ga0207663_10007458 3300025916 Bacteria 5673
325 Ga0207660_10003314 3300025917 Bacteria 10518
326 Ga0207660_10010746 3300025917 Bacteria 5949
327 Ga0207662_10000257 3300025918 Bacteria 24677
328 Ga0207662_10009537 3300025918 Bacteria 5347
329 Ga0207657_10182571 3300025919 Bacteria 1695
330 Ga0207652_10014091 3300025921 Bacteria 6473
331 Ga0207652_10054007 3300025921 Bacteria 3453
332 Ga0207652_10111925 3300025921 Bacteria 2421
333 Ga0207652_10112577 3300025921 Bacteria 2415
334 Ga0207652_10258852 3300025921 Bacteria 1569
335 Ga0207646_10108859 3300025922 Bacteria 2486
336 Ga0207681_10034479 3300025923 Bacteria 3328
337 Ga0207681_10062274 3300025923 Bacteria 2568
338 Ga0207650_10030542 3300025925 Bacteria 3882
339 Ga0207650_10068465 3300025925 Bacteria 2666
340 Ga0207650_10091002 3300025925 Bacteria 2330
341 Ga0207659_10125838 3300025926 Bacteria 1971
342 Ga0207659_10142786 3300025926 Bacteria 1860
343 Ga0207659_10182438 3300025926 Bacteria 1664
344 Ga0207659_10365432 3300025926 Bacteria 1200
345 Ga0207659_10366032 3300025926 Bacteria 1199
346 Ga0207687_10002535 3300025927 Bacteria 12403
347 Ga0207687_10062110 3300025927 Bacteria 2640
348 Ga0207687_10279310 3300025927 Bacteria 1338
349 Ga0207700_10050072 3300025928 Bacteria 3111
350 Ga0207700_10073659 3300025928 Bacteria 2638
351 Ga0207700_10127448 3300025928 Bacteria 2073
352 Ga0207700_10252912 3300025928 Bacteria 1506
353 Ga0207700_10315408 3300025928 Bacteria 1354
354 Ga0207664_10040999 3300025929 Bacteria 3604
355 Ga0207664_10201736 3300025929 Bacteria 1717
356 Ga0207664_10229820 3300025929 Bacteria 1612
357 Ga0207644_10000409 3300025931 Bacteria 28023
358 Ga0207644_10016411 3300025931 Bacteria 4981
359 Ga0207644_10031985 3300025931 Bacteria 3669
360 Ga0207644_10276929 3300025931 Bacteria 1346
361 Ga0207706_10038152 3300025933 Bacteria 4262
362 Ga0207706_10121373 3300025933 Bacteria 2298
363 Ga0207686_10014985 3300025934 Bacteria 4327
364 Ga0207709_10000662 3300025935 Bacteria 27921
365 Ga0207709_10145655 3300025935 Bacteria 1634
366 Ga0207670_10000333 3300025936 Bacteria 27980
367 Ga0207670_10002665 3300025936 Bacteria 9390
368 Ga0207670_10004310 3300025936 Bacteria 7639
369 Ga0207670_10020940 3300025936 Bacteria 4025
370 Ga0207670_10205270 3300025936 Bacteria 1499
371 Ga0207669_10030218 3300025937 Bacteria 3008
372 Ga0207669_10134855 3300025937 Bacteria 1703
373 Ga0207669_10210730 3300025937 Bacteria 1418
374 Ga0207704_10000798 3300025938 Bacteria 13929
375 Ga0207704_10010936 3300025938 Bacteria 4448
376 Ga0207704_10206684 3300025938 Bacteria 1441
377 Ga0207704_10242318 3300025938 Bacteria 1348
378 Ga0207665_10003244 3300025939 Bacteria 10891
379 Ga0207665_10023145 3300025939 Bacteria 4091
380 Ga0207665_10037567 3300025939 Bacteria 3224
381 Ga0207691_10020089 3300025940 Bacteria 6318
382 Ga0207691_10044610 3300025940 Bacteria 4080
383 Ga0207691_10161849 3300025940 Bacteria 1963
384 Ga0207711_10014397 3300025941 Bacteria 6568
385 Ga0207711_10055281 3300025941 Bacteria 3408
386 Ga0207711_10062514 3300025941 Bacteria 3211
387 Ga0207711_10141067 3300025941 Bacteria 2168
388 Ga0207689_10001220 3300025942 Bacteria 24704
389 Ga0207689_10014839 3300025942 Bacteria 6614
390 Ga0207689_10119685 3300025942 Bacteria 2166
391 Ga0207689_10128018 3300025942 Bacteria 2088
392 Ga0207689_10157051 3300025942 Bacteria 1875
393 Ga0207679_10207272 3300025945 Bacteria 1642
394 Ga0207667_10000029 3300025949 Bacteria 329192
395 Ga0207667_10011463 3300025949 Bacteria 10301
396 Ga0207667_10012740 3300025949 Bacteria 9659
397 Ga0207651_10009279 3300025960 Bacteria 5373
398 Ga0207651_10178410 3300025960 Bacteria 1682
399 Ga0207712_10048334 3300025961 Bacteria 2959
400 Ga0207668_10017068 3300025972 Bacteria 4541
401 Ga0207668_10405555 3300025972 Bacteria 1153
402 Ga0207640_10004352 3300025981 Bacteria 7673
403 Ga0207658_10019851 3300025986 Bacteria 4650
404 Ga0207658_10312615 3300025986 Bacteria 1357
405 Ga0207677_10049518 3300026023 Bacteria 2836
406 Ga0207678_10002574 3300026067 Bacteria 16522
407 Ga0207708_10000993 3300026075 Bacteria 21204
408 Ga0207708_10008364 3300026075 Bacteria 7659
409 Ga0207708_10015584 3300026075 Bacteria 5700
410 Ga0207702_10040209 3300026078 Bacteria 3920
411 Ga0207702_10176628 3300026078 Bacteria 1963
412 Ga0207702_10210465 3300026078 Bacteria 1807
413 Ga0207702_10300355 3300026078 Bacteria 1524
414 Ga0207641_10066100 3300026088 Bacteria 3095
415 Ga0207641_10172491 3300026088 Bacteria 1975
416 Ga0207648_10000840 3300026089 Bacteria 34588
417 Ga0207648_10001304 3300026089 Bacteria 27765
418 Ga0207648_10051080 3300026089 Bacteria 3613
419 Ga0207676_10018327 3300026095 Bacteria 5088
420 Ga0207676_10441243 3300026095 Bacteria 1225
421 Ga0207674_10067184 3300026116 Bacteria 3610
422 Ga0207674_10187815 3300026116 Bacteria 2017
423 Ga0207675_100000900 3300026118 Bacteria 29714
424 Ga0207675_100002492 3300026118 Bacteria 18230
425 Ga0207675_100152416 3300026118 Bacteria 2201
426 Ga0207675_100182211 3300026118 Bacteria 2011
427 Ga0207683_10002913 3300026121 Bacteria 14927
428 Ga0207683_10015669 3300026121 Bacteria 6452
429 Ga0207683_10242126 3300026121 Bacteria 1645
430 Ga0207683_10353005 3300026121 Bacteria 1350
431 Ga0207698_10169618 3300026142 Bacteria 1920
432 Ga0209969_1002388 3300027360 Bacteria 2597
433 Ga0209967_1007468 3300027364 Bacteria 1495
434 Ga0209179_1014773 3300027512 Bacteria 1439
435 Ga0209968_1005378 3300027526 Bacteria 1927
436 Ga0209999_1000224 3300027543 Bacteria 8056
437 Ga0207428_10000321 3300027907 Bacteria 62664
438 Ga0207428_10046915 3300027907 Bacteria 3471
439 Ga0265357_1005616 3300028023 Bacteria 1165
440 Ga0268266_10000063 3300028379 Bacteria 253339
441 Ga0268266_10001173 3300028379 Bacteria 32393
442 Ga0268265_10005803 3300028380 Bacteria 8422
443 Ga0268265_10241621 3300028380 Bacteria 1594
444 Ga0268265_10388220 3300028380 Bacteria 1286
445 Ga0268264_10003658 3300028381 Bacteria 13220
446 Ga0268264_10023040 3300028381 Bacteria 5081
447 Ga0268264_10169224 3300028381 Bacteria 1975
448 Ga0265337_1001602 3300028556 Bacteria 11051
449 Ga0265334_10000375 3300028573 Bacteria 23930
450 Ga0307515_10000292 3300028794 Bacteria 123160
451 Ga0265338_10017937 3300028800 Bacteria 7601
452 Ga0265760_10022541 3300031090 Bacteria 1825
453 Ga0265330_10025350 3300031235 Bacteria 2688
454 Ga0265332_10090049 3300031238 Bacteria 1298
455 Ga0265320_10064213 3300031240 Bacteria 1744
456 Ga0265325_10000649 3300031241 Bacteria 25279
457 Ga0265325_10086558 3300031241 Bacteria 1550
458 Ga0265325_10093049 3300031241 Bacteria 1484
459 Ga0265329_10006400 3300031242 Bacteria 4672
460 Ga0265340_10058038 3300031247 Bacteria 1859
461 Ga0265340_10075674 3300031247 Bacteria 1590
462 Ga0265340_10114843 3300031247 Bacteria 1242
463 Ga0265339_10000269 3300031249 Bacteria 41988
464 Ga0265339_10036335 3300031249 Bacteria 2758
465 Ga0265316_10183496 3300031344 Bacteria 1557
466 Ga0307408_100070914 3300031548 Bacteria 2574
467 Ga0265313_10022761 3300031595 Bacteria 3391
468 Ga0307508_10089616 3300031616 Bacteria 2661
469 Ga0265314_10038574 3300031711 Bacteria 3449
470 Ga0265314_10043616 3300031711 Bacteria 3187
471 Ga0265342_10043768 3300031712 Bacteria 2700
472 Ga0307405_10012768 3300031731 Bacteria 4461
473 Ga0307413_10001952 3300031824 Bacteria 8191
474 Ga0307406_10004403 3300031901 Bacteria 7660
475 Ga0307407_10013466 3300031903 Bacteria 3971
476 Ga0307412_10007438 3300031911 Bacteria 6212
477 Ga0307414_10227671 3300032004 Bacteria 1535
478 Ga0307411_10003851 3300032005 Bacteria 7067
479 Ga0307415_100005865 3300032126 Bacteria 6568
480 Ga0316583_10005706 3300032133 Bacteria 4476
481 Ga0373930_0015062 3300034816 Bacteria 1448
482 Ga0373926_0003071 3300035083 Bacteria 5358
483 Ga0373926_0016641 3300035083 Bacteria 2518
484 Ga0373928_0004469 3300035084 Bacteria 2666
485 Ga0373929_0012853 3300035085 Bacteria 1596
486 Ga0373940_0019433 3300035088 Bacteria 1716
487 Ga0373944_0018964 3300035089 Bacteria 1969
488 Ga0373944_0036368 3300035089 Bacteria 1504
489 Ga0373944_0103233 3300035089 Bacteria 966
490 Ga0373951_0005912 3300035091 Bacteria 2824
491 Ga0373952_0003713 3300035092 Bacteria 2758
492 Ga0373932_0001983 3300035112 Bacteria 5402
493 Ga0373936_0006658 3300035113 Bacteria 4350
494 Ga0373936_0029845 3300035113 Bacteria 2148
495 Ga0373945_0000969 3300035116 Bacteria 8556
496 Ga0373945_0003484 3300035116 Bacteria 4953
497 Ga0373945_0006884 3300035116 Bacteria 3675
498 Ga0373953_0020708 3300035117 Bacteria 2459
499 Ga0373954_0032131 3300035118 Bacteria 2426
500 Ga0373954_0056964 3300035118 Bacteria 1840
501 Ga0373954_0125623 3300035118 Bacteria 1247
502 Ga0373956_0026912 3300035119 Bacteria 2493
503 Ga0373957_0037722 3300035120 Bacteria 1806
504 Ga0373960_0033881 3300035121 Bacteria 1442
505 Ga0373943_0000185 3300035170 Bacteria 24985
506 Ga0373943_0014863 3300035170 Bacteria 3532
507 Ga0373943_0083775 3300035170 Bacteria 1639
508 Ga0373943_0152461 3300035170 Bacteria 1253
509 Ga0373946_0000642 3300035171 Bacteria 11673
510 Ga0373946_0174843 3300035171 Bacteria 1016
511 Ga0373955_0001304 3300035172 Bacteria 10611
512 Ga0373955_0002912 3300035172 Bacteria 7514
513 Ga0373955_0003944 3300035172 Bacteria 6545
514 Ga0373955_0068444 3300035172 Bacteria 1978
515 Ga0373961_0006705 3300035241 Bacteria 2768
516 Ga0373962_0012148 3300035242 Bacteria 2166
517 Ga0373962_0019134 3300035242 Bacteria 1789
518 Ga0373924_0008512 3300035410 Bacteria 3732
519 Ga0373924_0020013 3300035410 Bacteria 2598
520 Ga0373931_0000134 3300035691 Bacteria 33430
521 Ga0373931_0054056 3300035691 Bacteria 2145
522 Ga0373931_0140963 3300035691 Bacteria 1396
523 Ga0373931_0179923 3300035691 Bacteria 1251
524 Ga0373935_0000023 3300035692 Bacteria 61461
525 Ga0373935_0010837 3300035692 Bacteria 5476
526 Ga0373935_0039428 3300035692 Bacteria 2962
527 Ga0373935_0124974 3300035692 Bacteria 1722
528 Ga0373935_0163631 3300035692 Bacteria 1518
529 Ga0373935_0176776 3300035692 Bacteria 1463
530 Ga0373927_0000434 3300035695 Bacteria 32038
531 Ga0373927_0013020 3300035695 Bacteria 5532
532 Ga0373927_0020220 3300035695 Bacteria 4365
533 Ga0373927_0041756 3300035695 Bacteria 2974
534 Ga0373927_0051817 3300035695 Bacteria 2654
535 Ga0373927_0070058 3300035695 Bacteria 2270
536 Ga0373927_0072642 3300035695 Bacteria 2227
537 Ga0373933_0001503 3300035724 Bacteria 13639
538 Ga0373933_0006249 3300035724 Bacteria 6484
539 Ga0373933_0011490 3300035724 Bacteria 4883
540 Ga0373947_0000583 3300035725 Bacteria 21422
541 Ga0373947_0017670 3300035725 Bacteria 4104
542 Ga0373947_0070482 3300035725 Bacteria 2142
543 Ga0373947_0208520 3300035725 Bacteria 1281
544 Ga0373947_0213124 3300035725 Bacteria 1267
545 Ga0373937_0000005 3300036401 Bacteria 199965
546 Ga0373937_0003414 3300036401 Bacteria 13333
547 Ga0373937_0008905 3300036401 Bacteria 8714
548 Ga0373937_0009993 3300036401 Bacteria 8274
549 Ga0373937_0010352 3300036401 Bacteria 8143
550 Ga0373937_0091795 3300036401 Bacteria 2814
551 Ga0373925_0000007 3300037068 Bacteria 257023
552 Ga0373925_0000749 3300037068 Bacteria 29795
553 Ga0373925_0030549 3300037068 Bacteria 3955
554 Ga0373925_0104188 3300037068 Bacteria 2184
555 Ga0373925_0107062 3300037068 Bacteria 2156
556 Ga0373925_0132701 3300037068 Bacteria 1943
557 Ga0373925_0330088 3300037068 Bacteria 1235
558 Ga0395898_0152595 3300037466 Bacteria 2210
559 Ga0395898_0182889 3300037466 Bacteria 2003
560 Ga0436364_0611812 3300037853 Bacteria 1686
561 Ga0436364_1488218 3300037853 Bacteria 1913
562 Ga0436365_0053879 3300039437 Bacteria 2344
563 Ga0436365_0072895 3300039437 Bacteria 53725
564 Ga0436365_0120456 3300039437 Bacteria 3440
565 Ga0436365_0395269 3300039437 Bacteria 1213
566 Ga0436365_1548351 3300039437 Bacteria 1282
567 Ga0436365_1582443 3300039437 Bacteria 6857
568 Ga0436365_1849126 3300039437 Bacteria 3360
569 Ga0436360_0157058 3300039438 Bacteria 1376
570 Ga0436360_0793447 3300039438 Bacteria 1379
571 Ga0436360_1115848 3300039438 Bacteria 1921
572 Ga0436361_0028664 3300039447 Bacteria 69721
573 Ga0436361_0081134 3300039447 Bacteria 1491
574 Ga0436361_0200590 3300039447 Bacteria 2148
575 Ga0436361_0328438 3300039447 Bacteria 1311
576 Ga0436361_0340102 3300039447 Bacteria 1972
577 Ga0436363_0460787 3300039450 Bacteria 1715
578 Ga0436363_1144933 3300039450 Bacteria 1753
579 Ga0436362_0233360 3300039453 Bacteria 1195
580 Ga0436362_0463249 3300039453 Bacteria 4420
581 Ga0436362_0742152 3300039453 Bacteria 1104
582 Ga0436362_0992192 3300039453 Bacteria 2095
583 Ga0436362_1187034 3300039453 Bacteria 1608
584 Ga0451807_0095181 3300041486 Bacteria 3744
585 Ga0439434_0000107 3300042435 Bacteria 21642
586 Ga0439434_0027711 3300042435 Bacteria 1714
587 Ga0439435_0000076 3300042436 Bacteria 11878
588 Ga0451577_0000863 3300042876 Bacteria 45151
589 Ga0451577_0100523 3300042876 Bacteria 2583
590 Ga0466963_0016237 3300044694 Bacteria 4628
591 Ga0466957_0067767 3300044842 Bacteria 2202
592 Ga0466959_0064196 3300045049 Bacteria 2666
593 Ga0451576_0001387 3300045051 Bacteria 41619
594 Ga0466958_0000079 3300045836 Bacteria 29664
595 Ga0495627_051507 3300046453 Bacteria 1237
596 Ga0495592_0007203 3300046454 Bacteria 8333
597 Ga0495592_0021131 3300046454 Bacteria 4949
598 Ga0495592_0034241 3300046454 Bacteria 3829
599 Ga0495592_0038795 3300046454 Bacteria 3582
600 Ga0495592_0072080 3300046454 Bacteria 2514
601 Ga0495592_0231287 3300046454 Bacteria 1231
602 Ga0495603_0025282 3300046455 Bacteria 3591
603 Ga0495603_0237504 3300046455 Bacteria 1050
604 Ga0495629_0012162 3300046459 Bacteria 6236
605 Ga0495629_0017119 3300046459 Bacteria 5199
606 Ga0495629_0153118 3300046459 Bacteria 1602
607 Ga0495638_0008417 3300046460 Bacteria 7317
608 Ga0495638_0040866 3300046460 Bacteria 2937
609 Ga0495641_0020520 3300046461 Bacteria 3347
610 Ga0495651_0001105 3300046462 Bacteria 20821
611 Ga0495651_0007669 3300046462 Bacteria 8251
612 Ga0495651_0050378 3300046462 Bacteria 3212
613 Ga0495653_0000308 3300046463 Bacteria 39628
614 Ga0495653_0001999 3300046463 Bacteria 16036
615 Ga0495580_0001449 3300046472 Bacteria 20800
616 Ga0495580_0058208 3300046472 Bacteria 2718
617 Ga0495580_0110115 3300046472 Bacteria 1912
618 Ga0495580_0139388 3300046472 Bacteria 1681
619 Ga0495580_0189984 3300046472 Bacteria 1417
620 Ga0495639_0013308 3300046475 Bacteria 3552
621 Ga0495662_0008076 3300046476 Bacteria 5186
622 Ga0495662_0010733 3300046476 Bacteria 4479
623 Ga0495662_0054256 3300046476 Bacteria 1936
624 Ga0495664_0000003 3300046477 Bacteria 551602
625 Ga0495664_0001762 3300046477 Bacteria 11503
626 Ga0495584_0164884 3300046491 Bacteria 1126
627 Ga0495583_0000840 3300046506 Bacteria 37393
628 Ga0495606_0003584 3300046507 Bacteria 16361
629 Ga0495608_0000072 3300046511 Bacteria 76887
630 Ga0495608_0001418 3300046511 Bacteria 17055
631 Ga0495618_0000019 3300046514 Bacteria 136770
632 Ga0495618_0003872 3300046514 Bacteria 9249
633 Ga0495618_0017589 3300046514 Bacteria 4384
634 Ga0495628_0000015 3300046516 Bacteria 198912
635 Ga0495628_0104293 3300046516 Bacteria 2185
636 Ga0495628_0198013 3300046516 Bacteria 1514
637 Ga0495630_0027301 3300046517 Bacteria 4233
638 Ga0495630_0029121 3300046517 Bacteria 4105
639 Ga0495630_0142109 3300046517 Bacteria 1825
640 Ga0495663_0017948 3300046525 Bacteria 2012
641 Ga0495666_0040519 3300046526 Bacteria 2258
642 Ga0495666_0110666 3300046526 Bacteria 1290
643 Ga0495652_0000006 3300046529 Bacteria 459709
644 Ga0495652_0024988 3300046529 Bacteria 5286
645 Ga0495665_0013808 3300046531 Bacteria 4362
646 Ga0495665_0039593 3300046531 Bacteria 2510
647 Ga0495640_0000002 3300046533 Bacteria 646434
648 Ga0495640_0007626 3300046533 Bacteria 8505
649 Ga0495640_0007854 3300046533 Bacteria 8388
650 Ga0495640_0036736 3300046533 Bacteria 3459
651 Ga0495640_0063367 3300046533 Bacteria 2504
652 Ga0495640_0232222 3300046533 Bacteria 1160
653 Ga0495586_0001019 3300046535 Bacteria 15828
654 Ga0495587_0000001 3300046536 Bacteria 724132
655 Ga0495587_0000718 3300046536 Bacteria 22128
656 Ga0495587_0211790 3300046536 Bacteria 1094
657 Ga0495598_0029042 3300046537 Bacteria 1538
658 Ga0495621_0053406 3300046539 Bacteria 1451
659 Ga0495645_0002525 3300046543 Bacteria 12424
660 Ga0495645_0010377 3300046543 Bacteria 6527
661 Ga0495645_0061883 3300046543 Bacteria 2712
662 Ga0495667_0000021 3300046559 Bacteria 180625
663 Ga0495667_0015887 3300046559 Bacteria 5090
664 Ga0495667_0047937 3300046559 Bacteria 2821
665 Ga0495667_0069839 3300046559 Bacteria 2292
666 Ga0495667_0247884 3300046559 Bacteria 1134
667 Ga0495656_0011244 3300046615 Bacteria 3283
668 Ga0495656_0122948 3300046615 Bacteria 1227
669 Ga0495668_0188938 3300046616 Bacteria 1128
670 Ga0495634_0000251 3300046642 Bacteria 50728
671 Ga0495634_0004679 3300046642 Bacteria 10644
672 Ga0495634_0005356 3300046642 Bacteria 9887
673 Ga0495634_0008363 3300046642 Bacteria 7713
674 Ga0495634_0031218 3300046642 Bacteria 3671
675 Ga0495634_0147046 3300046642 Bacteria 1492
676 Ga0495625_0073164 3300046660 Bacteria 2403
677 Ga0495635_0000001 3300046663 Bacteria 704901
678 Ga0495635_0013586 3300046663 Bacteria 5698
679 Ga0495635_0309483 3300046663 Bacteria 1058
680 Ga0495588_0014197 3300046674 Bacteria 3809
681 Ga0495657_0000486 3300046675 Bacteria 37325
682 Ga0495657_0004121 3300046675 Bacteria 11643
683 Ga0495657_0094272 3300046675 Bacteria 1915
684 Ga0495599_0000203 3300046678 Bacteria 39491
685 Ga0495599_0061678 3300046678 Bacteria 2342
686 Ga0495599_0121767 3300046678 Bacteria 1621
687 Ga0495623_0000058 3300046679 Bacteria 68197
688 Ga0495623_0014685 3300046679 Bacteria 5065
689 Ga0495623_0040238 3300046679 Bacteria 2985
690 Ga0495646_0000003 3300046680 Bacteria 287773
691 Ga0495646_0118020 3300046680 Bacteria 1504
692 Ga0495647_0002041 3300046681 Bacteria 6316
693 Ga0495647_0019408 3300046681 Bacteria 2430
694 Ga0495647_0061291 3300046681 Bacteria 1485
695 Ga0495647_0063946 3300046681 Bacteria 1458
696 Ga0495658_0006634 3300046683 Bacteria 5688
697 Ga0495658_0021666 3300046683 Bacteria 3391
698 Ga0495613_0032385 3300046689 Bacteria 3883
699 Ga0495613_0044368 3300046689 Bacteria 3290
700 Ga0495613_0270040 3300046689 Bacteria 1183
701 Ga0495624_0019722 3300046690 Bacteria 4495
702 Ga0495624_0043998 3300046690 Bacteria 2847
703 Ga0495624_0066538 3300046690 Bacteria 2249
704 Ga0495624_0110338 3300046690 Bacteria 1692
705 Ga0495624_0226103 3300046690 Bacteria 1134
706 Ga0495670_0078096 3300046691 Bacteria 1684
707 Ga0495670_0089661 3300046691 Bacteria 1573
708 Ga0495600_0000002 3300046809 Bacteria 186597
709 Ga0495600_0006243 3300046809 Bacteria 7235
710 Ga0495600_0071440 3300046809 Bacteria 2267
711 Ga0495581_0018810 3300047315 Bacteria 4010
712 Ga0495604_0000001 3300047317 Bacteria 708627
713 Ga0495604_0003884 3300047317 Bacteria 11896
714 Ga0495604_0173303 3300047317 Bacteria 1515
715 Ga0495674_0000018 3300047319 Bacteria 204024
716 Ga0495674_0001596 3300047319 Bacteria 22233
717 Ga0495674_0006703 3300047319 Bacteria 11034
718 Ga0495674_0069384 3300047319 Bacteria 3048
719 Ga0495672_0033481 3300047320 Bacteria 3183
720 Ga0495672_0041858 3300047320 Bacteria 2767
721 Ga0495676_0004556 3300047321 Bacteria 12679
722 Ga0495676_0048763 3300047321 Bacteria 3411
723 Ga0495676_0069526 3300047321 Bacteria 2716
724 Ga0495680_0001109 3300047322 Bacteria 29730
725 Ga0495680_0010419 3300047322 Bacteria 8294
726 Ga0495683_0137760 3300047323 Bacteria 1146
727 Ga0495675_0003039 3300047444 Bacteria 10087
728 Ga0495675_0004157 3300047444 Bacteria 8756
729 Ga0495675_0075237 3300047444 Bacteria 2128
730 Ga0495679_040933 3300047446 Bacteria 1438
731 Ga0495685_049860 3300047447 Bacteria 1421
732 Ga0495684_0000010 3300047471 Bacteria 198915
733 Ga0495684_0007596 3300047471 Bacteria 8388
734 Ga0495684_0011645 3300047471 Bacteria 6790
735 Ga0495684_0027615 3300047471 Bacteria 4357
736 Ga0495684_0048735 3300047471 Bacteria 3238
737 Ga0495686_0000606 3300047472 Bacteria 49623
738 Ga0495593_0007996 3300047673 Bacteria 6157
739 Ga0495593_0048567 3300047673 Bacteria 2255
740 Ga0495593_0121493 3300047673 Bacteria 1329
741 Ga0495602_0013088 3300048088 Bacteria 8484
742 Ga0495602_0049699 3300048088 Bacteria 3754
743 Ga0495602_0284528 3300048088 Bacteria 1216
744 Ga0496100_0005463 3300048903 Bacteria 6850
745 Ga0496100_0023107 3300048903 Bacteria 3772
746 Ga0496100_0098803 3300048903 Bacteria 2007
747 Ga0496101_0001025 3300048904 Bacteria 16469
748 Ga0496101_0008677 3300048904 Bacteria 6646
749 Ga0496101_0020913 3300048904 Bacteria 4489
750 Ga0496101_0227973 3300048904 Bacteria 1447
751 Ga0496102_0001685 3300048905 Bacteria 19401
752 Ga0496102_0010694 3300048905 Bacteria 7904
753 Ga0496102_0041079 3300048905 Bacteria 4187
754 Ga0496102_0087737 3300048905 Bacteria 2874
755 Ga0496102_0151094 3300048905 Bacteria 2182
756 Ga0496103_0012080 3300048906 Bacteria 5130
757 Ga0496103_0045036 3300048906 Bacteria 2721
758 Ga0496103_0372135 3300048906 Bacteria 918
759 Ga0496104_0003048 3300048907 Bacteria 14438
760 Ga0496104_0012586 3300048907 Bacteria 7613
761 Ga0496104_0020110 3300048907 Bacteria 6117
762 Ga0496104_0125825 3300048907 Bacteria 2461
763 Ga0496104_0235547 3300048907 Bacteria 1742
764 Ga0496104_0307706 3300048907 Bacteria 1497
765 Ga0496104_0427971 3300048907 Bacteria 1235
766 Ga0496104_0504321 3300048907 Bacteria 1121
767 Ga0496105_0005567 3300048908 Bacteria 9565
768 Ga0496105_0005922 3300048908 Bacteria 9329
769 Ga0496105_0011176 3300048908 Bacteria 7082
770 Ga0496105_0050257 3300048908 Bacteria 3444
771 Ga0496105_0060568 3300048908 Bacteria 3123
772 Ga0496105_0092139 3300048908 Bacteria 2502
773 Ga0496105_0129449 3300048908 Bacteria 2081
774 Ga0496105_0136590 3300048908 Bacteria 2020
775 Ga0496106_0010565 3300048909 Bacteria 6819
776 Ga0496106_0023192 3300048909 Bacteria 4610
777 Ga0496106_0051071 3300048909 Bacteria 3117
778 Ga0496106_0177004 3300048909 Bacteria 1692
779 Ga0496106_0286611 3300048909 Bacteria 1320
780 Ga0496107_0007469 3300048910 Bacteria 7535
781 Ga0496107_0015009 3300048910 Bacteria 5425
782 Ga0496108_0002364 3300048911 Bacteria 15107
783 Ga0496108_0029304 3300048911 Bacteria 4556
784 Ga0496108_0050992 3300048911 Bacteria 3466
785 Ga0496108_0079831 3300048911 Bacteria 2770
786 Ga0496108_0169416 3300048911 Bacteria 1889
787 Ga0496109_0001638 3300048912 Bacteria 18700
788 Ga0496109_0002461 3300048912 Bacteria 15523
789 Ga0496109_0011159 3300048912 Bacteria 7707
790 Ga0496109_0029136 3300048912 Bacteria 4942
791 Ga0496109_0051551 3300048912 Bacteria 3748
792 Ga0496109_0105357 3300048912 Bacteria 2619
793 Ga0496109_0373964 3300048912 Bacteria 1346
794 Ga0496110_0003528 3300048913 Bacteria 12009
795 Ga0496110_0011641 3300048913 Bacteria 7212
796 Ga0496110_0037760 3300048913 Bacteria 4199
797 Ga0496110_0144854 3300048913 Bacteria 2148
798 Ga0496110_0179453 3300048913 Bacteria 1922
799 Ga0496111_0003518 3300048914 Bacteria 9693
800 Ga0496111_0005819 3300048914 Bacteria 7950
801 Ga0496111_0017449 3300048914 Bacteria 4963
802 Ga0496111_0018422 3300048914 Bacteria 4838
803 Ga0496111_0027735 3300048914 Bacteria 4009
804 Ga0496111_0147169 3300048914 Bacteria 1746
805 Ga0496111_0265230 3300048914 Bacteria 1274
806 Ga0496112_0037915 3300048915 Bacteria 4707
807 Ga0496112_0039123 3300048915 Bacteria 4632
808 Ga0496112_0067536 3300048915 Bacteria 3529
809 Ga0496112_0122371 3300048915 Bacteria 2572
810 Ga0496112_0135215 3300048915 Bacteria 2436
811 Ga0496112_0154557 3300048915 Bacteria 2261
812 Ga0496112_0157700 3300048915 Bacteria 2236
813 Ga0496112_0355360 3300048915 Bacteria 1407
814 Ga0496112_0366697 3300048915 Bacteria 1382
815 Ga0496113_0000175 3300048916 Bacteria 28436
816 Ga0496113_0001647 3300048916 Bacteria 12592
817 Ga0496113_0030542 3300048916 Bacteria 3901
818 Ga0496113_0030825 3300048916 Bacteria 3886
819 Ga0496113_0337568 3300048916 Unclassified 1208
820 Ga0496114_0027134 3300048917 Bacteria 4690
821 Ga0496114_0057372 3300048917 Bacteria 3251
822 Ga0496114_0085526 3300048917 Bacteria 2671
823 Ga0496115_0023215 3300048918 Bacteria 4813
824 Ga0496115_0084063 3300048918 Bacteria 2595
825 Ga0496115_0159650 3300048918 Bacteria 1863
826 Ga0496115_0235455 3300048918 Bacteria 1509
827 Ga0496117_0022967 3300048920 Bacteria 4989
828 Ga0496117_0087606 3300048920 Bacteria 2017
829 Ga0496118_0027984 3300048921 Bacteria 4759
830 Ga0496118_0037082 3300048921 Bacteria 3929
831 Ga0496118_0048685 3300048921 Bacteria 3269
832 Ga0496121_0009918 3300048924 Bacteria 10841
833 Ga0496124_0006822 3300048927 Bacteria 12323
834 Ga0496124_0191576 3300048927 Bacteria 1564
835 Ga0496126_0035095 3300048929 Bacteria 4703
836 Ga0496126_0039717 3300048929 Bacteria 4365
837 Ga0501294_004642 3300049517 Bacteria 1295
838 Ga0501031_0001402 3300049568 Bacteria 14899
839 Ga0501033_0017562 3300049570 Bacteria 5405
840 Ga0501034_0218199 3300049571 Bacteria 1860
841 Ga0501036_0009279 3300049572 Bacteria 8085
842 Ga0501036_0022892 3300049572 Bacteria 5260
843 Ga0501038_0030524 3300049574 Bacteria 4768
844 Ga0501038_0142363 3300049574 Bacteria 1961
845 Ga0501039_0001656 3300049575 Bacteria 16415
846 Ga0501039_0019439 3300049575 Bacteria 5208
847 Ga0501040_0055715 3300049576 Bacteria 2712
848 Ga0501041_0000600 3300049577 Bacteria 18846
849 Ga0501041_0009888 3300049577 Bacteria 5617
850 Ga0501041_0047078 3300049577 Bacteria 2625
851 Ga0501042_0004577 3300049578 Bacteria 8827
852 Ga0501042_0044082 3300049578 Bacteria 3178
853 Ga0501043_0027712 3300049579 Bacteria 4447
854 Ga0501043_0041339 3300049579 Bacteria 3622
855 Ga0501046_0000126 3300049580 Bacteria 81334
856 Ga0501046_0001057 3300049580 Bacteria 26945
857 Ga0501046_0363357 3300049580 Bacteria 1049
858 Ga0501047_0000160 3300049581 Bacteria 81946
859 Ga0501047_0332725 3300049581 Bacteria 1357
860 Ga0501048_0000040 3300049582 Bacteria 63031
861 Ga0501048_0011924 3300049582 Bacteria 6480
862 Ga0501048_0028075 3300049582 Bacteria 4086
863 Ga0501048_0184491 3300049582 Bacteria 1479
864 Ga0501069_0012334 3300049585 Bacteria 4541
865 Ga0501070_0104679 3300049586 Bacteria 2339
866 Ga0501070_0242388 3300049586 Bacteria 1475
867 Ga0501071_0044976 3300049587 Bacteria 3168
868 Ga0501071_0051424 3300049587 Bacteria 2969
869 Ga0501071_0344170 3300049587 Bacteria 1134
870 Ga0501072_0001862 3300049588 Bacteria 15708
871 Ga0501072_0016678 3300049588 Bacteria 5643
872 Ga0501072_0025063 3300049588 Bacteria 4644
873 Ga0501072_0280682 3300049588 Bacteria 1325
874 Ga0501073_0111896 3300049589 Bacteria 1894
875 Ga0501074_0013084 3300049590 Bacteria 6031
876 Ga0501074_0025976 3300049590 Bacteria 4247
877 Ga0501075_0003996 3300049591 Bacteria 9947
878 Ga0501075_0069220 3300049591 Bacteria 2667
879 Ga0501076_0000348 3300049592 Bacteria 28519
880 Ga0501076_0018281 3300049592 Bacteria 5341
881 Ga0501076_0031097 3300049592 Bacteria 4162
882 Ga0501076_0152057 3300049592 Bacteria 1883
883 Ga0501225_0008565 3300049705 Bacteria 2931
884 Ga0501079_0000859 3300049741 Bacteria 20782
885 Ga0501079_0125204 3300049741 Bacteria 1999
886 Ga0501080_0066965 3300049742 Bacteria 3340
887 Ga0501081_0000131 3300049743 Bacteria 33122
888 Ga0501081_0018251 3300049743 Bacteria 4657
889 Ga0501081_0089723 3300049743 Bacteria 2160
890 Ga0501083_0062007 3300049744 Bacteria 2496
891 Ga0501272_006773 3300049769 Bacteria 1230
892 Ga0501035_0379950 3300049822 Bacteria 1178
893 Ga0501044_0000743 3300049823 Bacteria 39318
894 Ga0501044_0139155 3300049823 Bacteria 2416
895 Ga0501044_0289665 3300049823 Bacteria 1569
896 Ga0501045_0004944 3300049824 Bacteria 9234
897 Ga0501045_0014083 3300049824 Bacteria 5663
898 Ga0501045_0018427 3300049824 Bacteria 4965
899 Ga0501045_0083981 3300049824 Bacteria 2349
900 nmdc:mga03683_20525_c1 3300050489 Bacteria 2536
901 nmdc:mga00v17_107895_c1 3300050491 Bacteria 1764
902 nmdc:mga00v17_188780_c1 3300050491 Bacteria 1331
903 nmdc:mga0k408_12633_c1 3300050493 Bacteria 4616
904 nmdc:mga0k408_2138_c1 3300050493 Bacteria 10590
905 nmdc:mga0k408_23217_c1 3300050493 Bacteria 3497
906 nmdc:mga06z11_104161_c1 3300050494 Bacteria 1562
907 nmdc:mga06z11_148497_c1 3300050494 Bacteria 1331
908 nmdc:mga07m45_64254_c1 3300050496 Bacteria 2082
909 nmdc:mga07m45_97530_c1 3300050496 Bacteria 1687
910 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
911 nmdc:mga05p37_261301_c1 3300050507 Bacteria 2072
912 nmdc:mga05p37_673219_c1 3300050507 Bacteria 1155
913 nmdc:mga09592_418_c1 3300050508 Bacteria 31192
914 nmdc:mga08y16_108320_c1 3300050511 Bacteria 2892
915 nmdc:mga08y16_425018_c1 3300050511 Bacteria 1357
916 nmdc:mga08y16_9476_c1 3300050511 Bacteria 10220
917 nmdc:mga0n895_109188_c1 3300050512 Bacteria 2782
918 nmdc:mga0n895_252410_c1 3300050512 Bacteria 1790
919 nmdc:mga0n895_290807_c1 3300050512 Bacteria 1657
920 nmdc:mga0n895_40845_c1 3300050512 Bacteria 4507
921 nmdc:mga0n895_468_c1 3300050512 Bacteria 27132
922 nmdc:mga0n895_93917_c1 3300050512 Bacteria 3003
923 nmdc:mga0rr50_145_c1 3300050513 Bacteria 39313
924 nmdc:mga0rr50_89121_c1 3300050513 Bacteria 2398
925 nmdc:mga08x19_14066_c1 3300050514 Bacteria 4849
926 nmdc:mga08x19_522_c1 3300050514 Bacteria 25573
927 nmdc:mga0a205_11596_c1 3300050515 Bacteria 8121
928 nmdc:mga0a205_54289_c1 3300050515 Bacteria 3868
929 nmdc:mga0sz30_20124_c1 3300050516 Bacteria 2690
930 nmdc:mga0sz30_60152_c1 3300050516 Bacteria 1140
931 Ga0495601_0000001 3300053077 Bacteria 549454
932 Ga0495601_0000243 3300053077 Bacteria 29083
933 Ga0495601_0016790 3300053077 Bacteria 4439
934 Ga0495601_0022082 3300053077 Bacteria 3905
935 Ga0495601_0025060 3300053077 Bacteria 3676
936 Ga0495601_0152994 3300053077 Bacteria 1506
937 Ga0495601_0164211 3300053077 Bacteria 1451
938 Ga0495612_0000063 3300053078 Bacteria 48104
939 Ga0495612_0001332 3300053078 Bacteria 10178
940 Ga0495612_0006769 3300053078 Bacteria 4694
941 Ga0495612_0009391 3300053078 Bacteria 3969
942 Ga0495595_0002319 3300053084 Bacteria 7421
943 Ga0495595_0046083 3300053084 Bacteria 2007
944 Ga0495619_0000004 3300053085 Bacteria 500068
945 Ga0495619_0004170 3300053085 Bacteria 9234
946 Ga0495619_0112964 3300053085 Bacteria 1857
947 Ga0500578_0178410 3300053086 Bacteria 1310
948 Ga0500643_063804 3300053087 Bacteria 1030
949 Ga0500583_0164039 3300053092 Bacteria 1107
950 Ga0500641_0003400 3300053096 Bacteria 5626
951 Ga0500555_000886 3300053103 Bacteria 10651
952 Ga0500595_016248 3300053119 Bacteria 2776
953 Ga0500652_000023 3300053131 Bacteria 116316
954 Ga0501084_0064199 3300054114 Bacteria 3073
955 Ga0501084_0071132 3300054114 Bacteria 2913
956 Ga0501084_0090900 3300054114 Bacteria 2563
957 Ga0501084_0159463 3300054114 Bacteria 1903
958 Ga0501084_0479070 3300054114 Bacteria 1052
959 Ga0590071_008354 3300059421 Bacteria 2440
960 Ga0501082_0000205 3300060353 Bacteria 51540
961 Ga0501082_0008926 3300060353 Bacteria 8651
962 Ga0501082_0025577 3300060353 Bacteria 5087
963 Ga0501082_0144096 3300060353 Bacteria 2068
964 Ga0530510_0000425 3300061734 Bacteria 27205
965 Ga0530510_0057591 3300061734 Bacteria 2808

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0084063 Ga0496115_0084063_1765_2550 260
2 3300005983 Ga0081540_1017724 Ga0081540_10177244 274
3 3300004625 Ga0055543_1018963 Ga0055543_10189632 283
4 3300013308 Ga0157375_10957914 Ga0157375_109579141 285
5 3300046663 Ga0495635_0309483 Ga0495635_0309483_11_874 287
6 3300048906 Ga0496103_0372135 Ga0496103_0372135_38_901 287
7 3300035089 Ga0373944_0103233 Ga0373944_0103233_90_956 288
8 3300006195 Ga0075366_10031321 Ga0075366_100313214 291
9 3300005983 Ga0081540_1003649 Ga0081540_10036493 293
10 3300031344 Ga0265316_10183496 Ga0265316_101834962 293
11 3300031711 Ga0265314_10038574 Ga0265314_100385743 293
12 3300032133 Ga0316583_10005706 Ga0316583_100057063 295
13 3300039447 Ga0436361_0328438 Ga0436361_0328438_306_1259 303
14 3300028794 Ga0307515_10000292 Ga0307515_100002922 304
15 3300039447 Ga0436361_0340102 Ga0436361_0340102_142_1101 304
16 3300048908 Ga0496105_0050257 Ga0496105_0050257_692_1612 304
17 3300025927 Ga0207687_10062110 Ga0207687_100621103 306
18 3300049517 Ga0501294_004642 Ga0501294_004642_163_1122 306
19 3300049705 Ga0501225_0008565 Ga0501225_0008565_1196_2155 306
20 3300039438 Ga0436360_0157058 Ga0436360_0157058_305_1255 307
21 3300049769 Ga0501272_006773 Ga0501272_006773_214_1173 307
22 3300005983 Ga0081540_1002003 Ga0081540_10020035 309
23 3300037853 Ga0436364_0611812 Ga0436364_0611812_545_1507 309
24 3300031616 Ga0307508_10089616 Ga0307508_100896162 310
25 3300036401 Ga0373937_0008905 Ga0373937_0008905_5223_6179 310
26 3300048918 Ga0496115_0159650 Ga0496115_0159650_47_1030 310
27 3300014497 Ga0182008_10146347 Ga0182008_101463471 311
28 iso_pu_bacteria 2928115317 2928117050 312
29 3300003322 rootL2_10020853 rootL2_100208531 313
30 3300005327 Ga0070658_10000534 Ga0070658_1000053419 313
31 3300005333 Ga0070677_10023218 Ga0070677_100232183 313
32 3300005354 Ga0070675_100011655 Ga0070675_1000116554 313
33 3300005438 Ga0070701_10227212 Ga0070701_102272121 313
34 3300005456 Ga0070678_100184370 Ga0070678_1001843702 313
35 3300005563 Ga0068855_100197575 Ga0068855_1001975752 313
36 3300005614 Ga0068856_100316903 Ga0068856_1003169032 313
37 3300006358 Ga0068871_100240442 Ga0068871_1002404422 313
38 3300009093 Ga0105240_10000369 Ga0105240_1000036961 313
39 3300015683 Ga0183362_10002 Ga0183362_10002607 313
40 3300021388 Ga0213875_10036455 Ga0213875_100364552 313
41 3300025893 Ga0207682_10003858 Ga0207682_100038585 313
42 3300025909 Ga0207705_10002747 Ga0207705_100027477 313
43 3300025913 Ga0207695_10014477 Ga0207695_100144774 313
44 3300025921 Ga0207652_10014091 Ga0207652_100140915 313
45 3300025926 Ga0207659_10125838 Ga0207659_101258382 313
46 3300025926 Ga0207659_10366032 Ga0207659_103660322 313
47 3300025937 Ga0207669_10030218 Ga0207669_100302184 313
48 3300025940 Ga0207691_10020089 Ga0207691_100200892 313
49 3300026075 Ga0207708_10015584 Ga0207708_100155842 313
50 3300026078 Ga0207702_10300355 Ga0207702_103003552 313
51 3300026116 Ga0207674_10067184 Ga0207674_100671842 313
52 3300026116 Ga0207674_10187815 Ga0207674_101878152 313
53 3300026121 Ga0207683_10002913 Ga0207683_1000291314 313
54 3300031548 Ga0307408_100070914 Ga0307408_1000709142 313
55 3300031731 Ga0307405_10012768 Ga0307405_100127685 313
56 3300031824 Ga0307413_10001952 Ga0307413_100019528 313
57 3300031901 Ga0307406_10004403 Ga0307406_100044031 313
58 3300031903 Ga0307407_10013466 Ga0307407_100134664 313
59 3300031911 Ga0307412_10007438 Ga0307412_100074382 313
60 3300032004 Ga0307414_10227671 Ga0307414_102276712 313
61 3300032005 Ga0307411_10003851 Ga0307411_100038512 313
62 3300032126 Ga0307415_100005865 Ga0307415_1000058654 313
63 3300039437 Ga0436365_0120456 Ga0436365_0120456_451_1398 313
64 3300045836 Ga0466958_0000079 Ga0466958_0000079_13881_14822 313
65 3300046507 Ga0495606_0003584 Ga0495606_0003584_1309_2250 313
66 3300047472 Ga0495686_0000606 Ga0495686_0000606_30940_31893 313
67 3300048905 Ga0496102_0001685 Ga0496102_0001685_427_1374 313
68 3300048927 Ga0496124_0191576 Ga0496124_0191576_361_1302 313
69 3300050493 nmdc:mga0k408_23217_c1 nmdc:mga0k408_23217_c1_109_1062 313
70 3300053087 Ga0500643_063804 Ga0500643_063804_38_979 313
71 3300005577 Ga0068857_100030804 Ga0068857_1000308043 314
72 3300010375 Ga0105239_10123372 Ga0105239_101233722 314
73 3300021361 Ga0213872_10000001 Ga0213872_10000001217 314
74 3300021384 Ga0213876_10024910 Ga0213876_100249104 314
75 3300039437 Ga0436365_0072895 Ga0436365_0072895_16729_17676 314
76 3300039447 Ga0436361_0028664 Ga0436361_0028664_56357_57310 314
77 3300039453 Ga0436362_0992192 Ga0436362_0992192_816_1763 314
78 3300046460 Ga0495638_0008417 Ga0495638_0008417_3234_4190 314
79 3300048921 Ga0496118_0037082 Ga0496118_0037082_2851_3807 314
80 3300049571 Ga0501034_0218199 Ga0501034_0218199_382_1335 314
81 3300049823 Ga0501044_0289665 Ga0501044_0289665_163_1116 314
82 3300002075 JGI24738J21930_10002238 JGI24738J21930_100022384 315
83 3300005354 Ga0070675_100141421 Ga0070675_1001414212 315
84 3300005456 Ga0070678_100292960 Ga0070678_1002929601 315
85 3300005468 Ga0070707_100602851 Ga0070707_1006028511 315
86 3300005543 Ga0070672_100293793 Ga0070672_1002937931 315
87 3300005548 Ga0070665_100000011 Ga0070665_10000001195 315
88 3300005563 Ga0068855_100000265 Ga0068855_10000026526 315
89 3300005840 Ga0068870_10137642 Ga0068870_101376422 315
90 3300005841 Ga0068863_100078963 Ga0068863_1000789633 315
91 3300005841 Ga0068863_100132536 Ga0068863_1001325362 315
92 3300006237 Ga0097621_100110302 Ga0097621_1001103022 315
93 3300006358 Ga0068871_100182244 Ga0068871_1001822442 315
94 3300006358 Ga0068871_100184289 Ga0068871_1001842892 315
95 3300006871 Ga0075434_100092271 Ga0075434_1000922712 315
96 3300006881 Ga0068865_100008534 Ga0068865_1000085344 315
97 3300009148 Ga0105243_10173670 Ga0105243_101736702 315
98 3300009176 Ga0105242_10088017 Ga0105242_100880172 315
99 3300013306 Ga0163162_10065362 Ga0163162_100653622 315
100 3300013308 Ga0157375_10117196 Ga0157375_101171964 315
101 3300014325 Ga0163163_10275912 Ga0163163_102759122 315
102 3300014326 Ga0157380_10019019 Ga0157380_100190194 315
103 3300017792 Ga0163161_10238579 Ga0163161_102385792 315
104 3300021361 Ga0213872_10039685 Ga0213872_100396852 315
105 3300025937 Ga0207669_10134855 Ga0207669_101348552 315
106 3300025938 Ga0207704_10242318 Ga0207704_102423182 315
107 3300025940 Ga0207691_10044610 Ga0207691_100446105 315
108 3300025949 Ga0207667_10000029 Ga0207667_1000002939 315
109 3300025960 Ga0207651_10178410 Ga0207651_101784102 315
110 3300026078 Ga0207702_10210465 Ga0207702_102104652 315
111 3300026088 Ga0207641_10066100 Ga0207641_100661002 315
112 3300026118 Ga0207675_100152416 Ga0207675_1001524162 315
113 3300026121 Ga0207683_10353005 Ga0207683_103530051 315
114 3300028379 Ga0268266_10000063 Ga0268266_1000006392 315
115 3300039437 Ga0436365_1849126 Ga0436365_1849126_1577_2527 315
116 3300039447 Ga0436361_0081134 Ga0436361_0081134_99_1058 315
117 3300039447 Ga0436361_0200590 Ga0436361_0200590_394_1353 315
118 3300042876 Ga0451577_0000863 Ga0451577_0000863_38841_39800 315
119 3300046506 Ga0495583_0000840 Ga0495583_0000840_5658_6605 315
120 3300046660 Ga0495625_0073164 Ga0495625_0073164_178_1137 315
121 3300046691 Ga0495670_0089661 Ga0495670_0089661_495_1442 315
122 3300049580 Ga0501046_0000126 Ga0501046_0000126_44666_45631 315
123 3300049581 Ga0501047_0000160 Ga0501047_0000160_35704_36669 315
124 3300049582 Ga0501048_0000040 Ga0501048_0000040_17338_18303 315
125 3300049824 Ga0501045_0004944 Ga0501045_0004944_5591_6556 315
126 3300050511 nmdc:mga08y16_425018_c1 nmdc:mga08y16_425018_c1_116_1087 315
127 3300050512 nmdc:mga0n895_40845_c1 nmdc:mga0n895_40845_c1_2458_3405 315
128 3300053103 Ga0500555_000886 Ga0500555_000886_8790_9737 315
129 iso_pu_bacteria 2842718218 2842719397 315
130 iso_pu_bacteria 2904479285 2904482832 315
131 iso_pu_bacteria 2974320154 2974321326 315
132 3300001977 JGI24746J21847_1002925 JGI24746J21847_10029252 316
133 3300001991 JGI24743J22301_10008228 JGI24743J22301_100082282 316
134 3300002239 JGI24034J26672_10016529 JGI24034J26672_100165291 316
135 3300003203 JGI25406J46586_10019988 JGI25406J46586_100199882 316
136 3300003215 JGI25153J46596_10001063 JGI25153J46596_1000106318 316
137 3300003911 JGI25405J52794_10017961 JGI25405J52794_100179611 316
138 3300005289 Ga0065704_10113311 Ga0065704_101133112 316
139 3300005293 Ga0065715_10280549 Ga0065715_102805491 316
140 3300005295 Ga0065707_10133474 Ga0065707_101334742 316
141 3300005295 Ga0065707_10153752 Ga0065707_101537522 316
142 3300005328 Ga0070676_10154994 Ga0070676_101549942 316
143 3300005330 Ga0070690_100000216 Ga0070690_1000002166 316
144 3300005330 Ga0070690_100012374 Ga0070690_1000123744 316
145 3300005330 Ga0070690_100068462 Ga0070690_1000684622 316
146 3300005330 Ga0070690_100373498 Ga0070690_1003734981 316
147 3300005331 Ga0070670_100081469 Ga0070670_1000814693 316
148 3300005331 Ga0070670_100153016 Ga0070670_1001530162 316
149 3300005333 Ga0070677_10007082 Ga0070677_100070821 316
150 3300005334 Ga0068869_100000759 Ga0068869_1000007591 316
151 3300005334 Ga0068869_100242126 Ga0068869_1002421262 316
152 3300005335 Ga0070666_10010599 Ga0070666_100105992 316
153 3300005335 Ga0070666_10114932 Ga0070666_101149323 316
154 3300005336 Ga0070680_100003121 Ga0070680_1000031214 316
155 3300005336 Ga0070680_100006895 Ga0070680_1000068955 316
156 3300005336 Ga0070680_100008902 Ga0070680_1000089023 316
157 3300005337 Ga0070682_100004786 Ga0070682_10000478610 316
158 3300005338 Ga0068868_100004312 Ga0068868_1000043126 316
159 3300005338 Ga0068868_100005010 Ga0068868_1000050105 316
160 3300005339 Ga0070660_100138867 Ga0070660_1001388671 316
161 3300005340 Ga0070689_100000399 Ga0070689_10000039913 316
162 3300005340 Ga0070689_100006563 Ga0070689_1000065632 316
163 3300005340 Ga0070689_100053981 Ga0070689_1000539811 316
164 3300005340 Ga0070689_100148812 Ga0070689_1001488122 316
165 3300005341 Ga0070691_10000528 Ga0070691_100005289 316
166 3300005341 Ga0070691_10062583 Ga0070691_100625831 316
167 3300005343 Ga0070687_100000604 Ga0070687_1000006047 316
168 3300005345 Ga0070692_10002623 Ga0070692_100026231 316
169 3300005345 Ga0070692_10057329 Ga0070692_100573291 316
170 3300005353 Ga0070669_100085688 Ga0070669_1000856882 316
171 3300005354 Ga0070675_100076146 Ga0070675_1000761461 316
172 3300005355 Ga0070671_100019910 Ga0070671_1000199102 316
173 3300005355 Ga0070671_100023857 Ga0070671_1000238575 316
174 3300005355 Ga0070671_100054746 Ga0070671_1000547462 316
175 3300005356 Ga0070674_100000456 Ga0070674_10000045615 316
176 3300005356 Ga0070674_100159480 Ga0070674_1001594801 316
177 3300005364 Ga0070673_100026117 Ga0070673_1000261175 316
178 3300005364 Ga0070673_100066945 Ga0070673_1000669452 316
179 3300005364 Ga0070673_100145316 Ga0070673_1001453162 316
180 3300005365 Ga0070688_100022931 Ga0070688_1000229314 316
181 3300005435 Ga0070714_100007015 Ga0070714_1000070158 316
182 3300005435 Ga0070714_100021227 Ga0070714_1000212273 316
183 3300005435 Ga0070714_100186416 Ga0070714_1001864162 316
184 3300005435 Ga0070714_100346423 Ga0070714_1003464231 316
185 3300005436 Ga0070713_100005924 Ga0070713_1000059244 316
186 3300005436 Ga0070713_100043906 Ga0070713_1000439062 316
187 3300005436 Ga0070713_100321600 Ga0070713_1003216002 316
188 3300005437 Ga0070710_10005399 Ga0070710_100053993 316
189 3300005438 Ga0070701_10129194 Ga0070701_101291942 316
190 3300005439 Ga0070711_100010002 Ga0070711_1000100026 316
191 3300005439 Ga0070711_100023557 Ga0070711_1000235571 316
192 3300005439 Ga0070711_100034687 Ga0070711_1000346873 316
193 3300005439 Ga0070711_100164991 Ga0070711_1001649912 316
194 3300005439 Ga0070711_100495344 Ga0070711_1004953441 316
195 3300005440 Ga0070705_100000554 Ga0070705_10000055416 316
196 3300005440 Ga0070705_100072555 Ga0070705_1000725552 316
197 3300005440 Ga0070705_100149842 Ga0070705_1001498422 316
198 3300005440 Ga0070705_100292763 Ga0070705_1002927632 316
199 3300005441 Ga0070700_100000281 Ga0070700_10000028111 316
200 3300005441 Ga0070700_100044716 Ga0070700_1000447163 316
201 3300005444 Ga0070694_100000565 Ga0070694_1000005659 316
202 3300005444 Ga0070694_100070278 Ga0070694_1000702783 316
203 3300005456 Ga0070678_100035789 Ga0070678_1000357891 316
204 3300005458 Ga0070681_10001127 Ga0070681_1000112711 316
205 3300005458 Ga0070681_10118881 Ga0070681_101188812 316
206 3300005458 Ga0070681_10154948 Ga0070681_101549483 316
207 3300005458 Ga0070681_10320812 Ga0070681_103208122 316
208 3300005458 Ga0070681_10414014 Ga0070681_104140142 316
209 3300005459 Ga0068867_100000206 Ga0068867_1000002067 316
210 3300005459 Ga0068867_100103433 Ga0068867_1001034331 316
211 3300005466 Ga0070685_10005577 Ga0070685_100055777 316
212 3300005467 Ga0070706_100306244 Ga0070706_1003062441 316
213 3300005468 Ga0070707_100128303 Ga0070707_1001283032 316
214 3300005471 Ga0070698_100365274 Ga0070698_1003652742 316
215 3300005518 Ga0070699_100184203 Ga0070699_1001842032 316
216 3300005518 Ga0070699_100276236 Ga0070699_1002762361 316
217 3300005530 Ga0070679_100003183 Ga0070679_1000031832 316
218 3300005530 Ga0070679_100034844 Ga0070679_1000348446 316
219 3300005530 Ga0070679_100149712 Ga0070679_1001497122 316
220 3300005536 Ga0070697_100121192 Ga0070697_1001211922 316
221 3300005536 Ga0070697_100180798 Ga0070697_1001807982 316
222 3300005539 Ga0068853_100063354 Ga0068853_1000633543 316
223 3300005543 Ga0070672_100268961 Ga0070672_1002689611 316
224 3300005543 Ga0070672_100314723 Ga0070672_1003147232 316
225 3300005544 Ga0070686_100000711 Ga0070686_1000007119 316
226 3300005545 Ga0070695_100000281 Ga0070695_10000028111 316
227 3300005546 Ga0070696_100004140 Ga0070696_1000041407 316
228 3300005546 Ga0070696_100010174 Ga0070696_1000101747 316
229 3300005547 Ga0070693_100000162 Ga0070693_10000016219 316
230 3300005547 Ga0070693_100364173 Ga0070693_1003641731 316
231 3300005548 Ga0070665_100030114 Ga0070665_1000301145 316
232 3300005548 Ga0070665_100190176 Ga0070665_1001901762 316
233 3300005549 Ga0070704_100010913 Ga0070704_1000109133 316
234 3300005549 Ga0070704_100039001 Ga0070704_1000390012 316
235 3300005549 Ga0070704_100059317 Ga0070704_1000593173 316
236 3300005563 Ga0068855_100105928 Ga0068855_1001059284 316
237 3300005614 Ga0068856_100327474 Ga0068856_1003274742 316
238 3300005615 Ga0070702_100000093 Ga0070702_10000009319 316
239 3300005617 Ga0068859_100003739 Ga0068859_10000373912 316
240 3300005617 Ga0068859_100045750 Ga0068859_1000457504 316
241 3300005617 Ga0068859_100185952 Ga0068859_1001859522 316
242 3300005617 Ga0068859_100695399 Ga0068859_1006953991 316
243 3300005618 Ga0068864_100046863 Ga0068864_1000468634 316
244 3300005718 Ga0068866_10000256 Ga0068866_1000025614 316
245 3300005719 Ga0068861_100000355 Ga0068861_10000035510 316
246 3300005840 Ga0068870_10022034 Ga0068870_100220341 316
247 3300005841 Ga0068863_100089193 Ga0068863_1000891932 316
248 3300005842 Ga0068858_100008078 Ga0068858_1000080785 316
249 3300005842 Ga0068858_100025135 Ga0068858_1000251352 316
250 3300005843 Ga0068860_100002594 Ga0068860_10000259416 316
251 3300005843 Ga0068860_100048947 Ga0068860_1000489472 316
252 3300005843 Ga0068860_100245021 Ga0068860_1002450212 316
253 3300005843 Ga0068860_100274649 Ga0068860_1002746492 316
254 3300005844 Ga0068862_100000381 Ga0068862_10000038115 316
255 3300005844 Ga0068862_100134173 Ga0068862_1001341732 316
256 3300005937 Ga0081455_10071704 Ga0081455_100717042 316
257 3300005981 Ga0081538_10000697 Ga0081538_1000069718 316
258 3300005981 Ga0081538_10017125 Ga0081538_100171255 316
259 3300005983 Ga0081540_1001984 Ga0081540_10019847 316
260 3300005983 Ga0081540_1036127 Ga0081540_10361272 316
261 3300005983 Ga0081540_1050173 Ga0081540_10501732 316
262 3300005985 Ga0081539_10002187 Ga0081539_100021873 316
263 3300005985 Ga0081539_10036902 Ga0081539_100369022 316
264 3300006028 Ga0070717_10014290 Ga0070717_100142901 316
265 3300006048 Ga0075363_100013539 Ga0075363_1000135394 316
266 3300006051 Ga0075364_10005843 Ga0075364_100058432 316
267 3300006051 Ga0075364_10073975 Ga0075364_100739752 316
268 3300006163 Ga0070715_10000633 Ga0070715_100006333 316
269 3300006163 Ga0070715_10002046 Ga0070715_100020462 316
270 3300006163 Ga0070715_10027128 Ga0070715_100271282 316
271 3300006173 Ga0070716_100006982 Ga0070716_1000069823 316
272 3300006173 Ga0070716_100065105 Ga0070716_1000651052 316
273 3300006173 Ga0070716_100072447 Ga0070716_1000724472 316
274 3300006175 Ga0070712_100002594 Ga0070712_1000025948 316
275 3300006175 Ga0070712_100008343 Ga0070712_1000083434 316
276 3300006175 Ga0070712_100028995 Ga0070712_1000289953 316
277 3300006175 Ga0070712_100038140 Ga0070712_1000381403 316
278 3300006175 Ga0070712_100047227 Ga0070712_1000472272 316
279 3300006175 Ga0070712_100110880 Ga0070712_1001108801 316
280 3300006175 Ga0070712_100158867 Ga0070712_1001588672 316
281 3300006177 Ga0075362_10002160 Ga0075362_100021602 316
282 3300006177 Ga0075362_10040981 Ga0075362_100409812 316
283 3300006178 Ga0075367_10067123 Ga0075367_100671232 316
284 3300006178 Ga0075367_10118426 Ga0075367_101184261 316
285 3300006186 Ga0075369_10015935 Ga0075369_100159353 316
286 3300006195 Ga0075366_10000931 Ga0075366_100009312 316
287 3300006195 Ga0075366_10022054 Ga0075366_100220543 316
288 3300006237 Ga0097621_100000303 Ga0097621_10000030312 316
289 3300006237 Ga0097621_100343669 Ga0097621_1003436692 316
290 3300006237 Ga0097621_100405247 Ga0097621_1004052472 316
291 3300006358 Ga0068871_100000925 Ga0068871_10000092518 316
292 3300006358 Ga0068871_100046071 Ga0068871_1000460713 316
293 3300006844 Ga0075428_100000083 Ga0075428_10000008348 316
294 3300006844 Ga0075428_100113402 Ga0075428_1001134023 316
295 3300006844 Ga0075428_100284076 Ga0075428_1002840763 316
296 3300006846 Ga0075430_100000163 Ga0075430_10000016331 316
297 3300006846 Ga0075430_100055653 Ga0075430_1000556533 316
298 3300006847 Ga0075431_100087790 Ga0075431_1000877902 316
299 3300006852 Ga0075433_10003177 Ga0075433_100031775 316
300 3300006871 Ga0075434_100000064 Ga0075434_10000006429 316
301 3300006880 Ga0075429_100001065 Ga0075429_1000010657 316
302 3300006881 Ga0068865_100093321 Ga0068865_1000933211 316
303 3300006914 Ga0075436_100005135 Ga0075436_1000051359 316
304 3300006914 Ga0075436_100016682 Ga0075436_1000166823 316
305 3300006931 Ga0097620_100003738 Ga0097620_10000373812 316
306 3300006931 Ga0097620_100045750 Ga0097620_1000457504 316
307 3300006931 Ga0097620_100185959 Ga0097620_1001859592 316
308 3300006931 Ga0097620_100695358 Ga0097620_1006953581 316
309 3300006948 Ga0099826_10035411 Ga0099826_100354113 316
310 3300007076 Ga0075435_100000586 Ga0075435_10000058610 316
311 3300007076 Ga0075435_100302692 Ga0075435_1003026922 316
312 3300007788 Ga0099795_10029911 Ga0099795_100299112 316
313 3300007788 Ga0099795_10076325 Ga0099795_100763252 316
314 3300009098 Ga0105245_10000696 Ga0105245_100006967 316
315 3300009098 Ga0105245_10002702 Ga0105245_100027028 316
316 3300009098 Ga0105245_10011796 Ga0105245_100117965 316
317 3300009098 Ga0105245_10167384 Ga0105245_101673842 316
318 3300009101 Ga0105247_10019849 Ga0105247_100198494 316
319 3300009101 Ga0105247_10109570 Ga0105247_101095702 316
320 3300009147 Ga0114129_10000210 Ga0114129_100002104 316
321 3300009147 Ga0114129_10087181 Ga0114129_100871814 316
322 3300009148 Ga0105243_10000631 Ga0105243_1000063116 316
323 3300009148 Ga0105243_10153892 Ga0105243_101538922 316
324 3300009148 Ga0105243_10197316 Ga0105243_101973162 316
325 3300009176 Ga0105242_10003476 Ga0105242_1000347613 316
326 3300009176 Ga0105242_10020603 Ga0105242_100206032 316
327 3300009177 Ga0105248_10465993 Ga0105248_104659932 316
328 3300009545 Ga0105237_10024199 Ga0105237_100241996 316
329 3300009545 Ga0105237_10183495 Ga0105237_101834952 316
330 3300009545 Ga0105237_10456475 Ga0105237_104564752 316
331 3300009553 Ga0105249_10003937 Ga0105249_100039377 316
332 3300010159 Ga0099796_10000419 Ga0099796_100004195 316
333 3300010375 Ga0105239_10253032 Ga0105239_102530322 316
334 3300011119 Ga0105246_10229808 Ga0105246_102298082 316
335 3300011119 Ga0105246_10422784 Ga0105246_104227842 316
336 3300013104 Ga0157370_10010690 Ga0157370_1001069010 316
337 3300013105 Ga0157369_10002769 Ga0157369_1000276913 316
338 3300013105 Ga0157369_10213752 Ga0157369_102137522 316
339 3300013296 Ga0157374_10012098 Ga0157374_100120982 316
340 3300013297 Ga0157378_10001488 Ga0157378_100014883 316
341 3300013306 Ga0163162_10030087 Ga0163162_100300875 316
342 3300013306 Ga0163162_10342000 Ga0163162_103420002 316
343 3300013307 Ga0157372_10507890 Ga0157372_105078902 316
344 3300015262 Ga0182007_10071314 Ga0182007_100713141 316
345 3300017792 Ga0163161_10291552 Ga0163161_102915521 316
346 3300020080 Ga0206350_10617166 Ga0206350_106171662 316
347 3300020080 Ga0206350_11377320 Ga0206350_113773202 316
348 3300021361 Ga0213872_10009977 Ga0213872_100099775 316
349 3300021384 Ga0213876_10102662 Ga0213876_101026621 316
350 3300024227 Ga0228598_1002924 Ga0228598_10029242 316
351 3300025297 Ga0209758_1000079 Ga0209758_100007921 316
352 3300025885 Ga0207653_10008178 Ga0207653_100081781 316
353 3300025893 Ga0207682_10000543 Ga0207682_1000054314 316
354 3300025899 Ga0207642_10095412 Ga0207642_100954121 316
355 3300025900 Ga0207710_10013829 Ga0207710_100138291 316
356 3300025903 Ga0207680_10177686 Ga0207680_101776861 316
357 3300025904 Ga0207647_10057890 Ga0207647_100578902 316
358 3300025905 Ga0207685_10004756 Ga0207685_100047562 316
359 3300025905 Ga0207685_10021335 Ga0207685_100213352 316
360 3300025906 Ga0207699_10012944 Ga0207699_100129443 316
361 3300025906 Ga0207699_10029996 Ga0207699_100299962 316
362 3300025906 Ga0207699_10235555 Ga0207699_102355552 316
363 3300025907 Ga0207645_10025828 Ga0207645_100258282 316
364 3300025907 Ga0207645_10027950 Ga0207645_100279502 316
365 3300025908 Ga0207643_10001848 Ga0207643_1000184810 316
366 3300025910 Ga0207684_10011372 Ga0207684_100113726 316
367 3300025910 Ga0207684_10274560 Ga0207684_102745601 316
368 3300025912 Ga0207707_10006531 Ga0207707_100065317 316
369 3300025912 Ga0207707_10062009 Ga0207707_100620093 316
370 3300025912 Ga0207707_10116094 Ga0207707_101160943 316
371 3300025912 Ga0207707_10217828 Ga0207707_102178282 316
372 3300025915 Ga0207693_10000068 Ga0207693_1000006821 316
373 3300025915 Ga0207693_10000855 Ga0207693_1000085516 316
374 3300025915 Ga0207693_10007507 Ga0207693_100075072 316
375 3300025915 Ga0207693_10023422 Ga0207693_100234224 316
376 3300025915 Ga0207693_10101537 Ga0207693_101015372 316
377 3300025916 Ga0207663_10007458 Ga0207663_100074585 316
378 3300025917 Ga0207660_10003314 Ga0207660_100033147 316
379 3300025917 Ga0207660_10010746 Ga0207660_100107462 316
380 3300025918 Ga0207662_10000257 Ga0207662_1000025710 316
381 3300025918 Ga0207662_10009537 Ga0207662_100095372 316
382 3300025919 Ga0207657_10182571 Ga0207657_101825712 316
383 3300025921 Ga0207652_10054007 Ga0207652_100540072 316
384 3300025921 Ga0207652_10111925 Ga0207652_101119251 316
385 3300025921 Ga0207652_10112577 Ga0207652_101125773 316
386 3300025921 Ga0207652_10258852 Ga0207652_102588521 316
387 3300025922 Ga0207646_10108859 Ga0207646_101088592 316
388 3300025923 Ga0207681_10062274 Ga0207681_100622742 316
389 3300025925 Ga0207650_10068465 Ga0207650_100684653 316
390 3300025925 Ga0207650_10091002 Ga0207650_100910022 316
391 3300025926 Ga0207659_10142786 Ga0207659_101427863 316
392 3300025926 Ga0207659_10182438 Ga0207659_101824382 316
393 3300025926 Ga0207659_10365432 Ga0207659_103654322 316
394 3300025927 Ga0207687_10002535 Ga0207687_100025358 316
395 3300025927 Ga0207687_10279310 Ga0207687_102793102 316
396 3300025928 Ga0207700_10050072 Ga0207700_100500722 316
397 3300025928 Ga0207700_10127448 Ga0207700_101274481 316
398 3300025928 Ga0207700_10252912 Ga0207700_102529122 316
399 3300025928 Ga0207700_10315408 Ga0207700_103154082 316
400 3300025929 Ga0207664_10040999 Ga0207664_100409992 316
401 3300025929 Ga0207664_10201736 Ga0207664_102017362 316
402 3300025929 Ga0207664_10229820 Ga0207664_102298202 316
403 3300025931 Ga0207644_10016411 Ga0207644_100164114 316
404 3300025931 Ga0207644_10031985 Ga0207644_100319852 316
405 3300025931 Ga0207644_10276929 Ga0207644_102769292 316
406 3300025933 Ga0207706_10038152 Ga0207706_100381524 316
407 3300025933 Ga0207706_10121373 Ga0207706_101213732 316
408 3300025934 Ga0207686_10014985 Ga0207686_100149853 316
409 3300025935 Ga0207709_10000662 Ga0207709_1000066225 316
410 3300025935 Ga0207709_10145655 Ga0207709_101456551 316
411 3300025936 Ga0207670_10000333 Ga0207670_1000033317 316
412 3300025936 Ga0207670_10002665 Ga0207670_1000266512 316
413 3300025936 Ga0207670_10004310 Ga0207670_100043108 316
414 3300025936 Ga0207670_10020940 Ga0207670_100209401 316
415 3300025936 Ga0207670_10205270 Ga0207670_102052702 316
416 3300025937 Ga0207669_10210730 Ga0207669_102107301 316
417 3300025938 Ga0207704_10000798 Ga0207704_100007987 316
418 3300025938 Ga0207704_10010936 Ga0207704_100109365 316
419 3300025938 Ga0207704_10206684 Ga0207704_102066842 316
420 3300025939 Ga0207665_10003244 Ga0207665_100032445 316
421 3300025939 Ga0207665_10023145 Ga0207665_100231453 316
422 3300025939 Ga0207665_10037567 Ga0207665_100375673 316
423 3300025940 Ga0207691_10161849 Ga0207691_101618492 316
424 3300025941 Ga0207711_10014397 Ga0207711_100143977 316
425 3300025941 Ga0207711_10055281 Ga0207711_100552812 316
426 3300025941 Ga0207711_10062514 Ga0207711_100625143 316
427 3300025941 Ga0207711_10141067 Ga0207711_101410672 316
428 3300025942 Ga0207689_10001220 Ga0207689_1000122018 316
429 3300025942 Ga0207689_10014839 Ga0207689_100148393 316
430 3300025942 Ga0207689_10119685 Ga0207689_101196852 316
431 3300025942 Ga0207689_10128018 Ga0207689_101280182 316
432 3300025942 Ga0207689_10157051 Ga0207689_101570512 316
433 3300025945 Ga0207679_10207272 Ga0207679_102072722 316
434 3300025949 Ga0207667_10011463 Ga0207667_100114634 316
435 3300025949 Ga0207667_10012740 Ga0207667_100127408 316
436 3300025960 Ga0207651_10009279 Ga0207651_100092791 316
437 3300025961 Ga0207712_10048334 Ga0207712_100483341 316
438 3300025972 Ga0207668_10405555 Ga0207668_104055552 316
439 3300025981 Ga0207640_10004352 Ga0207640_100043522 316
440 3300026023 Ga0207677_10049518 Ga0207677_100495183 316
441 3300026067 Ga0207678_10002574 Ga0207678_100025743 316
442 3300026075 Ga0207708_10000993 Ga0207708_100009934 316
443 3300026075 Ga0207708_10008364 Ga0207708_100083642 316
444 3300026078 Ga0207702_10040209 Ga0207702_100402092 316
445 3300026078 Ga0207702_10176628 Ga0207702_101766282 316
446 3300026088 Ga0207641_10172491 Ga0207641_101724912 316
447 3300026089 Ga0207648_10000840 Ga0207648_1000084026 316
448 3300026089 Ga0207648_10001304 Ga0207648_1000130418 316
449 3300026089 Ga0207648_10051080 Ga0207648_100510803 316
450 3300026095 Ga0207676_10018327 Ga0207676_100183274 316
451 3300026095 Ga0207676_10441243 Ga0207676_104412431 316
452 3300026118 Ga0207675_100000900 Ga0207675_10000090018 316
453 3300026118 Ga0207675_100002492 Ga0207675_1000024927 316
454 3300026118 Ga0207675_100182211 Ga0207675_1001822112 316
455 3300026121 Ga0207683_10015669 Ga0207683_100156696 316
456 3300026121 Ga0207683_10242126 Ga0207683_102421262 316
457 3300026142 Ga0207698_10169618 Ga0207698_101696182 316
458 3300027360 Ga0209969_1002388 Ga0209969_10023882 316
459 3300027364 Ga0209967_1007468 Ga0209967_10074682 316
460 3300027512 Ga0209179_1014773 Ga0209179_10147732 316
461 3300027526 Ga0209968_1005378 Ga0209968_10053782 316
462 3300027543 Ga0209999_1000224 Ga0209999_10002245 316
463 3300027907 Ga0207428_10000321 Ga0207428_1000032150 316
464 3300027907 Ga0207428_10046915 Ga0207428_100469155 316
465 3300028023 Ga0265357_1005616 Ga0265357_10056161 316
466 3300028380 Ga0268265_10005803 Ga0268265_100058033 316
467 3300028380 Ga0268265_10241621 Ga0268265_102416212 316
468 3300028381 Ga0268264_10023040 Ga0268264_100230401 316
469 3300028381 Ga0268264_10169224 Ga0268264_101692241 316
470 3300028556 Ga0265337_1001602 Ga0265337_10016029 316
471 3300028573 Ga0265334_10000375 Ga0265334_1000037515 316
472 3300028800 Ga0265338_10017937 Ga0265338_100179377 316
473 3300031090 Ga0265760_10022541 Ga0265760_100225412 316
474 3300031235 Ga0265330_10025350 Ga0265330_100253502 316
475 3300031238 Ga0265332_10090049 Ga0265332_100900491 316
476 3300031240 Ga0265320_10064213 Ga0265320_100642132 316
477 3300031241 Ga0265325_10000649 Ga0265325_1000064920 316
478 3300031241 Ga0265325_10086558 Ga0265325_100865581 316
479 3300031241 Ga0265325_10093049 Ga0265325_100930492 316
480 3300031242 Ga0265329_10006400 Ga0265329_100064001 316
481 3300031247 Ga0265340_10058038 Ga0265340_100580382 316
482 3300031247 Ga0265340_10075674 Ga0265340_100756742 316
483 3300031247 Ga0265340_10114843 Ga0265340_101148431 316
484 3300031249 Ga0265339_10000269 Ga0265339_1000026938 316
485 3300031249 Ga0265339_10036335 Ga0265339_100363352 316
486 3300031595 Ga0265313_10022761 Ga0265313_100227611 316
487 3300031711 Ga0265314_10043616 Ga0265314_100436163 316
488 3300031712 Ga0265342_10043768 Ga0265342_100437682 316
489 3300034816 Ga0373930_0015062 Ga0373930_0015062_403_1359 316
490 3300035083 Ga0373926_0003071 Ga0373926_0003071_1776_2732 316
491 3300035083 Ga0373926_0016641 Ga0373926_0016641_1305_2261 316
492 3300035084 Ga0373928_0004469 Ga0373928_0004469_877_1833 316
493 3300035085 Ga0373929_0012853 Ga0373929_0012853_302_1258 316
494 3300035088 Ga0373940_0019433 Ga0373940_0019433_330_1286 316
495 3300035089 Ga0373944_0018964 Ga0373944_0018964_292_1248 316
496 3300035089 Ga0373944_0036368 Ga0373944_0036368_205_1161 316
497 3300035091 Ga0373951_0005912 Ga0373951_0005912_1416_2372 316
498 3300035092 Ga0373952_0003713 Ga0373952_0003713_1470_2426 316
499 3300035112 Ga0373932_0001983 Ga0373932_0001983_1745_2701 316
500 3300035113 Ga0373936_0006658 Ga0373936_0006658_269_1315 316
501 3300035113 Ga0373936_0029845 Ga0373936_0029845_600_1556 316
502 3300035116 Ga0373945_0000969 Ga0373945_0000969_3033_3989 316
503 3300035116 Ga0373945_0003484 Ga0373945_0003484_2308_3264 316
504 3300035116 Ga0373945_0006884 Ga0373945_0006884_167_1123 316
505 3300035117 Ga0373953_0020708 Ga0373953_0020708_266_1222 316
506 3300035118 Ga0373954_0032131 Ga0373954_0032131_715_1665 316
507 3300035118 Ga0373954_0056964 Ga0373954_0056964_761_1717 316
508 3300035118 Ga0373954_0125623 Ga0373954_0125623_17_967 316
509 3300035119 Ga0373956_0026912 Ga0373956_0026912_53_1009 316
510 3300035120 Ga0373957_0037722 Ga0373957_0037722_206_1156 316
511 3300035121 Ga0373960_0033881 Ga0373960_0033881_128_1084 316
512 3300035170 Ga0373943_0000185 Ga0373943_0000185_19460_20416 316
513 3300035170 Ga0373943_0014863 Ga0373943_0014863_1165_2115 316
514 3300035170 Ga0373943_0083775 Ga0373943_0083775_238_1194 316
515 3300035170 Ga0373943_0152461 Ga0373943_0152461_215_1171 316
516 3300035171 Ga0373946_0000642 Ga0373946_0000642_7866_8822 316
517 3300035171 Ga0373946_0174843 Ga0373946_0174843_24_980 316
518 3300035172 Ga0373955_0001304 Ga0373955_0001304_1124_2080 316
519 3300035172 Ga0373955_0002912 Ga0373955_0002912_3905_4861 316
520 3300035172 Ga0373955_0003944 Ga0373955_0003944_4959_5924 316
521 3300035172 Ga0373955_0068444 Ga0373955_0068444_267_1223 316
522 3300035241 Ga0373961_0006705 Ga0373961_0006705_117_1073 316
523 3300035242 Ga0373962_0012148 Ga0373962_0012148_101_1057 316
524 3300035242 Ga0373962_0019134 Ga0373962_0019134_606_1562 316
525 3300035410 Ga0373924_0008512 Ga0373924_0008512_717_1682 316
526 3300035410 Ga0373924_0020013 Ga0373924_0020013_718_1674 316
527 3300035691 Ga0373931_0000134 Ga0373931_0000134_19338_20294 316
528 3300035691 Ga0373931_0054056 Ga0373931_0054056_775_1731 316
529 3300035691 Ga0373931_0140963 Ga0373931_0140963_214_1170 316
530 3300035691 Ga0373931_0179923 Ga0373931_0179923_126_1082 316
531 3300035692 Ga0373935_0000023 Ga0373935_0000023_38360_39325 316
532 3300035692 Ga0373935_0010837 Ga0373935_0010837_3040_3996 316
533 3300035692 Ga0373935_0039428 Ga0373935_0039428_76_1032 316
534 3300035692 Ga0373935_0124974 Ga0373935_0124974_250_1296 316
535 3300035692 Ga0373935_0163631 Ga0373935_0163631_115_1074 316
536 3300035692 Ga0373935_0176776 Ga0373935_0176776_496_1452 316
537 3300035695 Ga0373927_0000434 Ga0373927_0000434_23242_24198 316
538 3300035695 Ga0373927_0013020 Ga0373927_0013020_2543_3499 316
539 3300035695 Ga0373927_0020220 Ga0373927_0020220_1617_2582 316
540 3300035695 Ga0373927_0041756 Ga0373927_0041756_1059_2015 316
541 3300035695 Ga0373927_0051817 Ga0373927_0051817_129_1079 316
542 3300035695 Ga0373927_0070058 Ga0373927_0070058_82_1038 316
543 3300035695 Ga0373927_0072642 Ga0373927_0072642_190_1146 316
544 3300035724 Ga0373933_0001503 Ga0373933_0001503_8689_9645 316
545 3300035724 Ga0373933_0006249 Ga0373933_0006249_4989_5945 316
546 3300035724 Ga0373933_0011490 Ga0373933_0011490_1936_2901 316
547 3300035725 Ga0373947_0000583 Ga0373947_0000583_7853_8809 316
548 3300035725 Ga0373947_0017670 Ga0373947_0017670_33_989 316
549 3300035725 Ga0373947_0070482 Ga0373947_0070482_1153_2109 316
550 3300035725 Ga0373947_0208520 Ga0373947_0208520_45_1001 316
551 3300035725 Ga0373947_0213124 Ga0373947_0213124_235_1245 316
552 3300036401 Ga0373937_0000005 Ga0373937_0000005_148914_149879 316
553 3300036401 Ga0373937_0003414 Ga0373937_0003414_10776_11726 316
554 3300036401 Ga0373937_0009993 Ga0373937_0009993_3784_4740 316
555 3300036401 Ga0373937_0010352 Ga0373937_0010352_2312_3268 316
556 3300036401 Ga0373937_0091795 Ga0373937_0091795_10_960 316
557 3300037068 Ga0373925_0000007 Ga0373925_0000007_50314_51279 316
558 3300037068 Ga0373925_0000749 Ga0373925_0000749_1676_2632 316
559 3300037068 Ga0373925_0030549 Ga0373925_0030549_900_1850 316
560 3300037068 Ga0373925_0104188 Ga0373925_0104188_482_1492 316
561 3300037068 Ga0373925_0107062 Ga0373925_0107062_54_1010 316
562 3300037068 Ga0373925_0132701 Ga0373925_0132701_51_1007 316
563 3300037068 Ga0373925_0330088 Ga0373925_0330088_80_1036 316
564 3300037466 Ga0395898_0152595 Ga0395898_0152595_575_1528 316
565 3300037466 Ga0395898_0182889 Ga0395898_0182889_757_1713 316
566 3300037853 Ga0436364_1488218 Ga0436364_1488218_630_1586 316
567 3300039437 Ga0436365_0053879 Ga0436365_0053879_87_1043 316
568 3300039437 Ga0436365_0395269 Ga0436365_0395269_170_1126 316
569 3300039437 Ga0436365_1548351 Ga0436365_1548351_143_1099 316
570 3300039437 Ga0436365_1582443 Ga0436365_1582443_685_1635 316
571 3300039438 Ga0436360_0793447 Ga0436360_0793447_203_1153 316
572 3300039438 Ga0436360_1115848 Ga0436360_1115848_883_1839 316
573 3300039450 Ga0436363_0460787 Ga0436363_0460787_610_1566 316
574 3300039450 Ga0436363_1144933 Ga0436363_1144933_592_1548 316
575 3300039453 Ga0436362_0233360 Ga0436362_0233360_28_981 316
576 3300039453 Ga0436362_0742152 Ga0436362_0742152_46_1002 316
577 3300039453 Ga0436362_1187034 Ga0436362_1187034_93_1055 316
578 3300042435 Ga0439434_0000107 Ga0439434_0000107_19204_20160 316
579 3300042435 Ga0439434_0027711 Ga0439434_0027711_533_1489 316
580 3300042436 Ga0439435_0000076 Ga0439435_0000076_4939_5895 316
581 3300042876 Ga0451577_0100523 Ga0451577_0100523_799_1755 316
582 3300044694 Ga0466963_0016237 Ga0466963_0016237_1510_2466 316
583 3300044842 Ga0466957_0067767 Ga0466957_0067767_833_1789 316
584 3300045049 Ga0466959_0064196 Ga0466959_0064196_301_1257 316
585 3300045051 Ga0451576_0001387 Ga0451576_0001387_14166_15122 316
586 3300046453 Ga0495627_051507 Ga0495627_051507_95_1051 316
587 3300046454 Ga0495592_0007203 Ga0495592_0007203_4865_5830 316
588 3300046454 Ga0495592_0021131 Ga0495592_0021131_2245_3201 316
589 3300046454 Ga0495592_0034241 Ga0495592_0034241_2503_3459 316
590 3300046454 Ga0495592_0038795 Ga0495592_0038795_1170_2126 316
591 3300046454 Ga0495592_0072080 Ga0495592_0072080_453_1409 316
592 3300046454 Ga0495592_0231287 Ga0495592_0231287_56_1012 316
593 3300046455 Ga0495603_0025282 Ga0495603_0025282_2266_3222 316
594 3300046455 Ga0495603_0237504 Ga0495603_0237504_58_1014 316
595 3300046459 Ga0495629_0012162 Ga0495629_0012162_1871_2827 316
596 3300046459 Ga0495629_0017119 Ga0495629_0017119_3970_4935 316
597 3300046459 Ga0495629_0153118 Ga0495629_0153118_484_1440 316
598 3300046460 Ga0495638_0040866 Ga0495638_0040866_618_1574 316
599 3300046461 Ga0495641_0020520 Ga0495641_0020520_2262_3218 316
600 3300046462 Ga0495651_0001105 Ga0495651_0001105_4198_5154 316
601 3300046462 Ga0495651_0007669 Ga0495651_0007669_2426_3391 316
602 3300046462 Ga0495651_0050378 Ga0495651_0050378_1689_2645 316
603 3300046463 Ga0495653_0000308 Ga0495653_0000308_33795_34760 316
604 3300046463 Ga0495653_0001999 Ga0495653_0001999_3238_4194 316
605 3300046472 Ga0495580_0001449 Ga0495580_0001449_13996_14946 316
606 3300046472 Ga0495580_0058208 Ga0495580_0058208_486_1442 316
607 3300046472 Ga0495580_0110115 Ga0495580_0110115_787_1746 316
608 3300046472 Ga0495580_0139388 Ga0495580_0139388_633_1589 316
609 3300046472 Ga0495580_0189984 Ga0495580_0189984_433_1389 316
610 3300046475 Ga0495639_0013308 Ga0495639_0013308_152_1108 316
611 3300046476 Ga0495662_0008076 Ga0495662_0008076_1180_2226 316
612 3300046476 Ga0495662_0010733 Ga0495662_0010733_271_1227 316
613 3300046476 Ga0495662_0054256 Ga0495662_0054256_17_973 316
614 3300046477 Ga0495664_0000003 Ga0495664_0000003_508282_509247 316
615 3300046477 Ga0495664_0001762 Ga0495664_0001762_1726_2772 316
616 3300046491 Ga0495584_0164884 Ga0495584_0164884_160_1116 316
617 3300046511 Ga0495608_0000072 Ga0495608_0000072_33678_34643 316
618 3300046511 Ga0495608_0001418 Ga0495608_0001418_7679_8635 316
619 3300046514 Ga0495618_0000019 Ga0495618_0000019_73449_74414 316
620 3300046514 Ga0495618_0003872 Ga0495618_0003872_600_1556 316
621 3300046514 Ga0495618_0017589 Ga0495618_0017589_3091_4047 316
622 3300046516 Ga0495628_0000015 Ga0495628_0000015_4962_5927 316
623 3300046516 Ga0495628_0104293 Ga0495628_0104293_754_1710 316
624 3300046516 Ga0495628_0198013 Ga0495628_0198013_35_991 316
625 3300046517 Ga0495630_0027301 Ga0495630_0027301_732_1697 316
626 3300046517 Ga0495630_0029121 Ga0495630_0029121_82_1038 316
627 3300046517 Ga0495630_0142109 Ga0495630_0142109_107_1117 316
628 3300046525 Ga0495663_0017948 Ga0495663_0017948_283_1239 316
629 3300046526 Ga0495666_0040519 Ga0495666_0040519_154_1110 316
630 3300046526 Ga0495666_0110666 Ga0495666_0110666_41_997 316
631 3300046529 Ga0495652_0000006 Ga0495652_0000006_265755_266720 316
632 3300046529 Ga0495652_0024988 Ga0495652_0024988_2537_3493 316
633 3300046531 Ga0495665_0013808 Ga0495665_0013808_2913_3869 316
634 3300046531 Ga0495665_0039593 Ga0495665_0039593_428_1384 316
635 3300046533 Ga0495640_0000002 Ga0495640_0000002_452496_453461 316
636 3300046533 Ga0495640_0007626 Ga0495640_0007626_177_1136 316
637 3300046533 Ga0495640_0007854 Ga0495640_0007854_5701_6747 316
638 3300046533 Ga0495640_0036736 Ga0495640_0036736_17_973 316
639 3300046533 Ga0495640_0063367 Ga0495640_0063367_272_1231 316
640 3300046533 Ga0495640_0232222 Ga0495640_0232222_21_977 316
641 3300046535 Ga0495586_0001019 Ga0495586_0001019_1716_2672 316
642 3300046536 Ga0495587_0000001 Ga0495587_0000001_524952_525917 316
643 3300046536 Ga0495587_0000718 Ga0495587_0000718_12787_13743 316
644 3300046536 Ga0495587_0211790 Ga0495587_0211790_92_1048 316
645 3300046537 Ga0495598_0029042 Ga0495598_0029042_529_1485 316
646 3300046539 Ga0495621_0053406 Ga0495621_0053406_205_1161 316
647 3300046543 Ga0495645_0002525 Ga0495645_0002525_4905_5870 316
648 3300046543 Ga0495645_0010377 Ga0495645_0010377_348_1358 316
649 3300046543 Ga0495645_0061883 Ga0495645_0061883_1065_2021 316
650 3300046559 Ga0495667_0000021 Ga0495667_0000021_129429_130394 316
651 3300046559 Ga0495667_0015887 Ga0495667_0015887_1556_2512 316
652 3300046559 Ga0495667_0047937 Ga0495667_0047937_561_1517 316
653 3300046559 Ga0495667_0069839 Ga0495667_0069839_154_1110 316
654 3300046559 Ga0495667_0247884 Ga0495667_0247884_130_1086 316
655 3300046615 Ga0495656_0011244 Ga0495656_0011244_1325_2281 316
656 3300046615 Ga0495656_0122948 Ga0495656_0122948_55_1011 316
657 3300046616 Ga0495668_0188938 Ga0495668_0188938_137_1093 316
658 3300046642 Ga0495634_0000251 Ga0495634_0000251_44883_45848 316
659 3300046642 Ga0495634_0004679 Ga0495634_0004679_7795_8751 316
660 3300046642 Ga0495634_0005356 Ga0495634_0005356_7126_8082 316
661 3300046642 Ga0495634_0008363 Ga0495634_0008363_6486_7532 316
662 3300046642 Ga0495634_0031218 Ga0495634_0031218_1368_2327 316
663 3300046642 Ga0495634_0147046 Ga0495634_0147046_272_1228 316
664 3300046663 Ga0495635_0000001 Ga0495635_0000001_510763_511728 316
665 3300046663 Ga0495635_0013586 Ga0495635_0013586_2128_3084 316
666 3300046674 Ga0495588_0014197 Ga0495588_0014197_1944_2900 316
667 3300046675 Ga0495657_0000486 Ga0495657_0000486_7654_8619 316
668 3300046675 Ga0495657_0004121 Ga0495657_0004121_7222_8178 316
669 3300046675 Ga0495657_0094272 Ga0495657_0094272_700_1656 316
670 3300046678 Ga0495599_0000203 Ga0495599_0000203_4882_5847 316
671 3300046678 Ga0495599_0061678 Ga0495599_0061678_336_1292 316
672 3300046678 Ga0495599_0121767 Ga0495599_0121767_446_1402 316
673 3300046679 Ga0495623_0000058 Ga0495623_0000058_14552_15517 316
674 3300046679 Ga0495623_0014685 Ga0495623_0014685_2388_3344 316
675 3300046679 Ga0495623_0040238 Ga0495623_0040238_993_1943 316
676 3300046680 Ga0495646_0000003 Ga0495646_0000003_88751_89716 316
677 3300046680 Ga0495646_0118020 Ga0495646_0118020_471_1427 316
678 3300046681 Ga0495647_0002041 Ga0495647_0002041_5067_6023 316
679 3300046681 Ga0495647_0019408 Ga0495647_0019408_911_1867 316
680 3300046681 Ga0495647_0061291 Ga0495647_0061291_428_1384 316
681 3300046681 Ga0495647_0063946 Ga0495647_0063946_196_1146 316
682 3300046683 Ga0495658_0006634 Ga0495658_0006634_3679_4635 316
683 3300046683 Ga0495658_0021666 Ga0495658_0021666_1591_2547 316
684 3300046689 Ga0495613_0032385 Ga0495613_0032385_2328_3284 316
685 3300046689 Ga0495613_0044368 Ga0495613_0044368_753_1709 316
686 3300046689 Ga0495613_0270040 Ga0495613_0270040_183_1139 316
687 3300046690 Ga0495624_0019722 Ga0495624_0019722_2116_3081 316
688 3300046690 Ga0495624_0043998 Ga0495624_0043998_889_1845 316
689 3300046690 Ga0495624_0066538 Ga0495624_0066538_695_1651 316
690 3300046690 Ga0495624_0110338 Ga0495624_0110338_372_1331 316
691 3300046690 Ga0495624_0226103 Ga0495624_0226103_127_1083 316
692 3300046691 Ga0495670_0078096 Ga0495670_0078096_289_1245 316
693 3300046809 Ga0495600_0000002 Ga0495600_0000002_180746_181711 316
694 3300046809 Ga0495600_0006243 Ga0495600_0006243_5528_6484 316
695 3300046809 Ga0495600_0071440 Ga0495600_0071440_1096_2052 316
696 3300047315 Ga0495581_0018810 Ga0495581_0018810_631_1596 316
697 3300047317 Ga0495604_0000001 Ga0495604_0000001_702802_703767 316
698 3300047317 Ga0495604_0003884 Ga0495604_0003884_8404_9360 316
699 3300047317 Ga0495604_0173303 Ga0495604_0173303_144_1094 316
700 3300047319 Ga0495674_0000018 Ga0495674_0000018_198182_199147 316
701 3300047319 Ga0495674_0001596 Ga0495674_0001596_17227_18183 316
702 3300047319 Ga0495674_0006703 Ga0495674_0006703_8347_9393 316
703 3300047319 Ga0495674_0069384 Ga0495674_0069384_1846_2802 316
704 3300047320 Ga0495672_0033481 Ga0495672_0033481_201_1157 316
705 3300047320 Ga0495672_0041858 Ga0495672_0041858_329_1285 316
706 3300047321 Ga0495676_0004556 Ga0495676_0004556_6185_7141 316
707 3300047321 Ga0495676_0048763 Ga0495676_0048763_325_1281 316
708 3300047321 Ga0495676_0069526 Ga0495676_0069526_1077_2033 316
709 3300047322 Ga0495680_0001109 Ga0495680_0001109_12775_13731 316
710 3300047322 Ga0495680_0010419 Ga0495680_0010419_4875_5840 316
711 3300047323 Ga0495683_0137760 Ga0495683_0137760_47_1003 316
712 3300047444 Ga0495675_0003039 Ga0495675_0003039_2764_3720 316
713 3300047444 Ga0495675_0004157 Ga0495675_0004157_5058_6023 316
714 3300047444 Ga0495675_0075237 Ga0495675_0075237_400_1356 316
715 3300047446 Ga0495679_040933 Ga0495679_040933_323_1279 316
716 3300047447 Ga0495685_049860 Ga0495685_049860_17_973 316
717 3300047471 Ga0495684_0000010 Ga0495684_0000010_193078_194043 316
718 3300047471 Ga0495684_0007596 Ga0495684_0007596_1770_2816 316
719 3300047471 Ga0495684_0011645 Ga0495684_0011645_351_1307 316
720 3300047471 Ga0495684_0027615 Ga0495684_0027615_1070_2026 316
721 3300047471 Ga0495684_0048735 Ga0495684_0048735_511_1467 316
722 3300047673 Ga0495593_0007996 Ga0495593_0007996_3941_4906 316
723 3300047673 Ga0495593_0048567 Ga0495593_0048567_525_1481 316
724 3300047673 Ga0495593_0121493 Ga0495593_0121493_74_1030 316
725 3300048088 Ga0495602_0013088 Ga0495602_0013088_4882_5847 316
726 3300048088 Ga0495602_0049699 Ga0495602_0049699_1567_2517 316
727 3300048088 Ga0495602_0284528 Ga0495602_0284528_221_1177 316
728 3300048903 Ga0496100_0005463 Ga0496100_0005463_3088_4044 316
729 3300048903 Ga0496100_0023107 Ga0496100_0023107_854_1810 316
730 3300048903 Ga0496100_0098803 Ga0496100_0098803_620_1576 316
731 3300048904 Ga0496101_0001025 Ga0496101_0001025_7044_8000 316
732 3300048904 Ga0496101_0008677 Ga0496101_0008677_2334_3290 316
733 3300048904 Ga0496101_0020913 Ga0496101_0020913_149_1099 316
734 3300048904 Ga0496101_0227973 Ga0496101_0227973_64_1020 316
735 3300048905 Ga0496102_0010694 Ga0496102_0010694_4041_4997 316
736 3300048905 Ga0496102_0041079 Ga0496102_0041079_2491_3447 316
737 3300048905 Ga0496102_0087737 Ga0496102_0087737_1745_2701 316
738 3300048905 Ga0496102_0151094 Ga0496102_0151094_169_1125 316
739 3300048906 Ga0496103_0045036 Ga0496103_0045036_1229_2185 316
740 3300048907 Ga0496104_0003048 Ga0496104_0003048_6642_7598 316
741 3300048907 Ga0496104_0012586 Ga0496104_0012586_2300_3256 316
742 3300048907 Ga0496104_0020110 Ga0496104_0020110_2070_3026 316
743 3300048907 Ga0496104_0125825 Ga0496104_0125825_838_1794 316
744 3300048907 Ga0496104_0235547 Ga0496104_0235547_511_1467 316
745 3300048907 Ga0496104_0427971 Ga0496104_0427971_240_1190 316
746 3300048908 Ga0496105_0005567 Ga0496105_0005567_1178_2134 316
747 3300048908 Ga0496105_0005922 Ga0496105_0005922_6840_7796 316
748 3300048908 Ga0496105_0011176 Ga0496105_0011176_1533_2489 316
749 3300048908 Ga0496105_0060568 Ga0496105_0060568_789_1745 316
750 3300048908 Ga0496105_0092139 Ga0496105_0092139_273_1229 316
751 3300048908 Ga0496105_0129449 Ga0496105_0129449_801_1751 316
752 3300048908 Ga0496105_0136590 Ga0496105_0136590_455_1411 316
753 3300048909 Ga0496106_0010565 Ga0496106_0010565_3861_4811 316
754 3300048909 Ga0496106_0023192 Ga0496106_0023192_551_1507 316
755 3300048909 Ga0496106_0051071 Ga0496106_0051071_57_1013 316
756 3300048909 Ga0496106_0177004 Ga0496106_0177004_129_1085 316
757 3300048909 Ga0496106_0286611 Ga0496106_0286611_67_1023 316
758 3300048910 Ga0496107_0007469 Ga0496107_0007469_3495_4451 316
759 3300048910 Ga0496107_0015009 Ga0496107_0015009_3547_4497 316
760 3300048911 Ga0496108_0002364 Ga0496108_0002364_11289_12245 316
761 3300048911 Ga0496108_0029304 Ga0496108_0029304_907_1863 316
762 3300048911 Ga0496108_0050992 Ga0496108_0050992_2031_2987 316
763 3300048911 Ga0496108_0079831 Ga0496108_0079831_1331_2287 316
764 3300048911 Ga0496108_0169416 Ga0496108_0169416_579_1535 316
765 3300048912 Ga0496109_0001638 Ga0496109_0001638_670_1626 316
766 3300048912 Ga0496109_0002461 Ga0496109_0002461_3074_4030 316
767 3300048912 Ga0496109_0029136 Ga0496109_0029136_3216_4166 316
768 3300048912 Ga0496109_0051551 Ga0496109_0051551_1678_2634 316
769 3300048912 Ga0496109_0105357 Ga0496109_0105357_1610_2566 316
770 3300048912 Ga0496109_0373964 Ga0496109_0373964_148_1104 316
771 3300048913 Ga0496110_0003528 Ga0496110_0003528_2757_3713 316
772 3300048913 Ga0496110_0011641 Ga0496110_0011641_6144_7100 316
773 3300048913 Ga0496110_0037760 Ga0496110_0037760_3028_3987 316
774 3300048913 Ga0496110_0144854 Ga0496110_0144854_682_1638 316
775 3300048913 Ga0496110_0179453 Ga0496110_0179453_302_1258 316
776 3300048914 Ga0496111_0003518 Ga0496111_0003518_3032_3988 316
777 3300048914 Ga0496111_0005819 Ga0496111_0005819_1236_2192 316
778 3300048914 Ga0496111_0017449 Ga0496111_0017449_3132_4088 316
779 3300048914 Ga0496111_0018422 Ga0496111_0018422_1961_2920 316
780 3300048914 Ga0496111_0027735 Ga0496111_0027735_814_1770 316
781 3300048914 Ga0496111_0147169 Ga0496111_0147169_280_1236 316
782 3300048914 Ga0496111_0265230 Ga0496111_0265230_225_1181 316
783 3300048915 Ga0496112_0037915 Ga0496112_0037915_2458_3414 316
784 3300048915 Ga0496112_0039123 Ga0496112_0039123_2544_3500 316
785 3300048915 Ga0496112_0067536 Ga0496112_0067536_363_1313 316
786 3300048915 Ga0496112_0122371 Ga0496112_0122371_570_1526 316
787 3300048915 Ga0496112_0135215 Ga0496112_0135215_1103_2059 316
788 3300048915 Ga0496112_0154557 Ga0496112_0154557_76_1032 316
789 3300048915 Ga0496112_0157700 Ga0496112_0157700_196_1152 316
790 3300048915 Ga0496112_0355360 Ga0496112_0355360_266_1222 316
791 3300048915 Ga0496112_0366697 Ga0496112_0366697_36_986 316
792 3300048916 Ga0496113_0000175 Ga0496113_0000175_18868_19824 316
793 3300048916 Ga0496113_0001647 Ga0496113_0001647_8862_9818 316
794 3300048916 Ga0496113_0030542 Ga0496113_0030542_2827_3783 316
795 3300048916 Ga0496113_0030825 Ga0496113_0030825_1581_2531 316
796 3300048916 Ga0496113_0337568 Ga0496113_0337568_135_1091 316
797 3300048917 Ga0496114_0027134 Ga0496114_0027134_2668_3624 316
798 3300048917 Ga0496114_0057372 Ga0496114_0057372_1069_2025 316
799 3300048917 Ga0496114_0085526 Ga0496114_0085526_463_1419 316
800 3300048918 Ga0496115_0023215 Ga0496115_0023215_1997_2953 316
801 3300048918 Ga0496115_0235455 Ga0496115_0235455_34_984 316
802 3300048929 Ga0496126_0039717 Ga0496126_0039717_3283_4239 316
803 3300049568 Ga0501031_0001402 Ga0501031_0001402_10109_11065 316
804 3300049570 Ga0501033_0017562 Ga0501033_0017562_3482_4438 316
805 3300049572 Ga0501036_0009279 Ga0501036_0009279_2862_3818 316
806 3300049572 Ga0501036_0022892 Ga0501036_0022892_2030_2986 316
807 3300049574 Ga0501038_0030524 Ga0501038_0030524_1647_2603 316
808 3300049574 Ga0501038_0142363 Ga0501038_0142363_981_1937 316
809 3300049575 Ga0501039_0001656 Ga0501039_0001656_1670_2626 316
810 3300049575 Ga0501039_0019439 Ga0501039_0019439_2096_3052 316
811 3300049576 Ga0501040_0055715 Ga0501040_0055715_329_1285 316
812 3300049577 Ga0501041_0000600 Ga0501041_0000600_7177_8133 316
813 3300049577 Ga0501041_0009888 Ga0501041_0009888_2111_3067 316
814 3300049577 Ga0501041_0047078 Ga0501041_0047078_1478_2434 316
815 3300049578 Ga0501042_0004577 Ga0501042_0004577_1984_2940 316
816 3300049578 Ga0501042_0044082 Ga0501042_0044082_1803_2759 316
817 3300049579 Ga0501043_0027712 Ga0501043_0027712_3147_4103 316
818 3300049579 Ga0501043_0041339 Ga0501043_0041339_259_1215 316
819 3300049580 Ga0501046_0001057 Ga0501046_0001057_16115_17071 316
820 3300049580 Ga0501046_0363357 Ga0501046_0363357_31_987 316
821 3300049581 Ga0501047_0332725 Ga0501047_0332725_139_1095 316
822 3300049582 Ga0501048_0011924 Ga0501048_0011924_3940_4896 316
823 3300049582 Ga0501048_0028075 Ga0501048_0028075_1252_2208 316
824 3300049582 Ga0501048_0184491 Ga0501048_0184491_187_1143 316
825 3300049585 Ga0501069_0012334 Ga0501069_0012334_2171_3127 316
826 3300049586 Ga0501070_0104679 Ga0501070_0104679_1094_2050 316
827 3300049586 Ga0501070_0242388 Ga0501070_0242388_66_1022 316
828 3300049587 Ga0501071_0044976 Ga0501071_0044976_1028_1984 316
829 3300049587 Ga0501071_0051424 Ga0501071_0051424_298_1257 316
830 3300049587 Ga0501071_0344170 Ga0501071_0344170_153_1109 316
831 3300049588 Ga0501072_0001862 Ga0501072_0001862_3580_4536 316
832 3300049588 Ga0501072_0016678 Ga0501072_0016678_1789_2745 316
833 3300049588 Ga0501072_0025063 Ga0501072_0025063_2228_3187 316
834 3300049588 Ga0501072_0280682 Ga0501072_0280682_193_1149 316
835 3300049589 Ga0501073_0111896 Ga0501073_0111896_626_1576 316
836 3300049590 Ga0501074_0013084 Ga0501074_0013084_3541_4497 316
837 3300049590 Ga0501074_0025976 Ga0501074_0025976_1280_2236 316
838 3300049591 Ga0501075_0003996 Ga0501075_0003996_861_1817 316
839 3300049591 Ga0501075_0069220 Ga0501075_0069220_1377_2333 316
840 3300049592 Ga0501076_0000348 Ga0501076_0000348_7755_8711 316
841 3300049592 Ga0501076_0018281 Ga0501076_0018281_421_1377 316
842 3300049592 Ga0501076_0031097 Ga0501076_0031097_352_1308 316
843 3300049592 Ga0501076_0152057 Ga0501076_0152057_874_1830 316
844 3300049741 Ga0501079_0000859 Ga0501079_0000859_9951_10907 316
845 3300049741 Ga0501079_0125204 Ga0501079_0125204_621_1577 316
846 3300049742 Ga0501080_0066965 Ga0501080_0066965_102_1118 316
847 3300049743 Ga0501081_0000131 Ga0501081_0000131_23655_24611 316
848 3300049743 Ga0501081_0018251 Ga0501081_0018251_265_1224 316
849 3300049743 Ga0501081_0089723 Ga0501081_0089723_330_1286 316
850 3300049744 Ga0501083_0062007 Ga0501083_0062007_670_1686 316
851 3300049822 Ga0501035_0379950 Ga0501035_0379950_97_1053 316
852 3300049823 Ga0501044_0000743 Ga0501044_0000743_26851_27807 316
853 3300049823 Ga0501044_0139155 Ga0501044_0139155_726_1682 316
854 3300049824 Ga0501045_0014083 Ga0501045_0014083_1216_2172 316
855 3300049824 Ga0501045_0018427 Ga0501045_0018427_3160_4116 316
856 3300049824 Ga0501045_0083981 Ga0501045_0083981_331_1290 316
857 3300050489 nmdc:mga03683_20525_c1 nmdc:mga03683_20525_c1_327_1283 316
858 3300050491 nmdc:mga00v17_107895_c1 nmdc:mga00v17_107895_c1_626_1582 316
859 3300050491 nmdc:mga00v17_188780_c1 nmdc:mga00v17_188780_c1_343_1299 316
860 3300050493 nmdc:mga0k408_12633_c1 nmdc:mga0k408_12633_c1_1927_2883 316
861 3300050493 nmdc:mga0k408_2138_c1 nmdc:mga0k408_2138_c1_406_1362 316
862 3300050494 nmdc:mga06z11_104161_c1 nmdc:mga06z11_104161_c1_335_1291 316
863 3300050494 nmdc:mga06z11_148497_c1 nmdc:mga06z11_148497_c1_33_989 316
864 3300050496 nmdc:mga07m45_64254_c1 nmdc:mga07m45_64254_c1_384_1340 316
865 3300050496 nmdc:mga07m45_97530_c1 nmdc:mga07m45_97530_c1_672_1628 316
866 3300050507 nmdc:mga05p37_132_c1 nmdc:mga05p37_132_c1_33015_33971 316
867 3300050507 nmdc:mga05p37_261301_c1 nmdc:mga05p37_261301_c1_754_1710 316
868 3300050507 nmdc:mga05p37_673219_c1 nmdc:mga05p37_673219_c1_160_1116 316
869 3300050508 nmdc:mga09592_418_c1 nmdc:mga09592_418_c1_29245_30201 316
870 3300050511 nmdc:mga08y16_108320_c1 nmdc:mga08y16_108320_c1_333_1289 316
871 3300050511 nmdc:mga08y16_9476_c1 nmdc:mga08y16_9476_c1_7009_7965 316
872 3300050512 nmdc:mga0n895_109188_c1 nmdc:mga0n895_109188_c1_454_1410 316
873 3300050512 nmdc:mga0n895_252410_c1 nmdc:mga0n895_252410_c1_164_1120 316
874 3300050512 nmdc:mga0n895_290807_c1 nmdc:mga0n895_290807_c1_311_1267 316
875 3300050512 nmdc:mga0n895_468_c1 nmdc:mga0n895_468_c1_3262_4218 316
876 3300050512 nmdc:mga0n895_93917_c1 nmdc:mga0n895_93917_c1_1191_2147 316
877 3300050513 nmdc:mga0rr50_145_c1 nmdc:mga0rr50_145_c1_4083_5039 316
878 3300050513 nmdc:mga0rr50_89121_c1 nmdc:mga0rr50_89121_c1_1274_2230 316
879 3300050514 nmdc:mga08x19_14066_c1 nmdc:mga08x19_14066_c1_72_1028 316
880 3300050514 nmdc:mga08x19_522_c1 nmdc:mga08x19_522_c1_7876_8832 316
881 3300050515 nmdc:mga0a205_11596_c1 nmdc:mga0a205_11596_c1_4668_5624 316
882 3300050515 nmdc:mga0a205_54289_c1 nmdc:mga0a205_54289_c1_2394_3350 316
883 3300050516 nmdc:mga0sz30_20124_c1 nmdc:mga0sz30_20124_c1_83_1039 316
884 3300050516 nmdc:mga0sz30_60152_c1 nmdc:mga0sz30_60152_c1_60_1016 316
885 3300053077 Ga0495601_0000001 Ga0495601_0000001_33675_34640 316
886 3300053077 Ga0495601_0000243 Ga0495601_0000243_4936_5895 316
887 3300053077 Ga0495601_0016790 Ga0495601_0016790_243_1199 316
888 3300053077 Ga0495601_0022082 Ga0495601_0022082_768_1724 316
889 3300053077 Ga0495601_0025060 Ga0495601_0025060_2092_3138 316
890 3300053077 Ga0495601_0152994 Ga0495601_0152994_152_1108 316
891 3300053077 Ga0495601_0164211 Ga0495601_0164211_371_1327 316
892 3300053078 Ga0495612_0000063 Ga0495612_0000063_42228_43193 316
893 3300053078 Ga0495612_0001332 Ga0495612_0001332_2477_3523 316
894 3300053078 Ga0495612_0006769 Ga0495612_0006769_2674_3630 316
895 3300053078 Ga0495612_0009391 Ga0495612_0009391_2721_3677 316
896 3300053084 Ga0495595_0002319 Ga0495595_0002319_4906_5871 316
897 3300053084 Ga0495595_0046083 Ga0495595_0046083_743_1699 316
898 3300053085 Ga0495619_0000004 Ga0495619_0000004_33706_34671 316
899 3300053085 Ga0495619_0004170 Ga0495619_0004170_151_1197 316
900 3300053085 Ga0495619_0112964 Ga0495619_0112964_759_1715 316
901 3300053086 Ga0500578_0178410 Ga0500578_0178410_157_1113 316
902 3300053092 Ga0500583_0164039 Ga0500583_0164039_139_1095 316
903 3300053096 Ga0500641_0003400 Ga0500641_0003400_3274_4230 316
904 3300053119 Ga0500595_016248 Ga0500595_016248_736_1692 316
905 3300053131 Ga0500652_000023 Ga0500652_000023_44224_45180 316
906 3300054114 Ga0501084_0064199 Ga0501084_0064199_995_1951 316
907 3300054114 Ga0501084_0071132 Ga0501084_0071132_1723_2739 316
908 3300054114 Ga0501084_0090900 Ga0501084_0090900_1476_2432 316
909 3300054114 Ga0501084_0159463 Ga0501084_0159463_263_1222 316
910 3300054114 Ga0501084_0479070 Ga0501084_0479070_66_1022 316
911 3300059421 Ga0590071_008354 Ga0590071_008354_445_1401 316
912 3300060353 Ga0501082_0000205 Ga0501082_0000205_15014_15970 316
913 3300060353 Ga0501082_0008926 Ga0501082_0008926_4341_5297 316
914 3300060353 Ga0501082_0025577 Ga0501082_0025577_2155_3111 316
915 3300060353 Ga0501082_0144096 Ga0501082_0144096_1056_2012 316
916 3300061734 Ga0530510_0000425 Ga0530510_0000425_13663_14619 316
917 3300061734 Ga0530510_0057591 Ga0530510_0057591_1101_2057 316
918 3300005338 Ga0068868_100051086 Ga0068868_1000510862 317
919 3300005367 Ga0070667_100012483 Ga0070667_1000124832 317
920 3300005466 Ga0070685_10146707 Ga0070685_101467072 317
921 3300005841 Ga0068863_100005225 Ga0068863_1000052253 317
922 3300005843 Ga0068860_100011906 Ga0068860_1000119062 317
923 3300006237 Ga0097621_100095350 Ga0097621_1000953503 317
924 3300006358 Ga0068871_100011094 Ga0068871_1000110942 317
925 3300009176 Ga0105242_10009816 Ga0105242_100098167 317
926 3300013105 Ga0157369_10359901 Ga0157369_103599011 317
927 3300013308 Ga0157375_10020483 Ga0157375_100204832 317
928 3300014325 Ga0163163_10001830 Ga0163163_1000183014 317
929 3300014326 Ga0157380_10017000 Ga0157380_100170006 317
930 3300014968 Ga0157379_10016937 Ga0157379_100169373 317
931 3300014969 Ga0157376_10013769 Ga0157376_100137693 317
932 3300025928 Ga0207700_10073659 Ga0207700_100736594 317
933 3300025986 Ga0207658_10312615 Ga0207658_103126151 317
934 3300041486 Ga0451807_0095181 Ga0451807_0095181_452_1405 317
935 3300048907 Ga0496104_0307706 Ga0496104_0307706_347_1300 317
936 3300048912 Ga0496109_0011159 Ga0496109_0011159_2521_3474 317
937 3300039453 Ga0436362_0463249 Ga0436362_0463249_1248_2204 318
938 iso_pu_bacteria 2935390628 2935393018 318
939 iso_pu_bacteria 2997600082 2997605428 318
940 2162886007 SwRhRL2b_contig_2628462 SwRhRL2b_0060.00004610 319
941 2162886007 SwRhRL2b_contig_58648 SwRhRL2b_0969.00006930 319
942 3300005295 Ga0065707_10099655 Ga0065707_100996552 319
943 3300005331 Ga0070670_100098177 Ga0070670_1000981771 319
944 3300005335 Ga0070666_10064004 Ga0070666_100640043 319
945 3300005347 Ga0070668_100213743 Ga0070668_1002137431 319
946 3300005353 Ga0070669_100013431 Ga0070669_1000134314 319
947 3300005355 Ga0070671_100001928 Ga0070671_1000019284 319
948 3300005367 Ga0070667_100027609 Ga0070667_1000276092 319
949 3300005548 Ga0070665_100000169 Ga0070665_10000016975 319
950 3300005841 Ga0068863_100008798 Ga0068863_1000087987 319
951 3300009011 Ga0105251_10004488 Ga0105251_100044886 319
952 3300025735 Ga0207713_1002844 Ga0207713_10028447 319
953 3300025903 Ga0207680_10015096 Ga0207680_100150965 319
954 3300025910 Ga0207684_10195609 Ga0207684_101956093 319
955 3300025923 Ga0207681_10034479 Ga0207681_100344793 319
956 3300025925 Ga0207650_10030542 Ga0207650_100305424 319
957 3300025931 Ga0207644_10000409 Ga0207644_1000040917 319
958 3300025972 Ga0207668_10017068 Ga0207668_100170684 319
959 3300025986 Ga0207658_10019851 Ga0207658_100198514 319
960 3300028379 Ga0268266_10001173 Ga0268266_1000117324 319
961 3300028380 Ga0268265_10388220 Ga0268265_103882201 319
962 3300028381 Ga0268264_10003658 Ga0268264_100036584 319
963 3300048906 Ga0496103_0012080 Ga0496103_0012080_3557_4516 319
964 3300048907 Ga0496104_0504321 Ga0496104_0504321_25_1005 319
965 3300048920 Ga0496117_0022967 Ga0496117_0022967_392_1351 319
966 3300048920 Ga0496117_0087606 Ga0496117_0087606_898_1857 319
967 3300048921 Ga0496118_0027984 Ga0496118_0027984_830_1789 319
968 3300048921 Ga0496118_0048685 Ga0496118_0048685_2246_3205 319
969 3300048924 Ga0496121_0009918 Ga0496121_0009918_9636_10595 319
970 3300048927 Ga0496124_0006822 Ga0496124_0006822_9119_10078 319
971 3300048929 Ga0496126_0035095 Ga0496126_0035095_54_1013 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19858

OxRdtase_C

Bacterial oxidoreductases, C-terminal

178

340

0.99

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

31

148

0.95

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

156

276

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8973 1 314
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8884 1 314
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8824 1 314
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8776 1 314
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.869 1 314
ID Description Score Start End Superfamily
af_A0A1D8PPX6_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 1 116 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 1 119 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 1 119 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 1 116 3.40.50.720
af_Q04869_4_115_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 1 107 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D0M678-F1-model_v4 Dehydrogenase 0.976 2 139 GO:0000166
AF-A0A3A8SX78-F1-model_v4 deleted 0.9707 54 138
AF-A0A1J5I439-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9629 1 138 GO:0000166
AF-A0A3N5KE09-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9613 1 82 GO:0000166
AF-A0A7W0GP34-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9599 1 138 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map