F487081
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 969 | 283 | 969 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300050513|nmdc:mga0rr50_301141_c1|nmdc:mga0rr50_301141_c1_339_1274 |
| Length | 311 |
| Sequence | LILHPSAFILCVVVGLGVIFGRNSSQKLVQAFLPVSNEQDLHGGPMLIESTVHLPTSLAMLQSLFHAPSGDEILRIGFRWFHFAAGITWIGLLYFFNLVNVPFQKGIDADTKKKVNPDLLGRALWWFRWGAVVTVLAGLAYYAMFILKADVVNANNIGHGNVNLWVVFLAWLTYPIVLFGIEFFIIKKVPGVIKDGRIFAVVMIVLVLFFSWALARYFTGMLSVNGESFASNKTYSIGIGGAYGIVMMLNVWGIIWPNNKRILAATAGTGPAAPPELARQAFIASRTNAWLSLPLLLFMGTSHGDWIILGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 201 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 204 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 232 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 233 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 234 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 235 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 238 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 239 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 240 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 242 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 243 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 244 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 248 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 251 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 252 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 253 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 256 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 257 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 258 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 259 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 260 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 261 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 264 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 265 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 269 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 271 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 97.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_36198 | 2162886007 | Bacteria | 2309 |
| 2 | CNBas_1002080 | 3300000531 | Bacteria | 1091 |
| 3 | CNAas_1000886 | 3300000532 | Unclassified | 2808 |
| 4 | JGI24748J21848_1000087 | 3300002074 | Bacteria | 27375 |
| 5 | JGI24034J26672_10000070 | 3300002239 | Bacteria | 27386 |
| 6 | JGI24751J29686_10000009 | 3300002459 | Bacteria | 125815 |
| 7 | JGI25406J46586_10004348 | 3300003203 | Bacteria | 6610 |
| 8 | JGI25406J46586_10007246 | 3300003203 | Bacteria | 5074 |
| 9 | rootH1_10128632 | 3300003316 | Unclassified | 1115 |
| 10 | Ga0065714_10064433 | 3300005288 | Bacteria | 133062 |
| 11 | Ga0065704_10007866 | 3300005289 | Unclassified | 3774 |
| 12 | Ga0065704_10071538 | 3300005289 | Bacteria | 10765 |
| 13 | Ga0065704_10150712 | 3300005289 | Bacteria | 1431 |
| 14 | Ga0065704_10160288 | 3300005289 | Unclassified | 1360 |
| 15 | Ga0065712_10009957 | 3300005290 | Bacteria | 2148 |
| 16 | Ga0065712_10067731 | 3300005290 | Bacteria | 133054 |
| 17 | Ga0065712_10073465 | 3300005290 | Unclassified | 4383 |
| 18 | Ga0065715_10012000 | 3300005293 | Bacteria | 2804 |
| 19 | Ga0065715_10018282 | 3300005293 | Bacteria | 2250 |
| 20 | Ga0065715_10056887 | 3300005293 | Unclassified | 996 |
| 21 | Ga0065715_10088984 | 3300005293 | Bacteria | 18335 |
| 22 | Ga0065715_10091196 | 3300005293 | Bacteria | 6008 |
| 23 | Ga0065715_10125544 | 3300005293 | Bacteria | 2128 |
| 24 | Ga0065715_10129549 | 3300005293 | Bacteria | 2043 |
| 25 | Ga0065707_10001225 | 3300005295 | Bacteria | 9555 |
| 26 | Ga0065707_10179265 | 3300005295 | Unclassified | 1429 |
| 27 | Ga0065707_10233064 | 3300005295 | Bacteria | 1182 |
| 28 | Ga0065707_10248713 | 3300005295 | Unclassified | 1129 |
| 29 | Ga0070676_10061800 | 3300005328 | Bacteria | 2227 |
| 30 | Ga0070676_10190390 | 3300005328 | Unclassified | 1339 |
| 31 | Ga0070676_10296667 | 3300005328 | Unclassified | 1094 |
| 32 | Ga0070690_100001514 | 3300005330 | Bacteria | 12179 |
| 33 | Ga0070690_100023410 | 3300005330 | Bacteria | 3788 |
| 34 | Ga0070690_100079209 | 3300005330 | Bacteria | 2148 |
| 35 | Ga0070690_100158097 | 3300005330 | Bacteria | 1551 |
| 36 | Ga0070690_100230058 | 3300005330 | Unclassified | 1303 |
| 37 | Ga0070690_100593698 | 3300005330 | Unclassified | 840 |
| 38 | Ga0070670_100000088 | 3300005331 | Bacteria | 87898 |
| 39 | Ga0070670_100128323 | 3300005331 | Bacteria | 2189 |
| 40 | Ga0070670_100153806 | 3300005331 | Unclassified | 1991 |
| 41 | Ga0070670_100280649 | 3300005331 | Bacteria | 1454 |
| 42 | Ga0070670_100308186 | 3300005331 | Bacteria | 1386 |
| 43 | Ga0070670_100308249 | 3300005331 | Bacteria | 1385 |
| 44 | Ga0070670_100318672 | 3300005331 | Bacteria | 1362 |
| 45 | Ga0068869_100034500 | 3300005334 | Bacteria | 3580 |
| 46 | Ga0068869_100048762 | 3300005334 | Bacteria | 3064 |
| 47 | Ga0068869_100077696 | 3300005334 | Unclassified | 2470 |
| 48 | Ga0068869_100098505 | 3300005334 | Unclassified | 2208 |
| 49 | Ga0068869_100211334 | 3300005334 | Bacteria | 1534 |
| 50 | Ga0068869_100343835 | 3300005334 | Bacteria | 1215 |
| 51 | Ga0070666_10009988 | 3300005335 | Bacteria | 5923 |
| 52 | Ga0070666_10151870 | 3300005335 | Unclassified | 1616 |
| 53 | Ga0070680_100029340 | 3300005336 | Bacteria | 4418 |
| 54 | Ga0070680_100083439 | 3300005336 | Unclassified | 2639 |
| 55 | Ga0070682_100000658 | 3300005337 | Bacteria | 20968 |
| 56 | Ga0070682_100025067 | 3300005337 | Bacteria | 3557 |
| 57 | Ga0070682_100053546 | 3300005337 | Bacteria | 2529 |
| 58 | Ga0068868_100068046 | 3300005338 | Unclassified | 2835 |
| 59 | Ga0068868_100111973 | 3300005338 | Unclassified | 2218 |
| 60 | Ga0068868_100180895 | 3300005338 | Bacteria | 1749 |
| 61 | Ga0068868_100259110 | 3300005338 | Bacteria | 1466 |
| 62 | Ga0070689_100017912 | 3300005340 | Bacteria | 5207 |
| 63 | Ga0070689_100035344 | 3300005340 | Bacteria | 3818 |
| 64 | Ga0070689_100063329 | 3300005340 | Bacteria | 2878 |
| 65 | Ga0070689_100281890 | 3300005340 | Bacteria | 1379 |
| 66 | Ga0070689_100365267 | 3300005340 | Unclassified | 1213 |
| 67 | Ga0070689_100447868 | 3300005340 | Unclassified | 1098 |
| 68 | Ga0070687_100106748 | 3300005343 | Unclassified | 1578 |
| 69 | Ga0070687_100179835 | 3300005343 | Bacteria | 1266 |
| 70 | Ga0070661_100025902 | 3300005344 | Bacteria | 4215 |
| 71 | Ga0070692_10004444 | 3300005345 | Bacteria | 5862 |
| 72 | Ga0070692_10033025 | 3300005345 | Unclassified | 2607 |
| 73 | Ga0070692_10059843 | 3300005345 | Bacteria | 2003 |
| 74 | Ga0070692_10152614 | 3300005345 | Bacteria | 1317 |
| 75 | Ga0070692_10189665 | 3300005345 | Unclassified | 1197 |
| 76 | Ga0070692_10226599 | 3300005345 | Bacteria | 1107 |
| 77 | Ga0070692_10233098 | 3300005345 | Bacteria | 1094 |
| 78 | Ga0070692_10279461 | 3300005345 | Bacteria | 1011 |
| 79 | Ga0070692_10320358 | 3300005345 | Unclassified | 953 |
| 80 | Ga0070668_100008267 | 3300005347 | Bacteria | 7724 |
| 81 | Ga0070669_100030178 | 3300005353 | Bacteria | 3910 |
| 82 | Ga0070669_100037585 | 3300005353 | Bacteria | 3512 |
| 83 | Ga0070669_100061319 | 3300005353 | Bacteria | 2763 |
| 84 | Ga0070669_100145666 | 3300005353 | Bacteria | 1830 |
| 85 | Ga0070675_100077534 | 3300005354 | Bacteria | 2766 |
| 86 | Ga0070671_100024875 | 3300005355 | Bacteria | 4907 |
| 87 | Ga0070671_100170372 | 3300005355 | Unclassified | 1841 |
| 88 | Ga0070671_100781882 | 3300005355 | Unclassified | 830 |
| 89 | Ga0070674_100116112 | 3300005356 | Bacteria | 1974 |
| 90 | Ga0070674_100190414 | 3300005356 | Unclassified | 1578 |
| 91 | Ga0070673_100043302 | 3300005364 | Bacteria | 3477 |
| 92 | Ga0070673_100061670 | 3300005364 | Bacteria | 2976 |
| 93 | Ga0070673_100077183 | 3300005364 | Unclassified | 2692 |
| 94 | Ga0070673_100081737 | 3300005364 | Bacteria | 2620 |
| 95 | Ga0070673_100084407 | 3300005364 | Bacteria | 2583 |
| 96 | Ga0070673_100107933 | 3300005364 | Unclassified | 2303 |
| 97 | Ga0070673_100246507 | 3300005364 | Bacteria | 1555 |
| 98 | Ga0070673_100250396 | 3300005364 | Bacteria | 1544 |
| 99 | Ga0070673_100364802 | 3300005364 | Unclassified | 1285 |
| 100 | Ga0070688_100044481 | 3300005365 | Bacteria | 2740 |
| 101 | Ga0070659_100008321 | 3300005366 | Bacteria | 7573 |
| 102 | Ga0070667_100420358 | 3300005367 | Unclassified | 1218 |
| 103 | Ga0070703_10000077 | 3300005406 | Bacteria | 48491 |
| 104 | Ga0070701_10020338 | 3300005438 | Bacteria | 3151 |
| 105 | Ga0070701_10045910 | 3300005438 | Bacteria | 2244 |
| 106 | Ga0070701_10129566 | 3300005438 | Bacteria | 1432 |
| 107 | Ga0070701_10349716 | 3300005438 | Unclassified | 923 |
| 108 | Ga0070705_100004943 | 3300005440 | Bacteria | 6493 |
| 109 | Ga0070705_100013030 | 3300005440 | Bacteria | 4243 |
| 110 | Ga0070705_100014024 | 3300005440 | Bacteria | 4113 |
| 111 | Ga0070705_100041667 | 3300005440 | Bacteria | 2620 |
| 112 | Ga0070705_100063379 | 3300005440 | Bacteria | 2205 |
| 113 | Ga0070705_100201943 | 3300005440 | Unclassified | 1363 |
| 114 | Ga0070705_100295684 | 3300005440 | Bacteria | 1158 |
| 115 | Ga0070705_100472910 | 3300005440 | Unclassified | 945 |
| 116 | Ga0070700_100000120 | 3300005441 | Bacteria | 48358 |
| 117 | Ga0070700_100005553 | 3300005441 | Bacteria | 6686 |
| 118 | Ga0070700_100010579 | 3300005441 | Bacteria | 5097 |
| 119 | Ga0070700_100060229 | 3300005441 | Bacteria | 2392 |
| 120 | Ga0070700_100120895 | 3300005441 | Unclassified | 1755 |
| 121 | Ga0070700_100157375 | 3300005441 | Bacteria | 1560 |
| 122 | Ga0070694_100001229 | 3300005444 | Bacteria | 14813 |
| 123 | Ga0070694_100001886 | 3300005444 | Bacteria | 12411 |
| 124 | Ga0070694_100010557 | 3300005444 | Bacteria | 5702 |
| 125 | Ga0070694_100017204 | 3300005444 | Bacteria | 4565 |
| 126 | Ga0070694_100046532 | 3300005444 | Bacteria | 2913 |
| 127 | Ga0070694_100082875 | 3300005444 | Bacteria | 2234 |
| 128 | Ga0070694_100092269 | 3300005444 | Bacteria | 2127 |
| 129 | Ga0070694_100139441 | 3300005444 | Bacteria | 1759 |
| 130 | Ga0070694_100167114 | 3300005444 | Bacteria | 1618 |
| 131 | Ga0070694_100221294 | 3300005444 | Bacteria | 1420 |
| 132 | Ga0070694_100233179 | 3300005444 | Unclassified | 1385 |
| 133 | Ga0070694_100276359 | 3300005444 | Bacteria | 1279 |
| 134 | Ga0070708_100000337 | 3300005445 | Bacteria | 35479 |
| 135 | Ga0070708_100148145 | 3300005445 | Bacteria | 2181 |
| 136 | Ga0070708_100463792 | 3300005445 | Bacteria | 1195 |
| 137 | Ga0070708_100621821 | 3300005445 | Unclassified | 1018 |
| 138 | Ga0070678_100047848 | 3300005456 | Bacteria | 3076 |
| 139 | Ga0070678_100236270 | 3300005456 | Unclassified | 1526 |
| 140 | Ga0070662_100150379 | 3300005457 | Unclassified | 1812 |
| 141 | Ga0070681_10001081 | 3300005458 | Bacteria | 23250 |
| 142 | Ga0070681_10006294 | 3300005458 | Bacteria | 11540 |
| 143 | Ga0070681_10054385 | 3300005458 | Bacteria | 3988 |
| 144 | Ga0070681_10466136 | 3300005458 | Bacteria | 1176 |
| 145 | Ga0068867_100034591 | 3300005459 | Bacteria | 3662 |
| 146 | Ga0068867_100042795 | 3300005459 | Unclassified | 3315 |
| 147 | Ga0068867_100101133 | 3300005459 | Bacteria | 2202 |
| 148 | Ga0068867_100455123 | 3300005459 | Bacteria | 1091 |
| 149 | Ga0070685_10305426 | 3300005466 | Unclassified | 1073 |
| 150 | Ga0070706_100000017 | 3300005467 | Bacteria | 172828 |
| 151 | Ga0070706_100005724 | 3300005467 | Bacteria | 11816 |
| 152 | Ga0070706_100012259 | 3300005467 | Bacteria | 7944 |
| 153 | Ga0070706_100026556 | 3300005467 | Bacteria | 5328 |
| 154 | Ga0070706_100028645 | 3300005467 | Bacteria | 5128 |
| 155 | Ga0070706_100030934 | 3300005467 | Bacteria | 4935 |
| 156 | Ga0070706_100035284 | 3300005467 | Bacteria | 4619 |
| 157 | Ga0070706_100488454 | 3300005467 | Bacteria | 1146 |
| 158 | Ga0070706_100660570 | 3300005467 | Bacteria | 970 |
| 159 | Ga0070707_100000197 | 3300005468 | Bacteria | 60425 |
| 160 | Ga0070707_100005488 | 3300005468 | Bacteria | 11861 |
| 161 | Ga0070707_100021433 | 3300005468 | Bacteria | 6108 |
| 162 | Ga0070707_100042234 | 3300005468 | Bacteria | 4365 |
| 163 | Ga0070707_100145430 | 3300005468 | Bacteria | 2307 |
| 164 | Ga0070707_100286500 | 3300005468 | Bacteria | 1601 |
| 165 | Ga0070698_100004605 | 3300005471 | Bacteria | 15147 |
| 166 | Ga0070698_100004943 | 3300005471 | Bacteria | 14614 |
| 167 | Ga0070698_100012974 | 3300005471 | Bacteria | 8821 |
| 168 | Ga0070698_100013753 | 3300005471 | Bacteria | 8567 |
| 169 | Ga0070698_100018834 | 3300005471 | Bacteria | 7263 |
| 170 | Ga0070698_100042470 | 3300005471 | Bacteria | 4664 |
| 171 | Ga0070698_100045775 | 3300005471 | Bacteria | 4477 |
| 172 | Ga0070698_100147259 | 3300005471 | Bacteria | 2303 |
| 173 | Ga0070698_100172267 | 3300005471 | Bacteria | 2105 |
| 174 | Ga0070698_100407889 | 3300005471 | Unclassified | 1293 |
| 175 | Ga0070699_100006275 | 3300005518 | Bacteria | 10374 |
| 176 | Ga0070699_100007202 | 3300005518 | Bacteria | 9674 |
| 177 | Ga0070699_100030729 | 3300005518 | Bacteria | 4637 |
| 178 | Ga0070699_100049948 | 3300005518 | Bacteria | 3620 |
| 179 | Ga0070699_100083270 | 3300005518 | Bacteria | 2790 |
| 180 | Ga0070699_100453036 | 3300005518 | Bacteria | 1163 |
| 181 | Ga0070699_100481441 | 3300005518 | Bacteria | 1126 |
| 182 | Ga0070699_100788077 | 3300005518 | Unclassified | 870 |
| 183 | Ga0070679_100008421 | 3300005530 | Bacteria | 9706 |
| 184 | Ga0070679_100056125 | 3300005530 | Bacteria | 3924 |
| 185 | Ga0070697_100000062 | 3300005536 | Bacteria | 84791 |
| 186 | Ga0070697_100001572 | 3300005536 | Bacteria | 17404 |
| 187 | Ga0070697_100038063 | 3300005536 | Bacteria | 3886 |
| 188 | Ga0070697_100046238 | 3300005536 | Bacteria | 3528 |
| 189 | Ga0070697_100096040 | 3300005536 | Unclassified | 2459 |
| 190 | Ga0070697_100102947 | 3300005536 | Bacteria | 2373 |
| 191 | Ga0070697_100122249 | 3300005536 | Bacteria | 2178 |
| 192 | Ga0070697_100170156 | 3300005536 | Bacteria | 1843 |
| 193 | Ga0070697_100317176 | 3300005536 | Bacteria | 1342 |
| 194 | Ga0070697_100411310 | 3300005536 | Bacteria | 1175 |
| 195 | Ga0068853_100124344 | 3300005539 | Bacteria | 2304 |
| 196 | Ga0068853_100180300 | 3300005539 | Bacteria | 1915 |
| 197 | Ga0068853_100313516 | 3300005539 | Bacteria | 1453 |
| 198 | Ga0068853_100633730 | 3300005539 | Unclassified | 1017 |
| 199 | Ga0070672_100003235 | 3300005543 | Bacteria | 10544 |
| 200 | Ga0070672_100255342 | 3300005543 | Unclassified | 1477 |
| 201 | Ga0070672_100327472 | 3300005543 | Unclassified | 1303 |
| 202 | Ga0070686_100002174 | 3300005544 | Bacteria | 10821 |
| 203 | Ga0070686_100011973 | 3300005544 | Bacteria | 4932 |
| 204 | Ga0070686_100101956 | 3300005544 | Bacteria | 1940 |
| 205 | Ga0070686_100196842 | 3300005544 | Bacteria | 1442 |
| 206 | Ga0070686_100236950 | 3300005544 | Bacteria | 1327 |
| 207 | Ga0070686_100334617 | 3300005544 | Unclassified | 1133 |
| 208 | Ga0070695_100013916 | 3300005545 | Bacteria | 4842 |
| 209 | Ga0070695_100098211 | 3300005545 | Bacteria | 1967 |
| 210 | Ga0070695_100104505 | 3300005545 | Bacteria | 1912 |
| 211 | Ga0070695_100134121 | 3300005545 | Unclassified | 1709 |
| 212 | Ga0070695_100135304 | 3300005545 | Bacteria | 1703 |
| 213 | Ga0070695_100141653 | 3300005545 | Bacteria | 1668 |
| 214 | Ga0070695_100162909 | 3300005545 | Bacteria | 1567 |
| 215 | Ga0070695_100280149 | 3300005545 | Unclassified | 1225 |
| 216 | Ga0070695_100355392 | 3300005545 | Bacteria | 1099 |
| 217 | Ga0070696_100000807 | 3300005546 | Bacteria | 20137 |
| 218 | Ga0070696_100028469 | 3300005546 | Unclassified | 3814 |
| 219 | Ga0070696_100069441 | 3300005546 | Bacteria | 2476 |
| 220 | Ga0070696_100083176 | 3300005546 | Bacteria | 2270 |
| 221 | Ga0070696_100165930 | 3300005546 | Unclassified | 1629 |
| 222 | Ga0070696_100211143 | 3300005546 | Unclassified | 1453 |
| 223 | Ga0070696_100272351 | 3300005546 | Unclassified | 1288 |
| 224 | Ga0070693_100006647 | 3300005547 | Bacteria | 5614 |
| 225 | Ga0070693_100022522 | 3300005547 | Unclassified | 3352 |
| 226 | Ga0070693_100040645 | 3300005547 | Bacteria | 2612 |
| 227 | Ga0070693_100108136 | 3300005547 | Unclassified | 1706 |
| 228 | Ga0070693_100275582 | 3300005547 | Unclassified | 1125 |
| 229 | Ga0070665_100267008 | 3300005548 | Unclassified | 1713 |
| 230 | Ga0070704_100001685 | 3300005549 | Bacteria | 12016 |
| 231 | Ga0070704_100022845 | 3300005549 | Bacteria | 4075 |
| 232 | Ga0070704_100041854 | 3300005549 | Bacteria | 3165 |
| 233 | Ga0070704_100047366 | 3300005549 | Bacteria | 3004 |
| 234 | Ga0070704_100060228 | 3300005549 | Bacteria | 2712 |
| 235 | Ga0070704_100228050 | 3300005549 | Unclassified | 1518 |
| 236 | Ga0070704_100461537 | 3300005549 | Bacteria | 1096 |
| 237 | Ga0070704_100527065 | 3300005549 | Unclassified | 1029 |
| 238 | Ga0068855_100455794 | 3300005563 | Bacteria | 1395 |
| 239 | Ga0070664_100005757 | 3300005564 | Bacteria | 9992 |
| 240 | Ga0070664_100073910 | 3300005564 | Bacteria | 2925 |
| 241 | Ga0070664_100089390 | 3300005564 | Bacteria | 2665 |
| 242 | Ga0070664_100252396 | 3300005564 | Unclassified | 1586 |
| 243 | Ga0070664_100373174 | 3300005564 | Bacteria | 1301 |
| 244 | Ga0068857_100011647 | 3300005577 | Bacteria | 7650 |
| 245 | Ga0068857_100096441 | 3300005577 | Unclassified | 2650 |
| 246 | Ga0068857_100259806 | 3300005577 | Bacteria | 1593 |
| 247 | Ga0068857_100363002 | 3300005577 | Bacteria | 1343 |
| 248 | Ga0068857_100496245 | 3300005577 | Bacteria | 1145 |
| 249 | Ga0068854_100039135 | 3300005578 | Bacteria | 3338 |
| 250 | Ga0068856_100021795 | 3300005614 | Bacteria | 6227 |
| 251 | Ga0068856_100339979 | 3300005614 | Bacteria | 1519 |
| 252 | Ga0070702_100020950 | 3300005615 | Bacteria | 3432 |
| 253 | Ga0070702_100051700 | 3300005615 | Unclassified | 2353 |
| 254 | Ga0070702_100052042 | 3300005615 | Bacteria | 2347 |
| 255 | Ga0070702_100063007 | 3300005615 | Unclassified | 2163 |
| 256 | Ga0070702_100118173 | 3300005615 | Bacteria | 1655 |
| 257 | Ga0070702_100183017 | 3300005615 | Bacteria | 1373 |
| 258 | Ga0068852_100129712 | 3300005616 | Unclassified | 2320 |
| 259 | Ga0068852_100318997 | 3300005616 | Unclassified | 1509 |
| 260 | Ga0068859_100006661 | 3300005617 | Bacteria | 11729 |
| 261 | Ga0068859_100009613 | 3300005617 | Bacteria | 9764 |
| 262 | Ga0068859_100010028 | 3300005617 | Bacteria | 9554 |
| 263 | Ga0068859_100027113 | 3300005617 | Bacteria | 5747 |
| 264 | Ga0068859_100063364 | 3300005617 | Bacteria | 3728 |
| 265 | Ga0068859_100113336 | 3300005617 | Unclassified | 2775 |
| 266 | Ga0068859_100205079 | 3300005617 | Bacteria | 2057 |
| 267 | Ga0068859_100235025 | 3300005617 | Bacteria | 1921 |
| 268 | Ga0068859_100339026 | 3300005617 | Bacteria | 1597 |
| 269 | Ga0068859_100974884 | 3300005617 | Unclassified | 930 |
| 270 | Ga0068864_100020637 | 3300005618 | Bacteria | 5512 |
| 271 | Ga0068864_100021333 | 3300005618 | Bacteria | 5427 |
| 272 | Ga0068864_100054098 | 3300005618 | Bacteria | 3464 |
| 273 | Ga0068864_100207035 | 3300005618 | Bacteria | 1805 |
| 274 | Ga0068864_100302488 | 3300005618 | Unclassified | 1498 |
| 275 | Ga0068864_100323995 | 3300005618 | Bacteria | 1448 |
| 276 | Ga0068864_100334544 | 3300005618 | Bacteria | 1425 |
| 277 | Ga0068864_100387108 | 3300005618 | Unclassified | 1326 |
| 278 | Ga0068864_100411897 | 3300005618 | Bacteria | 1286 |
| 279 | Ga0068864_100617330 | 3300005618 | Unclassified | 1053 |
| 280 | Ga0068864_100871270 | 3300005618 | Bacteria | 888 |
| 281 | Ga0068866_10011179 | 3300005718 | Bacteria | 3875 |
| 282 | Ga0068866_10045935 | 3300005718 | Bacteria | 2193 |
| 283 | Ga0068866_10070708 | 3300005718 | Unclassified | 1843 |
| 284 | Ga0068866_10079744 | 3300005718 | Unclassified | 1755 |
| 285 | Ga0068861_100004194 | 3300005719 | Bacteria | 9666 |
| 286 | Ga0068861_100032846 | 3300005719 | Bacteria | 3824 |
| 287 | Ga0068861_100151057 | 3300005719 | Bacteria | 1906 |
| 288 | Ga0068861_100218202 | 3300005719 | Bacteria | 1610 |
| 289 | Ga0068861_100332914 | 3300005719 | Unclassified | 1326 |
| 290 | Ga0068861_100340012 | 3300005719 | Bacteria | 1313 |
| 291 | Ga0068851_10003618 | 3300005834 | Bacteria | 6893 |
| 292 | Ga0068870_10052726 | 3300005840 | Bacteria | 2158 |
| 293 | Ga0068870_10054718 | 3300005840 | Bacteria | 2124 |
| 294 | Ga0068870_10107101 | 3300005840 | Unclassified | 1590 |
| 295 | Ga0068870_10188650 | 3300005840 | Bacteria | 1242 |
| 296 | Ga0068863_100027299 | 3300005841 | Bacteria | 5445 |
| 297 | Ga0068863_100075227 | 3300005841 | Bacteria | 3195 |
| 298 | Ga0068863_100112035 | 3300005841 | Bacteria | 2599 |
| 299 | Ga0068863_100167444 | 3300005841 | Bacteria | 2107 |
| 300 | Ga0068863_100213033 | 3300005841 | Bacteria | 1860 |
| 301 | Ga0068863_100221915 | 3300005841 | Bacteria | 1821 |
| 302 | Ga0068863_100223750 | 3300005841 | Bacteria | 1813 |
| 303 | Ga0068863_100274814 | 3300005841 | Bacteria | 1631 |
| 304 | Ga0068863_100399332 | 3300005841 | Bacteria | 1344 |
| 305 | Ga0068858_100000077 | 3300005842 | Bacteria | 103156 |
| 306 | Ga0068858_100020307 | 3300005842 | Bacteria | 6212 |
| 307 | Ga0068858_100041123 | 3300005842 | Bacteria | 4287 |
| 308 | Ga0068858_100062270 | 3300005842 | Bacteria | 3450 |
| 309 | Ga0068858_100066492 | 3300005842 | Unclassified | 3337 |
| 310 | Ga0068858_100070049 | 3300005842 | Bacteria | 3251 |
| 311 | Ga0068858_100201172 | 3300005842 | Bacteria | 1884 |
| 312 | Ga0068860_100014175 | 3300005843 | Bacteria | 7817 |
| 313 | Ga0068860_100067260 | 3300005843 | Bacteria | 3405 |
| 314 | Ga0068860_100095228 | 3300005843 | Bacteria | 2838 |
| 315 | Ga0068860_100100146 | 3300005843 | Bacteria | 2764 |
| 316 | Ga0068860_100124757 | 3300005843 | Bacteria | 2468 |
| 317 | Ga0068860_100186267 | 3300005843 | Bacteria | 2007 |
| 318 | Ga0068860_100251887 | 3300005843 | Unclassified | 1720 |
| 319 | Ga0068860_100332402 | 3300005843 | Unclassified | 1493 |
| 320 | Ga0068862_100016914 | 3300005844 | Bacteria | 6070 |
| 321 | Ga0068862_100036312 | 3300005844 | Bacteria | 4177 |
| 322 | Ga0068862_100073581 | 3300005844 | Bacteria | 2953 |
| 323 | Ga0068862_100132035 | 3300005844 | Bacteria | 2210 |
| 324 | Ga0068862_100150979 | 3300005844 | Bacteria | 2068 |
| 325 | Ga0068862_100211958 | 3300005844 | Unclassified | 1750 |
| 326 | Ga0068862_100223692 | 3300005844 | Bacteria | 1705 |
| 327 | Ga0068862_100256870 | 3300005844 | Bacteria | 1594 |
| 328 | Ga0081540_1046504 | 3300005983 | Bacteria | 2190 |
| 329 | Ga0081539_10000408 | 3300005985 | Bacteria | 91634 |
| 330 | Ga0081539_10000941 | 3300005985 | Bacteria | 54539 |
| 331 | Ga0081539_10001941 | 3300005985 | Bacteria | 31706 |
| 332 | Ga0081539_10071166 | 3300005985 | Bacteria | 1864 |
| 333 | Ga0070715_10000010 | 3300006163 | Bacteria | 184687 |
| 334 | Ga0070716_100000004 | 3300006173 | Bacteria | 296614 |
| 335 | Ga0097621_100008542 | 3300006237 | Bacteria | 7378 |
| 336 | Ga0097621_100167622 | 3300006237 | Bacteria | 1891 |
| 337 | Ga0097621_100320459 | 3300006237 | Bacteria | 1373 |
| 338 | Ga0068871_100031414 | 3300006358 | Bacteria | 4188 |
| 339 | Ga0068871_100079208 | 3300006358 | Unclassified | 2718 |
| 340 | Ga0068871_100185048 | 3300006358 | Unclassified | 1791 |
| 341 | Ga0068871_100515700 | 3300006358 | Unclassified | 1079 |
| 342 | Ga0075428_100085023 | 3300006844 | Bacteria | 3451 |
| 343 | Ga0075428_100369112 | 3300006844 | Unclassified | 1539 |
| 344 | Ga0075428_100522689 | 3300006844 | Bacteria | 1269 |
| 345 | Ga0075428_100555117 | 3300006844 | Bacteria | 1228 |
| 346 | Ga0075430_100066558 | 3300006846 | Bacteria | 3025 |
| 347 | Ga0075430_100082659 | 3300006846 | Unclassified | 2691 |
| 348 | Ga0075431_100094063 | 3300006847 | Bacteria | 3093 |
| 349 | Ga0075431_100164221 | 3300006847 | Bacteria | 2283 |
| 350 | Ga0075431_100236813 | 3300006847 | Bacteria | 1858 |
| 351 | Ga0075433_10022852 | 3300006852 | Bacteria | 5254 |
| 352 | Ga0075433_10037055 | 3300006852 | Bacteria | 4204 |
| 353 | Ga0075433_10056566 | 3300006852 | Bacteria | 3426 |
| 354 | Ga0075433_10168759 | 3300006852 | Unclassified | 1948 |
| 355 | Ga0075433_10171185 | 3300006852 | Bacteria | 1932 |
| 356 | Ga0075433_10394577 | 3300006852 | Bacteria | 1221 |
| 357 | Ga0075434_100014554 | 3300006871 | Bacteria | 7524 |
| 358 | Ga0075434_100040126 | 3300006871 | Bacteria | 4637 |
| 359 | Ga0075434_100067157 | 3300006871 | Unclassified | 3573 |
| 360 | Ga0075434_100068253 | 3300006871 | Bacteria | 3542 |
| 361 | Ga0075434_100087715 | 3300006871 | Unclassified | 3112 |
| 362 | Ga0075434_100091846 | 3300006871 | Bacteria | 3038 |
| 363 | Ga0075434_100363644 | 3300006871 | Bacteria | 1468 |
| 364 | Ga0075434_100406254 | 3300006871 | Bacteria | 1383 |
| 365 | Ga0075434_100580678 | 3300006871 | Bacteria | 1140 |
| 366 | Ga0075429_100024483 | 3300006880 | Bacteria | 5237 |
| 367 | Ga0075429_100038505 | 3300006880 | Bacteria | 4162 |
| 368 | Ga0075429_100386165 | 3300006880 | Bacteria | 1226 |
| 369 | Ga0075429_100447729 | 3300006880 | Unclassified | 1132 |
| 370 | Ga0068865_100048889 | 3300006881 | Bacteria | 2913 |
| 371 | Ga0075436_100000009 | 3300006914 | Bacteria | 256132 |
| 372 | Ga0075436_100209691 | 3300006914 | Unclassified | 1381 |
| 373 | Ga0097620_100006661 | 3300006931 | Bacteria | 11729 |
| 374 | Ga0097620_100009613 | 3300006931 | Bacteria | 9764 |
| 375 | Ga0097620_100010027 | 3300006931 | Bacteria | 9554 |
| 376 | Ga0097620_100027113 | 3300006931 | Bacteria | 5747 |
| 377 | Ga0097620_100063365 | 3300006931 | Bacteria | 3728 |
| 378 | Ga0097620_100113335 | 3300006931 | Unclassified | 2775 |
| 379 | Ga0097620_100205064 | 3300006931 | Bacteria | 2057 |
| 380 | Ga0097620_100235042 | 3300006931 | Bacteria | 1921 |
| 381 | Ga0097620_100339046 | 3300006931 | Bacteria | 1597 |
| 382 | Ga0097620_100974960 | 3300006931 | Unclassified | 930 |
| 383 | Ga0075435_100008534 | 3300007076 | Bacteria | 7363 |
| 384 | Ga0075435_100021117 | 3300007076 | Bacteria | 5002 |
| 385 | Ga0075435_100238966 | 3300007076 | Bacteria | 1544 |
| 386 | Ga0075435_100553886 | 3300007076 | Unclassified | 996 |
| 387 | Ga0105251_10081677 | 3300009011 | Unclassified | 1493 |
| 388 | Ga0105240_10042866 | 3300009093 | Bacteria | 5764 |
| 389 | Ga0105240_10191814 | 3300009093 | Bacteria | 2402 |
| 390 | Ga0105240_10199958 | 3300009093 | Bacteria | 2343 |
| 391 | Ga0111539_10005075 | 3300009094 | Bacteria | 17101 |
| 392 | Ga0111539_10010333 | 3300009094 | Bacteria | 11751 |
| 393 | Ga0111539_10062464 | 3300009094 | Bacteria | 4408 |
| 394 | Ga0111539_10083728 | 3300009094 | Bacteria | 3750 |
| 395 | Ga0105245_10141499 | 3300009098 | Bacteria | 2266 |
| 396 | Ga0105245_10142966 | 3300009098 | Bacteria | 2255 |
| 397 | Ga0105245_10382373 | 3300009098 | Bacteria | 1402 |
| 398 | Ga0105245_10775801 | 3300009098 | Unclassified | 996 |
| 399 | Ga0105247_10000015 | 3300009101 | Bacteria | 277224 |
| 400 | Ga0105247_10007521 | 3300009101 | Bacteria | 6677 |
| 401 | Ga0105247_10171682 | 3300009101 | Unclassified | 1442 |
| 402 | Ga0114129_10023642 | 3300009147 | Bacteria | 8710 |
| 403 | Ga0114129_10051841 | 3300009147 | Bacteria | 5760 |
| 404 | Ga0114129_10051936 | 3300009147 | Bacteria | 5754 |
| 405 | Ga0114129_10066340 | 3300009147 | Bacteria | 5035 |
| 406 | Ga0114129_10068673 | 3300009147 | Bacteria | 4941 |
| 407 | Ga0114129_10114657 | 3300009147 | Unclassified | 3715 |
| 408 | Ga0114129_10164259 | 3300009147 | Bacteria | 3031 |
| 409 | Ga0114129_10237746 | 3300009147 | Unclassified | 2450 |
| 410 | Ga0114129_10286870 | 3300009147 | Bacteria | 2198 |
| 411 | Ga0114129_10446440 | 3300009147 | Bacteria | 1697 |
| 412 | Ga0114129_10815980 | 3300009147 | Bacteria | 1189 |
| 413 | Ga0114129_10911613 | 3300009147 | Bacteria | 1113 |
| 414 | Ga0114129_11148137 | 3300009147 | Bacteria | 970 |
| 415 | Ga0114129_11198199 | 3300009147 | Unclassified | 946 |
| 416 | Ga0105243_10000283 | 3300009148 | Bacteria | 56438 |
| 417 | Ga0105243_10000350 | 3300009148 | Bacteria | 49215 |
| 418 | Ga0105243_10042180 | 3300009148 | Bacteria | 3571 |
| 419 | Ga0105243_10059880 | 3300009148 | Bacteria | 3040 |
| 420 | Ga0105243_10077421 | 3300009148 | Bacteria | 2705 |
| 421 | Ga0105243_10077653 | 3300009148 | Unclassified | 2701 |
| 422 | Ga0105243_10145993 | 3300009148 | Bacteria | 2024 |
| 423 | Ga0105243_10237386 | 3300009148 | Bacteria | 1620 |
| 424 | Ga0105243_10256448 | 3300009148 | Unclassified | 1564 |
| 425 | Ga0105243_10405196 | 3300009148 | Unclassified | 1268 |
| 426 | Ga0105243_10606802 | 3300009148 | Bacteria | 1054 |
| 427 | Ga0105241_10019245 | 3300009174 | Bacteria | 5034 |
| 428 | Ga0105241_10021776 | 3300009174 | Bacteria | 4742 |
| 429 | Ga0105241_10046782 | 3300009174 | Bacteria | 3287 |
| 430 | Ga0105241_10064366 | 3300009174 | Bacteria | 2831 |
| 431 | Ga0105241_10109925 | 3300009174 | Unclassified | 2205 |
| 432 | Ga0105241_10222574 | 3300009174 | Unclassified | 1587 |
| 433 | Ga0105241_10362011 | 3300009174 | Unclassified | 1262 |
| 434 | Ga0105242_10000235 | 3300009176 | Bacteria | 43611 |
| 435 | Ga0105242_10000694 | 3300009176 | Bacteria | 26389 |
| 436 | Ga0105242_10002192 | 3300009176 | Bacteria | 15419 |
| 437 | Ga0105242_10018177 | 3300009176 | Bacteria | 5492 |
| 438 | Ga0105242_10039298 | 3300009176 | Unclassified | 3807 |
| 439 | Ga0105242_10062185 | 3300009176 | Bacteria | 3072 |
| 440 | Ga0105242_10285870 | 3300009176 | Bacteria | 1500 |
| 441 | Ga0105242_10346571 | 3300009176 | Bacteria | 1371 |
| 442 | Ga0105248_10007251 | 3300009177 | Bacteria | 12167 |
| 443 | Ga0105248_10033803 | 3300009177 | Bacteria | 5714 |
| 444 | Ga0105248_10033984 | 3300009177 | Bacteria | 5700 |
| 445 | Ga0105248_10112607 | 3300009177 | Bacteria | 3069 |
| 446 | Ga0105248_10133245 | 3300009177 | Bacteria | 2804 |
| 447 | Ga0105248_10297035 | 3300009177 | Bacteria | 1819 |
| 448 | Ga0105248_10342618 | 3300009177 | Bacteria | 1683 |
| 449 | Ga0105248_10357877 | 3300009177 | Bacteria | 1643 |
| 450 | Ga0105248_10387468 | 3300009177 | Bacteria | 1573 |
| 451 | Ga0105248_10398892 | 3300009177 | Unclassified | 1549 |
| 452 | Ga0105248_10451487 | 3300009177 | Bacteria | 1448 |
| 453 | Ga0105248_10746510 | 3300009177 | Unclassified | 1104 |
| 454 | Ga0105248_10846879 | 3300009177 | Bacteria | 1032 |
| 455 | Ga0105248_10946294 | 3300009177 | Unclassified | 973 |
| 456 | Ga0105237_10010849 | 3300009545 | Bacteria | 9669 |
| 457 | Ga0105237_10019745 | 3300009545 | Bacteria | 6957 |
| 458 | Ga0105238_10008842 | 3300009551 | Bacteria | 10074 |
| 459 | Ga0105249_10000052 | 3300009553 | Bacteria | 168047 |
| 460 | Ga0105249_10004897 | 3300009553 | Bacteria | 11556 |
| 461 | Ga0105249_10013685 | 3300009553 | Bacteria | 7165 |
| 462 | Ga0105249_10017459 | 3300009553 | Bacteria | 6371 |
| 463 | Ga0105249_10176017 | 3300009553 | Bacteria | 2078 |
| 464 | Ga0105249_10194020 | 3300009553 | Bacteria | 1984 |
| 465 | Ga0105249_10711010 | 3300009553 | Unclassified | 1065 |
| 466 | Ga0105239_10104143 | 3300010375 | Bacteria | 3142 |
| 467 | Ga0105239_10116098 | 3300010375 | Bacteria | 2970 |
| 468 | Ga0105239_10303061 | 3300010375 | Bacteria | 1799 |
| 469 | Ga0105239_10472490 | 3300010375 | Bacteria | 1424 |
| 470 | Ga0105239_10563382 | 3300010375 | Unclassified | 1298 |
| 471 | Ga0105246_10019006 | 3300011119 | Bacteria | 4383 |
| 472 | Ga0105246_10041615 | 3300011119 | Bacteria | 3106 |
| 473 | Ga0105246_10079138 | 3300011119 | Bacteria | 2337 |
| 474 | Ga0105246_10094377 | 3300011119 | Unclassified | 2164 |
| 475 | Ga0105246_10111502 | 3300011119 | Bacteria | 2010 |
| 476 | Ga0105246_10161407 | 3300011119 | Bacteria | 1708 |
| 477 | Ga0157373_10016111 | 3300013100 | Bacteria | 5456 |
| 478 | Ga0157373_10033790 | 3300013100 | Bacteria | 3676 |
| 479 | Ga0157371_10210552 | 3300013102 | Bacteria | 1395 |
| 480 | Ga0157371_10273083 | 3300013102 | Bacteria | 1220 |
| 481 | Ga0157374_10015970 | 3300013296 | Bacteria | 6594 |
| 482 | Ga0157374_10135043 | 3300013296 | Bacteria | 2391 |
| 483 | Ga0157378_10000095 | 3300013297 | Bacteria | 84288 |
| 484 | Ga0157378_10001282 | 3300013297 | Bacteria | 22599 |
| 485 | Ga0157378_10003380 | 3300013297 | Bacteria | 14189 |
| 486 | Ga0157378_10010625 | 3300013297 | Bacteria | 8047 |
| 487 | Ga0157378_10021341 | 3300013297 | Bacteria | 5694 |
| 488 | Ga0157378_10043585 | 3300013297 | Bacteria | 3984 |
| 489 | Ga0157378_10048711 | 3300013297 | Unclassified | 3768 |
| 490 | Ga0157378_10060725 | 3300013297 | Bacteria | 3373 |
| 491 | Ga0157378_10061510 | 3300013297 | Bacteria | 3351 |
| 492 | Ga0157378_10070903 | 3300013297 | Unclassified | 3129 |
| 493 | Ga0157378_10194990 | 3300013297 | Unclassified | 1913 |
| 494 | Ga0157378_10280336 | 3300013297 | Unclassified | 1606 |
| 495 | Ga0163162_10000001 | 3300013306 | Bacteria | 751833 |
| 496 | Ga0163162_10009010 | 3300013306 | Bacteria | 9702 |
| 497 | Ga0163162_10010751 | 3300013306 | Bacteria | 8905 |
| 498 | Ga0163162_10012811 | 3300013306 | Bacteria | 8191 |
| 499 | Ga0163162_10039048 | 3300013306 | Bacteria | 4740 |
| 500 | Ga0163162_10044633 | 3300013306 | Bacteria | 4439 |
| 501 | Ga0163162_10149517 | 3300013306 | Bacteria | 2452 |
| 502 | Ga0163162_10170307 | 3300013306 | Bacteria | 2302 |
| 503 | Ga0163162_10463601 | 3300013306 | Bacteria | 1398 |
| 504 | Ga0163162_10504261 | 3300013306 | Unclassified | 1340 |
| 505 | Ga0163162_10526133 | 3300013306 | Bacteria | 1312 |
| 506 | Ga0163162_10543775 | 3300013306 | Bacteria | 1290 |
| 507 | Ga0163162_10891855 | 3300013306 | Bacteria | 1003 |
| 508 | Ga0157372_10012910 | 3300013307 | Bacteria | 8904 |
| 509 | Ga0157372_10113831 | 3300013307 | Bacteria | 3101 |
| 510 | Ga0157372_10295285 | 3300013307 | Bacteria | 1885 |
| 511 | Ga0157372_10557490 | 3300013307 | Bacteria | 1336 |
| 512 | Ga0157372_10706495 | 3300013307 | Bacteria | 1173 |
| 513 | Ga0157375_10004418 | 3300013308 | Bacteria | 12206 |
| 514 | Ga0157375_10014917 | 3300013308 | Bacteria | 6946 |
| 515 | Ga0157375_10036058 | 3300013308 | Bacteria | 4727 |
| 516 | Ga0157375_10067251 | 3300013308 | Bacteria | 3580 |
| 517 | Ga0157375_10073908 | 3300013308 | Bacteria | 3429 |
| 518 | Ga0157375_10140339 | 3300013308 | Unclassified | 2543 |
| 519 | Ga0157375_10167282 | 3300013308 | Bacteria | 2344 |
| 520 | Ga0157375_10198777 | 3300013308 | Bacteria | 2160 |
| 521 | Ga0157375_10262499 | 3300013308 | Unclassified | 1889 |
| 522 | Ga0157375_10296720 | 3300013308 | Unclassified | 1779 |
| 523 | Ga0157375_10757279 | 3300013308 | Bacteria | 1122 |
| 524 | Ga0163163_10001533 | 3300014325 | Bacteria | 19476 |
| 525 | Ga0163163_10001831 | 3300014325 | Bacteria | 17942 |
| 526 | Ga0163163_10007435 | 3300014325 | Bacteria | 9669 |
| 527 | Ga0163163_10074554 | 3300014325 | Bacteria | 3385 |
| 528 | Ga0163163_10132213 | 3300014325 | Bacteria | 2536 |
| 529 | Ga0163163_10145626 | 3300014325 | Unclassified | 2412 |
| 530 | Ga0163163_10207137 | 3300014325 | Unclassified | 2010 |
| 531 | Ga0163163_10220860 | 3300014325 | Bacteria | 1943 |
| 532 | Ga0163163_10310393 | 3300014325 | Bacteria | 1630 |
| 533 | Ga0163163_10312194 | 3300014325 | Bacteria | 1625 |
| 534 | Ga0163163_10419274 | 3300014325 | Bacteria | 1397 |
| 535 | Ga0163163_10577833 | 3300014325 | Unclassified | 1187 |
| 536 | Ga0157380_10001174 | 3300014326 | Bacteria | 16974 |
| 537 | Ga0157380_10001205 | 3300014326 | Bacteria | 16752 |
| 538 | Ga0157380_10015063 | 3300014326 | Bacteria | 5673 |
| 539 | Ga0157380_10017030 | 3300014326 | Bacteria | 5370 |
| 540 | Ga0157380_10041006 | 3300014326 | Bacteria | 3610 |
| 541 | Ga0157380_10045487 | 3300014326 | Unclassified | 3445 |
| 542 | Ga0157380_10183100 | 3300014326 | Unclassified | 1842 |
| 543 | Ga0157380_10239283 | 3300014326 | Unclassified | 1635 |
| 544 | Ga0157380_10379173 | 3300014326 | Unclassified | 1334 |
| 545 | Ga0157380_10547028 | 3300014326 | Bacteria | 1135 |
| 546 | Ga0157377_10005057 | 3300014745 | Bacteria | 6157 |
| 547 | Ga0157377_10183115 | 3300014745 | Bacteria | 1319 |
| 548 | Ga0157377_10246536 | 3300014745 | Bacteria | 1156 |
| 549 | Ga0157377_10480803 | 3300014745 | Bacteria | 864 |
| 550 | Ga0157379_10025079 | 3300014968 | Bacteria | 5294 |
| 551 | Ga0157379_10146621 | 3300014968 | Bacteria | 2128 |
| 552 | Ga0157379_10269493 | 3300014968 | Unclassified | 1548 |
| 553 | Ga0157379_10290117 | 3300014968 | Bacteria | 1490 |
| 554 | Ga0157376_10014842 | 3300014969 | Bacteria | 5863 |
| 555 | Ga0157376_10445779 | 3300014969 | Unclassified | 1262 |
| 556 | Ga0163161_10007521 | 3300017792 | Bacteria | 7527 |
| 557 | Ga0163161_10032403 | 3300017792 | Bacteria | 3731 |
| 558 | Ga0163161_10282467 | 3300017792 | Bacteria | 1302 |
| 559 | Ga0163161_10329395 | 3300017792 | Bacteria | 1209 |
| 560 | Ga0213876_10000251 | 3300021384 | Bacteria | 50908 |
| 561 | Ga0213876_10000279 | 3300021384 | Bacteria | 46863 |
| 562 | Ga0207672_1000270 | 3300025223 | Bacteria | 7071 |
| 563 | Ga0207697_10013752 | 3300025315 | Bacteria | 3372 |
| 564 | Ga0207697_10077790 | 3300025315 | Bacteria | 1395 |
| 565 | Ga0207713_1049101 | 3300025735 | Bacteria | 1694 |
| 566 | Ga0207653_10000171 | 3300025885 | Bacteria | 45563 |
| 567 | Ga0207653_10001174 | 3300025885 | Bacteria | 8552 |
| 568 | Ga0207642_10076213 | 3300025899 | Bacteria | 1613 |
| 569 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 570 | Ga0207710_10006048 | 3300025900 | Bacteria | 5187 |
| 571 | Ga0207688_10080312 | 3300025901 | Unclassified | 1861 |
| 572 | Ga0207680_10106801 | 3300025903 | Bacteria | 1808 |
| 573 | Ga0207685_10000006 | 3300025905 | Bacteria | 284255 |
| 574 | Ga0207645_10034311 | 3300025907 | Bacteria | 3260 |
| 575 | Ga0207645_10104839 | 3300025907 | Unclassified | 1826 |
| 576 | Ga0207643_10007213 | 3300025908 | Bacteria | 5967 |
| 577 | Ga0207643_10044664 | 3300025908 | Bacteria | 2501 |
| 578 | Ga0207643_10094051 | 3300025908 | Bacteria | 1750 |
| 579 | Ga0207684_10000079 | 3300025910 | Bacteria | 179842 |
| 580 | Ga0207684_10007353 | 3300025910 | Bacteria | 9935 |
| 581 | Ga0207684_10027931 | 3300025910 | Unclassified | 4806 |
| 582 | Ga0207684_10116395 | 3300025910 | Bacteria | 2290 |
| 583 | Ga0207654_10021305 | 3300025911 | Bacteria | 3445 |
| 584 | Ga0207654_10094769 | 3300025911 | Bacteria | 1827 |
| 585 | Ga0207707_10034115 | 3300025912 | Bacteria | 4453 |
| 586 | Ga0207707_10046482 | 3300025912 | Bacteria | 3781 |
| 587 | Ga0207707_10266148 | 3300025912 | Unclassified | 1486 |
| 588 | Ga0207671_10010718 | 3300025914 | Bacteria | 7536 |
| 589 | Ga0207660_10033557 | 3300025917 | Bacteria | 3551 |
| 590 | Ga0207662_10003190 | 3300025918 | Bacteria | 8392 |
| 591 | Ga0207662_10017971 | 3300025918 | Bacteria | 4005 |
| 592 | Ga0207662_10021969 | 3300025918 | Bacteria | 3653 |
| 593 | Ga0207662_10043560 | 3300025918 | Bacteria | 2648 |
| 594 | Ga0207662_10260595 | 3300025918 | Bacteria | 1141 |
| 595 | Ga0207649_10056940 | 3300025920 | Bacteria | 2442 |
| 596 | Ga0207649_10196675 | 3300025920 | Unclassified | 1421 |
| 597 | Ga0207649_10441359 | 3300025920 | Bacteria | 981 |
| 598 | Ga0207652_10038997 | 3300025921 | Bacteria | 4030 |
| 599 | Ga0207652_10126285 | 3300025921 | Bacteria | 2279 |
| 600 | Ga0207646_10001342 | 3300025922 | Bacteria | 30550 |
| 601 | Ga0207646_10001700 | 3300025922 | Bacteria | 26758 |
| 602 | Ga0207646_10020611 | 3300025922 | Bacteria | 6106 |
| 603 | Ga0207646_10102864 | 3300025922 | Bacteria | 2561 |
| 604 | Ga0207646_10133647 | 3300025922 | Bacteria | 2233 |
| 605 | Ga0207646_10174609 | 3300025922 | Bacteria | 1941 |
| 606 | Ga0207646_10322797 | 3300025922 | Bacteria | 1395 |
| 607 | Ga0207646_10396313 | 3300025922 | Bacteria | 1247 |
| 608 | Ga0207681_10001745 | 3300025923 | Bacteria | 13958 |
| 609 | Ga0207681_10005262 | 3300025923 | Bacteria | 7950 |
| 610 | Ga0207681_10011079 | 3300025923 | Bacteria | 5537 |
| 611 | Ga0207681_10173897 | 3300025923 | Unclassified | 1634 |
| 612 | Ga0207694_10020544 | 3300025924 | Bacteria | 4998 |
| 613 | Ga0207694_10087086 | 3300025924 | Bacteria | 2460 |
| 614 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 615 | Ga0207650_10008569 | 3300025925 | Bacteria | 6982 |
| 616 | Ga0207650_10122387 | 3300025925 | Bacteria | 2027 |
| 617 | Ga0207650_10239752 | 3300025925 | Bacteria | 1465 |
| 618 | Ga0207650_10283155 | 3300025925 | Bacteria | 1350 |
| 619 | Ga0207650_10360810 | 3300025925 | Bacteria | 1197 |
| 620 | Ga0207659_10059289 | 3300025926 | Bacteria | 2751 |
| 621 | Ga0207659_10591353 | 3300025926 | Unclassified | 945 |
| 622 | Ga0207644_10001610 | 3300025931 | Bacteria | 14561 |
| 623 | Ga0207644_10024830 | 3300025931 | Bacteria | 4117 |
| 624 | Ga0207644_10164322 | 3300025931 | Unclassified | 1728 |
| 625 | Ga0207644_10224378 | 3300025931 | Bacteria | 1491 |
| 626 | Ga0207690_10102531 | 3300025932 | Bacteria | 2046 |
| 627 | Ga0207706_10033906 | 3300025933 | Unclassified | 4544 |
| 628 | Ga0207706_10062945 | 3300025933 | Bacteria | 3267 |
| 629 | Ga0207686_10000021 | 3300025934 | Bacteria | 181793 |
| 630 | Ga0207686_10000283 | 3300025934 | Bacteria | 37692 |
| 631 | Ga0207686_10001321 | 3300025934 | Bacteria | 14158 |
| 632 | Ga0207686_10033667 | 3300025934 | Unclassified | 3060 |
| 633 | Ga0207686_10072162 | 3300025934 | Bacteria | 2224 |
| 634 | Ga0207686_10074054 | 3300025934 | Bacteria | 2199 |
| 635 | Ga0207686_10277884 | 3300025934 | Bacteria | 1235 |
| 636 | Ga0207709_10000069 | 3300025935 | Bacteria | 183367 |
| 637 | Ga0207709_10000921 | 3300025935 | Bacteria | 22171 |
| 638 | Ga0207709_10003136 | 3300025935 | Bacteria | 9943 |
| 639 | Ga0207709_10037073 | 3300025935 | Unclassified | 2895 |
| 640 | Ga0207709_10037714 | 3300025935 | Bacteria | 2873 |
| 641 | Ga0207709_10153624 | 3300025935 | Unclassified | 1597 |
| 642 | Ga0207709_10431305 | 3300025935 | Bacteria | 1015 |
| 643 | Ga0207709_10572715 | 3300025935 | Bacteria | 891 |
| 644 | Ga0207670_10000250 | 3300025936 | Bacteria | 33568 |
| 645 | Ga0207670_10060445 | 3300025936 | Bacteria | 2582 |
| 646 | Ga0207670_10078127 | 3300025936 | Bacteria | 2307 |
| 647 | Ga0207670_10161749 | 3300025936 | Bacteria | 1671 |
| 648 | Ga0207670_10469109 | 3300025936 | Unclassified | 1018 |
| 649 | Ga0207669_10110184 | 3300025937 | Bacteria | 1843 |
| 650 | Ga0207704_10357412 | 3300025938 | Unclassified | 1139 |
| 651 | Ga0207665_10000139 | 3300025939 | Bacteria | 48695 |
| 652 | Ga0207665_10078025 | 3300025939 | Unclassified | 2274 |
| 653 | Ga0207665_10112476 | 3300025939 | Bacteria | 1915 |
| 654 | Ga0207691_10001421 | 3300025940 | Bacteria | 23877 |
| 655 | Ga0207691_10207170 | 3300025940 | Bacteria | 1705 |
| 656 | Ga0207711_10019129 | 3300025941 | Bacteria | 5700 |
| 657 | Ga0207711_10132721 | 3300025941 | Bacteria | 2234 |
| 658 | Ga0207711_10156595 | 3300025941 | Bacteria | 2059 |
| 659 | Ga0207711_10159891 | 3300025941 | Bacteria | 2038 |
| 660 | Ga0207711_10359566 | 3300025941 | Bacteria | 1348 |
| 661 | Ga0207711_10438171 | 3300025941 | Unclassified | 1216 |
| 662 | Ga0207711_10524660 | 3300025941 | Bacteria | 1104 |
| 663 | Ga0207711_10542011 | 3300025941 | Bacteria | 1085 |
| 664 | Ga0207711_10654226 | 3300025941 | Unclassified | 980 |
| 665 | Ga0207689_10002102 | 3300025942 | Bacteria | 18756 |
| 666 | Ga0207689_10009874 | 3300025942 | Bacteria | 8227 |
| 667 | Ga0207689_10012415 | 3300025942 | Bacteria | 7283 |
| 668 | Ga0207689_10019251 | 3300025942 | Bacteria | 5755 |
| 669 | Ga0207689_10048605 | 3300025942 | Unclassified | 3499 |
| 670 | Ga0207689_10257770 | 3300025942 | Bacteria | 1443 |
| 671 | Ga0207689_10495372 | 3300025942 | Bacteria | 1024 |
| 672 | Ga0207689_10510471 | 3300025942 | Bacteria | 1008 |
| 673 | Ga0207679_10106366 | 3300025945 | Bacteria | 2205 |
| 674 | Ga0207679_10166511 | 3300025945 | Bacteria | 1810 |
| 675 | Ga0207679_10170112 | 3300025945 | Bacteria | 1793 |
| 676 | Ga0207679_10304566 | 3300025945 | Bacteria | 1375 |
| 677 | Ga0207679_10469627 | 3300025945 | Bacteria | 1118 |
| 678 | Ga0207679_10487633 | 3300025945 | Unclassified | 1098 |
| 679 | Ga0207651_10052772 | 3300025960 | Bacteria | 2774 |
| 680 | Ga0207651_10055671 | 3300025960 | Bacteria | 2718 |
| 681 | Ga0207651_10113650 | 3300025960 | Bacteria | 2038 |
| 682 | Ga0207651_10291202 | 3300025960 | Bacteria | 1354 |
| 683 | Ga0207651_10344551 | 3300025960 | Bacteria | 1253 |
| 684 | Ga0207651_10380402 | 3300025960 | Bacteria | 1196 |
| 685 | Ga0207651_10719418 | 3300025960 | Unclassified | 881 |
| 686 | Ga0207651_10728768 | 3300025960 | Bacteria | 875 |
| 687 | Ga0207712_10000925 | 3300025961 | Bacteria | 21172 |
| 688 | Ga0207712_10005189 | 3300025961 | Bacteria | 8239 |
| 689 | Ga0207712_10017134 | 3300025961 | Bacteria | 4701 |
| 690 | Ga0207712_10033995 | 3300025961 | Bacteria | 3451 |
| 691 | Ga0207712_10194852 | 3300025961 | Bacteria | 1602 |
| 692 | Ga0207712_10400078 | 3300025961 | Unclassified | 1154 |
| 693 | Ga0207712_10454617 | 3300025961 | Bacteria | 1087 |
| 694 | Ga0207712_10582738 | 3300025961 | Bacteria | 966 |
| 695 | Ga0207668_10005063 | 3300025972 | Bacteria | 7760 |
| 696 | Ga0207640_10012393 | 3300025981 | Unclassified | 4853 |
| 697 | Ga0207640_10457192 | 3300025981 | Unclassified | 1054 |
| 698 | Ga0207658_10165555 | 3300025986 | Bacteria | 1816 |
| 699 | Ga0207677_10099650 | 3300026023 | Bacteria | 2134 |
| 700 | Ga0207677_10147209 | 3300026023 | Bacteria | 1812 |
| 701 | Ga0207703_10000043 | 3300026035 | Bacteria | 161047 |
| 702 | Ga0207703_10016211 | 3300026035 | Bacteria | 5808 |
| 703 | Ga0207703_10102323 | 3300026035 | Unclassified | 2430 |
| 704 | Ga0207703_10103548 | 3300026035 | Bacteria | 2416 |
| 705 | Ga0207703_10108349 | 3300026035 | Unclassified | 2366 |
| 706 | Ga0207703_10122477 | 3300026035 | Unclassified | 2234 |
| 707 | Ga0207703_10304678 | 3300026035 | Bacteria | 1454 |
| 708 | Ga0207639_10081730 | 3300026041 | Bacteria | 2560 |
| 709 | Ga0207708_10000196 | 3300026075 | Bacteria | 47880 |
| 710 | Ga0207708_10010047 | 3300026075 | Bacteria | 7027 |
| 711 | Ga0207708_10024519 | 3300026075 | Bacteria | 4563 |
| 712 | Ga0207708_10038708 | 3300026075 | Bacteria | 3632 |
| 713 | Ga0207708_10097546 | 3300026075 | Bacteria | 2271 |
| 714 | Ga0207708_10152920 | 3300026075 | Bacteria | 1818 |
| 715 | Ga0207702_10023166 | 3300026078 | Bacteria | 5150 |
| 716 | Ga0207641_10053400 | 3300026088 | Unclassified | 3425 |
| 717 | Ga0207641_10066364 | 3300026088 | Bacteria | 3088 |
| 718 | Ga0207641_10228323 | 3300026088 | Bacteria | 1729 |
| 719 | Ga0207641_10235805 | 3300026088 | Unclassified | 1702 |
| 720 | Ga0207641_10402557 | 3300026088 | Unclassified | 1314 |
| 721 | Ga0207648_10025398 | 3300026089 | Bacteria | 5277 |
| 722 | Ga0207648_10052268 | 3300026089 | Bacteria | 3572 |
| 723 | Ga0207648_10052499 | 3300026089 | Unclassified | 3564 |
| 724 | Ga0207648_10209835 | 3300026089 | Unclassified | 1728 |
| 725 | Ga0207676_10003808 | 3300026095 | Bacteria | 10661 |
| 726 | Ga0207676_10014298 | 3300026095 | Bacteria | 5707 |
| 727 | Ga0207676_10022718 | 3300026095 | Bacteria | 4616 |
| 728 | Ga0207676_10057488 | 3300026095 | Unclassified | 3063 |
| 729 | Ga0207676_10286415 | 3300026095 | Bacteria | 1498 |
| 730 | Ga0207676_10594110 | 3300026095 | Unclassified | 1062 |
| 731 | Ga0207676_10632295 | 3300026095 | Unclassified | 1031 |
| 732 | Ga0207674_10001115 | 3300026116 | Bacteria | 34877 |
| 733 | Ga0207674_10033931 | 3300026116 | Bacteria | 5339 |
| 734 | Ga0207674_10141200 | 3300026116 | Bacteria | 2368 |
| 735 | Ga0207674_10147004 | 3300026116 | Bacteria | 2315 |
| 736 | Ga0207674_10276964 | 3300026116 | Bacteria | 1625 |
| 737 | Ga0207674_10429880 | 3300026116 | Bacteria | 1276 |
| 738 | Ga0207674_10536449 | 3300026116 | Unclassified | 1130 |
| 739 | Ga0207674_10738722 | 3300026116 | Unclassified | 950 |
| 740 | Ga0207675_100003693 | 3300026118 | Bacteria | 14905 |
| 741 | Ga0207675_100008300 | 3300026118 | Bacteria | 9782 |
| 742 | Ga0207675_100017343 | 3300026118 | Bacteria | 6721 |
| 743 | Ga0207675_100027734 | 3300026118 | Bacteria | 5275 |
| 744 | Ga0207675_100152890 | 3300026118 | Bacteria | 2197 |
| 745 | Ga0207675_100188276 | 3300026118 | Bacteria | 1979 |
| 746 | Ga0207675_100408669 | 3300026118 | Bacteria | 1339 |
| 747 | Ga0207675_100964185 | 3300026118 | Bacteria | 870 |
| 748 | Ga0207683_10146154 | 3300026121 | Bacteria | 2132 |
| 749 | Ga0207683_10263611 | 3300026121 | Unclassified | 1573 |
| 750 | Ga0207698_10201010 | 3300026142 | Bacteria | 1784 |
| 751 | Ga0207428_10003589 | 3300027907 | Bacteria | 14977 |
| 752 | Ga0207428_10011034 | 3300027907 | Bacteria | 8032 |
| 753 | Ga0268266_10330643 | 3300028379 | Unclassified | 1428 |
| 754 | Ga0268265_10160070 | 3300028380 | Bacteria | 1911 |
| 755 | Ga0268265_10166170 | 3300028380 | Bacteria | 1881 |
| 756 | Ga0268265_10247986 | 3300028380 | Bacteria | 1575 |
| 757 | Ga0268265_10429373 | 3300028380 | Unclassified | 1229 |
| 758 | Ga0268265_10582847 | 3300028380 | Unclassified | 1066 |
| 759 | Ga0268265_10775501 | 3300028380 | Unclassified | 932 |
| 760 | Ga0268264_10027695 | 3300028381 | Bacteria | 4632 |
| 761 | Ga0268264_10049768 | 3300028381 | Bacteria | 3488 |
| 762 | Ga0268264_10081762 | 3300028381 | Unclassified | 2762 |
| 763 | Ga0268264_10117447 | 3300028381 | Bacteria | 2339 |
| 764 | Ga0268264_10130419 | 3300028381 | Bacteria | 2227 |
| 765 | Ga0268264_10157374 | 3300028381 | Bacteria | 2043 |
| 766 | Ga0268264_10238304 | 3300028381 | Bacteria | 1684 |
| 767 | Ga0268264_10317595 | 3300028381 | Unclassified | 1472 |
| 768 | Ga0268264_10576573 | 3300028381 | Bacteria | 1106 |
| 769 | Ga0268264_10620847 | 3300028381 | Bacteria | 1067 |
| 770 | Ga0307513_10000238 | 3300031456 | Bacteria | 80100 |
| 771 | Ga0307513_10322989 | 3300031456 | Bacteria | 1301 |
| 772 | Ga0307408_100013384 | 3300031548 | Bacteria | 5444 |
| 773 | Ga0307408_100042473 | 3300031548 | Bacteria | 3230 |
| 774 | Ga0307408_100078016 | 3300031548 | Bacteria | 2468 |
| 775 | Ga0307408_100133239 | 3300031548 | Unclassified | 1941 |
| 776 | Ga0307405_10015061 | 3300031731 | Bacteria | 4176 |
| 777 | Ga0307413_10036152 | 3300031824 | Bacteria | 2841 |
| 778 | Ga0307410_10002023 | 3300031852 | Bacteria | 9564 |
| 779 | Ga0307406_10007704 | 3300031901 | Bacteria | 5981 |
| 780 | Ga0307406_10186241 | 3300031901 | Bacteria | 1516 |
| 781 | Ga0307412_10018014 | 3300031911 | Unclassified | 4239 |
| 782 | Ga0307409_100075645 | 3300031995 | Bacteria | 2697 |
| 783 | Ga0307409_100223084 | 3300031995 | Bacteria | 1703 |
| 784 | Ga0307416_100010309 | 3300032002 | Bacteria | 6166 |
| 785 | Ga0307416_100526014 | 3300032002 | Bacteria | 1252 |
| 786 | Ga0307414_10007653 | 3300032004 | Bacteria | 6081 |
| 787 | Ga0307414_10491564 | 3300032004 | Bacteria | 1084 |
| 788 | Ga0307415_100007828 | 3300032126 | Bacteria | 5873 |
| 789 | Ga0307415_100277030 | 3300032126 | Bacteria | 1377 |
| 790 | Ga0373951_0000266 | 3300035091 | Bacteria | 17178 |
| 791 | Ga0373942_0004261 | 3300035207 | Unclassified | 3330 |
| 792 | Ga0373935_0309885 | 3300035692 | Unclassified | 1118 |
| 793 | Ga0373937_0026568 | 3300036401 | Bacteria | 5231 |
| 794 | Ga0395899_0045268 | 3300037312 | Bacteria | 3279 |
| 795 | Ga0395900_0067377 | 3300037418 | Bacteria | 3678 |
| 796 | Ga0395900_0071081 | 3300037418 | Bacteria | 3577 |
| 797 | Ga0395900_0218954 | 3300037418 | Bacteria | 1920 |
| 798 | Ga0395900_0352138 | 3300037418 | Bacteria | 1446 |
| 799 | Ga0395900_0381631 | 3300037418 | Bacteria | 1377 |
| 800 | Ga0395898_0216244 | 3300037466 | Unclassified | 1828 |
| 801 | Ga0395905_0010361 | 3300037471 | Bacteria | 9076 |
| 802 | Ga0395905_0343158 | 3300037471 | Bacteria | 1385 |
| 803 | Ga0395901_0778767 | 3300038443 | Unclassified | 947 |
| 804 | Ga0242422_00216 | 3300038699 | Bacteria | 3315 |
| 805 | Ga0242420_004095 | 3300038996 | Bacteria | 2187 |
| 806 | Ga0242420_006840 | 3300038996 | Bacteria | 1815 |
| 807 | Ga0242420_015403 | 3300038996 | Unclassified | 1322 |
| 808 | Ga0436365_0344253 | 3300039437 | Bacteria | 119698 |
| 809 | Ga0436365_1630086 | 3300039437 | Bacteria | 73381 |
| 810 | Ga0439455_0002290 | 3300042012 | Bacteria | 3447 |
| 811 | Ga0439458_0001735 | 3300042157 | Bacteria | 5441 |
| 812 | Ga0439464_0064509 | 3300042439 | Bacteria | 1076 |
| 813 | Ga0451577_0122848 | 3300042876 | Bacteria | 2326 |
| 814 | Ga0451576_0070619 | 3300045051 | Bacteria | 3635 |
| 815 | Ga0451576_0356829 | 3300045051 | Bacteria | 1531 |
| 816 | Ga0451576_0418537 | 3300045051 | Unclassified | 1406 |
| 817 | Ga0451576_0611580 | 3300045051 | Bacteria | 1145 |
| 818 | Ga0451576_0981769 | 3300045051 | Bacteria | 885 |
| 819 | Ga0495639_0070334 | 3300046475 | Unclassified | 1616 |
| 820 | Ga0495584_0201882 | 3300046491 | Unclassified | 1011 |
| 821 | Ga0495632_0026354 | 3300046519 | Bacteria | 3061 |
| 822 | Ga0495663_0001444 | 3300046525 | Bacteria | 7503 |
| 823 | Ga0495598_0009606 | 3300046537 | Bacteria | 2292 |
| 824 | Ga0495621_0001077 | 3300046539 | Bacteria | 7003 |
| 825 | Ga0495656_0148571 | 3300046615 | Bacteria | 1130 |
| 826 | Ga0495659_0092218 | 3300046664 | Unclassified | 1164 |
| 827 | Ga0495647_0126097 | 3300046681 | Unclassified | 1081 |
| 828 | Ga0495669_0105890 | 3300046684 | Unclassified | 1310 |
| 829 | Ga0495670_0126650 | 3300046691 | Bacteria | 1330 |
| 830 | Ga0495636_0105731 | 3300047318 | Unclassified | 1234 |
| 831 | Ga0495636_0155542 | 3300047318 | Bacteria | 1028 |
| 832 | Ga0495674_0347914 | 3300047319 | Unclassified | 1204 |
| 833 | Ga0495672_0138844 | 3300047320 | Bacteria | 1271 |
| 834 | Ga0496100_0152678 | 3300048903 | Unclassified | 1649 |
| 835 | Ga0496102_0011427 | 3300048905 | Bacteria | 7655 |
| 836 | Ga0496102_0116640 | 3300048905 | Bacteria | 2492 |
| 837 | Ga0496103_0089903 | 3300048906 | Bacteria | 1937 |
| 838 | Ga0496106_0055940 | 3300048909 | Bacteria | 2983 |
| 839 | Ga0496106_0386594 | 3300048909 | Bacteria | 1124 |
| 840 | Ga0496106_0415000 | 3300048909 | Unclassified | 1082 |
| 841 | Ga0496107_0013028 | 3300048910 | Bacteria | 5809 |
| 842 | Ga0496108_0368381 | 3300048911 | Bacteria | 1254 |
| 843 | Ga0496110_0389074 | 3300048913 | Unclassified | 1271 |
| 844 | Ga0496110_0928606 | 3300048913 | Bacteria | 777 |
| 845 | Ga0496112_0025724 | 3300048915 | Bacteria | 5653 |
| 846 | Ga0496112_0162595 | 3300048915 | Bacteria | 2199 |
| 847 | Ga0496113_0256050 | 3300048916 | Bacteria | 1398 |
| 848 | Ga0496113_0580913 | 3300048916 | Unclassified | 898 |
| 849 | Ga0501291_007157 | 3300049514 | Bacteria | 1506 |
| 850 | Ga0501291_010725 | 3300049514 | Bacteria | 1309 |
| 851 | Ga0501291_018911 | 3300049514 | Bacteria | 1076 |
| 852 | Ga0501292_003124 | 3300049515 | Bacteria | 2191 |
| 853 | Ga0501292_003582 | 3300049515 | Bacteria | 2084 |
| 854 | Ga0501292_009963 | 3300049515 | Bacteria | 1417 |
| 855 | Ga0501292_015774 | 3300049515 | Unclassified | 1184 |
| 856 | Ga0501295_041091 | 3300049518 | Unclassified | 959 |
| 857 | Ga0501298_002676 | 3300049521 | Bacteria | 2716 |
| 858 | Ga0501299_000754 | 3300049522 | Bacteria | 3928 |
| 859 | Ga0501038_0032512 | 3300049574 | Bacteria | 4602 |
| 860 | Ga0501198_001879 | 3300049649 | Bacteria | 2774 |
| 861 | Ga0501198_002730 | 3300049649 | Unclassified | 2389 |
| 862 | Ga0501198_004098 | 3300049649 | Bacteria | 2014 |
| 863 | Ga0501202_001705 | 3300049652 | Bacteria | 3563 |
| 864 | Ga0501202_005263 | 3300049652 | Bacteria | 2291 |
| 865 | Ga0501202_006175 | 3300049652 | Bacteria | 2137 |
| 866 | Ga0501207_002171 | 3300049654 | Bacteria | 2514 |
| 867 | Ga0501207_008031 | 3300049654 | Bacteria | 1518 |
| 868 | Ga0501208_004930 | 3300049655 | Bacteria | 1609 |
| 869 | Ga0501208_005660 | 3300049655 | Bacteria | 1549 |
| 870 | Ga0501214_000540 | 3300049659 | Bacteria | 2576 |
| 871 | Ga0501216_002071 | 3300049660 | Bacteria | 2810 |
| 872 | Ga0501216_013672 | 3300049660 | Bacteria | 1349 |
| 873 | Ga0501216_019021 | 3300049660 | Unclassified | 1187 |
| 874 | Ga0501217_000517 | 3300049661 | Bacteria | 6418 |
| 875 | Ga0501217_002052 | 3300049661 | Bacteria | 3898 |
| 876 | Ga0501217_015844 | 3300049661 | Bacteria | 1721 |
| 877 | Ga0501223_000504 | 3300049663 | Bacteria | 9463 |
| 878 | Ga0501223_006582 | 3300049663 | Unclassified | 2399 |
| 879 | Ga0501224_000129 | 3300049664 | Bacteria | 8262 |
| 880 | Ga0501227_000295 | 3300049665 | Bacteria | 10300 |
| 881 | Ga0501227_010369 | 3300049665 | Bacteria | 2019 |
| 882 | Ga0501230_003632 | 3300049667 | Bacteria | 2065 |
| 883 | Ga0501233_000556 | 3300049668 | Bacteria | 6049 |
| 884 | Ga0501233_004577 | 3300049668 | Bacteria | 2541 |
| 885 | Ga0501233_016218 | 3300049668 | Unclassified | 1543 |
| 886 | Ga0501233_020069 | 3300049668 | Bacteria | 1423 |
| 887 | Ga0501235_004630 | 3300049669 | Bacteria | 2974 |
| 888 | Ga0501235_010239 | 3300049669 | Bacteria | 2049 |
| 889 | Ga0501240_000221 | 3300049673 | Bacteria | 4271 |
| 890 | Ga0501243_003067 | 3300049675 | Unclassified | 2466 |
| 891 | Ga0501243_021776 | 3300049675 | Bacteria | 1059 |
| 892 | Ga0501243_033213 | 3300049675 | Bacteria | 887 |
| 893 | Ga0501246_004142 | 3300049676 | Unclassified | 1189 |
| 894 | Ga0501249_015567 | 3300049679 | Bacteria | 1627 |
| 895 | Ga0501249_036007 | 3300049679 | Unclassified | 1114 |
| 896 | Ga0501250_001921 | 3300049680 | Unclassified | 1806 |
| 897 | Ga0501251_002794 | 3300049681 | Unclassified | 1710 |
| 898 | Ga0501255_004304 | 3300049684 | Bacteria | 1373 |
| 899 | Ga0501256_004876 | 3300049685 | Bacteria | 1165 |
| 900 | Ga0501259_001344 | 3300049688 | Unclassified | 4115 |
| 901 | Ga0501259_009350 | 3300049688 | Bacteria | 1590 |
| 902 | Ga0501259_020058 | 3300049688 | Unclassified | 1182 |
| 903 | Ga0501260_006541 | 3300049689 | Bacteria | 1122 |
| 904 | Ga0501261_006049 | 3300049690 | Bacteria | 1535 |
| 905 | Ga0501225_0000145 | 3300049705 | Bacteria | 21644 |
| 906 | Ga0501225_0009821 | 3300049705 | Bacteria | 2718 |
| 907 | Ga0501225_0085746 | 3300049705 | Bacteria | 908 |
| 908 | Ga0501234_000075 | 3300049707 | Bacteria | 12283 |
| 909 | Ga0501234_002153 | 3300049707 | Bacteria | 3113 |
| 910 | Ga0501234_011417 | 3300049707 | Bacteria | 1389 |
| 911 | Ga0501245_009982 | 3300049708 | Bacteria | 1369 |
| 912 | Ga0501266_017453 | 3300049763 | Unclassified | 960 |
| 913 | Ga0501266_017623 | 3300049763 | Unclassified | 956 |
| 914 | Ga0501268_018587 | 3300049765 | Unclassified | 1170 |
| 915 | Ga0501268_036007 | 3300049765 | Unclassified | 915 |
| 916 | Ga0501270_014036 | 3300049767 | Unclassified | 1121 |
| 917 | Ga0501272_005644 | 3300049769 | Unclassified | 1323 |
| 918 | Ga0501272_006476 | 3300049769 | Bacteria | 1251 |
| 919 | Ga0501273_003589 | 3300049770 | Bacteria | 1657 |
| 920 | Ga0501273_011924 | 3300049770 | Bacteria | 1089 |
| 921 | Ga0501279_001580 | 3300049775 | Bacteria | 2997 |
| 922 | Ga0501279_001951 | 3300049775 | Bacteria | 2720 |
| 923 | Ga0501283_002494 | 3300049779 | Bacteria | 2392 |
| 924 | Ga0501212_001962 | 3300049851 | Bacteria | 2418 |
| 925 | Ga0501212_002472 | 3300049851 | Bacteria | 2232 |
| 926 | Ga0501212_003670 | 3300049851 | Bacteria | 1943 |
| 927 | Ga0501212_020353 | 3300049851 | Bacteria | 1022 |
| 928 | nmdc:mga05p37_184818_c1 | 3300050507 | Bacteria | 2534 |
| 929 | nmdc:mga05p37_207493_c1 | 3300050507 | Bacteria | 2369 |
| 930 | nmdc:mga05p37_275258_c1 | 3300050507 | Bacteria | 2010 |
| 931 | nmdc:mga05p37_282388_c1 | 3300050507 | Unclassified | 1979 |
| 932 | nmdc:mga05p37_303373_c1 | 3300050507 | Bacteria | 1896 |
| 933 | nmdc:mga05p37_43970_c1 | 3300050507 | Bacteria | 5495 |
| 934 | nmdc:mga05p37_558656_c1 | 3300050507 | Unclassified | 1301 |
| 935 | nmdc:mga05p37_61134_c1 | 3300050507 | Bacteria | 4637 |
| 936 | nmdc:mga05p37_83593_c1 | 3300050507 | Bacteria | 3933 |
| 937 | nmdc:mga09592_422740_c1 | 3300050508 | Bacteria | 1151 |
| 938 | nmdc:mga09592_71662_c1 | 3300050508 | Bacteria | 2941 |
| 939 | nmdc:mga09592_92749_c1 | 3300050508 | Bacteria | 2582 |
| 940 | nmdc:mga06r32_136876_c1 | 3300050510 | Bacteria | 2424 |
| 941 | nmdc:mga06r32_171085_c1 | 3300050510 | Bacteria | 2156 |
| 942 | nmdc:mga08y16_118388_c1 | 3300050511 | Bacteria | 2757 |
| 943 | nmdc:mga08y16_287332_c1 | 3300050511 | Bacteria | 1696 |
| 944 | nmdc:mga08y16_36035_c1 | 3300050511 | Bacteria | 5195 |
| 945 | nmdc:mga08y16_3905_c1 | 3300050511 | Bacteria | 15524 |
| 946 | nmdc:mga0n895_164400_c1 | 3300050512 | Bacteria | 2251 |
| 947 | nmdc:mga0n895_179377_c1 | 3300050512 | Bacteria | 2149 |
| 948 | nmdc:mga0n895_203507_c1 | 3300050512 | Bacteria | 2010 |
| 949 | nmdc:mga0n895_236459_c1 | 3300050512 | Bacteria | 1854 |
| 950 | nmdc:mga0n895_274902_c1 | 3300050512 | Bacteria | 1708 |
| 951 | nmdc:mga0n895_408379_c1 | 3300050512 | Unclassified | 1373 |
| 952 | nmdc:mga0n895_438430_c1 | 3300050512 | Unclassified | 1320 |
| 953 | nmdc:mga0n895_528069_c1 | 3300050512 | Bacteria | 1187 |
| 954 | nmdc:mga0n895_67515_c1 | 3300050512 | Bacteria | 3541 |
| 955 | nmdc:mga0rr50_301141_c1 | 3300050513 | Bacteria | 1341 |
| 956 | nmdc:mga0rr50_43685_c1 | 3300050513 | Bacteria | 3282 |
| 957 | nmdc:mga0rr50_520_c1 | 3300050513 | Bacteria | 20566 |
| 958 | nmdc:mga08x19_107_c1 | 3300050514 | Bacteria | 74172 |
| 959 | nmdc:mga08x19_193356_c1 | 3300050514 | Unclassified | 1393 |
| 960 | nmdc:mga0a205_152147_c1 | 3300050515 | Bacteria | 2213 |
| 961 | nmdc:mga0a205_177434_c1 | 3300050515 | Bacteria | 2025 |
| 962 | nmdc:mga0a205_190637_c1 | 3300050515 | Bacteria | 1942 |
| 963 | nmdc:mga0a205_263263_c1 | 3300050515 | Bacteria | 1602 |
| 964 | nmdc:mga0a205_312347_c1 | 3300050515 | Unclassified | 1444 |
| 965 | nmdc:mga0a205_75331_c1 | 3300050515 | Bacteria | 3261 |
| 966 | Ga0495655_0034110 | 3300053083 | Bacteria | 1257 |
| 967 | Ga0587085_005441 | 3300059506 | Bacteria | 1500 |
| 968 | Ga0587091_037760 | 3300059511 | Unclassified | 939 |
| 969 | Ga0530510_0073156 | 3300061734 | Bacteria | 2488 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050512 | nmdc:mga0n895_408379_c1 | nmdc:mga0n895_408379_c1_12_677 | 221 |
| 2 | 3300009098 | Ga0105245_10775801 | Ga0105245_107758011 | 227 |
| 3 | 3300049515 | Ga0501292_009963 | Ga0501292_009963_14_718 | 234 |
| 4 | 3300049675 | Ga0501243_003067 | Ga0501243_003067_158_874 | 237 |
| 5 | 3300046681 | Ga0495647_0126097 | Ga0495647_0126097_16_732 | 238 |
| 6 | 3300048913 | Ga0496110_0928606 | Ga0496110_0928606_25_741 | 238 |
| 7 | 3300050507 | nmdc:mga05p37_207493_c1 | nmdc:mga05p37_207493_c1_378_1094 | 238 |
| 8 | 3300050512 | nmdc:mga0n895_67515_c1 | nmdc:mga0n895_67515_c1_18_737 | 239 |
| 9 | 3300014325 | Ga0163163_10074554 | Ga0163163_100745543 | 243 |
| 10 | 3300005345 | Ga0070692_10279461 | Ga0070692_102794611 | 245 |
| 11 | 3300014326 | Ga0157380_10045487 | Ga0157380_100454871 | 245 |
| 12 | 3300009177 | Ga0105248_10846879 | Ga0105248_108468791 | 246 |
| 13 | 3300010375 | Ga0105239_10303061 | Ga0105239_103030612 | 246 |
| 14 | 3300037418 | Ga0395900_0352138 | Ga0395900_0352138_37_783 | 246 |
| 15 | 3300037471 | Ga0395905_0010361 | Ga0395905_0010361_4231_4977 | 246 |
| 16 | 3300038699 | Ga0242422_00216 | Ga0242422_00216_1764_2507 | 246 |
| 17 | 3300038996 | Ga0242420_004095 | Ga0242420_004095_558_1301 | 246 |
| 18 | 3300045051 | Ga0451576_0611580 | Ga0451576_0611580_108_851 | 246 |
| 19 | 3300050513 | nmdc:mga0rr50_43685_c1 | nmdc:mga0rr50_43685_c1_2232_2990 | 246 |
| 20 | 3300005985 | Ga0081539_10000941 | Ga0081539_1000094120 | 248 |
| 21 | 3300009148 | Ga0105243_10606802 | Ga0105243_106068021 | 248 |
| 22 | 3300005364 | Ga0070673_100061670 | Ga0070673_1000616701 | 249 |
| 23 | 3300009148 | Ga0105243_10405196 | Ga0105243_104051961 | 249 |
| 24 | 3300025960 | Ga0207651_10052772 | Ga0207651_100527724 | 249 |
| 25 | 3300031456 | Ga0307513_10000238 | Ga0307513_1000023851 | 249 |
| 26 | 3300032002 | Ga0307416_100526014 | Ga0307416_1005260141 | 249 |
| 27 | 3300000531 | CNBas_1002080 | CNBas_10020801 | 250 |
| 28 | 3300005440 | Ga0070705_100295684 | Ga0070705_1002956841 | 250 |
| 29 | 3300005549 | Ga0070704_100461537 | Ga0070704_1004615371 | 250 |
| 30 | 3300045051 | Ga0451576_0981769 | Ga0451576_0981769_79_846 | 250 |
| 31 | 3300050507 | nmdc:mga05p37_558656_c1 | nmdc:mga05p37_558656_c1_512_1273 | 250 |
| 32 | 3300009011 | Ga0105251_10081677 | Ga0105251_100816771 | 251 |
| 33 | 3300009148 | Ga0105243_10059880 | Ga0105243_100598801 | 251 |
| 34 | 3300009148 | Ga0105243_10256448 | Ga0105243_102564482 | 251 |
| 35 | 3300009174 | Ga0105241_10019245 | Ga0105241_100192456 | 251 |
| 36 | 3300009174 | Ga0105241_10046782 | Ga0105241_100467822 | 251 |
| 37 | 3300009177 | Ga0105248_10033984 | Ga0105248_100339843 | 251 |
| 38 | 3300009177 | Ga0105248_10387468 | Ga0105248_103874682 | 251 |
| 39 | 3300009177 | Ga0105248_10398892 | Ga0105248_103988922 | 251 |
| 40 | 3300009177 | Ga0105248_10746510 | Ga0105248_107465101 | 251 |
| 41 | 3300010375 | Ga0105239_10472490 | Ga0105239_104724902 | 251 |
| 42 | 3300011119 | Ga0105246_10019006 | Ga0105246_100190062 | 251 |
| 43 | 3300011119 | Ga0105246_10094377 | Ga0105246_100943772 | 251 |
| 44 | 3300013100 | Ga0157373_10033790 | Ga0157373_100337903 | 251 |
| 45 | 3300013306 | Ga0163162_10009010 | Ga0163162_100090101 | 251 |
| 46 | 3300013306 | Ga0163162_10044633 | Ga0163162_100446335 | 251 |
| 47 | 3300013306 | Ga0163162_10891855 | Ga0163162_108918551 | 251 |
| 48 | 3300013307 | Ga0157372_10706495 | Ga0157372_107064951 | 251 |
| 49 | 3300014325 | Ga0163163_10007435 | Ga0163163_100074358 | 251 |
| 50 | 3300014325 | Ga0163163_10145626 | Ga0163163_101456263 | 251 |
| 51 | 3300014325 | Ga0163163_10310393 | Ga0163163_103103931 | 251 |
| 52 | 3300014325 | Ga0163163_10312194 | Ga0163163_103121942 | 251 |
| 53 | 3300014325 | Ga0163163_10419274 | Ga0163163_104192742 | 251 |
| 54 | 3300014325 | Ga0163163_10577833 | Ga0163163_105778331 | 251 |
| 55 | 3300014968 | Ga0157379_10025079 | Ga0157379_100250796 | 251 |
| 56 | 3300037418 | Ga0395900_0381631 | Ga0395900_0381631_112_867 | 251 |
| 57 | 3300045051 | Ga0451576_0418537 | Ga0451576_0418537_51_812 | 251 |
| 58 | 3300046491 | Ga0495584_0201882 | Ga0495584_0201882_241_999 | 251 |
| 59 | 3300047320 | Ga0495672_0138844 | Ga0495672_0138844_180_938 | 251 |
| 60 | 3300048905 | Ga0496102_0011427 | Ga0496102_0011427_5299_6057 | 251 |
| 61 | 3300048911 | Ga0496108_0368381 | Ga0496108_0368381_101_859 | 251 |
| 62 | 3300049514 | Ga0501291_007157 | Ga0501291_007157_309_1109 | 251 |
| 63 | 3300049514 | Ga0501291_018911 | Ga0501291_018911_277_1032 | 251 |
| 64 | 3300049515 | Ga0501292_015774 | Ga0501292_015774_133_891 | 251 |
| 65 | 3300049518 | Ga0501295_041091 | Ga0501295_041091_37_837 | 251 |
| 66 | 3300049521 | Ga0501298_002676 | Ga0501298_002676_848_1606 | 251 |
| 67 | 3300049649 | Ga0501198_002730 | Ga0501198_002730_987_1745 | 251 |
| 68 | 3300049652 | Ga0501202_001705 | Ga0501202_001705_971_1729 | 251 |
| 69 | 3300049654 | Ga0501207_002171 | Ga0501207_002171_95_853 | 251 |
| 70 | 3300049655 | Ga0501208_005660 | Ga0501208_005660_455_1255 | 251 |
| 71 | 3300049659 | Ga0501214_000540 | Ga0501214_000540_1042_1800 | 251 |
| 72 | 3300049660 | Ga0501216_002071 | Ga0501216_002071_364_1122 | 251 |
| 73 | 3300049660 | Ga0501216_013672 | Ga0501216_013672_17_772 | 251 |
| 74 | 3300049660 | Ga0501216_019021 | Ga0501216_019021_271_1071 | 251 |
| 75 | 3300049661 | Ga0501217_000517 | Ga0501217_000517_1001_1759 | 251 |
| 76 | 3300049661 | Ga0501217_015844 | Ga0501217_015844_698_1498 | 251 |
| 77 | 3300049663 | Ga0501223_000504 | Ga0501223_000504_7104_7862 | 251 |
| 78 | 3300049663 | Ga0501223_006582 | Ga0501223_006582_26_826 | 251 |
| 79 | 3300049664 | Ga0501224_000129 | Ga0501224_000129_5172_5930 | 251 |
| 80 | 3300049665 | Ga0501227_000295 | Ga0501227_000295_2072_2830 | 251 |
| 81 | 3300049668 | Ga0501233_000556 | Ga0501233_000556_2840_3598 | 251 |
| 82 | 3300049668 | Ga0501233_016218 | Ga0501233_016218_502_1302 | 251 |
| 83 | 3300049668 | Ga0501233_020069 | Ga0501233_020069_291_1046 | 251 |
| 84 | 3300049669 | Ga0501235_010239 | Ga0501235_010239_846_1601 | 251 |
| 85 | 3300049673 | Ga0501240_000221 | Ga0501240_000221_1747_2505 | 251 |
| 86 | 3300049676 | Ga0501246_004142 | Ga0501246_004142_163_963 | 251 |
| 87 | 3300049679 | Ga0501249_036007 | Ga0501249_036007_268_1068 | 251 |
| 88 | 3300049681 | Ga0501251_002794 | Ga0501251_002794_744_1544 | 251 |
| 89 | 3300049688 | Ga0501259_001344 | Ga0501259_001344_2426_3184 | 251 |
| 90 | 3300049688 | Ga0501259_020058 | Ga0501259_020058_38_838 | 251 |
| 91 | 3300049705 | Ga0501225_0000145 | Ga0501225_0000145_15121_15879 | 251 |
| 92 | 3300049707 | Ga0501234_000075 | Ga0501234_000075_1795_2553 | 251 |
| 93 | 3300049708 | Ga0501245_009982 | Ga0501245_009982_584_1342 | 251 |
| 94 | 3300049763 | Ga0501266_017453 | Ga0501266_017453_47_847 | 251 |
| 95 | 3300049763 | Ga0501266_017623 | Ga0501266_017623_125_883 | 251 |
| 96 | 3300049765 | Ga0501268_018587 | Ga0501268_018587_255_1013 | 251 |
| 97 | 3300049765 | Ga0501268_036007 | Ga0501268_036007_27_782 | 251 |
| 98 | 3300049767 | Ga0501270_014036 | Ga0501270_014036_163_963 | 251 |
| 99 | 3300049769 | Ga0501272_005644 | Ga0501272_005644_28_786 | 251 |
| 100 | 3300049769 | Ga0501272_006476 | Ga0501272_006476_126_926 | 251 |
| 101 | 3300049770 | Ga0501273_011924 | Ga0501273_011924_62_820 | 251 |
| 102 | 3300049775 | Ga0501279_001580 | Ga0501279_001580_1791_2591 | 251 |
| 103 | 3300049779 | Ga0501283_002494 | Ga0501283_002494_122_922 | 251 |
| 104 | 3300049851 | Ga0501212_002472 | Ga0501212_002472_240_1040 | 251 |
| 105 | 3300050510 | nmdc:mga06r32_171085_c1 | nmdc:mga06r32_171085_c1_987_1745 | 251 |
| 106 | 3300050515 | nmdc:mga0a205_152147_c1 | nmdc:mga0a205_152147_c1_17_775 | 251 |
| 107 | 3300050515 | nmdc:mga0a205_312347_c1 | nmdc:mga0a205_312347_c1_60_815 | 251 |
| 108 | 3300009093 | Ga0105240_10042866 | Ga0105240_100428662 | 252 |
| 109 | 3300009094 | Ga0111539_10083728 | Ga0111539_100837284 | 252 |
| 110 | 3300009098 | Ga0105245_10141499 | Ga0105245_101414993 | 252 |
| 111 | 3300009101 | Ga0105247_10007521 | Ga0105247_1000752111 | 252 |
| 112 | 3300009147 | Ga0114129_10023642 | Ga0114129_100236422 | 252 |
| 113 | 3300009147 | Ga0114129_10051936 | Ga0114129_100519368 | 252 |
| 114 | 3300009147 | Ga0114129_10114657 | Ga0114129_101146575 | 252 |
| 115 | 3300009147 | Ga0114129_11148137 | Ga0114129_111481371 | 252 |
| 116 | 3300009147 | Ga0114129_11198199 | Ga0114129_111981991 | 252 |
| 117 | 3300009148 | Ga0105243_10077421 | Ga0105243_100774213 | 252 |
| 118 | 3300009148 | Ga0105243_10077653 | Ga0105243_100776532 | 252 |
| 119 | 3300009148 | Ga0105243_10145993 | Ga0105243_101459933 | 252 |
| 120 | 3300009148 | Ga0105243_10237386 | Ga0105243_102373862 | 252 |
| 121 | 3300009174 | Ga0105241_10064366 | Ga0105241_100643662 | 252 |
| 122 | 3300009174 | Ga0105241_10362011 | Ga0105241_103620112 | 252 |
| 123 | 3300009176 | Ga0105242_10002192 | Ga0105242_100021927 | 252 |
| 124 | 3300009176 | Ga0105242_10039298 | Ga0105242_100392981 | 252 |
| 125 | 3300009176 | Ga0105242_10346571 | Ga0105242_103465711 | 252 |
| 126 | 3300009177 | Ga0105248_10033803 | Ga0105248_100338032 | 252 |
| 127 | 3300009177 | Ga0105248_10112607 | Ga0105248_101126073 | 252 |
| 128 | 3300009177 | Ga0105248_10297035 | Ga0105248_102970351 | 252 |
| 129 | 3300009177 | Ga0105248_10357877 | Ga0105248_103578772 | 252 |
| 130 | 3300009545 | Ga0105237_10010849 | Ga0105237_1001084910 | 252 |
| 131 | 3300009545 | Ga0105237_10019745 | Ga0105237_100197456 | 252 |
| 132 | 3300009553 | Ga0105249_10017459 | Ga0105249_100174595 | 252 |
| 133 | 3300009553 | Ga0105249_10711010 | Ga0105249_107110102 | 252 |
| 134 | 3300010375 | Ga0105239_10116098 | Ga0105239_101160982 | 252 |
| 135 | 3300011119 | Ga0105246_10079138 | Ga0105246_100791382 | 252 |
| 136 | 3300011119 | Ga0105246_10111502 | Ga0105246_101115022 | 252 |
| 137 | 3300013102 | Ga0157371_10210552 | Ga0157371_102105522 | 252 |
| 138 | 3300013102 | Ga0157371_10273083 | Ga0157371_102730832 | 252 |
| 139 | 3300013296 | Ga0157374_10015970 | Ga0157374_100159707 | 252 |
| 140 | 3300013296 | Ga0157374_10135043 | Ga0157374_101350432 | 252 |
| 141 | 3300013297 | Ga0157378_10001282 | Ga0157378_1000128212 | 252 |
| 142 | 3300013297 | Ga0157378_10003380 | Ga0157378_100033807 | 252 |
| 143 | 3300013297 | Ga0157378_10048711 | Ga0157378_100487111 | 252 |
| 144 | 3300013297 | Ga0157378_10194990 | Ga0157378_101949902 | 252 |
| 145 | 3300013306 | Ga0163162_10010751 | Ga0163162_100107519 | 252 |
| 146 | 3300013306 | Ga0163162_10012811 | Ga0163162_100128118 | 252 |
| 147 | 3300013306 | Ga0163162_10170307 | Ga0163162_101703072 | 252 |
| 148 | 3300013306 | Ga0163162_10463601 | Ga0163162_104636012 | 252 |
| 149 | 3300013306 | Ga0163162_10526133 | Ga0163162_105261332 | 252 |
| 150 | 3300013306 | Ga0163162_10543775 | Ga0163162_105437751 | 252 |
| 151 | 3300013307 | Ga0157372_10295285 | Ga0157372_102952852 | 252 |
| 152 | 3300013308 | Ga0157375_10004418 | Ga0157375_1000441810 | 252 |
| 153 | 3300013308 | Ga0157375_10067251 | Ga0157375_100672516 | 252 |
| 154 | 3300013308 | Ga0157375_10073908 | Ga0157375_100739083 | 252 |
| 155 | 3300013308 | Ga0157375_10167282 | Ga0157375_101672822 | 252 |
| 156 | 3300013308 | Ga0157375_10198777 | Ga0157375_101987771 | 252 |
| 157 | 3300013308 | Ga0157375_10262499 | Ga0157375_102624992 | 252 |
| 158 | 3300014325 | Ga0163163_10001831 | Ga0163163_1000183112 | 252 |
| 159 | 3300014325 | Ga0163163_10132213 | Ga0163163_101322132 | 252 |
| 160 | 3300014325 | Ga0163163_10207137 | Ga0163163_102071372 | 252 |
| 161 | 3300014325 | Ga0163163_10220860 | Ga0163163_102208601 | 252 |
| 162 | 3300014326 | Ga0157380_10001205 | Ga0157380_1000120510 | 252 |
| 163 | 3300014326 | Ga0157380_10015063 | Ga0157380_100150634 | 252 |
| 164 | 3300014326 | Ga0157380_10041006 | Ga0157380_100410064 | 252 |
| 165 | 3300014745 | Ga0157377_10005057 | Ga0157377_100050575 | 252 |
| 166 | 3300014745 | Ga0157377_10183115 | Ga0157377_101831151 | 252 |
| 167 | 3300014745 | Ga0157377_10480803 | Ga0157377_104808031 | 252 |
| 168 | 3300014968 | Ga0157379_10290117 | Ga0157379_102901171 | 252 |
| 169 | 3300014969 | Ga0157376_10014842 | Ga0157376_100148423 | 252 |
| 170 | 3300014969 | Ga0157376_10445779 | Ga0157376_104457792 | 252 |
| 171 | 3300036401 | Ga0373937_0026568 | Ga0373937_0026568_957_1715 | 252 |
| 172 | 3300037418 | Ga0395900_0071081 | Ga0395900_0071081_523_1281 | 252 |
| 173 | 3300037471 | Ga0395905_0343158 | Ga0395905_0343158_116_877 | 252 |
| 174 | 3300038443 | Ga0395901_0778767 | Ga0395901_0778767_171_929 | 252 |
| 175 | 3300042012 | Ga0439455_0002290 | Ga0439455_0002290_602_1363 | 252 |
| 176 | 3300042157 | Ga0439458_0001735 | Ga0439458_0001735_3579_4340 | 252 |
| 177 | 3300045051 | Ga0451576_0356829 | Ga0451576_0356829_248_1006 | 252 |
| 178 | 3300046519 | Ga0495632_0026354 | Ga0495632_0026354_53_880 | 252 |
| 179 | 3300046684 | Ga0495669_0105890 | Ga0495669_0105890_479_1237 | 252 |
| 180 | 3300048903 | Ga0496100_0152678 | Ga0496100_0152678_736_1494 | 252 |
| 181 | 3300048913 | Ga0496110_0389074 | Ga0496110_0389074_434_1192 | 252 |
| 182 | 3300048915 | Ga0496112_0162595 | Ga0496112_0162595_940_1698 | 252 |
| 183 | 3300048916 | Ga0496113_0256050 | Ga0496113_0256050_470_1234 | 252 |
| 184 | 3300049514 | Ga0501291_010725 | Ga0501291_010725_505_1263 | 252 |
| 185 | 3300049675 | Ga0501243_033213 | Ga0501243_033213_96_854 | 252 |
| 186 | 3300049680 | Ga0501250_001921 | Ga0501250_001921_1009_1767 | 252 |
| 187 | 3300049705 | Ga0501225_0085746 | Ga0501225_0085746_40_798 | 252 |
| 188 | 3300049707 | Ga0501234_011417 | Ga0501234_011417_615_1373 | 252 |
| 189 | 3300049851 | Ga0501212_001962 | Ga0501212_001962_522_1280 | 252 |
| 190 | 3300050507 | nmdc:mga05p37_303373_c1 | nmdc:mga05p37_303373_c1_146_904 | 252 |
| 191 | 3300050507 | nmdc:mga05p37_43970_c1 | nmdc:mga05p37_43970_c1_805_1563 | 252 |
| 192 | 3300050507 | nmdc:mga05p37_61134_c1 | nmdc:mga05p37_61134_c1_1018_1776 | 252 |
| 193 | 3300050508 | nmdc:mga09592_422740_c1 | nmdc:mga09592_422740_c1_132_890 | 252 |
| 194 | 3300050508 | nmdc:mga09592_71662_c1 | nmdc:mga09592_71662_c1_1917_2675 | 252 |
| 195 | 3300050508 | nmdc:mga09592_92749_c1 | nmdc:mga09592_92749_c1_794_1552 | 252 |
| 196 | 3300050510 | nmdc:mga06r32_136876_c1 | nmdc:mga06r32_136876_c1_1121_1879 | 252 |
| 197 | 3300050511 | nmdc:mga08y16_118388_c1 | nmdc:mga08y16_118388_c1_569_1333 | 252 |
| 198 | 3300050511 | nmdc:mga08y16_36035_c1 | nmdc:mga08y16_36035_c1_1535_2293 | 252 |
| 199 | 3300050512 | nmdc:mga0n895_274902_c1 | nmdc:mga0n895_274902_c1_443_1201 | 252 |
| 200 | 3300050512 | nmdc:mga0n895_438430_c1 | nmdc:mga0n895_438430_c1_471_1232 | 252 |
| 201 | 3300050515 | nmdc:mga0a205_190637_c1 | nmdc:mga0a205_190637_c1_357_1115 | 252 |
| 202 | 3300050515 | nmdc:mga0a205_75331_c1 | nmdc:mga0a205_75331_c1_2079_2840 | 252 |
| 203 | 3300061734 | Ga0530510_0073156 | Ga0530510_0073156_678_1436 | 252 |
| 204 | 3300009093 | Ga0105240_10191814 | Ga0105240_101918144 | 253 |
| 205 | 3300009094 | Ga0111539_10005075 | Ga0111539_1000507510 | 253 |
| 206 | 3300009098 | Ga0105245_10382373 | Ga0105245_103823731 | 253 |
| 207 | 3300009174 | Ga0105241_10222574 | Ga0105241_102225742 | 253 |
| 208 | 3300009177 | Ga0105248_10133245 | Ga0105248_101332453 | 253 |
| 209 | 3300009551 | Ga0105238_10008842 | Ga0105238_1000884210 | 253 |
| 210 | 3300009553 | Ga0105249_10004897 | Ga0105249_100048977 | 253 |
| 211 | 3300013306 | Ga0163162_10149517 | Ga0163162_101495172 | 253 |
| 212 | 3300013308 | Ga0157375_10140339 | Ga0157375_101403391 | 253 |
| 213 | 3300014325 | Ga0163163_10001533 | Ga0163163_1000153326 | 253 |
| 214 | 3300035091 | Ga0373951_0000266 | Ga0373951_0000266_1549_2316 | 253 |
| 215 | 3300035207 | Ga0373942_0004261 | Ga0373942_0004261_2227_2991 | 253 |
| 216 | 3300035692 | Ga0373935_0309885 | Ga0373935_0309885_305_1081 | 253 |
| 217 | 3300048909 | Ga0496106_0386594 | Ga0496106_0386594_192_956 | 253 |
| 218 | 3300048915 | Ga0496112_0025724 | Ga0496112_0025724_4537_5298 | 253 |
| 219 | 3300048916 | Ga0496113_0580913 | Ga0496113_0580913_17_778 | 253 |
| 220 | 3300006871 | Ga0075434_100014554 | Ga0075434_1000145544 | 256 |
| 221 | 3300031548 | Ga0307408_100078016 | Ga0307408_1000780163 | 256 |
| 222 | 3300031731 | Ga0307405_10015061 | Ga0307405_100150615 | 256 |
| 223 | 3300032004 | Ga0307414_10491564 | Ga0307414_104915641 | 256 |
| 224 | 3300032126 | Ga0307415_100277030 | Ga0307415_1002770301 | 256 |
| 225 | 3300050512 | nmdc:mga0n895_164400_c1 | nmdc:mga0n895_164400_c1_963_1754 | 256 |
| 226 | 3300000532 | CNAas_1000886 | CNAas_10008864 | 257 |
| 227 | 3300005441 | Ga0070700_100060229 | Ga0070700_1000602293 | 257 |
| 228 | 3300005546 | Ga0070696_100211143 | Ga0070696_1002111431 | 257 |
| 229 | 3300005617 | Ga0068859_100974884 | Ga0068859_1009748841 | 257 |
| 230 | 3300005618 | Ga0068864_100020637 | Ga0068864_1000206375 | 257 |
| 231 | 3300005841 | Ga0068863_100221915 | Ga0068863_1002219152 | 257 |
| 232 | 3300006852 | Ga0075433_10022852 | Ga0075433_100228526 | 257 |
| 233 | 3300006871 | Ga0075434_100040126 | Ga0075434_1000401262 | 257 |
| 234 | 3300006931 | Ga0097620_100974960 | Ga0097620_1009749601 | 257 |
| 235 | 3300017792 | Ga0163161_10329395 | Ga0163161_103293952 | 257 |
| 236 | 3300025911 | Ga0207654_10094769 | Ga0207654_100947692 | 257 |
| 237 | 3300025924 | Ga0207694_10087086 | Ga0207694_100870862 | 257 |
| 238 | 3300025961 | Ga0207712_10400078 | Ga0207712_104000781 | 257 |
| 239 | 3300026035 | Ga0207703_10108349 | Ga0207703_101083493 | 257 |
| 240 | 3300026089 | Ga0207648_10209835 | Ga0207648_102098351 | 257 |
| 241 | 3300026095 | Ga0207676_10014298 | Ga0207676_100142983 | 257 |
| 242 | 3300028380 | Ga0268265_10775501 | Ga0268265_107755011 | 257 |
| 243 | 3300049574 | Ga0501038_0032512 | Ga0501038_0032512_2762_3562 | 257 |
| 244 | 3300005440 | Ga0070705_100472910 | Ga0070705_1004729101 | 259 |
| 245 | 3300009147 | Ga0114129_10446440 | Ga0114129_104464402 | 259 |
| 246 | 3300021384 | Ga0213876_10000251 | Ga0213876_1000025119 | 259 |
| 247 | 3300021384 | Ga0213876_10000279 | Ga0213876_1000027938 | 259 |
| 248 | 3300039437 | Ga0436365_0344253 | Ga0436365_0344253_20332_21126 | 259 |
| 249 | 3300039437 | Ga0436365_1630086 | Ga0436365_1630086_52953_53747 | 259 |
| 250 | 3300005295 | Ga0065707_10233064 | Ga0065707_102330641 | 260 |
| 251 | 3300005468 | Ga0070707_100000197 | Ga0070707_10000019735 | 260 |
| 252 | 3300005518 | Ga0070699_100453036 | Ga0070699_1004530361 | 260 |
| 253 | 3300005545 | Ga0070695_100135304 | Ga0070695_1001353042 | 260 |
| 254 | 3300005549 | Ga0070704_100001685 | Ga0070704_1000016853 | 260 |
| 255 | 3300005985 | Ga0081539_10071166 | Ga0081539_100711663 | 260 |
| 256 | 3300007076 | Ga0075435_100021117 | Ga0075435_1000211176 | 260 |
| 257 | 3300025922 | Ga0207646_10001342 | Ga0207646_1000134227 | 260 |
| 258 | 3300005467 | Ga0070706_100030934 | Ga0070706_1000309341 | 261 |
| 259 | 3300005468 | Ga0070707_100005488 | Ga0070707_1000054883 | 261 |
| 260 | 3300005471 | Ga0070698_100147259 | Ga0070698_1001472592 | 261 |
| 261 | 3300005518 | Ga0070699_100481441 | Ga0070699_1004814412 | 261 |
| 262 | 3300005536 | Ga0070697_100046238 | Ga0070697_1000462383 | 261 |
| 263 | 3300025922 | Ga0207646_10001700 | Ga0207646_1000170015 | 261 |
| 264 | 3300005546 | Ga0070696_100272351 | Ga0070696_1002723512 | 262 |
| 265 | 3300006846 | Ga0075430_100082659 | Ga0075430_1000826595 | 262 |
| 266 | 3300006880 | Ga0075429_100447729 | Ga0075429_1004477291 | 262 |
| 267 | 3300011119 | Ga0105246_10041615 | Ga0105246_100416151 | 262 |
| 268 | 3300013100 | Ga0157373_10016111 | Ga0157373_100161112 | 262 |
| 269 | 3300013297 | Ga0157378_10070903 | Ga0157378_100709031 | 262 |
| 270 | 3300025908 | Ga0207643_10094051 | Ga0207643_100940512 | 262 |
| 271 | 3300025935 | Ga0207709_10431305 | Ga0207709_104313051 | 262 |
| 272 | 3300026075 | Ga0207708_10152920 | Ga0207708_101529201 | 262 |
| 273 | 3300026116 | Ga0207674_10141200 | Ga0207674_101412002 | 262 |
| 274 | 3300031548 | Ga0307408_100133239 | Ga0307408_1001332392 | 262 |
| 275 | 3300005288 | Ga0065714_10064433 | Ga0065714_1006443366 | 263 |
| 276 | 3300005290 | Ga0065712_10067731 | Ga0065712_1006773166 | 263 |
| 277 | 3300005293 | Ga0065715_10088984 | Ga0065715_1008898410 | 263 |
| 278 | 3300005337 | Ga0070682_100025067 | Ga0070682_1000250675 | 263 |
| 279 | 3300005345 | Ga0070692_10004444 | Ga0070692_100044446 | 263 |
| 280 | 3300005345 | Ga0070692_10059843 | Ga0070692_100598433 | 263 |
| 281 | 3300005347 | Ga0070668_100008267 | Ga0070668_1000082677 | 263 |
| 282 | 3300005438 | Ga0070701_10020338 | Ga0070701_100203385 | 263 |
| 283 | 3300005440 | Ga0070705_100004943 | Ga0070705_1000049434 | 263 |
| 284 | 3300005444 | Ga0070694_100010557 | Ga0070694_1000105576 | 263 |
| 285 | 3300005444 | Ga0070694_100139441 | Ga0070694_1001394411 | 263 |
| 286 | 3300005444 | Ga0070694_100167114 | Ga0070694_1001671141 | 263 |
| 287 | 3300005467 | Ga0070706_100005724 | Ga0070706_10000572411 | 263 |
| 288 | 3300005467 | Ga0070706_100026556 | Ga0070706_1000265564 | 263 |
| 289 | 3300005544 | Ga0070686_100101956 | Ga0070686_1001019563 | 263 |
| 290 | 3300005546 | Ga0070696_100083176 | Ga0070696_1000831763 | 263 |
| 291 | 3300005615 | Ga0070702_100051700 | Ga0070702_1000517003 | 263 |
| 292 | 3300005618 | Ga0068864_100411897 | Ga0068864_1004118972 | 263 |
| 293 | 3300005718 | Ga0068866_10011179 | Ga0068866_100111793 | 263 |
| 294 | 3300005834 | Ga0068851_10003618 | Ga0068851_100036187 | 263 |
| 295 | 3300005842 | Ga0068858_100041123 | Ga0068858_1000411234 | 263 |
| 296 | 3300009094 | Ga0111539_10062464 | Ga0111539_100624644 | 263 |
| 297 | 3300009147 | Ga0114129_10068673 | Ga0114129_100686733 | 263 |
| 298 | 3300009148 | Ga0105243_10042180 | Ga0105243_100421802 | 263 |
| 299 | 3300009553 | Ga0105249_10000052 | Ga0105249_1000005289 | 263 |
| 300 | 3300010375 | Ga0105239_10104143 | Ga0105239_101041432 | 263 |
| 301 | 3300013297 | Ga0157378_10061510 | Ga0157378_100615103 | 263 |
| 302 | 3300013297 | Ga0157378_10280336 | Ga0157378_102803362 | 263 |
| 303 | 3300013306 | Ga0163162_10000001 | Ga0163162_10000001601 | 263 |
| 304 | 3300013307 | Ga0157372_10113831 | Ga0157372_101138312 | 263 |
| 305 | 3300013308 | Ga0157375_10757279 | Ga0157375_107572791 | 263 |
| 306 | 3300014326 | Ga0157380_10239283 | Ga0157380_102392832 | 263 |
| 307 | 3300014968 | Ga0157379_10146621 | Ga0157379_101466212 | 263 |
| 308 | 3300025885 | Ga0207653_10001174 | Ga0207653_1000117410 | 263 |
| 309 | 3300025914 | Ga0207671_10010718 | Ga0207671_100107182 | 263 |
| 310 | 3300025961 | Ga0207712_10000925 | Ga0207712_1000092516 | 263 |
| 311 | 3300025972 | Ga0207668_10005063 | Ga0207668_100050637 | 263 |
| 312 | 3300048909 | Ga0496106_0055940 | Ga0496106_0055940_1251_2042 | 263 |
| 313 | 3300048910 | Ga0496107_0013028 | Ga0496107_0013028_2312_3103 | 263 |
| 314 | 3300049515 | Ga0501292_003582 | Ga0501292_003582_275_1069 | 263 |
| 315 | 3300049649 | Ga0501198_004098 | Ga0501198_004098_189_983 | 263 |
| 316 | 3300049652 | Ga0501202_005263 | Ga0501202_005263_354_1148 | 263 |
| 317 | 3300049654 | Ga0501207_008031 | Ga0501207_008031_532_1326 | 263 |
| 318 | 3300049665 | Ga0501227_010369 | Ga0501227_010369_280_1074 | 263 |
| 319 | 3300049667 | Ga0501230_003632 | Ga0501230_003632_234_1028 | 263 |
| 320 | 3300049668 | Ga0501233_004577 | Ga0501233_004577_476_1270 | 263 |
| 321 | 3300049669 | Ga0501235_004630 | Ga0501235_004630_1211_2005 | 263 |
| 322 | 3300049675 | Ga0501243_021776 | Ga0501243_021776_240_1034 | 263 |
| 323 | 3300049679 | Ga0501249_015567 | Ga0501249_015567_520_1314 | 263 |
| 324 | 3300049685 | Ga0501256_004876 | Ga0501256_004876_324_1118 | 263 |
| 325 | 3300049688 | Ga0501259_009350 | Ga0501259_009350_439_1233 | 263 |
| 326 | 3300049689 | Ga0501260_006541 | Ga0501260_006541_155_949 | 263 |
| 327 | 3300049705 | Ga0501225_0009821 | Ga0501225_0009821_1101_1895 | 263 |
| 328 | 3300049851 | Ga0501212_020353 | Ga0501212_020353_81_875 | 263 |
| 329 | 3300050511 | nmdc:mga08y16_287332_c1 | nmdc:mga08y16_287332_c1_373_1167 | 263 |
| 330 | 3300005328 | Ga0070676_10190390 | Ga0070676_101903901 | 264 |
| 331 | 3300005330 | Ga0070690_100023410 | Ga0070690_1000234104 | 264 |
| 332 | 3300005330 | Ga0070690_100230058 | Ga0070690_1002300581 | 264 |
| 333 | 3300005334 | Ga0068869_100034500 | Ga0068869_1000345003 | 264 |
| 334 | 3300005338 | Ga0068868_100111973 | Ga0068868_1001119731 | 264 |
| 335 | 3300005338 | Ga0068868_100259110 | Ga0068868_1002591102 | 264 |
| 336 | 3300005340 | Ga0070689_100281890 | Ga0070689_1002818902 | 264 |
| 337 | 3300005345 | Ga0070692_10320358 | Ga0070692_103203581 | 264 |
| 338 | 3300005406 | Ga0070703_10000077 | Ga0070703_1000007733 | 264 |
| 339 | 3300005438 | Ga0070701_10129566 | Ga0070701_101295661 | 264 |
| 340 | 3300005440 | Ga0070705_100041667 | Ga0070705_1000416672 | 264 |
| 341 | 3300005441 | Ga0070700_100005553 | Ga0070700_1000055531 | 264 |
| 342 | 3300005444 | Ga0070694_100001229 | Ga0070694_1000012296 | 264 |
| 343 | 3300005444 | Ga0070694_100001886 | Ga0070694_1000018863 | 264 |
| 344 | 3300005445 | Ga0070708_100463792 | Ga0070708_1004637921 | 264 |
| 345 | 3300005459 | Ga0068867_100455123 | Ga0068867_1004551231 | 264 |
| 346 | 3300005467 | Ga0070706_100660570 | Ga0070706_1006605701 | 264 |
| 347 | 3300005468 | Ga0070707_100021433 | Ga0070707_1000214332 | 264 |
| 348 | 3300005468 | Ga0070707_100042234 | Ga0070707_1000422343 | 264 |
| 349 | 3300005471 | Ga0070698_100004943 | Ga0070698_10000494310 | 264 |
| 350 | 3300005471 | Ga0070698_100407889 | Ga0070698_1004078891 | 264 |
| 351 | 3300005518 | Ga0070699_100083270 | Ga0070699_1000832703 | 264 |
| 352 | 3300005536 | Ga0070697_100096040 | Ga0070697_1000960404 | 264 |
| 353 | 3300005544 | Ga0070686_100011973 | Ga0070686_1000119733 | 264 |
| 354 | 3300005544 | Ga0070686_100196842 | Ga0070686_1001968421 | 264 |
| 355 | 3300005544 | Ga0070686_100236950 | Ga0070686_1002369501 | 264 |
| 356 | 3300005544 | Ga0070686_100334617 | Ga0070686_1003346171 | 264 |
| 357 | 3300005546 | Ga0070696_100165930 | Ga0070696_1001659302 | 264 |
| 358 | 3300005549 | Ga0070704_100022845 | Ga0070704_1000228453 | 264 |
| 359 | 3300005549 | Ga0070704_100060228 | Ga0070704_1000602283 | 264 |
| 360 | 3300005577 | Ga0068857_100496245 | Ga0068857_1004962452 | 264 |
| 361 | 3300005617 | Ga0068859_100010028 | Ga0068859_1000100289 | 264 |
| 362 | 3300005617 | Ga0068859_100339026 | Ga0068859_1003390261 | 264 |
| 363 | 3300005618 | Ga0068864_100207035 | Ga0068864_1002070351 | 264 |
| 364 | 3300005719 | Ga0068861_100032846 | Ga0068861_1000328463 | 264 |
| 365 | 3300005719 | Ga0068861_100340012 | Ga0068861_1003400121 | 264 |
| 366 | 3300005840 | Ga0068870_10052726 | Ga0068870_100527262 | 264 |
| 367 | 3300005842 | Ga0068858_100066492 | Ga0068858_1000664923 | 264 |
| 368 | 3300005842 | Ga0068858_100201172 | Ga0068858_1002011722 | 264 |
| 369 | 3300005843 | Ga0068860_100251887 | Ga0068860_1002518871 | 264 |
| 370 | 3300005844 | Ga0068862_100016914 | Ga0068862_1000169145 | 264 |
| 371 | 3300006163 | Ga0070715_10000010 | Ga0070715_1000001043 | 264 |
| 372 | 3300006173 | Ga0070716_100000004 | Ga0070716_100000004257 | 264 |
| 373 | 3300006358 | Ga0068871_100515700 | Ga0068871_1005157001 | 264 |
| 374 | 3300006844 | Ga0075428_100522689 | Ga0075428_1005226891 | 264 |
| 375 | 3300006847 | Ga0075431_100236813 | Ga0075431_1002368131 | 264 |
| 376 | 3300006871 | Ga0075434_100068253 | Ga0075434_1000682533 | 264 |
| 377 | 3300006871 | Ga0075434_100406254 | Ga0075434_1004062542 | 264 |
| 378 | 3300006871 | Ga0075434_100580678 | Ga0075434_1005806782 | 264 |
| 379 | 3300006880 | Ga0075429_100038505 | Ga0075429_1000385055 | 264 |
| 380 | 3300006914 | Ga0075436_100000009 | Ga0075436_1000000096 | 264 |
| 381 | 3300006931 | Ga0097620_100010027 | Ga0097620_1000100279 | 264 |
| 382 | 3300006931 | Ga0097620_100339046 | Ga0097620_1003390462 | 264 |
| 383 | 3300007076 | Ga0075435_100008534 | Ga0075435_1000085345 | 264 |
| 384 | 3300009094 | Ga0111539_10010333 | Ga0111539_100103334 | 264 |
| 385 | 3300009098 | Ga0105245_10142966 | Ga0105245_101429662 | 264 |
| 386 | 3300009148 | Ga0105243_10000283 | Ga0105243_1000028337 | 264 |
| 387 | 3300009176 | Ga0105242_10000235 | Ga0105242_1000023513 | 264 |
| 388 | 3300009176 | Ga0105242_10018177 | Ga0105242_100181774 | 264 |
| 389 | 3300009176 | Ga0105242_10285870 | Ga0105242_102858701 | 264 |
| 390 | 3300009177 | Ga0105248_10342618 | Ga0105248_103426182 | 264 |
| 391 | 3300009177 | Ga0105248_10451487 | Ga0105248_104514871 | 264 |
| 392 | 3300009177 | Ga0105248_10946294 | Ga0105248_109462941 | 264 |
| 393 | 3300009553 | Ga0105249_10013685 | Ga0105249_100136853 | 264 |
| 394 | 3300009553 | Ga0105249_10176017 | Ga0105249_101760172 | 264 |
| 395 | 3300010375 | Ga0105239_10563382 | Ga0105239_105633821 | 264 |
| 396 | 3300011119 | Ga0105246_10161407 | Ga0105246_101614072 | 264 |
| 397 | 3300013297 | Ga0157378_10010625 | Ga0157378_100106254 | 264 |
| 398 | 3300013297 | Ga0157378_10021341 | Ga0157378_100213412 | 264 |
| 399 | 3300013297 | Ga0157378_10043585 | Ga0157378_100435853 | 264 |
| 400 | 3300013297 | Ga0157378_10060725 | Ga0157378_100607253 | 264 |
| 401 | 3300013306 | Ga0163162_10039048 | Ga0163162_100390484 | 264 |
| 402 | 3300013306 | Ga0163162_10504261 | Ga0163162_105042611 | 264 |
| 403 | 3300013308 | Ga0157375_10036058 | Ga0157375_100360583 | 264 |
| 404 | 3300014326 | Ga0157380_10001174 | Ga0157380_100011742 | 264 |
| 405 | 3300014326 | Ga0157380_10379173 | Ga0157380_103791732 | 264 |
| 406 | 3300014326 | Ga0157380_10547028 | Ga0157380_105470281 | 264 |
| 407 | 3300014745 | Ga0157377_10246536 | Ga0157377_102465361 | 264 |
| 408 | 3300017792 | Ga0163161_10007521 | Ga0163161_100075215 | 264 |
| 409 | 3300017792 | Ga0163161_10282467 | Ga0163161_102824672 | 264 |
| 410 | 3300025885 | Ga0207653_10000171 | Ga0207653_100001715 | 264 |
| 411 | 3300025905 | Ga0207685_10000006 | Ga0207685_10000006170 | 264 |
| 412 | 3300025918 | Ga0207662_10043560 | Ga0207662_100435603 | 264 |
| 413 | 3300025918 | Ga0207662_10260595 | Ga0207662_102605951 | 264 |
| 414 | 3300025922 | Ga0207646_10020611 | Ga0207646_100206116 | 264 |
| 415 | 3300025922 | Ga0207646_10133647 | Ga0207646_101336473 | 264 |
| 416 | 3300025934 | Ga0207686_10000021 | Ga0207686_1000002123 | 264 |
| 417 | 3300025934 | Ga0207686_10000283 | Ga0207686_1000028317 | 264 |
| 418 | 3300025935 | Ga0207709_10000069 | Ga0207709_10000069128 | 264 |
| 419 | 3300025935 | Ga0207709_10153624 | Ga0207709_101536242 | 264 |
| 420 | 3300025936 | Ga0207670_10078127 | Ga0207670_100781273 | 264 |
| 421 | 3300025939 | Ga0207665_10000139 | Ga0207665_1000013917 | 264 |
| 422 | 3300025939 | Ga0207665_10078025 | Ga0207665_100780252 | 264 |
| 423 | 3300025941 | Ga0207711_10524660 | Ga0207711_105246601 | 264 |
| 424 | 3300025942 | Ga0207689_10012415 | Ga0207689_100124153 | 264 |
| 425 | 3300025960 | Ga0207651_10113650 | Ga0207651_101136501 | 264 |
| 426 | 3300025961 | Ga0207712_10194852 | Ga0207712_101948521 | 264 |
| 427 | 3300025961 | Ga0207712_10454617 | Ga0207712_104546171 | 264 |
| 428 | 3300025961 | Ga0207712_10582738 | Ga0207712_105827381 | 264 |
| 429 | 3300026035 | Ga0207703_10122477 | Ga0207703_101224773 | 264 |
| 430 | 3300026035 | Ga0207703_10304678 | Ga0207703_103046782 | 264 |
| 431 | 3300026075 | Ga0207708_10010047 | Ga0207708_100100471 | 264 |
| 432 | 3300026088 | Ga0207641_10228323 | Ga0207641_102283231 | 264 |
| 433 | 3300026095 | Ga0207676_10286415 | Ga0207676_102864152 | 264 |
| 434 | 3300026095 | Ga0207676_10632295 | Ga0207676_106322951 | 264 |
| 435 | 3300026118 | Ga0207675_100003693 | Ga0207675_1000036939 | 264 |
| 436 | 3300026118 | Ga0207675_100152890 | Ga0207675_1001528901 | 264 |
| 437 | 3300027907 | Ga0207428_10011034 | Ga0207428_100110347 | 264 |
| 438 | 3300028381 | Ga0268264_10081762 | Ga0268264_100817621 | 264 |
| 439 | 3300028381 | Ga0268264_10238304 | Ga0268264_102383042 | 264 |
| 440 | 3300028381 | Ga0268264_10576573 | Ga0268264_105765731 | 264 |
| 441 | 3300038996 | Ga0242420_015403 | Ga0242420_015403_459_1262 | 264 |
| 442 | 3300042876 | Ga0451577_0122848 | Ga0451577_0122848_521_1324 | 264 |
| 443 | 3300045051 | Ga0451576_0070619 | Ga0451576_0070619_291_1286 | 264 |
| 444 | 3300046475 | Ga0495639_0070334 | Ga0495639_0070334_302_1111 | 264 |
| 445 | 3300046615 | Ga0495656_0148571 | Ga0495656_0148571_114_911 | 264 |
| 446 | 3300046691 | Ga0495670_0126650 | Ga0495670_0126650_121_918 | 264 |
| 447 | 3300047319 | Ga0495674_0347914 | Ga0495674_0347914_341_1150 | 264 |
| 448 | 3300050512 | nmdc:mga0n895_179377_c1 | nmdc:mga0n895_179377_c1_588_1397 | 264 |
| 449 | 3300050512 | nmdc:mga0n895_528069_c1 | nmdc:mga0n895_528069_c1_98_895 | 264 |
| 450 | 3300050513 | nmdc:mga0rr50_520_c1 | nmdc:mga0rr50_520_c1_3242_4039 | 264 |
| 451 | 3300050514 | nmdc:mga08x19_107_c1 | nmdc:mga08x19_107_c1_66771_67568 | 264 |
| 452 | 3300053083 | Ga0495655_0034110 | Ga0495655_0034110_310_1110 | 264 |
| 453 | 3300002074 | JGI24748J21848_1000087 | JGI24748J21848_100008717 | 265 |
| 454 | 3300002239 | JGI24034J26672_10000070 | JGI24034J26672_1000007017 | 265 |
| 455 | 3300003203 | JGI25406J46586_10007246 | JGI25406J46586_100072465 | 265 |
| 456 | 3300005289 | Ga0065704_10160288 | Ga0065704_101602881 | 265 |
| 457 | 3300005293 | Ga0065715_10056887 | Ga0065715_100568871 | 265 |
| 458 | 3300005295 | Ga0065707_10248713 | Ga0065707_102487131 | 265 |
| 459 | 3300005331 | Ga0070670_100308249 | Ga0070670_1003082492 | 265 |
| 460 | 3300005334 | Ga0068869_100343835 | Ga0068869_1003438351 | 265 |
| 461 | 3300005336 | Ga0070680_100029340 | Ga0070680_1000293405 | 265 |
| 462 | 3300005340 | Ga0070689_100447868 | Ga0070689_1004478681 | 265 |
| 463 | 3300005344 | Ga0070661_100025902 | Ga0070661_1000259022 | 265 |
| 464 | 3300005345 | Ga0070692_10189665 | Ga0070692_101896652 | 265 |
| 465 | 3300005355 | Ga0070671_100024875 | Ga0070671_1000248755 | 265 |
| 466 | 3300005355 | Ga0070671_100781882 | Ga0070671_1007818821 | 265 |
| 467 | 3300005364 | Ga0070673_100364802 | Ga0070673_1003648022 | 265 |
| 468 | 3300005366 | Ga0070659_100008321 | Ga0070659_1000083214 | 265 |
| 469 | 3300005440 | Ga0070705_100063379 | Ga0070705_1000633794 | 265 |
| 470 | 3300005441 | Ga0070700_100000120 | Ga0070700_10000012015 | 265 |
| 471 | 3300005444 | Ga0070694_100046532 | Ga0070694_1000465325 | 265 |
| 472 | 3300005444 | Ga0070694_100082875 | Ga0070694_1000828752 | 265 |
| 473 | 3300005444 | Ga0070694_100233179 | Ga0070694_1002331792 | 265 |
| 474 | 3300005445 | Ga0070708_100148145 | Ga0070708_1001481453 | 265 |
| 475 | 3300005445 | Ga0070708_100621821 | Ga0070708_1006218211 | 265 |
| 476 | 3300005458 | Ga0070681_10006294 | Ga0070681_100062948 | 265 |
| 477 | 3300005467 | Ga0070706_100035284 | Ga0070706_1000352845 | 265 |
| 478 | 3300005468 | Ga0070707_100286500 | Ga0070707_1002865001 | 265 |
| 479 | 3300005471 | Ga0070698_100012974 | Ga0070698_1000129746 | 265 |
| 480 | 3300005471 | Ga0070698_100013753 | Ga0070698_1000137538 | 265 |
| 481 | 3300005471 | Ga0070698_100042470 | Ga0070698_1000424701 | 265 |
| 482 | 3300005518 | Ga0070699_100030729 | Ga0070699_1000307295 | 265 |
| 483 | 3300005518 | Ga0070699_100049948 | Ga0070699_1000499481 | 265 |
| 484 | 3300005530 | Ga0070679_100008421 | Ga0070679_10000842112 | 265 |
| 485 | 3300005530 | Ga0070679_100056125 | Ga0070679_1000561253 | 265 |
| 486 | 3300005536 | Ga0070697_100038063 | Ga0070697_1000380632 | 265 |
| 487 | 3300005536 | Ga0070697_100317176 | Ga0070697_1003171762 | 265 |
| 488 | 3300005536 | Ga0070697_100411310 | Ga0070697_1004113101 | 265 |
| 489 | 3300005539 | Ga0068853_100124344 | Ga0068853_1001243441 | 265 |
| 490 | 3300005539 | Ga0068853_100633730 | Ga0068853_1006337301 | 265 |
| 491 | 3300005545 | Ga0070695_100104505 | Ga0070695_1001045053 | 265 |
| 492 | 3300005546 | Ga0070696_100000807 | Ga0070696_10000080715 | 265 |
| 493 | 3300005546 | Ga0070696_100069441 | Ga0070696_1000694412 | 265 |
| 494 | 3300005547 | Ga0070693_100006647 | Ga0070693_1000066475 | 265 |
| 495 | 3300005547 | Ga0070693_100022522 | Ga0070693_1000225223 | 265 |
| 496 | 3300005547 | Ga0070693_100108136 | Ga0070693_1001081363 | 265 |
| 497 | 3300005549 | Ga0070704_100047366 | Ga0070704_1000473663 | 265 |
| 498 | 3300005563 | Ga0068855_100455794 | Ga0068855_1004557942 | 265 |
| 499 | 3300005564 | Ga0070664_100005757 | Ga0070664_1000057576 | 265 |
| 500 | 3300005564 | Ga0070664_100252396 | Ga0070664_1002523962 | 265 |
| 501 | 3300005577 | Ga0068857_100011647 | Ga0068857_1000116475 | 265 |
| 502 | 3300005577 | Ga0068857_100363002 | Ga0068857_1003630022 | 265 |
| 503 | 3300005614 | Ga0068856_100021795 | Ga0068856_1000217957 | 265 |
| 504 | 3300005617 | Ga0068859_100027113 | Ga0068859_1000271138 | 265 |
| 505 | 3300005617 | Ga0068859_100113336 | Ga0068859_1001133361 | 265 |
| 506 | 3300005618 | Ga0068864_100021333 | Ga0068864_1000213333 | 265 |
| 507 | 3300005618 | Ga0068864_100302488 | Ga0068864_1003024882 | 265 |
| 508 | 3300005618 | Ga0068864_100323995 | Ga0068864_1003239953 | 265 |
| 509 | 3300005618 | Ga0068864_100334544 | Ga0068864_1003345442 | 265 |
| 510 | 3300005718 | Ga0068866_10070708 | Ga0068866_100707082 | 265 |
| 511 | 3300005841 | Ga0068863_100274814 | Ga0068863_1002748143 | 265 |
| 512 | 3300005842 | Ga0068858_100000077 | Ga0068858_10000007778 | 265 |
| 513 | 3300005843 | Ga0068860_100100146 | Ga0068860_1001001462 | 265 |
| 514 | 3300005844 | Ga0068862_100150979 | Ga0068862_1001509793 | 265 |
| 515 | 3300005983 | Ga0081540_1046504 | Ga0081540_10465042 | 265 |
| 516 | 3300005985 | Ga0081539_10001941 | Ga0081539_1000194118 | 265 |
| 517 | 3300006847 | Ga0075431_100164221 | Ga0075431_1001642212 | 265 |
| 518 | 3300006852 | Ga0075433_10037055 | Ga0075433_100370553 | 265 |
| 519 | 3300006871 | Ga0075434_100067157 | Ga0075434_1000671572 | 265 |
| 520 | 3300006914 | Ga0075436_100209691 | Ga0075436_1002096912 | 265 |
| 521 | 3300006931 | Ga0097620_100027113 | Ga0097620_1000271138 | 265 |
| 522 | 3300006931 | Ga0097620_100113335 | Ga0097620_1001133351 | 265 |
| 523 | 3300009101 | Ga0105247_10000015 | Ga0105247_10000015227 | 265 |
| 524 | 3300009101 | Ga0105247_10171682 | Ga0105247_101716821 | 265 |
| 525 | 3300009147 | Ga0114129_10164259 | Ga0114129_101642592 | 265 |
| 526 | 3300009147 | Ga0114129_10237746 | Ga0114129_102377462 | 265 |
| 527 | 3300009147 | Ga0114129_10815980 | Ga0114129_108159801 | 265 |
| 528 | 3300009148 | Ga0105243_10000350 | Ga0105243_1000035040 | 265 |
| 529 | 3300009174 | Ga0105241_10021776 | Ga0105241_100217764 | 265 |
| 530 | 3300009176 | Ga0105242_10000694 | Ga0105242_1000069424 | 265 |
| 531 | 3300013297 | Ga0157378_10000095 | Ga0157378_1000009538 | 265 |
| 532 | 3300013307 | Ga0157372_10557490 | Ga0157372_105574901 | 265 |
| 533 | 3300013308 | Ga0157375_10014917 | Ga0157375_100149173 | 265 |
| 534 | 3300014968 | Ga0157379_10269493 | Ga0157379_102694932 | 265 |
| 535 | 3300025223 | Ga0207672_1000270 | Ga0207672_10002705 | 265 |
| 536 | 3300025735 | Ga0207713_1049101 | Ga0207713_10491011 | 265 |
| 537 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004522 | 265 |
| 538 | 3300025910 | Ga0207684_10027931 | Ga0207684_100279313 | 265 |
| 539 | 3300025911 | Ga0207654_10021305 | Ga0207654_100213055 | 265 |
| 540 | 3300025912 | Ga0207707_10266148 | Ga0207707_102661481 | 265 |
| 541 | 3300025917 | Ga0207660_10033557 | Ga0207660_100335574 | 265 |
| 542 | 3300025920 | Ga0207649_10056940 | Ga0207649_100569402 | 265 |
| 543 | 3300025921 | Ga0207652_10038997 | Ga0207652_100389976 | 265 |
| 544 | 3300025921 | Ga0207652_10126285 | Ga0207652_101262854 | 265 |
| 545 | 3300025925 | Ga0207650_10239752 | Ga0207650_102397522 | 265 |
| 546 | 3300025931 | Ga0207644_10001610 | Ga0207644_100016105 | 265 |
| 547 | 3300025931 | Ga0207644_10024830 | Ga0207644_100248303 | 265 |
| 548 | 3300025932 | Ga0207690_10102531 | Ga0207690_101025313 | 265 |
| 549 | 3300025933 | Ga0207706_10062945 | Ga0207706_100629453 | 265 |
| 550 | 3300025934 | Ga0207686_10001321 | Ga0207686_100013217 | 265 |
| 551 | 3300025935 | Ga0207709_10003136 | Ga0207709_100031364 | 265 |
| 552 | 3300025935 | Ga0207709_10037073 | Ga0207709_100370734 | 265 |
| 553 | 3300025935 | Ga0207709_10572715 | Ga0207709_105727151 | 265 |
| 554 | 3300025941 | Ga0207711_10019129 | Ga0207711_100191297 | 265 |
| 555 | 3300025941 | Ga0207711_10156595 | Ga0207711_101565952 | 265 |
| 556 | 3300025942 | Ga0207689_10002102 | Ga0207689_1000210211 | 265 |
| 557 | 3300025942 | Ga0207689_10009874 | Ga0207689_100098745 | 265 |
| 558 | 3300025945 | Ga0207679_10106366 | Ga0207679_101063662 | 265 |
| 559 | 3300025945 | Ga0207679_10304566 | Ga0207679_103045662 | 265 |
| 560 | 3300025960 | Ga0207651_10291202 | Ga0207651_102912022 | 265 |
| 561 | 3300026035 | Ga0207703_10000043 | Ga0207703_100000438 | 265 |
| 562 | 3300026041 | Ga0207639_10081730 | Ga0207639_100817303 | 265 |
| 563 | 3300026075 | Ga0207708_10000196 | Ga0207708_1000019634 | 265 |
| 564 | 3300026078 | Ga0207702_10023166 | Ga0207702_100231666 | 265 |
| 565 | 3300026095 | Ga0207676_10022718 | Ga0207676_100227183 | 265 |
| 566 | 3300026116 | Ga0207674_10001115 | Ga0207674_1000111524 | 265 |
| 567 | 3300026116 | Ga0207674_10276964 | Ga0207674_102769642 | 265 |
| 568 | 3300028380 | Ga0268265_10582847 | Ga0268265_105828471 | 265 |
| 569 | 3300028381 | Ga0268264_10117447 | Ga0268264_101174473 | 265 |
| 570 | 3300031548 | Ga0307408_100013384 | Ga0307408_1000133846 | 265 |
| 571 | 3300031824 | Ga0307413_10036152 | Ga0307413_100361522 | 265 |
| 572 | 3300031852 | Ga0307410_10002023 | Ga0307410_100020235 | 265 |
| 573 | 3300031901 | Ga0307406_10007704 | Ga0307406_100077045 | 265 |
| 574 | 3300031911 | Ga0307412_10018014 | Ga0307412_100180145 | 265 |
| 575 | 3300031995 | Ga0307409_100075645 | Ga0307409_1000756452 | 265 |
| 576 | 3300032002 | Ga0307416_100010309 | Ga0307416_1000103095 | 265 |
| 577 | 3300032004 | Ga0307414_10007653 | Ga0307414_100076535 | 265 |
| 578 | 3300032126 | Ga0307415_100007828 | Ga0307415_1000078286 | 265 |
| 579 | 3300037466 | Ga0395898_0216244 | Ga0395898_0216244_345_1148 | 265 |
| 580 | 3300046664 | Ga0495659_0092218 | Ga0495659_0092218_246_1046 | 265 |
| 581 | 3300047318 | Ga0495636_0105731 | Ga0495636_0105731_213_1013 | 265 |
| 582 | 3300048906 | Ga0496103_0089903 | Ga0496103_0089903_652_1452 | 265 |
| 583 | 3300048909 | Ga0496106_0415000 | Ga0496106_0415000_178_978 | 265 |
| 584 | 3300050507 | nmdc:mga05p37_184818_c1 | nmdc:mga05p37_184818_c1_964_1761 | 265 |
| 585 | 3300050507 | nmdc:mga05p37_282388_c1 | nmdc:mga05p37_282388_c1_108_908 | 265 |
| 586 | 3300050507 | nmdc:mga05p37_83593_c1 | nmdc:mga05p37_83593_c1_3039_3839 | 265 |
| 587 | 3300050512 | nmdc:mga0n895_203507_c1 | nmdc:mga0n895_203507_c1_965_1765 | 265 |
| 588 | 3300050514 | nmdc:mga08x19_193356_c1 | nmdc:mga08x19_193356_c1_351_1154 | 265 |
| 589 | 3300059506 | Ga0587085_005441 | Ga0587085_005441_488_1291 | 265 |
| 590 | 3300059511 | Ga0587091_037760 | Ga0587091_037760_51_854 | 265 |
| 591 | 3300005289 | Ga0065704_10007866 | Ga0065704_100078664 | 266 |
| 592 | 3300005290 | Ga0065712_10009957 | Ga0065712_100099572 | 266 |
| 593 | 3300005290 | Ga0065712_10073465 | Ga0065712_100734654 | 266 |
| 594 | 3300005293 | Ga0065715_10012000 | Ga0065715_100120003 | 266 |
| 595 | 3300005293 | Ga0065715_10091196 | Ga0065715_100911968 | 266 |
| 596 | 3300005293 | Ga0065715_10125544 | Ga0065715_101255443 | 266 |
| 597 | 3300005293 | Ga0065715_10129549 | Ga0065715_101295493 | 266 |
| 598 | 3300005295 | Ga0065707_10179265 | Ga0065707_101792652 | 266 |
| 599 | 3300005328 | Ga0070676_10061800 | Ga0070676_100618002 | 266 |
| 600 | 3300005328 | Ga0070676_10296667 | Ga0070676_102966671 | 266 |
| 601 | 3300005330 | Ga0070690_100001514 | Ga0070690_10000151413 | 266 |
| 602 | 3300005330 | Ga0070690_100079209 | Ga0070690_1000792092 | 266 |
| 603 | 3300005330 | Ga0070690_100158097 | Ga0070690_1001580972 | 266 |
| 604 | 3300005330 | Ga0070690_100593698 | Ga0070690_1005936981 | 266 |
| 605 | 3300005331 | Ga0070670_100128323 | Ga0070670_1001283233 | 266 |
| 606 | 3300005331 | Ga0070670_100153806 | Ga0070670_1001538062 | 266 |
| 607 | 3300005331 | Ga0070670_100318672 | Ga0070670_1003186722 | 266 |
| 608 | 3300005334 | Ga0068869_100048762 | Ga0068869_1000487623 | 266 |
| 609 | 3300005334 | Ga0068869_100077696 | Ga0068869_1000776963 | 266 |
| 610 | 3300005334 | Ga0068869_100211334 | Ga0068869_1002113342 | 266 |
| 611 | 3300005335 | Ga0070666_10009988 | Ga0070666_100099886 | 266 |
| 612 | 3300005335 | Ga0070666_10151870 | Ga0070666_101518702 | 266 |
| 613 | 3300005336 | Ga0070680_100083439 | Ga0070680_1000834393 | 266 |
| 614 | 3300005337 | Ga0070682_100000658 | Ga0070682_10000065815 | 266 |
| 615 | 3300005338 | Ga0068868_100068046 | Ga0068868_1000680462 | 266 |
| 616 | 3300005338 | Ga0068868_100180895 | Ga0068868_1001808952 | 266 |
| 617 | 3300005340 | Ga0070689_100017912 | Ga0070689_1000179121 | 266 |
| 618 | 3300005340 | Ga0070689_100035344 | Ga0070689_1000353444 | 266 |
| 619 | 3300005340 | Ga0070689_100063329 | Ga0070689_1000633293 | 266 |
| 620 | 3300005343 | Ga0070687_100106748 | Ga0070687_1001067481 | 266 |
| 621 | 3300005343 | Ga0070687_100179835 | Ga0070687_1001798352 | 266 |
| 622 | 3300005345 | Ga0070692_10152614 | Ga0070692_101526142 | 266 |
| 623 | 3300005345 | Ga0070692_10226599 | Ga0070692_102265991 | 266 |
| 624 | 3300005345 | Ga0070692_10233098 | Ga0070692_102330981 | 266 |
| 625 | 3300005353 | Ga0070669_100030178 | Ga0070669_1000301786 | 266 |
| 626 | 3300005353 | Ga0070669_100061319 | Ga0070669_1000613194 | 266 |
| 627 | 3300005353 | Ga0070669_100145666 | Ga0070669_1001456661 | 266 |
| 628 | 3300005354 | Ga0070675_100077534 | Ga0070675_1000775342 | 266 |
| 629 | 3300005355 | Ga0070671_100170372 | Ga0070671_1001703722 | 266 |
| 630 | 3300005356 | Ga0070674_100116112 | Ga0070674_1001161123 | 266 |
| 631 | 3300005356 | Ga0070674_100190414 | Ga0070674_1001904141 | 266 |
| 632 | 3300005364 | Ga0070673_100043302 | Ga0070673_1000433024 | 266 |
| 633 | 3300005364 | Ga0070673_100077183 | Ga0070673_1000771832 | 266 |
| 634 | 3300005364 | Ga0070673_100081737 | Ga0070673_1000817373 | 266 |
| 635 | 3300005364 | Ga0070673_100084407 | Ga0070673_1000844072 | 266 |
| 636 | 3300005364 | Ga0070673_100246507 | Ga0070673_1002465072 | 266 |
| 637 | 3300005364 | Ga0070673_100250396 | Ga0070673_1002503962 | 266 |
| 638 | 3300005365 | Ga0070688_100044481 | Ga0070688_1000444812 | 266 |
| 639 | 3300005367 | Ga0070667_100420358 | Ga0070667_1004203581 | 266 |
| 640 | 3300005438 | Ga0070701_10045910 | Ga0070701_100459103 | 266 |
| 641 | 3300005438 | Ga0070701_10349716 | Ga0070701_103497161 | 266 |
| 642 | 3300005440 | Ga0070705_100013030 | Ga0070705_1000130302 | 266 |
| 643 | 3300005440 | Ga0070705_100014024 | Ga0070705_1000140244 | 266 |
| 644 | 3300005440 | Ga0070705_100201943 | Ga0070705_1002019431 | 266 |
| 645 | 3300005441 | Ga0070700_100010579 | Ga0070700_1000105792 | 266 |
| 646 | 3300005441 | Ga0070700_100120895 | Ga0070700_1001208951 | 266 |
| 647 | 3300005441 | Ga0070700_100157375 | Ga0070700_1001573752 | 266 |
| 648 | 3300005444 | Ga0070694_100017204 | Ga0070694_1000172042 | 266 |
| 649 | 3300005444 | Ga0070694_100092269 | Ga0070694_1000922693 | 266 |
| 650 | 3300005444 | Ga0070694_100221294 | Ga0070694_1002212942 | 266 |
| 651 | 3300005444 | Ga0070694_100276359 | Ga0070694_1002763591 | 266 |
| 652 | 3300005445 | Ga0070708_100000337 | Ga0070708_10000033719 | 266 |
| 653 | 3300005456 | Ga0070678_100047848 | Ga0070678_1000478483 | 266 |
| 654 | 3300005456 | Ga0070678_100236270 | Ga0070678_1002362702 | 266 |
| 655 | 3300005457 | Ga0070662_100150379 | Ga0070662_1001503792 | 266 |
| 656 | 3300005458 | Ga0070681_10001081 | Ga0070681_100010818 | 266 |
| 657 | 3300005458 | Ga0070681_10054385 | Ga0070681_100543855 | 266 |
| 658 | 3300005459 | Ga0068867_100034591 | Ga0068867_1000345912 | 266 |
| 659 | 3300005459 | Ga0068867_100042795 | Ga0068867_1000427953 | 266 |
| 660 | 3300005459 | Ga0068867_100101133 | Ga0068867_1001011332 | 266 |
| 661 | 3300005466 | Ga0070685_10305426 | Ga0070685_103054261 | 266 |
| 662 | 3300005467 | Ga0070706_100000017 | Ga0070706_10000001768 | 266 |
| 663 | 3300005467 | Ga0070706_100012259 | Ga0070706_1000122593 | 266 |
| 664 | 3300005467 | Ga0070706_100028645 | Ga0070706_1000286456 | 266 |
| 665 | 3300005467 | Ga0070706_100488454 | Ga0070706_1004884541 | 266 |
| 666 | 3300005468 | Ga0070707_100145430 | Ga0070707_1001454301 | 266 |
| 667 | 3300005471 | Ga0070698_100004605 | Ga0070698_10000460513 | 266 |
| 668 | 3300005471 | Ga0070698_100018834 | Ga0070698_1000188348 | 266 |
| 669 | 3300005471 | Ga0070698_100045775 | Ga0070698_1000457753 | 266 |
| 670 | 3300005471 | Ga0070698_100172267 | Ga0070698_1001722672 | 266 |
| 671 | 3300005518 | Ga0070699_100006275 | Ga0070699_1000062759 | 266 |
| 672 | 3300005518 | Ga0070699_100007202 | Ga0070699_10000720211 | 266 |
| 673 | 3300005536 | Ga0070697_100000062 | Ga0070697_10000006214 | 266 |
| 674 | 3300005536 | Ga0070697_100001572 | Ga0070697_1000015726 | 266 |
| 675 | 3300005536 | Ga0070697_100102947 | Ga0070697_1001029473 | 266 |
| 676 | 3300005536 | Ga0070697_100122249 | Ga0070697_1001222492 | 266 |
| 677 | 3300005536 | Ga0070697_100170156 | Ga0070697_1001701561 | 266 |
| 678 | 3300005539 | Ga0068853_100313516 | Ga0068853_1003135162 | 266 |
| 679 | 3300005543 | Ga0070672_100003235 | Ga0070672_10000323512 | 266 |
| 680 | 3300005543 | Ga0070672_100255342 | Ga0070672_1002553421 | 266 |
| 681 | 3300005543 | Ga0070672_100327472 | Ga0070672_1003274722 | 266 |
| 682 | 3300005544 | Ga0070686_100002174 | Ga0070686_10000217410 | 266 |
| 683 | 3300005545 | Ga0070695_100013916 | Ga0070695_1000139163 | 266 |
| 684 | 3300005545 | Ga0070695_100098211 | Ga0070695_1000982111 | 266 |
| 685 | 3300005545 | Ga0070695_100134121 | Ga0070695_1001341213 | 266 |
| 686 | 3300005545 | Ga0070695_100162909 | Ga0070695_1001629092 | 266 |
| 687 | 3300005545 | Ga0070695_100355392 | Ga0070695_1003553921 | 266 |
| 688 | 3300005546 | Ga0070696_100028469 | Ga0070696_1000284694 | 266 |
| 689 | 3300005547 | Ga0070693_100040645 | Ga0070693_1000406452 | 266 |
| 690 | 3300005548 | Ga0070665_100267008 | Ga0070665_1002670082 | 266 |
| 691 | 3300005549 | Ga0070704_100041854 | Ga0070704_1000418541 | 266 |
| 692 | 3300005549 | Ga0070704_100228050 | Ga0070704_1002280502 | 266 |
| 693 | 3300005549 | Ga0070704_100527065 | Ga0070704_1005270651 | 266 |
| 694 | 3300005564 | Ga0070664_100073910 | Ga0070664_1000739103 | 266 |
| 695 | 3300005564 | Ga0070664_100089390 | Ga0070664_1000893904 | 266 |
| 696 | 3300005564 | Ga0070664_100373174 | Ga0070664_1003731741 | 266 |
| 697 | 3300005577 | Ga0068857_100096441 | Ga0068857_1000964412 | 266 |
| 698 | 3300005577 | Ga0068857_100259806 | Ga0068857_1002598063 | 266 |
| 699 | 3300005578 | Ga0068854_100039135 | Ga0068854_1000391352 | 266 |
| 700 | 3300005614 | Ga0068856_100339979 | Ga0068856_1003399792 | 266 |
| 701 | 3300005615 | Ga0070702_100020950 | Ga0070702_1000209502 | 266 |
| 702 | 3300005615 | Ga0070702_100052042 | Ga0070702_1000520422 | 266 |
| 703 | 3300005615 | Ga0070702_100063007 | Ga0070702_1000630073 | 266 |
| 704 | 3300005615 | Ga0070702_100183017 | Ga0070702_1001830172 | 266 |
| 705 | 3300005616 | Ga0068852_100129712 | Ga0068852_1001297123 | 266 |
| 706 | 3300005616 | Ga0068852_100318997 | Ga0068852_1003189971 | 266 |
| 707 | 3300005617 | Ga0068859_100006661 | Ga0068859_1000066618 | 266 |
| 708 | 3300005617 | Ga0068859_100009613 | Ga0068859_1000096135 | 266 |
| 709 | 3300005617 | Ga0068859_100063364 | Ga0068859_1000633644 | 266 |
| 710 | 3300005617 | Ga0068859_100205079 | Ga0068859_1002050792 | 266 |
| 711 | 3300005617 | Ga0068859_100235025 | Ga0068859_1002350253 | 266 |
| 712 | 3300005618 | Ga0068864_100054098 | Ga0068864_1000540984 | 266 |
| 713 | 3300005618 | Ga0068864_100871270 | Ga0068864_1008712701 | 266 |
| 714 | 3300005718 | Ga0068866_10045935 | Ga0068866_100459352 | 266 |
| 715 | 3300005718 | Ga0068866_10079744 | Ga0068866_100797442 | 266 |
| 716 | 3300005719 | Ga0068861_100004194 | Ga0068861_1000041949 | 266 |
| 717 | 3300005719 | Ga0068861_100151057 | Ga0068861_1001510572 | 266 |
| 718 | 3300005719 | Ga0068861_100218202 | Ga0068861_1002182022 | 266 |
| 719 | 3300005719 | Ga0068861_100332914 | Ga0068861_1003329142 | 266 |
| 720 | 3300005840 | Ga0068870_10054718 | Ga0068870_100547182 | 266 |
| 721 | 3300005840 | Ga0068870_10107101 | Ga0068870_101071012 | 266 |
| 722 | 3300005840 | Ga0068870_10188650 | Ga0068870_101886501 | 266 |
| 723 | 3300005841 | Ga0068863_100075227 | Ga0068863_1000752274 | 266 |
| 724 | 3300005841 | Ga0068863_100112035 | Ga0068863_1001120353 | 266 |
| 725 | 3300005841 | Ga0068863_100167444 | Ga0068863_1001674443 | 266 |
| 726 | 3300005841 | Ga0068863_100213033 | Ga0068863_1002130332 | 266 |
| 727 | 3300005841 | Ga0068863_100223750 | Ga0068863_1002237502 | 266 |
| 728 | 3300005841 | Ga0068863_100399332 | Ga0068863_1003993322 | 266 |
| 729 | 3300005842 | Ga0068858_100020307 | Ga0068858_1000203078 | 266 |
| 730 | 3300005842 | Ga0068858_100062270 | Ga0068858_1000622704 | 266 |
| 731 | 3300005842 | Ga0068858_100070049 | Ga0068858_1000700493 | 266 |
| 732 | 3300005843 | Ga0068860_100067260 | Ga0068860_1000672604 | 266 |
| 733 | 3300005843 | Ga0068860_100095228 | Ga0068860_1000952283 | 266 |
| 734 | 3300005843 | Ga0068860_100124757 | Ga0068860_1001247573 | 266 |
| 735 | 3300005843 | Ga0068860_100186267 | Ga0068860_1001862672 | 266 |
| 736 | 3300005843 | Ga0068860_100332402 | Ga0068860_1003324022 | 266 |
| 737 | 3300005844 | Ga0068862_100036312 | Ga0068862_1000363126 | 266 |
| 738 | 3300005844 | Ga0068862_100073581 | Ga0068862_1000735815 | 266 |
| 739 | 3300005844 | Ga0068862_100132035 | Ga0068862_1001320352 | 266 |
| 740 | 3300005844 | Ga0068862_100223692 | Ga0068862_1002236922 | 266 |
| 741 | 3300005844 | Ga0068862_100256870 | Ga0068862_1002568702 | 266 |
| 742 | 3300006237 | Ga0097621_100008542 | Ga0097621_1000085428 | 266 |
| 743 | 3300006237 | Ga0097621_100167622 | Ga0097621_1001676222 | 266 |
| 744 | 3300006237 | Ga0097621_100320459 | Ga0097621_1003204591 | 266 |
| 745 | 3300006358 | Ga0068871_100031414 | Ga0068871_1000314142 | 266 |
| 746 | 3300006358 | Ga0068871_100185048 | Ga0068871_1001850482 | 266 |
| 747 | 3300006844 | Ga0075428_100085023 | Ga0075428_1000850232 | 266 |
| 748 | 3300006844 | Ga0075428_100369112 | Ga0075428_1003691122 | 266 |
| 749 | 3300006844 | Ga0075428_100555117 | Ga0075428_1005551172 | 266 |
| 750 | 3300006846 | Ga0075430_100066558 | Ga0075430_1000665582 | 266 |
| 751 | 3300006847 | Ga0075431_100094063 | Ga0075431_1000940633 | 266 |
| 752 | 3300006852 | Ga0075433_10056566 | Ga0075433_100565663 | 266 |
| 753 | 3300006852 | Ga0075433_10171185 | Ga0075433_101711853 | 266 |
| 754 | 3300006852 | Ga0075433_10394577 | Ga0075433_103945771 | 266 |
| 755 | 3300006871 | Ga0075434_100087715 | Ga0075434_1000877152 | 266 |
| 756 | 3300006871 | Ga0075434_100091846 | Ga0075434_1000918462 | 266 |
| 757 | 3300006880 | Ga0075429_100024483 | Ga0075429_1000244833 | 266 |
| 758 | 3300006880 | Ga0075429_100386165 | Ga0075429_1003861652 | 266 |
| 759 | 3300006881 | Ga0068865_100048889 | Ga0068865_1000488892 | 266 |
| 760 | 3300006931 | Ga0097620_100006661 | Ga0097620_1000066618 | 266 |
| 761 | 3300006931 | Ga0097620_100009613 | Ga0097620_1000096135 | 266 |
| 762 | 3300006931 | Ga0097620_100063365 | Ga0097620_1000633654 | 266 |
| 763 | 3300006931 | Ga0097620_100205064 | Ga0097620_1002050642 | 266 |
| 764 | 3300006931 | Ga0097620_100235042 | Ga0097620_1002350423 | 266 |
| 765 | 3300007076 | Ga0075435_100238966 | Ga0075435_1002389661 | 266 |
| 766 | 3300007076 | Ga0075435_100553886 | Ga0075435_1005538861 | 266 |
| 767 | 3300009093 | Ga0105240_10199958 | Ga0105240_101999582 | 266 |
| 768 | 3300009147 | Ga0114129_10051841 | Ga0114129_100518418 | 266 |
| 769 | 3300009147 | Ga0114129_10066340 | Ga0114129_100663405 | 266 |
| 770 | 3300009147 | Ga0114129_10286870 | Ga0114129_102868703 | 266 |
| 771 | 3300009147 | Ga0114129_10911613 | Ga0114129_109116131 | 266 |
| 772 | 3300009174 | Ga0105241_10109925 | Ga0105241_101099251 | 266 |
| 773 | 3300009176 | Ga0105242_10062185 | Ga0105242_100621853 | 266 |
| 774 | 3300009177 | Ga0105248_10007251 | Ga0105248_100072519 | 266 |
| 775 | 3300009553 | Ga0105249_10194020 | Ga0105249_101940202 | 266 |
| 776 | 3300013307 | Ga0157372_10012910 | Ga0157372_100129104 | 266 |
| 777 | 3300013308 | Ga0157375_10296720 | Ga0157375_102967202 | 266 |
| 778 | 3300014326 | Ga0157380_10017030 | Ga0157380_100170301 | 266 |
| 779 | 3300014326 | Ga0157380_10183100 | Ga0157380_101831003 | 266 |
| 780 | 3300017792 | Ga0163161_10032403 | Ga0163161_100324034 | 266 |
| 781 | 3300025315 | Ga0207697_10013752 | Ga0207697_100137523 | 266 |
| 782 | 3300025900 | Ga0207710_10006048 | Ga0207710_100060482 | 266 |
| 783 | 3300025901 | Ga0207688_10080312 | Ga0207688_100803122 | 266 |
| 784 | 3300025903 | Ga0207680_10106801 | Ga0207680_101068012 | 266 |
| 785 | 3300025907 | Ga0207645_10034311 | Ga0207645_100343112 | 266 |
| 786 | 3300025907 | Ga0207645_10104839 | Ga0207645_101048391 | 266 |
| 787 | 3300025908 | Ga0207643_10007213 | Ga0207643_100072137 | 266 |
| 788 | 3300025908 | Ga0207643_10044664 | Ga0207643_100446642 | 266 |
| 789 | 3300025910 | Ga0207684_10000079 | Ga0207684_1000007923 | 266 |
| 790 | 3300025910 | Ga0207684_10007353 | Ga0207684_100073536 | 266 |
| 791 | 3300025910 | Ga0207684_10116395 | Ga0207684_101163952 | 266 |
| 792 | 3300025912 | Ga0207707_10034115 | Ga0207707_100341152 | 266 |
| 793 | 3300025912 | Ga0207707_10046482 | Ga0207707_100464825 | 266 |
| 794 | 3300025918 | Ga0207662_10003190 | Ga0207662_100031902 | 266 |
| 795 | 3300025918 | Ga0207662_10017971 | Ga0207662_100179714 | 266 |
| 796 | 3300025918 | Ga0207662_10021969 | Ga0207662_100219692 | 266 |
| 797 | 3300025920 | Ga0207649_10441359 | Ga0207649_104413591 | 266 |
| 798 | 3300025922 | Ga0207646_10102864 | Ga0207646_101028642 | 266 |
| 799 | 3300025922 | Ga0207646_10174609 | Ga0207646_101746092 | 266 |
| 800 | 3300025922 | Ga0207646_10322797 | Ga0207646_103227971 | 266 |
| 801 | 3300025922 | Ga0207646_10396313 | Ga0207646_103963132 | 266 |
| 802 | 3300025923 | Ga0207681_10001745 | Ga0207681_100017455 | 266 |
| 803 | 3300025923 | Ga0207681_10005262 | Ga0207681_100052626 | 266 |
| 804 | 3300025923 | Ga0207681_10173897 | Ga0207681_101738972 | 266 |
| 805 | 3300025925 | Ga0207650_10008569 | Ga0207650_100085697 | 266 |
| 806 | 3300025925 | Ga0207650_10122387 | Ga0207650_101223872 | 266 |
| 807 | 3300025925 | Ga0207650_10283155 | Ga0207650_102831552 | 266 |
| 808 | 3300025925 | Ga0207650_10360810 | Ga0207650_103608101 | 266 |
| 809 | 3300025926 | Ga0207659_10059289 | Ga0207659_100592892 | 266 |
| 810 | 3300025926 | Ga0207659_10591353 | Ga0207659_105913531 | 266 |
| 811 | 3300025931 | Ga0207644_10164322 | Ga0207644_101643222 | 266 |
| 812 | 3300025933 | Ga0207706_10033906 | Ga0207706_100339061 | 266 |
| 813 | 3300025934 | Ga0207686_10033667 | Ga0207686_100336672 | 266 |
| 814 | 3300025934 | Ga0207686_10072162 | Ga0207686_100721624 | 266 |
| 815 | 3300025934 | Ga0207686_10277884 | Ga0207686_102778841 | 266 |
| 816 | 3300025935 | Ga0207709_10000921 | Ga0207709_100009212 | 266 |
| 817 | 3300025935 | Ga0207709_10037714 | Ga0207709_100377143 | 266 |
| 818 | 3300025936 | Ga0207670_10000250 | Ga0207670_1000025011 | 266 |
| 819 | 3300025936 | Ga0207670_10161749 | Ga0207670_101617491 | 266 |
| 820 | 3300025937 | Ga0207669_10110184 | Ga0207669_101101841 | 266 |
| 821 | 3300025938 | Ga0207704_10357412 | Ga0207704_103574121 | 266 |
| 822 | 3300025939 | Ga0207665_10112476 | Ga0207665_101124761 | 266 |
| 823 | 3300025940 | Ga0207691_10001421 | Ga0207691_100014215 | 266 |
| 824 | 3300025940 | Ga0207691_10207170 | Ga0207691_102071702 | 266 |
| 825 | 3300025941 | Ga0207711_10132721 | Ga0207711_101327212 | 266 |
| 826 | 3300025941 | Ga0207711_10159891 | Ga0207711_101598912 | 266 |
| 827 | 3300025941 | Ga0207711_10438171 | Ga0207711_104381712 | 266 |
| 828 | 3300025942 | Ga0207689_10019251 | Ga0207689_100192515 | 266 |
| 829 | 3300025942 | Ga0207689_10048605 | Ga0207689_100486055 | 266 |
| 830 | 3300025942 | Ga0207689_10257770 | Ga0207689_102577703 | 266 |
| 831 | 3300025942 | Ga0207689_10495372 | Ga0207689_104953721 | 266 |
| 832 | 3300025942 | Ga0207689_10510471 | Ga0207689_105104711 | 266 |
| 833 | 3300025945 | Ga0207679_10166511 | Ga0207679_101665111 | 266 |
| 834 | 3300025945 | Ga0207679_10170112 | Ga0207679_101701122 | 266 |
| 835 | 3300025945 | Ga0207679_10469627 | Ga0207679_104696272 | 266 |
| 836 | 3300025960 | Ga0207651_10055671 | Ga0207651_100556713 | 266 |
| 837 | 3300025960 | Ga0207651_10344551 | Ga0207651_103445511 | 266 |
| 838 | 3300025960 | Ga0207651_10380402 | Ga0207651_103804021 | 266 |
| 839 | 3300025960 | Ga0207651_10719418 | Ga0207651_107194181 | 266 |
| 840 | 3300025960 | Ga0207651_10728768 | Ga0207651_107287681 | 266 |
| 841 | 3300025961 | Ga0207712_10017134 | Ga0207712_100171341 | 266 |
| 842 | 3300025961 | Ga0207712_10033995 | Ga0207712_100339952 | 266 |
| 843 | 3300025981 | Ga0207640_10012393 | Ga0207640_100123931 | 266 |
| 844 | 3300025981 | Ga0207640_10457192 | Ga0207640_104571921 | 266 |
| 845 | 3300025986 | Ga0207658_10165555 | Ga0207658_101655552 | 266 |
| 846 | 3300026023 | Ga0207677_10099650 | Ga0207677_100996502 | 266 |
| 847 | 3300026023 | Ga0207677_10147209 | Ga0207677_101472092 | 266 |
| 848 | 3300026035 | Ga0207703_10016211 | Ga0207703_100162116 | 266 |
| 849 | 3300026035 | Ga0207703_10102323 | Ga0207703_101023232 | 266 |
| 850 | 3300026075 | Ga0207708_10024519 | Ga0207708_100245194 | 266 |
| 851 | 3300026075 | Ga0207708_10038708 | Ga0207708_100387085 | 266 |
| 852 | 3300026075 | Ga0207708_10097546 | Ga0207708_100975462 | 266 |
| 853 | 3300026088 | Ga0207641_10053400 | Ga0207641_100534002 | 266 |
| 854 | 3300026088 | Ga0207641_10066364 | Ga0207641_100663643 | 266 |
| 855 | 3300026088 | Ga0207641_10235805 | Ga0207641_102358052 | 266 |
| 856 | 3300026088 | Ga0207641_10402557 | Ga0207641_104025572 | 266 |
| 857 | 3300026089 | Ga0207648_10025398 | Ga0207648_100253985 | 266 |
| 858 | 3300026089 | Ga0207648_10052268 | Ga0207648_100522682 | 266 |
| 859 | 3300026089 | Ga0207648_10052499 | Ga0207648_100524994 | 266 |
| 860 | 3300026095 | Ga0207676_10003808 | Ga0207676_1000380811 | 266 |
| 861 | 3300026095 | Ga0207676_10057488 | Ga0207676_100574883 | 266 |
| 862 | 3300026095 | Ga0207676_10594110 | Ga0207676_105941102 | 266 |
| 863 | 3300026116 | Ga0207674_10033931 | Ga0207674_100339315 | 266 |
| 864 | 3300026116 | Ga0207674_10147004 | Ga0207674_101470042 | 266 |
| 865 | 3300026116 | Ga0207674_10429880 | Ga0207674_104298802 | 266 |
| 866 | 3300026116 | Ga0207674_10536449 | Ga0207674_105364491 | 266 |
| 867 | 3300026116 | Ga0207674_10738722 | Ga0207674_107387221 | 266 |
| 868 | 3300026118 | Ga0207675_100008300 | Ga0207675_1000083009 | 266 |
| 869 | 3300026118 | Ga0207675_100017343 | Ga0207675_1000173433 | 266 |
| 870 | 3300026118 | Ga0207675_100027734 | Ga0207675_1000277343 | 266 |
| 871 | 3300026118 | Ga0207675_100188276 | Ga0207675_1001882761 | 266 |
| 872 | 3300026118 | Ga0207675_100408669 | Ga0207675_1004086692 | 266 |
| 873 | 3300026118 | Ga0207675_100964185 | Ga0207675_1009641851 | 266 |
| 874 | 3300026121 | Ga0207683_10146154 | Ga0207683_101461542 | 266 |
| 875 | 3300026121 | Ga0207683_10263611 | Ga0207683_102636112 | 266 |
| 876 | 3300026142 | Ga0207698_10201010 | Ga0207698_102010103 | 266 |
| 877 | 3300028379 | Ga0268266_10330643 | Ga0268266_103306431 | 266 |
| 878 | 3300028380 | Ga0268265_10160070 | Ga0268265_101600702 | 266 |
| 879 | 3300028380 | Ga0268265_10166170 | Ga0268265_101661702 | 266 |
| 880 | 3300028380 | Ga0268265_10247986 | Ga0268265_102479862 | 266 |
| 881 | 3300028380 | Ga0268265_10429373 | Ga0268265_104293731 | 266 |
| 882 | 3300028381 | Ga0268264_10027695 | Ga0268264_100276954 | 266 |
| 883 | 3300028381 | Ga0268264_10049768 | Ga0268264_100497684 | 266 |
| 884 | 3300028381 | Ga0268264_10130419 | Ga0268264_101304193 | 266 |
| 885 | 3300028381 | Ga0268264_10157374 | Ga0268264_101573742 | 266 |
| 886 | 3300031456 | Ga0307513_10322989 | Ga0307513_103229891 | 266 |
| 887 | 3300031548 | Ga0307408_100042473 | Ga0307408_1000424733 | 266 |
| 888 | 3300031901 | Ga0307406_10186241 | Ga0307406_101862412 | 266 |
| 889 | 3300031995 | Ga0307409_100223084 | Ga0307409_1002230842 | 266 |
| 890 | 3300037312 | Ga0395899_0045268 | Ga0395899_0045268_328_1128 | 266 |
| 891 | 3300037418 | Ga0395900_0067377 | Ga0395900_0067377_2673_3473 | 266 |
| 892 | 3300037418 | Ga0395900_0218954 | Ga0395900_0218954_863_1663 | 266 |
| 893 | 3300038996 | Ga0242420_006840 | Ga0242420_006840_679_1479 | 266 |
| 894 | 3300042439 | Ga0439464_0064509 | Ga0439464_0064509_51_854 | 266 |
| 895 | 3300046525 | Ga0495663_0001444 | Ga0495663_0001444_5258_6058 | 266 |
| 896 | 3300046537 | Ga0495598_0009606 | Ga0495598_0009606_1115_1915 | 266 |
| 897 | 3300046539 | Ga0495621_0001077 | Ga0495621_0001077_1894_2694 | 266 |
| 898 | 3300047318 | Ga0495636_0155542 | Ga0495636_0155542_185_985 | 266 |
| 899 | 3300048905 | Ga0496102_0116640 | Ga0496102_0116640_1213_2013 | 266 |
| 900 | 3300049515 | Ga0501292_003124 | Ga0501292_003124_760_1563 | 266 |
| 901 | 3300049522 | Ga0501299_000754 | Ga0501299_000754_2267_3070 | 266 |
| 902 | 3300049649 | Ga0501198_001879 | Ga0501198_001879_110_913 | 266 |
| 903 | 3300049652 | Ga0501202_006175 | Ga0501202_006175_489_1292 | 266 |
| 904 | 3300049655 | Ga0501208_004930 | Ga0501208_004930_633_1436 | 266 |
| 905 | 3300049661 | Ga0501217_002052 | Ga0501217_002052_2239_3042 | 266 |
| 906 | 3300049684 | Ga0501255_004304 | Ga0501255_004304_531_1334 | 266 |
| 907 | 3300049690 | Ga0501261_006049 | Ga0501261_006049_165_968 | 266 |
| 908 | 3300049707 | Ga0501234_002153 | Ga0501234_002153_750_1553 | 266 |
| 909 | 3300049770 | Ga0501273_003589 | Ga0501273_003589_472_1275 | 266 |
| 910 | 3300049775 | Ga0501279_001951 | Ga0501279_001951_40_843 | 266 |
| 911 | 3300049851 | Ga0501212_003670 | Ga0501212_003670_161_964 | 266 |
| 912 | 3300050507 | nmdc:mga05p37_275258_c1 | nmdc:mga05p37_275258_c1_881_1681 | 266 |
| 913 | 3300050512 | nmdc:mga0n895_236459_c1 | nmdc:mga0n895_236459_c1_251_1051 | 266 |
| 914 | 3300050513 | nmdc:mga0rr50_301141_c1 | nmdc:mga0rr50_301141_c1_339_1274 | 266 |
| 915 | 3300050515 | nmdc:mga0a205_177434_c1 | nmdc:mga0a205_177434_c1_973_1773 | 266 |
| 916 | 3300050515 | nmdc:mga0a205_263263_c1 | nmdc:mga0a205_263263_c1_197_997 | 266 |
| 917 | 2162886007 | SwRhRL2b_contig_36198 | SwRhRL2b_0769.00008800 | 267 |
| 918 | 3300002459 | JGI24751J29686_10000009 | JGI24751J29686_1000000948 | 267 |
| 919 | 3300003203 | JGI25406J46586_10004348 | JGI25406J46586_100043483 | 267 |
| 920 | 3300003316 | rootH1_10128632 | rootH1_101286321 | 267 |
| 921 | 3300005289 | Ga0065704_10071538 | Ga0065704_1007153811 | 267 |
| 922 | 3300005289 | Ga0065704_10150712 | Ga0065704_101507122 | 267 |
| 923 | 3300005293 | Ga0065715_10018282 | Ga0065715_100182823 | 267 |
| 924 | 3300005295 | Ga0065707_10001225 | Ga0065707_1000122510 | 267 |
| 925 | 3300005331 | Ga0070670_100000088 | Ga0070670_10000008825 | 267 |
| 926 | 3300005331 | Ga0070670_100280649 | Ga0070670_1002806491 | 267 |
| 927 | 3300005331 | Ga0070670_100308186 | Ga0070670_1003081862 | 267 |
| 928 | 3300005334 | Ga0068869_100098505 | Ga0068869_1000985052 | 267 |
| 929 | 3300005337 | Ga0070682_100053546 | Ga0070682_1000535463 | 267 |
| 930 | 3300005340 | Ga0070689_100365267 | Ga0070689_1003652671 | 267 |
| 931 | 3300005345 | Ga0070692_10033025 | Ga0070692_100330252 | 267 |
| 932 | 3300005353 | Ga0070669_100037585 | Ga0070669_1000375855 | 267 |
| 933 | 3300005364 | Ga0070673_100107933 | Ga0070673_1001079332 | 267 |
| 934 | 3300005458 | Ga0070681_10466136 | Ga0070681_104661361 | 267 |
| 935 | 3300005518 | Ga0070699_100788077 | Ga0070699_1007880771 | 267 |
| 936 | 3300005539 | Ga0068853_100180300 | Ga0068853_1001803001 | 267 |
| 937 | 3300005545 | Ga0070695_100141653 | Ga0070695_1001416531 | 267 |
| 938 | 3300005545 | Ga0070695_100280149 | Ga0070695_1002801492 | 267 |
| 939 | 3300005547 | Ga0070693_100275582 | Ga0070693_1002755822 | 267 |
| 940 | 3300005615 | Ga0070702_100118173 | Ga0070702_1001181732 | 267 |
| 941 | 3300005618 | Ga0068864_100387108 | Ga0068864_1003871081 | 267 |
| 942 | 3300005618 | Ga0068864_100617330 | Ga0068864_1006173301 | 267 |
| 943 | 3300005841 | Ga0068863_100027299 | Ga0068863_1000272997 | 267 |
| 944 | 3300005843 | Ga0068860_100014175 | Ga0068860_10001417510 | 267 |
| 945 | 3300005844 | Ga0068862_100211958 | Ga0068862_1002119582 | 267 |
| 946 | 3300005985 | Ga0081539_10000408 | Ga0081539_1000040885 | 267 |
| 947 | 3300006358 | Ga0068871_100079208 | Ga0068871_1000792082 | 267 |
| 948 | 3300006852 | Ga0075433_10168759 | Ga0075433_101687591 | 267 |
| 949 | 3300006871 | Ga0075434_100363644 | Ga0075434_1003636441 | 267 |
| 950 | 3300025315 | Ga0207697_10077790 | Ga0207697_100777901 | 267 |
| 951 | 3300025899 | Ga0207642_10076213 | Ga0207642_100762132 | 267 |
| 952 | 3300025920 | Ga0207649_10196675 | Ga0207649_101966752 | 267 |
| 953 | 3300025923 | Ga0207681_10011079 | Ga0207681_100110795 | 267 |
| 954 | 3300025924 | Ga0207694_10020544 | Ga0207694_100205445 | 267 |
| 955 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001217 | 267 |
| 956 | 3300025931 | Ga0207644_10224378 | Ga0207644_102243782 | 267 |
| 957 | 3300025934 | Ga0207686_10074054 | Ga0207686_100740543 | 267 |
| 958 | 3300025936 | Ga0207670_10060445 | Ga0207670_100604453 | 267 |
| 959 | 3300025936 | Ga0207670_10469109 | Ga0207670_104691092 | 267 |
| 960 | 3300025941 | Ga0207711_10359566 | Ga0207711_103595662 | 267 |
| 961 | 3300025941 | Ga0207711_10542011 | Ga0207711_105420112 | 267 |
| 962 | 3300025941 | Ga0207711_10654226 | Ga0207711_106542261 | 267 |
| 963 | 3300025945 | Ga0207679_10487633 | Ga0207679_104876331 | 267 |
| 964 | 3300025961 | Ga0207712_10005189 | Ga0207712_100051899 | 267 |
| 965 | 3300026035 | Ga0207703_10103548 | Ga0207703_101035482 | 267 |
| 966 | 3300027907 | Ga0207428_10003589 | Ga0207428_1000358910 | 267 |
| 967 | 3300028381 | Ga0268264_10317595 | Ga0268264_103175952 | 267 |
| 968 | 3300028381 | Ga0268264_10620847 | Ga0268264_106208472 | 267 |
| 969 | 3300050511 | nmdc:mga08y16_3905_c1 | nmdc:mga08y16_3905_c1_7895_8698 | 267 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u3f-assembly2.cif.gz_B | structural basis for the interaction of pyk2 pat domain with paxillin ld motifs | 0.4188 | 125 | 258 |
| 2b0h-assembly1.cif.gz_A | solution structure of vbs3 fragment of talin | 0.4055 | 96 | 260 |
| 1ktm-assembly1.cif.gz_A | solution structure of fat domain of focal adhesion kinase | 0.4009 | 130 | 256 |
| 4xev-assembly1.cif.gz_A | fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide | 0.3976 | 123 | 261 |
| 2b0h-assembly1.cif.gz_A | solution structure of vbs3 fragment of talin | 0.3949 | 96 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1Q930_116_353_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5347 | 4 | 257 | 1.20.1070.10 |
| af_A0A0G2KYS3_6_191_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5086 | 165 | 258 | 1.20.140.150 |
| af_A0A0R4IN71_16_196_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.475 | 161 | 256 | 1.20.140.150 |
| af_Q2QZT1_1_211_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.4735 | 12 | 261 | 1.20.120.550 |
| af_Q555E4_30_180_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.4648 | 48 | 256 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9MGY2-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9586 | 25 | 267 |
GO:0016020
|
| AF-A0A3B9MGY2-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9547 | 25 | 267 |
GO:0016020
|
| AF-A0A2V8QIU2-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9513 | 7 | 267 |
GO:0016020
|
| AF-A0A7Z9UY01-F1-model_v4 | Antitermination protein NusG | 0.9443 | 29 | 95 |
GO:0016020
|
| AF-A0A2V8PQ44-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9302 | 1 | 266 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar