F487081

General Info

Members Datasets Scaffolds Average Seq Length
969 283 969 263

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_301141_c1|nmdc:mga0rr50_301141_c1_339_1274
Length 311
Sequence LILHPSAFILCVVVGLGVIFGRNSSQKLVQAFLPVSNEQDLHGGPMLIESTVHLPTSLAMLQSLFHAPSGDEILRIGFRWFHFAAGITWIGLLYFFNLVNVPFQKGIDADTKKKVNPDLLGRALWWFRWGAVVTVLAGLAYYAMFILKADVVNANNIGHGNVNLWVVFLAWLTYPIVLFGIEFFIIKKVPGVIKDGRIFAVVMIVLVLFFSWALARYFTGMLSVNGESFASNKTYSIGIGGAYGIVMMLNVWGIIWPNNKRILAATAGTGPAAPPELARQAFIASRTNAWLSLPLLLFMGTSHGDWIILGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
201 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
232 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
233 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
238 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
239 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
240 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
241 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
245 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
251 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
252 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
253 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
254 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
255 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
256 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
257 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
258 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
259 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
260 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
261 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
262 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
263 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
264 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
265 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
266 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
267 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
268 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
269 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
270 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
271 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
281 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.55
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_36198 2162886007 Bacteria 2309
2 CNBas_1002080 3300000531 Bacteria 1091
3 CNAas_1000886 3300000532 Unclassified 2808
4 JGI24748J21848_1000087 3300002074 Bacteria 27375
5 JGI24034J26672_10000070 3300002239 Bacteria 27386
6 JGI24751J29686_10000009 3300002459 Bacteria 125815
7 JGI25406J46586_10004348 3300003203 Bacteria 6610
8 JGI25406J46586_10007246 3300003203 Bacteria 5074
9 rootH1_10128632 3300003316 Unclassified 1115
10 Ga0065714_10064433 3300005288 Bacteria 133062
11 Ga0065704_10007866 3300005289 Unclassified 3774
12 Ga0065704_10071538 3300005289 Bacteria 10765
13 Ga0065704_10150712 3300005289 Bacteria 1431
14 Ga0065704_10160288 3300005289 Unclassified 1360
15 Ga0065712_10009957 3300005290 Bacteria 2148
16 Ga0065712_10067731 3300005290 Bacteria 133054
17 Ga0065712_10073465 3300005290 Unclassified 4383
18 Ga0065715_10012000 3300005293 Bacteria 2804
19 Ga0065715_10018282 3300005293 Bacteria 2250
20 Ga0065715_10056887 3300005293 Unclassified 996
21 Ga0065715_10088984 3300005293 Bacteria 18335
22 Ga0065715_10091196 3300005293 Bacteria 6008
23 Ga0065715_10125544 3300005293 Bacteria 2128
24 Ga0065715_10129549 3300005293 Bacteria 2043
25 Ga0065707_10001225 3300005295 Bacteria 9555
26 Ga0065707_10179265 3300005295 Unclassified 1429
27 Ga0065707_10233064 3300005295 Bacteria 1182
28 Ga0065707_10248713 3300005295 Unclassified 1129
29 Ga0070676_10061800 3300005328 Bacteria 2227
30 Ga0070676_10190390 3300005328 Unclassified 1339
31 Ga0070676_10296667 3300005328 Unclassified 1094
32 Ga0070690_100001514 3300005330 Bacteria 12179
33 Ga0070690_100023410 3300005330 Bacteria 3788
34 Ga0070690_100079209 3300005330 Bacteria 2148
35 Ga0070690_100158097 3300005330 Bacteria 1551
36 Ga0070690_100230058 3300005330 Unclassified 1303
37 Ga0070690_100593698 3300005330 Unclassified 840
38 Ga0070670_100000088 3300005331 Bacteria 87898
39 Ga0070670_100128323 3300005331 Bacteria 2189
40 Ga0070670_100153806 3300005331 Unclassified 1991
41 Ga0070670_100280649 3300005331 Bacteria 1454
42 Ga0070670_100308186 3300005331 Bacteria 1386
43 Ga0070670_100308249 3300005331 Bacteria 1385
44 Ga0070670_100318672 3300005331 Bacteria 1362
45 Ga0068869_100034500 3300005334 Bacteria 3580
46 Ga0068869_100048762 3300005334 Bacteria 3064
47 Ga0068869_100077696 3300005334 Unclassified 2470
48 Ga0068869_100098505 3300005334 Unclassified 2208
49 Ga0068869_100211334 3300005334 Bacteria 1534
50 Ga0068869_100343835 3300005334 Bacteria 1215
51 Ga0070666_10009988 3300005335 Bacteria 5923
52 Ga0070666_10151870 3300005335 Unclassified 1616
53 Ga0070680_100029340 3300005336 Bacteria 4418
54 Ga0070680_100083439 3300005336 Unclassified 2639
55 Ga0070682_100000658 3300005337 Bacteria 20968
56 Ga0070682_100025067 3300005337 Bacteria 3557
57 Ga0070682_100053546 3300005337 Bacteria 2529
58 Ga0068868_100068046 3300005338 Unclassified 2835
59 Ga0068868_100111973 3300005338 Unclassified 2218
60 Ga0068868_100180895 3300005338 Bacteria 1749
61 Ga0068868_100259110 3300005338 Bacteria 1466
62 Ga0070689_100017912 3300005340 Bacteria 5207
63 Ga0070689_100035344 3300005340 Bacteria 3818
64 Ga0070689_100063329 3300005340 Bacteria 2878
65 Ga0070689_100281890 3300005340 Bacteria 1379
66 Ga0070689_100365267 3300005340 Unclassified 1213
67 Ga0070689_100447868 3300005340 Unclassified 1098
68 Ga0070687_100106748 3300005343 Unclassified 1578
69 Ga0070687_100179835 3300005343 Bacteria 1266
70 Ga0070661_100025902 3300005344 Bacteria 4215
71 Ga0070692_10004444 3300005345 Bacteria 5862
72 Ga0070692_10033025 3300005345 Unclassified 2607
73 Ga0070692_10059843 3300005345 Bacteria 2003
74 Ga0070692_10152614 3300005345 Bacteria 1317
75 Ga0070692_10189665 3300005345 Unclassified 1197
76 Ga0070692_10226599 3300005345 Bacteria 1107
77 Ga0070692_10233098 3300005345 Bacteria 1094
78 Ga0070692_10279461 3300005345 Bacteria 1011
79 Ga0070692_10320358 3300005345 Unclassified 953
80 Ga0070668_100008267 3300005347 Bacteria 7724
81 Ga0070669_100030178 3300005353 Bacteria 3910
82 Ga0070669_100037585 3300005353 Bacteria 3512
83 Ga0070669_100061319 3300005353 Bacteria 2763
84 Ga0070669_100145666 3300005353 Bacteria 1830
85 Ga0070675_100077534 3300005354 Bacteria 2766
86 Ga0070671_100024875 3300005355 Bacteria 4907
87 Ga0070671_100170372 3300005355 Unclassified 1841
88 Ga0070671_100781882 3300005355 Unclassified 830
89 Ga0070674_100116112 3300005356 Bacteria 1974
90 Ga0070674_100190414 3300005356 Unclassified 1578
91 Ga0070673_100043302 3300005364 Bacteria 3477
92 Ga0070673_100061670 3300005364 Bacteria 2976
93 Ga0070673_100077183 3300005364 Unclassified 2692
94 Ga0070673_100081737 3300005364 Bacteria 2620
95 Ga0070673_100084407 3300005364 Bacteria 2583
96 Ga0070673_100107933 3300005364 Unclassified 2303
97 Ga0070673_100246507 3300005364 Bacteria 1555
98 Ga0070673_100250396 3300005364 Bacteria 1544
99 Ga0070673_100364802 3300005364 Unclassified 1285
100 Ga0070688_100044481 3300005365 Bacteria 2740
101 Ga0070659_100008321 3300005366 Bacteria 7573
102 Ga0070667_100420358 3300005367 Unclassified 1218
103 Ga0070703_10000077 3300005406 Bacteria 48491
104 Ga0070701_10020338 3300005438 Bacteria 3151
105 Ga0070701_10045910 3300005438 Bacteria 2244
106 Ga0070701_10129566 3300005438 Bacteria 1432
107 Ga0070701_10349716 3300005438 Unclassified 923
108 Ga0070705_100004943 3300005440 Bacteria 6493
109 Ga0070705_100013030 3300005440 Bacteria 4243
110 Ga0070705_100014024 3300005440 Bacteria 4113
111 Ga0070705_100041667 3300005440 Bacteria 2620
112 Ga0070705_100063379 3300005440 Bacteria 2205
113 Ga0070705_100201943 3300005440 Unclassified 1363
114 Ga0070705_100295684 3300005440 Bacteria 1158
115 Ga0070705_100472910 3300005440 Unclassified 945
116 Ga0070700_100000120 3300005441 Bacteria 48358
117 Ga0070700_100005553 3300005441 Bacteria 6686
118 Ga0070700_100010579 3300005441 Bacteria 5097
119 Ga0070700_100060229 3300005441 Bacteria 2392
120 Ga0070700_100120895 3300005441 Unclassified 1755
121 Ga0070700_100157375 3300005441 Bacteria 1560
122 Ga0070694_100001229 3300005444 Bacteria 14813
123 Ga0070694_100001886 3300005444 Bacteria 12411
124 Ga0070694_100010557 3300005444 Bacteria 5702
125 Ga0070694_100017204 3300005444 Bacteria 4565
126 Ga0070694_100046532 3300005444 Bacteria 2913
127 Ga0070694_100082875 3300005444 Bacteria 2234
128 Ga0070694_100092269 3300005444 Bacteria 2127
129 Ga0070694_100139441 3300005444 Bacteria 1759
130 Ga0070694_100167114 3300005444 Bacteria 1618
131 Ga0070694_100221294 3300005444 Bacteria 1420
132 Ga0070694_100233179 3300005444 Unclassified 1385
133 Ga0070694_100276359 3300005444 Bacteria 1279
134 Ga0070708_100000337 3300005445 Bacteria 35479
135 Ga0070708_100148145 3300005445 Bacteria 2181
136 Ga0070708_100463792 3300005445 Bacteria 1195
137 Ga0070708_100621821 3300005445 Unclassified 1018
138 Ga0070678_100047848 3300005456 Bacteria 3076
139 Ga0070678_100236270 3300005456 Unclassified 1526
140 Ga0070662_100150379 3300005457 Unclassified 1812
141 Ga0070681_10001081 3300005458 Bacteria 23250
142 Ga0070681_10006294 3300005458 Bacteria 11540
143 Ga0070681_10054385 3300005458 Bacteria 3988
144 Ga0070681_10466136 3300005458 Bacteria 1176
145 Ga0068867_100034591 3300005459 Bacteria 3662
146 Ga0068867_100042795 3300005459 Unclassified 3315
147 Ga0068867_100101133 3300005459 Bacteria 2202
148 Ga0068867_100455123 3300005459 Bacteria 1091
149 Ga0070685_10305426 3300005466 Unclassified 1073
150 Ga0070706_100000017 3300005467 Bacteria 172828
151 Ga0070706_100005724 3300005467 Bacteria 11816
152 Ga0070706_100012259 3300005467 Bacteria 7944
153 Ga0070706_100026556 3300005467 Bacteria 5328
154 Ga0070706_100028645 3300005467 Bacteria 5128
155 Ga0070706_100030934 3300005467 Bacteria 4935
156 Ga0070706_100035284 3300005467 Bacteria 4619
157 Ga0070706_100488454 3300005467 Bacteria 1146
158 Ga0070706_100660570 3300005467 Bacteria 970
159 Ga0070707_100000197 3300005468 Bacteria 60425
160 Ga0070707_100005488 3300005468 Bacteria 11861
161 Ga0070707_100021433 3300005468 Bacteria 6108
162 Ga0070707_100042234 3300005468 Bacteria 4365
163 Ga0070707_100145430 3300005468 Bacteria 2307
164 Ga0070707_100286500 3300005468 Bacteria 1601
165 Ga0070698_100004605 3300005471 Bacteria 15147
166 Ga0070698_100004943 3300005471 Bacteria 14614
167 Ga0070698_100012974 3300005471 Bacteria 8821
168 Ga0070698_100013753 3300005471 Bacteria 8567
169 Ga0070698_100018834 3300005471 Bacteria 7263
170 Ga0070698_100042470 3300005471 Bacteria 4664
171 Ga0070698_100045775 3300005471 Bacteria 4477
172 Ga0070698_100147259 3300005471 Bacteria 2303
173 Ga0070698_100172267 3300005471 Bacteria 2105
174 Ga0070698_100407889 3300005471 Unclassified 1293
175 Ga0070699_100006275 3300005518 Bacteria 10374
176 Ga0070699_100007202 3300005518 Bacteria 9674
177 Ga0070699_100030729 3300005518 Bacteria 4637
178 Ga0070699_100049948 3300005518 Bacteria 3620
179 Ga0070699_100083270 3300005518 Bacteria 2790
180 Ga0070699_100453036 3300005518 Bacteria 1163
181 Ga0070699_100481441 3300005518 Bacteria 1126
182 Ga0070699_100788077 3300005518 Unclassified 870
183 Ga0070679_100008421 3300005530 Bacteria 9706
184 Ga0070679_100056125 3300005530 Bacteria 3924
185 Ga0070697_100000062 3300005536 Bacteria 84791
186 Ga0070697_100001572 3300005536 Bacteria 17404
187 Ga0070697_100038063 3300005536 Bacteria 3886
188 Ga0070697_100046238 3300005536 Bacteria 3528
189 Ga0070697_100096040 3300005536 Unclassified 2459
190 Ga0070697_100102947 3300005536 Bacteria 2373
191 Ga0070697_100122249 3300005536 Bacteria 2178
192 Ga0070697_100170156 3300005536 Bacteria 1843
193 Ga0070697_100317176 3300005536 Bacteria 1342
194 Ga0070697_100411310 3300005536 Bacteria 1175
195 Ga0068853_100124344 3300005539 Bacteria 2304
196 Ga0068853_100180300 3300005539 Bacteria 1915
197 Ga0068853_100313516 3300005539 Bacteria 1453
198 Ga0068853_100633730 3300005539 Unclassified 1017
199 Ga0070672_100003235 3300005543 Bacteria 10544
200 Ga0070672_100255342 3300005543 Unclassified 1477
201 Ga0070672_100327472 3300005543 Unclassified 1303
202 Ga0070686_100002174 3300005544 Bacteria 10821
203 Ga0070686_100011973 3300005544 Bacteria 4932
204 Ga0070686_100101956 3300005544 Bacteria 1940
205 Ga0070686_100196842 3300005544 Bacteria 1442
206 Ga0070686_100236950 3300005544 Bacteria 1327
207 Ga0070686_100334617 3300005544 Unclassified 1133
208 Ga0070695_100013916 3300005545 Bacteria 4842
209 Ga0070695_100098211 3300005545 Bacteria 1967
210 Ga0070695_100104505 3300005545 Bacteria 1912
211 Ga0070695_100134121 3300005545 Unclassified 1709
212 Ga0070695_100135304 3300005545 Bacteria 1703
213 Ga0070695_100141653 3300005545 Bacteria 1668
214 Ga0070695_100162909 3300005545 Bacteria 1567
215 Ga0070695_100280149 3300005545 Unclassified 1225
216 Ga0070695_100355392 3300005545 Bacteria 1099
217 Ga0070696_100000807 3300005546 Bacteria 20137
218 Ga0070696_100028469 3300005546 Unclassified 3814
219 Ga0070696_100069441 3300005546 Bacteria 2476
220 Ga0070696_100083176 3300005546 Bacteria 2270
221 Ga0070696_100165930 3300005546 Unclassified 1629
222 Ga0070696_100211143 3300005546 Unclassified 1453
223 Ga0070696_100272351 3300005546 Unclassified 1288
224 Ga0070693_100006647 3300005547 Bacteria 5614
225 Ga0070693_100022522 3300005547 Unclassified 3352
226 Ga0070693_100040645 3300005547 Bacteria 2612
227 Ga0070693_100108136 3300005547 Unclassified 1706
228 Ga0070693_100275582 3300005547 Unclassified 1125
229 Ga0070665_100267008 3300005548 Unclassified 1713
230 Ga0070704_100001685 3300005549 Bacteria 12016
231 Ga0070704_100022845 3300005549 Bacteria 4075
232 Ga0070704_100041854 3300005549 Bacteria 3165
233 Ga0070704_100047366 3300005549 Bacteria 3004
234 Ga0070704_100060228 3300005549 Bacteria 2712
235 Ga0070704_100228050 3300005549 Unclassified 1518
236 Ga0070704_100461537 3300005549 Bacteria 1096
237 Ga0070704_100527065 3300005549 Unclassified 1029
238 Ga0068855_100455794 3300005563 Bacteria 1395
239 Ga0070664_100005757 3300005564 Bacteria 9992
240 Ga0070664_100073910 3300005564 Bacteria 2925
241 Ga0070664_100089390 3300005564 Bacteria 2665
242 Ga0070664_100252396 3300005564 Unclassified 1586
243 Ga0070664_100373174 3300005564 Bacteria 1301
244 Ga0068857_100011647 3300005577 Bacteria 7650
245 Ga0068857_100096441 3300005577 Unclassified 2650
246 Ga0068857_100259806 3300005577 Bacteria 1593
247 Ga0068857_100363002 3300005577 Bacteria 1343
248 Ga0068857_100496245 3300005577 Bacteria 1145
249 Ga0068854_100039135 3300005578 Bacteria 3338
250 Ga0068856_100021795 3300005614 Bacteria 6227
251 Ga0068856_100339979 3300005614 Bacteria 1519
252 Ga0070702_100020950 3300005615 Bacteria 3432
253 Ga0070702_100051700 3300005615 Unclassified 2353
254 Ga0070702_100052042 3300005615 Bacteria 2347
255 Ga0070702_100063007 3300005615 Unclassified 2163
256 Ga0070702_100118173 3300005615 Bacteria 1655
257 Ga0070702_100183017 3300005615 Bacteria 1373
258 Ga0068852_100129712 3300005616 Unclassified 2320
259 Ga0068852_100318997 3300005616 Unclassified 1509
260 Ga0068859_100006661 3300005617 Bacteria 11729
261 Ga0068859_100009613 3300005617 Bacteria 9764
262 Ga0068859_100010028 3300005617 Bacteria 9554
263 Ga0068859_100027113 3300005617 Bacteria 5747
264 Ga0068859_100063364 3300005617 Bacteria 3728
265 Ga0068859_100113336 3300005617 Unclassified 2775
266 Ga0068859_100205079 3300005617 Bacteria 2057
267 Ga0068859_100235025 3300005617 Bacteria 1921
268 Ga0068859_100339026 3300005617 Bacteria 1597
269 Ga0068859_100974884 3300005617 Unclassified 930
270 Ga0068864_100020637 3300005618 Bacteria 5512
271 Ga0068864_100021333 3300005618 Bacteria 5427
272 Ga0068864_100054098 3300005618 Bacteria 3464
273 Ga0068864_100207035 3300005618 Bacteria 1805
274 Ga0068864_100302488 3300005618 Unclassified 1498
275 Ga0068864_100323995 3300005618 Bacteria 1448
276 Ga0068864_100334544 3300005618 Bacteria 1425
277 Ga0068864_100387108 3300005618 Unclassified 1326
278 Ga0068864_100411897 3300005618 Bacteria 1286
279 Ga0068864_100617330 3300005618 Unclassified 1053
280 Ga0068864_100871270 3300005618 Bacteria 888
281 Ga0068866_10011179 3300005718 Bacteria 3875
282 Ga0068866_10045935 3300005718 Bacteria 2193
283 Ga0068866_10070708 3300005718 Unclassified 1843
284 Ga0068866_10079744 3300005718 Unclassified 1755
285 Ga0068861_100004194 3300005719 Bacteria 9666
286 Ga0068861_100032846 3300005719 Bacteria 3824
287 Ga0068861_100151057 3300005719 Bacteria 1906
288 Ga0068861_100218202 3300005719 Bacteria 1610
289 Ga0068861_100332914 3300005719 Unclassified 1326
290 Ga0068861_100340012 3300005719 Bacteria 1313
291 Ga0068851_10003618 3300005834 Bacteria 6893
292 Ga0068870_10052726 3300005840 Bacteria 2158
293 Ga0068870_10054718 3300005840 Bacteria 2124
294 Ga0068870_10107101 3300005840 Unclassified 1590
295 Ga0068870_10188650 3300005840 Bacteria 1242
296 Ga0068863_100027299 3300005841 Bacteria 5445
297 Ga0068863_100075227 3300005841 Bacteria 3195
298 Ga0068863_100112035 3300005841 Bacteria 2599
299 Ga0068863_100167444 3300005841 Bacteria 2107
300 Ga0068863_100213033 3300005841 Bacteria 1860
301 Ga0068863_100221915 3300005841 Bacteria 1821
302 Ga0068863_100223750 3300005841 Bacteria 1813
303 Ga0068863_100274814 3300005841 Bacteria 1631
304 Ga0068863_100399332 3300005841 Bacteria 1344
305 Ga0068858_100000077 3300005842 Bacteria 103156
306 Ga0068858_100020307 3300005842 Bacteria 6212
307 Ga0068858_100041123 3300005842 Bacteria 4287
308 Ga0068858_100062270 3300005842 Bacteria 3450
309 Ga0068858_100066492 3300005842 Unclassified 3337
310 Ga0068858_100070049 3300005842 Bacteria 3251
311 Ga0068858_100201172 3300005842 Bacteria 1884
312 Ga0068860_100014175 3300005843 Bacteria 7817
313 Ga0068860_100067260 3300005843 Bacteria 3405
314 Ga0068860_100095228 3300005843 Bacteria 2838
315 Ga0068860_100100146 3300005843 Bacteria 2764
316 Ga0068860_100124757 3300005843 Bacteria 2468
317 Ga0068860_100186267 3300005843 Bacteria 2007
318 Ga0068860_100251887 3300005843 Unclassified 1720
319 Ga0068860_100332402 3300005843 Unclassified 1493
320 Ga0068862_100016914 3300005844 Bacteria 6070
321 Ga0068862_100036312 3300005844 Bacteria 4177
322 Ga0068862_100073581 3300005844 Bacteria 2953
323 Ga0068862_100132035 3300005844 Bacteria 2210
324 Ga0068862_100150979 3300005844 Bacteria 2068
325 Ga0068862_100211958 3300005844 Unclassified 1750
326 Ga0068862_100223692 3300005844 Bacteria 1705
327 Ga0068862_100256870 3300005844 Bacteria 1594
328 Ga0081540_1046504 3300005983 Bacteria 2190
329 Ga0081539_10000408 3300005985 Bacteria 91634
330 Ga0081539_10000941 3300005985 Bacteria 54539
331 Ga0081539_10001941 3300005985 Bacteria 31706
332 Ga0081539_10071166 3300005985 Bacteria 1864
333 Ga0070715_10000010 3300006163 Bacteria 184687
334 Ga0070716_100000004 3300006173 Bacteria 296614
335 Ga0097621_100008542 3300006237 Bacteria 7378
336 Ga0097621_100167622 3300006237 Bacteria 1891
337 Ga0097621_100320459 3300006237 Bacteria 1373
338 Ga0068871_100031414 3300006358 Bacteria 4188
339 Ga0068871_100079208 3300006358 Unclassified 2718
340 Ga0068871_100185048 3300006358 Unclassified 1791
341 Ga0068871_100515700 3300006358 Unclassified 1079
342 Ga0075428_100085023 3300006844 Bacteria 3451
343 Ga0075428_100369112 3300006844 Unclassified 1539
344 Ga0075428_100522689 3300006844 Bacteria 1269
345 Ga0075428_100555117 3300006844 Bacteria 1228
346 Ga0075430_100066558 3300006846 Bacteria 3025
347 Ga0075430_100082659 3300006846 Unclassified 2691
348 Ga0075431_100094063 3300006847 Bacteria 3093
349 Ga0075431_100164221 3300006847 Bacteria 2283
350 Ga0075431_100236813 3300006847 Bacteria 1858
351 Ga0075433_10022852 3300006852 Bacteria 5254
352 Ga0075433_10037055 3300006852 Bacteria 4204
353 Ga0075433_10056566 3300006852 Bacteria 3426
354 Ga0075433_10168759 3300006852 Unclassified 1948
355 Ga0075433_10171185 3300006852 Bacteria 1932
356 Ga0075433_10394577 3300006852 Bacteria 1221
357 Ga0075434_100014554 3300006871 Bacteria 7524
358 Ga0075434_100040126 3300006871 Bacteria 4637
359 Ga0075434_100067157 3300006871 Unclassified 3573
360 Ga0075434_100068253 3300006871 Bacteria 3542
361 Ga0075434_100087715 3300006871 Unclassified 3112
362 Ga0075434_100091846 3300006871 Bacteria 3038
363 Ga0075434_100363644 3300006871 Bacteria 1468
364 Ga0075434_100406254 3300006871 Bacteria 1383
365 Ga0075434_100580678 3300006871 Bacteria 1140
366 Ga0075429_100024483 3300006880 Bacteria 5237
367 Ga0075429_100038505 3300006880 Bacteria 4162
368 Ga0075429_100386165 3300006880 Bacteria 1226
369 Ga0075429_100447729 3300006880 Unclassified 1132
370 Ga0068865_100048889 3300006881 Bacteria 2913
371 Ga0075436_100000009 3300006914 Bacteria 256132
372 Ga0075436_100209691 3300006914 Unclassified 1381
373 Ga0097620_100006661 3300006931 Bacteria 11729
374 Ga0097620_100009613 3300006931 Bacteria 9764
375 Ga0097620_100010027 3300006931 Bacteria 9554
376 Ga0097620_100027113 3300006931 Bacteria 5747
377 Ga0097620_100063365 3300006931 Bacteria 3728
378 Ga0097620_100113335 3300006931 Unclassified 2775
379 Ga0097620_100205064 3300006931 Bacteria 2057
380 Ga0097620_100235042 3300006931 Bacteria 1921
381 Ga0097620_100339046 3300006931 Bacteria 1597
382 Ga0097620_100974960 3300006931 Unclassified 930
383 Ga0075435_100008534 3300007076 Bacteria 7363
384 Ga0075435_100021117 3300007076 Bacteria 5002
385 Ga0075435_100238966 3300007076 Bacteria 1544
386 Ga0075435_100553886 3300007076 Unclassified 996
387 Ga0105251_10081677 3300009011 Unclassified 1493
388 Ga0105240_10042866 3300009093 Bacteria 5764
389 Ga0105240_10191814 3300009093 Bacteria 2402
390 Ga0105240_10199958 3300009093 Bacteria 2343
391 Ga0111539_10005075 3300009094 Bacteria 17101
392 Ga0111539_10010333 3300009094 Bacteria 11751
393 Ga0111539_10062464 3300009094 Bacteria 4408
394 Ga0111539_10083728 3300009094 Bacteria 3750
395 Ga0105245_10141499 3300009098 Bacteria 2266
396 Ga0105245_10142966 3300009098 Bacteria 2255
397 Ga0105245_10382373 3300009098 Bacteria 1402
398 Ga0105245_10775801 3300009098 Unclassified 996
399 Ga0105247_10000015 3300009101 Bacteria 277224
400 Ga0105247_10007521 3300009101 Bacteria 6677
401 Ga0105247_10171682 3300009101 Unclassified 1442
402 Ga0114129_10023642 3300009147 Bacteria 8710
403 Ga0114129_10051841 3300009147 Bacteria 5760
404 Ga0114129_10051936 3300009147 Bacteria 5754
405 Ga0114129_10066340 3300009147 Bacteria 5035
406 Ga0114129_10068673 3300009147 Bacteria 4941
407 Ga0114129_10114657 3300009147 Unclassified 3715
408 Ga0114129_10164259 3300009147 Bacteria 3031
409 Ga0114129_10237746 3300009147 Unclassified 2450
410 Ga0114129_10286870 3300009147 Bacteria 2198
411 Ga0114129_10446440 3300009147 Bacteria 1697
412 Ga0114129_10815980 3300009147 Bacteria 1189
413 Ga0114129_10911613 3300009147 Bacteria 1113
414 Ga0114129_11148137 3300009147 Bacteria 970
415 Ga0114129_11198199 3300009147 Unclassified 946
416 Ga0105243_10000283 3300009148 Bacteria 56438
417 Ga0105243_10000350 3300009148 Bacteria 49215
418 Ga0105243_10042180 3300009148 Bacteria 3571
419 Ga0105243_10059880 3300009148 Bacteria 3040
420 Ga0105243_10077421 3300009148 Bacteria 2705
421 Ga0105243_10077653 3300009148 Unclassified 2701
422 Ga0105243_10145993 3300009148 Bacteria 2024
423 Ga0105243_10237386 3300009148 Bacteria 1620
424 Ga0105243_10256448 3300009148 Unclassified 1564
425 Ga0105243_10405196 3300009148 Unclassified 1268
426 Ga0105243_10606802 3300009148 Bacteria 1054
427 Ga0105241_10019245 3300009174 Bacteria 5034
428 Ga0105241_10021776 3300009174 Bacteria 4742
429 Ga0105241_10046782 3300009174 Bacteria 3287
430 Ga0105241_10064366 3300009174 Bacteria 2831
431 Ga0105241_10109925 3300009174 Unclassified 2205
432 Ga0105241_10222574 3300009174 Unclassified 1587
433 Ga0105241_10362011 3300009174 Unclassified 1262
434 Ga0105242_10000235 3300009176 Bacteria 43611
435 Ga0105242_10000694 3300009176 Bacteria 26389
436 Ga0105242_10002192 3300009176 Bacteria 15419
437 Ga0105242_10018177 3300009176 Bacteria 5492
438 Ga0105242_10039298 3300009176 Unclassified 3807
439 Ga0105242_10062185 3300009176 Bacteria 3072
440 Ga0105242_10285870 3300009176 Bacteria 1500
441 Ga0105242_10346571 3300009176 Bacteria 1371
442 Ga0105248_10007251 3300009177 Bacteria 12167
443 Ga0105248_10033803 3300009177 Bacteria 5714
444 Ga0105248_10033984 3300009177 Bacteria 5700
445 Ga0105248_10112607 3300009177 Bacteria 3069
446 Ga0105248_10133245 3300009177 Bacteria 2804
447 Ga0105248_10297035 3300009177 Bacteria 1819
448 Ga0105248_10342618 3300009177 Bacteria 1683
449 Ga0105248_10357877 3300009177 Bacteria 1643
450 Ga0105248_10387468 3300009177 Bacteria 1573
451 Ga0105248_10398892 3300009177 Unclassified 1549
452 Ga0105248_10451487 3300009177 Bacteria 1448
453 Ga0105248_10746510 3300009177 Unclassified 1104
454 Ga0105248_10846879 3300009177 Bacteria 1032
455 Ga0105248_10946294 3300009177 Unclassified 973
456 Ga0105237_10010849 3300009545 Bacteria 9669
457 Ga0105237_10019745 3300009545 Bacteria 6957
458 Ga0105238_10008842 3300009551 Bacteria 10074
459 Ga0105249_10000052 3300009553 Bacteria 168047
460 Ga0105249_10004897 3300009553 Bacteria 11556
461 Ga0105249_10013685 3300009553 Bacteria 7165
462 Ga0105249_10017459 3300009553 Bacteria 6371
463 Ga0105249_10176017 3300009553 Bacteria 2078
464 Ga0105249_10194020 3300009553 Bacteria 1984
465 Ga0105249_10711010 3300009553 Unclassified 1065
466 Ga0105239_10104143 3300010375 Bacteria 3142
467 Ga0105239_10116098 3300010375 Bacteria 2970
468 Ga0105239_10303061 3300010375 Bacteria 1799
469 Ga0105239_10472490 3300010375 Bacteria 1424
470 Ga0105239_10563382 3300010375 Unclassified 1298
471 Ga0105246_10019006 3300011119 Bacteria 4383
472 Ga0105246_10041615 3300011119 Bacteria 3106
473 Ga0105246_10079138 3300011119 Bacteria 2337
474 Ga0105246_10094377 3300011119 Unclassified 2164
475 Ga0105246_10111502 3300011119 Bacteria 2010
476 Ga0105246_10161407 3300011119 Bacteria 1708
477 Ga0157373_10016111 3300013100 Bacteria 5456
478 Ga0157373_10033790 3300013100 Bacteria 3676
479 Ga0157371_10210552 3300013102 Bacteria 1395
480 Ga0157371_10273083 3300013102 Bacteria 1220
481 Ga0157374_10015970 3300013296 Bacteria 6594
482 Ga0157374_10135043 3300013296 Bacteria 2391
483 Ga0157378_10000095 3300013297 Bacteria 84288
484 Ga0157378_10001282 3300013297 Bacteria 22599
485 Ga0157378_10003380 3300013297 Bacteria 14189
486 Ga0157378_10010625 3300013297 Bacteria 8047
487 Ga0157378_10021341 3300013297 Bacteria 5694
488 Ga0157378_10043585 3300013297 Bacteria 3984
489 Ga0157378_10048711 3300013297 Unclassified 3768
490 Ga0157378_10060725 3300013297 Bacteria 3373
491 Ga0157378_10061510 3300013297 Bacteria 3351
492 Ga0157378_10070903 3300013297 Unclassified 3129
493 Ga0157378_10194990 3300013297 Unclassified 1913
494 Ga0157378_10280336 3300013297 Unclassified 1606
495 Ga0163162_10000001 3300013306 Bacteria 751833
496 Ga0163162_10009010 3300013306 Bacteria 9702
497 Ga0163162_10010751 3300013306 Bacteria 8905
498 Ga0163162_10012811 3300013306 Bacteria 8191
499 Ga0163162_10039048 3300013306 Bacteria 4740
500 Ga0163162_10044633 3300013306 Bacteria 4439
501 Ga0163162_10149517 3300013306 Bacteria 2452
502 Ga0163162_10170307 3300013306 Bacteria 2302
503 Ga0163162_10463601 3300013306 Bacteria 1398
504 Ga0163162_10504261 3300013306 Unclassified 1340
505 Ga0163162_10526133 3300013306 Bacteria 1312
506 Ga0163162_10543775 3300013306 Bacteria 1290
507 Ga0163162_10891855 3300013306 Bacteria 1003
508 Ga0157372_10012910 3300013307 Bacteria 8904
509 Ga0157372_10113831 3300013307 Bacteria 3101
510 Ga0157372_10295285 3300013307 Bacteria 1885
511 Ga0157372_10557490 3300013307 Bacteria 1336
512 Ga0157372_10706495 3300013307 Bacteria 1173
513 Ga0157375_10004418 3300013308 Bacteria 12206
514 Ga0157375_10014917 3300013308 Bacteria 6946
515 Ga0157375_10036058 3300013308 Bacteria 4727
516 Ga0157375_10067251 3300013308 Bacteria 3580
517 Ga0157375_10073908 3300013308 Bacteria 3429
518 Ga0157375_10140339 3300013308 Unclassified 2543
519 Ga0157375_10167282 3300013308 Bacteria 2344
520 Ga0157375_10198777 3300013308 Bacteria 2160
521 Ga0157375_10262499 3300013308 Unclassified 1889
522 Ga0157375_10296720 3300013308 Unclassified 1779
523 Ga0157375_10757279 3300013308 Bacteria 1122
524 Ga0163163_10001533 3300014325 Bacteria 19476
525 Ga0163163_10001831 3300014325 Bacteria 17942
526 Ga0163163_10007435 3300014325 Bacteria 9669
527 Ga0163163_10074554 3300014325 Bacteria 3385
528 Ga0163163_10132213 3300014325 Bacteria 2536
529 Ga0163163_10145626 3300014325 Unclassified 2412
530 Ga0163163_10207137 3300014325 Unclassified 2010
531 Ga0163163_10220860 3300014325 Bacteria 1943
532 Ga0163163_10310393 3300014325 Bacteria 1630
533 Ga0163163_10312194 3300014325 Bacteria 1625
534 Ga0163163_10419274 3300014325 Bacteria 1397
535 Ga0163163_10577833 3300014325 Unclassified 1187
536 Ga0157380_10001174 3300014326 Bacteria 16974
537 Ga0157380_10001205 3300014326 Bacteria 16752
538 Ga0157380_10015063 3300014326 Bacteria 5673
539 Ga0157380_10017030 3300014326 Bacteria 5370
540 Ga0157380_10041006 3300014326 Bacteria 3610
541 Ga0157380_10045487 3300014326 Unclassified 3445
542 Ga0157380_10183100 3300014326 Unclassified 1842
543 Ga0157380_10239283 3300014326 Unclassified 1635
544 Ga0157380_10379173 3300014326 Unclassified 1334
545 Ga0157380_10547028 3300014326 Bacteria 1135
546 Ga0157377_10005057 3300014745 Bacteria 6157
547 Ga0157377_10183115 3300014745 Bacteria 1319
548 Ga0157377_10246536 3300014745 Bacteria 1156
549 Ga0157377_10480803 3300014745 Bacteria 864
550 Ga0157379_10025079 3300014968 Bacteria 5294
551 Ga0157379_10146621 3300014968 Bacteria 2128
552 Ga0157379_10269493 3300014968 Unclassified 1548
553 Ga0157379_10290117 3300014968 Bacteria 1490
554 Ga0157376_10014842 3300014969 Bacteria 5863
555 Ga0157376_10445779 3300014969 Unclassified 1262
556 Ga0163161_10007521 3300017792 Bacteria 7527
557 Ga0163161_10032403 3300017792 Bacteria 3731
558 Ga0163161_10282467 3300017792 Bacteria 1302
559 Ga0163161_10329395 3300017792 Bacteria 1209
560 Ga0213876_10000251 3300021384 Bacteria 50908
561 Ga0213876_10000279 3300021384 Bacteria 46863
562 Ga0207672_1000270 3300025223 Bacteria 7071
563 Ga0207697_10013752 3300025315 Bacteria 3372
564 Ga0207697_10077790 3300025315 Bacteria 1395
565 Ga0207713_1049101 3300025735 Bacteria 1694
566 Ga0207653_10000171 3300025885 Bacteria 45563
567 Ga0207653_10001174 3300025885 Bacteria 8552
568 Ga0207642_10076213 3300025899 Bacteria 1613
569 Ga0207710_10000004 3300025900 Bacteria 846540
570 Ga0207710_10006048 3300025900 Bacteria 5187
571 Ga0207688_10080312 3300025901 Unclassified 1861
572 Ga0207680_10106801 3300025903 Bacteria 1808
573 Ga0207685_10000006 3300025905 Bacteria 284255
574 Ga0207645_10034311 3300025907 Bacteria 3260
575 Ga0207645_10104839 3300025907 Unclassified 1826
576 Ga0207643_10007213 3300025908 Bacteria 5967
577 Ga0207643_10044664 3300025908 Bacteria 2501
578 Ga0207643_10094051 3300025908 Bacteria 1750
579 Ga0207684_10000079 3300025910 Bacteria 179842
580 Ga0207684_10007353 3300025910 Bacteria 9935
581 Ga0207684_10027931 3300025910 Unclassified 4806
582 Ga0207684_10116395 3300025910 Bacteria 2290
583 Ga0207654_10021305 3300025911 Bacteria 3445
584 Ga0207654_10094769 3300025911 Bacteria 1827
585 Ga0207707_10034115 3300025912 Bacteria 4453
586 Ga0207707_10046482 3300025912 Bacteria 3781
587 Ga0207707_10266148 3300025912 Unclassified 1486
588 Ga0207671_10010718 3300025914 Bacteria 7536
589 Ga0207660_10033557 3300025917 Bacteria 3551
590 Ga0207662_10003190 3300025918 Bacteria 8392
591 Ga0207662_10017971 3300025918 Bacteria 4005
592 Ga0207662_10021969 3300025918 Bacteria 3653
593 Ga0207662_10043560 3300025918 Bacteria 2648
594 Ga0207662_10260595 3300025918 Bacteria 1141
595 Ga0207649_10056940 3300025920 Bacteria 2442
596 Ga0207649_10196675 3300025920 Unclassified 1421
597 Ga0207649_10441359 3300025920 Bacteria 981
598 Ga0207652_10038997 3300025921 Bacteria 4030
599 Ga0207652_10126285 3300025921 Bacteria 2279
600 Ga0207646_10001342 3300025922 Bacteria 30550
601 Ga0207646_10001700 3300025922 Bacteria 26758
602 Ga0207646_10020611 3300025922 Bacteria 6106
603 Ga0207646_10102864 3300025922 Bacteria 2561
604 Ga0207646_10133647 3300025922 Bacteria 2233
605 Ga0207646_10174609 3300025922 Bacteria 1941
606 Ga0207646_10322797 3300025922 Bacteria 1395
607 Ga0207646_10396313 3300025922 Bacteria 1247
608 Ga0207681_10001745 3300025923 Bacteria 13958
609 Ga0207681_10005262 3300025923 Bacteria 7950
610 Ga0207681_10011079 3300025923 Bacteria 5537
611 Ga0207681_10173897 3300025923 Unclassified 1634
612 Ga0207694_10020544 3300025924 Bacteria 4998
613 Ga0207694_10087086 3300025924 Bacteria 2460
614 Ga0207650_10000001 3300025925 Bacteria 1545726
615 Ga0207650_10008569 3300025925 Bacteria 6982
616 Ga0207650_10122387 3300025925 Bacteria 2027
617 Ga0207650_10239752 3300025925 Bacteria 1465
618 Ga0207650_10283155 3300025925 Bacteria 1350
619 Ga0207650_10360810 3300025925 Bacteria 1197
620 Ga0207659_10059289 3300025926 Bacteria 2751
621 Ga0207659_10591353 3300025926 Unclassified 945
622 Ga0207644_10001610 3300025931 Bacteria 14561
623 Ga0207644_10024830 3300025931 Bacteria 4117
624 Ga0207644_10164322 3300025931 Unclassified 1728
625 Ga0207644_10224378 3300025931 Bacteria 1491
626 Ga0207690_10102531 3300025932 Bacteria 2046
627 Ga0207706_10033906 3300025933 Unclassified 4544
628 Ga0207706_10062945 3300025933 Bacteria 3267
629 Ga0207686_10000021 3300025934 Bacteria 181793
630 Ga0207686_10000283 3300025934 Bacteria 37692
631 Ga0207686_10001321 3300025934 Bacteria 14158
632 Ga0207686_10033667 3300025934 Unclassified 3060
633 Ga0207686_10072162 3300025934 Bacteria 2224
634 Ga0207686_10074054 3300025934 Bacteria 2199
635 Ga0207686_10277884 3300025934 Bacteria 1235
636 Ga0207709_10000069 3300025935 Bacteria 183367
637 Ga0207709_10000921 3300025935 Bacteria 22171
638 Ga0207709_10003136 3300025935 Bacteria 9943
639 Ga0207709_10037073 3300025935 Unclassified 2895
640 Ga0207709_10037714 3300025935 Bacteria 2873
641 Ga0207709_10153624 3300025935 Unclassified 1597
642 Ga0207709_10431305 3300025935 Bacteria 1015
643 Ga0207709_10572715 3300025935 Bacteria 891
644 Ga0207670_10000250 3300025936 Bacteria 33568
645 Ga0207670_10060445 3300025936 Bacteria 2582
646 Ga0207670_10078127 3300025936 Bacteria 2307
647 Ga0207670_10161749 3300025936 Bacteria 1671
648 Ga0207670_10469109 3300025936 Unclassified 1018
649 Ga0207669_10110184 3300025937 Bacteria 1843
650 Ga0207704_10357412 3300025938 Unclassified 1139
651 Ga0207665_10000139 3300025939 Bacteria 48695
652 Ga0207665_10078025 3300025939 Unclassified 2274
653 Ga0207665_10112476 3300025939 Bacteria 1915
654 Ga0207691_10001421 3300025940 Bacteria 23877
655 Ga0207691_10207170 3300025940 Bacteria 1705
656 Ga0207711_10019129 3300025941 Bacteria 5700
657 Ga0207711_10132721 3300025941 Bacteria 2234
658 Ga0207711_10156595 3300025941 Bacteria 2059
659 Ga0207711_10159891 3300025941 Bacteria 2038
660 Ga0207711_10359566 3300025941 Bacteria 1348
661 Ga0207711_10438171 3300025941 Unclassified 1216
662 Ga0207711_10524660 3300025941 Bacteria 1104
663 Ga0207711_10542011 3300025941 Bacteria 1085
664 Ga0207711_10654226 3300025941 Unclassified 980
665 Ga0207689_10002102 3300025942 Bacteria 18756
666 Ga0207689_10009874 3300025942 Bacteria 8227
667 Ga0207689_10012415 3300025942 Bacteria 7283
668 Ga0207689_10019251 3300025942 Bacteria 5755
669 Ga0207689_10048605 3300025942 Unclassified 3499
670 Ga0207689_10257770 3300025942 Bacteria 1443
671 Ga0207689_10495372 3300025942 Bacteria 1024
672 Ga0207689_10510471 3300025942 Bacteria 1008
673 Ga0207679_10106366 3300025945 Bacteria 2205
674 Ga0207679_10166511 3300025945 Bacteria 1810
675 Ga0207679_10170112 3300025945 Bacteria 1793
676 Ga0207679_10304566 3300025945 Bacteria 1375
677 Ga0207679_10469627 3300025945 Bacteria 1118
678 Ga0207679_10487633 3300025945 Unclassified 1098
679 Ga0207651_10052772 3300025960 Bacteria 2774
680 Ga0207651_10055671 3300025960 Bacteria 2718
681 Ga0207651_10113650 3300025960 Bacteria 2038
682 Ga0207651_10291202 3300025960 Bacteria 1354
683 Ga0207651_10344551 3300025960 Bacteria 1253
684 Ga0207651_10380402 3300025960 Bacteria 1196
685 Ga0207651_10719418 3300025960 Unclassified 881
686 Ga0207651_10728768 3300025960 Bacteria 875
687 Ga0207712_10000925 3300025961 Bacteria 21172
688 Ga0207712_10005189 3300025961 Bacteria 8239
689 Ga0207712_10017134 3300025961 Bacteria 4701
690 Ga0207712_10033995 3300025961 Bacteria 3451
691 Ga0207712_10194852 3300025961 Bacteria 1602
692 Ga0207712_10400078 3300025961 Unclassified 1154
693 Ga0207712_10454617 3300025961 Bacteria 1087
694 Ga0207712_10582738 3300025961 Bacteria 966
695 Ga0207668_10005063 3300025972 Bacteria 7760
696 Ga0207640_10012393 3300025981 Unclassified 4853
697 Ga0207640_10457192 3300025981 Unclassified 1054
698 Ga0207658_10165555 3300025986 Bacteria 1816
699 Ga0207677_10099650 3300026023 Bacteria 2134
700 Ga0207677_10147209 3300026023 Bacteria 1812
701 Ga0207703_10000043 3300026035 Bacteria 161047
702 Ga0207703_10016211 3300026035 Bacteria 5808
703 Ga0207703_10102323 3300026035 Unclassified 2430
704 Ga0207703_10103548 3300026035 Bacteria 2416
705 Ga0207703_10108349 3300026035 Unclassified 2366
706 Ga0207703_10122477 3300026035 Unclassified 2234
707 Ga0207703_10304678 3300026035 Bacteria 1454
708 Ga0207639_10081730 3300026041 Bacteria 2560
709 Ga0207708_10000196 3300026075 Bacteria 47880
710 Ga0207708_10010047 3300026075 Bacteria 7027
711 Ga0207708_10024519 3300026075 Bacteria 4563
712 Ga0207708_10038708 3300026075 Bacteria 3632
713 Ga0207708_10097546 3300026075 Bacteria 2271
714 Ga0207708_10152920 3300026075 Bacteria 1818
715 Ga0207702_10023166 3300026078 Bacteria 5150
716 Ga0207641_10053400 3300026088 Unclassified 3425
717 Ga0207641_10066364 3300026088 Bacteria 3088
718 Ga0207641_10228323 3300026088 Bacteria 1729
719 Ga0207641_10235805 3300026088 Unclassified 1702
720 Ga0207641_10402557 3300026088 Unclassified 1314
721 Ga0207648_10025398 3300026089 Bacteria 5277
722 Ga0207648_10052268 3300026089 Bacteria 3572
723 Ga0207648_10052499 3300026089 Unclassified 3564
724 Ga0207648_10209835 3300026089 Unclassified 1728
725 Ga0207676_10003808 3300026095 Bacteria 10661
726 Ga0207676_10014298 3300026095 Bacteria 5707
727 Ga0207676_10022718 3300026095 Bacteria 4616
728 Ga0207676_10057488 3300026095 Unclassified 3063
729 Ga0207676_10286415 3300026095 Bacteria 1498
730 Ga0207676_10594110 3300026095 Unclassified 1062
731 Ga0207676_10632295 3300026095 Unclassified 1031
732 Ga0207674_10001115 3300026116 Bacteria 34877
733 Ga0207674_10033931 3300026116 Bacteria 5339
734 Ga0207674_10141200 3300026116 Bacteria 2368
735 Ga0207674_10147004 3300026116 Bacteria 2315
736 Ga0207674_10276964 3300026116 Bacteria 1625
737 Ga0207674_10429880 3300026116 Bacteria 1276
738 Ga0207674_10536449 3300026116 Unclassified 1130
739 Ga0207674_10738722 3300026116 Unclassified 950
740 Ga0207675_100003693 3300026118 Bacteria 14905
741 Ga0207675_100008300 3300026118 Bacteria 9782
742 Ga0207675_100017343 3300026118 Bacteria 6721
743 Ga0207675_100027734 3300026118 Bacteria 5275
744 Ga0207675_100152890 3300026118 Bacteria 2197
745 Ga0207675_100188276 3300026118 Bacteria 1979
746 Ga0207675_100408669 3300026118 Bacteria 1339
747 Ga0207675_100964185 3300026118 Bacteria 870
748 Ga0207683_10146154 3300026121 Bacteria 2132
749 Ga0207683_10263611 3300026121 Unclassified 1573
750 Ga0207698_10201010 3300026142 Bacteria 1784
751 Ga0207428_10003589 3300027907 Bacteria 14977
752 Ga0207428_10011034 3300027907 Bacteria 8032
753 Ga0268266_10330643 3300028379 Unclassified 1428
754 Ga0268265_10160070 3300028380 Bacteria 1911
755 Ga0268265_10166170 3300028380 Bacteria 1881
756 Ga0268265_10247986 3300028380 Bacteria 1575
757 Ga0268265_10429373 3300028380 Unclassified 1229
758 Ga0268265_10582847 3300028380 Unclassified 1066
759 Ga0268265_10775501 3300028380 Unclassified 932
760 Ga0268264_10027695 3300028381 Bacteria 4632
761 Ga0268264_10049768 3300028381 Bacteria 3488
762 Ga0268264_10081762 3300028381 Unclassified 2762
763 Ga0268264_10117447 3300028381 Bacteria 2339
764 Ga0268264_10130419 3300028381 Bacteria 2227
765 Ga0268264_10157374 3300028381 Bacteria 2043
766 Ga0268264_10238304 3300028381 Bacteria 1684
767 Ga0268264_10317595 3300028381 Unclassified 1472
768 Ga0268264_10576573 3300028381 Bacteria 1106
769 Ga0268264_10620847 3300028381 Bacteria 1067
770 Ga0307513_10000238 3300031456 Bacteria 80100
771 Ga0307513_10322989 3300031456 Bacteria 1301
772 Ga0307408_100013384 3300031548 Bacteria 5444
773 Ga0307408_100042473 3300031548 Bacteria 3230
774 Ga0307408_100078016 3300031548 Bacteria 2468
775 Ga0307408_100133239 3300031548 Unclassified 1941
776 Ga0307405_10015061 3300031731 Bacteria 4176
777 Ga0307413_10036152 3300031824 Bacteria 2841
778 Ga0307410_10002023 3300031852 Bacteria 9564
779 Ga0307406_10007704 3300031901 Bacteria 5981
780 Ga0307406_10186241 3300031901 Bacteria 1516
781 Ga0307412_10018014 3300031911 Unclassified 4239
782 Ga0307409_100075645 3300031995 Bacteria 2697
783 Ga0307409_100223084 3300031995 Bacteria 1703
784 Ga0307416_100010309 3300032002 Bacteria 6166
785 Ga0307416_100526014 3300032002 Bacteria 1252
786 Ga0307414_10007653 3300032004 Bacteria 6081
787 Ga0307414_10491564 3300032004 Bacteria 1084
788 Ga0307415_100007828 3300032126 Bacteria 5873
789 Ga0307415_100277030 3300032126 Bacteria 1377
790 Ga0373951_0000266 3300035091 Bacteria 17178
791 Ga0373942_0004261 3300035207 Unclassified 3330
792 Ga0373935_0309885 3300035692 Unclassified 1118
793 Ga0373937_0026568 3300036401 Bacteria 5231
794 Ga0395899_0045268 3300037312 Bacteria 3279
795 Ga0395900_0067377 3300037418 Bacteria 3678
796 Ga0395900_0071081 3300037418 Bacteria 3577
797 Ga0395900_0218954 3300037418 Bacteria 1920
798 Ga0395900_0352138 3300037418 Bacteria 1446
799 Ga0395900_0381631 3300037418 Bacteria 1377
800 Ga0395898_0216244 3300037466 Unclassified 1828
801 Ga0395905_0010361 3300037471 Bacteria 9076
802 Ga0395905_0343158 3300037471 Bacteria 1385
803 Ga0395901_0778767 3300038443 Unclassified 947
804 Ga0242422_00216 3300038699 Bacteria 3315
805 Ga0242420_004095 3300038996 Bacteria 2187
806 Ga0242420_006840 3300038996 Bacteria 1815
807 Ga0242420_015403 3300038996 Unclassified 1322
808 Ga0436365_0344253 3300039437 Bacteria 119698
809 Ga0436365_1630086 3300039437 Bacteria 73381
810 Ga0439455_0002290 3300042012 Bacteria 3447
811 Ga0439458_0001735 3300042157 Bacteria 5441
812 Ga0439464_0064509 3300042439 Bacteria 1076
813 Ga0451577_0122848 3300042876 Bacteria 2326
814 Ga0451576_0070619 3300045051 Bacteria 3635
815 Ga0451576_0356829 3300045051 Bacteria 1531
816 Ga0451576_0418537 3300045051 Unclassified 1406
817 Ga0451576_0611580 3300045051 Bacteria 1145
818 Ga0451576_0981769 3300045051 Bacteria 885
819 Ga0495639_0070334 3300046475 Unclassified 1616
820 Ga0495584_0201882 3300046491 Unclassified 1011
821 Ga0495632_0026354 3300046519 Bacteria 3061
822 Ga0495663_0001444 3300046525 Bacteria 7503
823 Ga0495598_0009606 3300046537 Bacteria 2292
824 Ga0495621_0001077 3300046539 Bacteria 7003
825 Ga0495656_0148571 3300046615 Bacteria 1130
826 Ga0495659_0092218 3300046664 Unclassified 1164
827 Ga0495647_0126097 3300046681 Unclassified 1081
828 Ga0495669_0105890 3300046684 Unclassified 1310
829 Ga0495670_0126650 3300046691 Bacteria 1330
830 Ga0495636_0105731 3300047318 Unclassified 1234
831 Ga0495636_0155542 3300047318 Bacteria 1028
832 Ga0495674_0347914 3300047319 Unclassified 1204
833 Ga0495672_0138844 3300047320 Bacteria 1271
834 Ga0496100_0152678 3300048903 Unclassified 1649
835 Ga0496102_0011427 3300048905 Bacteria 7655
836 Ga0496102_0116640 3300048905 Bacteria 2492
837 Ga0496103_0089903 3300048906 Bacteria 1937
838 Ga0496106_0055940 3300048909 Bacteria 2983
839 Ga0496106_0386594 3300048909 Bacteria 1124
840 Ga0496106_0415000 3300048909 Unclassified 1082
841 Ga0496107_0013028 3300048910 Bacteria 5809
842 Ga0496108_0368381 3300048911 Bacteria 1254
843 Ga0496110_0389074 3300048913 Unclassified 1271
844 Ga0496110_0928606 3300048913 Bacteria 777
845 Ga0496112_0025724 3300048915 Bacteria 5653
846 Ga0496112_0162595 3300048915 Bacteria 2199
847 Ga0496113_0256050 3300048916 Bacteria 1398
848 Ga0496113_0580913 3300048916 Unclassified 898
849 Ga0501291_007157 3300049514 Bacteria 1506
850 Ga0501291_010725 3300049514 Bacteria 1309
851 Ga0501291_018911 3300049514 Bacteria 1076
852 Ga0501292_003124 3300049515 Bacteria 2191
853 Ga0501292_003582 3300049515 Bacteria 2084
854 Ga0501292_009963 3300049515 Bacteria 1417
855 Ga0501292_015774 3300049515 Unclassified 1184
856 Ga0501295_041091 3300049518 Unclassified 959
857 Ga0501298_002676 3300049521 Bacteria 2716
858 Ga0501299_000754 3300049522 Bacteria 3928
859 Ga0501038_0032512 3300049574 Bacteria 4602
860 Ga0501198_001879 3300049649 Bacteria 2774
861 Ga0501198_002730 3300049649 Unclassified 2389
862 Ga0501198_004098 3300049649 Bacteria 2014
863 Ga0501202_001705 3300049652 Bacteria 3563
864 Ga0501202_005263 3300049652 Bacteria 2291
865 Ga0501202_006175 3300049652 Bacteria 2137
866 Ga0501207_002171 3300049654 Bacteria 2514
867 Ga0501207_008031 3300049654 Bacteria 1518
868 Ga0501208_004930 3300049655 Bacteria 1609
869 Ga0501208_005660 3300049655 Bacteria 1549
870 Ga0501214_000540 3300049659 Bacteria 2576
871 Ga0501216_002071 3300049660 Bacteria 2810
872 Ga0501216_013672 3300049660 Bacteria 1349
873 Ga0501216_019021 3300049660 Unclassified 1187
874 Ga0501217_000517 3300049661 Bacteria 6418
875 Ga0501217_002052 3300049661 Bacteria 3898
876 Ga0501217_015844 3300049661 Bacteria 1721
877 Ga0501223_000504 3300049663 Bacteria 9463
878 Ga0501223_006582 3300049663 Unclassified 2399
879 Ga0501224_000129 3300049664 Bacteria 8262
880 Ga0501227_000295 3300049665 Bacteria 10300
881 Ga0501227_010369 3300049665 Bacteria 2019
882 Ga0501230_003632 3300049667 Bacteria 2065
883 Ga0501233_000556 3300049668 Bacteria 6049
884 Ga0501233_004577 3300049668 Bacteria 2541
885 Ga0501233_016218 3300049668 Unclassified 1543
886 Ga0501233_020069 3300049668 Bacteria 1423
887 Ga0501235_004630 3300049669 Bacteria 2974
888 Ga0501235_010239 3300049669 Bacteria 2049
889 Ga0501240_000221 3300049673 Bacteria 4271
890 Ga0501243_003067 3300049675 Unclassified 2466
891 Ga0501243_021776 3300049675 Bacteria 1059
892 Ga0501243_033213 3300049675 Bacteria 887
893 Ga0501246_004142 3300049676 Unclassified 1189
894 Ga0501249_015567 3300049679 Bacteria 1627
895 Ga0501249_036007 3300049679 Unclassified 1114
896 Ga0501250_001921 3300049680 Unclassified 1806
897 Ga0501251_002794 3300049681 Unclassified 1710
898 Ga0501255_004304 3300049684 Bacteria 1373
899 Ga0501256_004876 3300049685 Bacteria 1165
900 Ga0501259_001344 3300049688 Unclassified 4115
901 Ga0501259_009350 3300049688 Bacteria 1590
902 Ga0501259_020058 3300049688 Unclassified 1182
903 Ga0501260_006541 3300049689 Bacteria 1122
904 Ga0501261_006049 3300049690 Bacteria 1535
905 Ga0501225_0000145 3300049705 Bacteria 21644
906 Ga0501225_0009821 3300049705 Bacteria 2718
907 Ga0501225_0085746 3300049705 Bacteria 908
908 Ga0501234_000075 3300049707 Bacteria 12283
909 Ga0501234_002153 3300049707 Bacteria 3113
910 Ga0501234_011417 3300049707 Bacteria 1389
911 Ga0501245_009982 3300049708 Bacteria 1369
912 Ga0501266_017453 3300049763 Unclassified 960
913 Ga0501266_017623 3300049763 Unclassified 956
914 Ga0501268_018587 3300049765 Unclassified 1170
915 Ga0501268_036007 3300049765 Unclassified 915
916 Ga0501270_014036 3300049767 Unclassified 1121
917 Ga0501272_005644 3300049769 Unclassified 1323
918 Ga0501272_006476 3300049769 Bacteria 1251
919 Ga0501273_003589 3300049770 Bacteria 1657
920 Ga0501273_011924 3300049770 Bacteria 1089
921 Ga0501279_001580 3300049775 Bacteria 2997
922 Ga0501279_001951 3300049775 Bacteria 2720
923 Ga0501283_002494 3300049779 Bacteria 2392
924 Ga0501212_001962 3300049851 Bacteria 2418
925 Ga0501212_002472 3300049851 Bacteria 2232
926 Ga0501212_003670 3300049851 Bacteria 1943
927 Ga0501212_020353 3300049851 Bacteria 1022
928 nmdc:mga05p37_184818_c1 3300050507 Bacteria 2534
929 nmdc:mga05p37_207493_c1 3300050507 Bacteria 2369
930 nmdc:mga05p37_275258_c1 3300050507 Bacteria 2010
931 nmdc:mga05p37_282388_c1 3300050507 Unclassified 1979
932 nmdc:mga05p37_303373_c1 3300050507 Bacteria 1896
933 nmdc:mga05p37_43970_c1 3300050507 Bacteria 5495
934 nmdc:mga05p37_558656_c1 3300050507 Unclassified 1301
935 nmdc:mga05p37_61134_c1 3300050507 Bacteria 4637
936 nmdc:mga05p37_83593_c1 3300050507 Bacteria 3933
937 nmdc:mga09592_422740_c1 3300050508 Bacteria 1151
938 nmdc:mga09592_71662_c1 3300050508 Bacteria 2941
939 nmdc:mga09592_92749_c1 3300050508 Bacteria 2582
940 nmdc:mga06r32_136876_c1 3300050510 Bacteria 2424
941 nmdc:mga06r32_171085_c1 3300050510 Bacteria 2156
942 nmdc:mga08y16_118388_c1 3300050511 Bacteria 2757
943 nmdc:mga08y16_287332_c1 3300050511 Bacteria 1696
944 nmdc:mga08y16_36035_c1 3300050511 Bacteria 5195
945 nmdc:mga08y16_3905_c1 3300050511 Bacteria 15524
946 nmdc:mga0n895_164400_c1 3300050512 Bacteria 2251
947 nmdc:mga0n895_179377_c1 3300050512 Bacteria 2149
948 nmdc:mga0n895_203507_c1 3300050512 Bacteria 2010
949 nmdc:mga0n895_236459_c1 3300050512 Bacteria 1854
950 nmdc:mga0n895_274902_c1 3300050512 Bacteria 1708
951 nmdc:mga0n895_408379_c1 3300050512 Unclassified 1373
952 nmdc:mga0n895_438430_c1 3300050512 Unclassified 1320
953 nmdc:mga0n895_528069_c1 3300050512 Bacteria 1187
954 nmdc:mga0n895_67515_c1 3300050512 Bacteria 3541
955 nmdc:mga0rr50_301141_c1 3300050513 Bacteria 1341
956 nmdc:mga0rr50_43685_c1 3300050513 Bacteria 3282
957 nmdc:mga0rr50_520_c1 3300050513 Bacteria 20566
958 nmdc:mga08x19_107_c1 3300050514 Bacteria 74172
959 nmdc:mga08x19_193356_c1 3300050514 Unclassified 1393
960 nmdc:mga0a205_152147_c1 3300050515 Bacteria 2213
961 nmdc:mga0a205_177434_c1 3300050515 Bacteria 2025
962 nmdc:mga0a205_190637_c1 3300050515 Bacteria 1942
963 nmdc:mga0a205_263263_c1 3300050515 Bacteria 1602
964 nmdc:mga0a205_312347_c1 3300050515 Unclassified 1444
965 nmdc:mga0a205_75331_c1 3300050515 Bacteria 3261
966 Ga0495655_0034110 3300053083 Bacteria 1257
967 Ga0587085_005441 3300059506 Bacteria 1500
968 Ga0587091_037760 3300059511 Unclassified 939
969 Ga0530510_0073156 3300061734 Bacteria 2488

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_408379_c1 nmdc:mga0n895_408379_c1_12_677 221
2 3300009098 Ga0105245_10775801 Ga0105245_107758011 227
3 3300049515 Ga0501292_009963 Ga0501292_009963_14_718 234
4 3300049675 Ga0501243_003067 Ga0501243_003067_158_874 237
5 3300046681 Ga0495647_0126097 Ga0495647_0126097_16_732 238
6 3300048913 Ga0496110_0928606 Ga0496110_0928606_25_741 238
7 3300050507 nmdc:mga05p37_207493_c1 nmdc:mga05p37_207493_c1_378_1094 238
8 3300050512 nmdc:mga0n895_67515_c1 nmdc:mga0n895_67515_c1_18_737 239
9 3300014325 Ga0163163_10074554 Ga0163163_100745543 243
10 3300005345 Ga0070692_10279461 Ga0070692_102794611 245
11 3300014326 Ga0157380_10045487 Ga0157380_100454871 245
12 3300009177 Ga0105248_10846879 Ga0105248_108468791 246
13 3300010375 Ga0105239_10303061 Ga0105239_103030612 246
14 3300037418 Ga0395900_0352138 Ga0395900_0352138_37_783 246
15 3300037471 Ga0395905_0010361 Ga0395905_0010361_4231_4977 246
16 3300038699 Ga0242422_00216 Ga0242422_00216_1764_2507 246
17 3300038996 Ga0242420_004095 Ga0242420_004095_558_1301 246
18 3300045051 Ga0451576_0611580 Ga0451576_0611580_108_851 246
19 3300050513 nmdc:mga0rr50_43685_c1 nmdc:mga0rr50_43685_c1_2232_2990 246
20 3300005985 Ga0081539_10000941 Ga0081539_1000094120 248
21 3300009148 Ga0105243_10606802 Ga0105243_106068021 248
22 3300005364 Ga0070673_100061670 Ga0070673_1000616701 249
23 3300009148 Ga0105243_10405196 Ga0105243_104051961 249
24 3300025960 Ga0207651_10052772 Ga0207651_100527724 249
25 3300031456 Ga0307513_10000238 Ga0307513_1000023851 249
26 3300032002 Ga0307416_100526014 Ga0307416_1005260141 249
27 3300000531 CNBas_1002080 CNBas_10020801 250
28 3300005440 Ga0070705_100295684 Ga0070705_1002956841 250
29 3300005549 Ga0070704_100461537 Ga0070704_1004615371 250
30 3300045051 Ga0451576_0981769 Ga0451576_0981769_79_846 250
31 3300050507 nmdc:mga05p37_558656_c1 nmdc:mga05p37_558656_c1_512_1273 250
32 3300009011 Ga0105251_10081677 Ga0105251_100816771 251
33 3300009148 Ga0105243_10059880 Ga0105243_100598801 251
34 3300009148 Ga0105243_10256448 Ga0105243_102564482 251
35 3300009174 Ga0105241_10019245 Ga0105241_100192456 251
36 3300009174 Ga0105241_10046782 Ga0105241_100467822 251
37 3300009177 Ga0105248_10033984 Ga0105248_100339843 251
38 3300009177 Ga0105248_10387468 Ga0105248_103874682 251
39 3300009177 Ga0105248_10398892 Ga0105248_103988922 251
40 3300009177 Ga0105248_10746510 Ga0105248_107465101 251
41 3300010375 Ga0105239_10472490 Ga0105239_104724902 251
42 3300011119 Ga0105246_10019006 Ga0105246_100190062 251
43 3300011119 Ga0105246_10094377 Ga0105246_100943772 251
44 3300013100 Ga0157373_10033790 Ga0157373_100337903 251
45 3300013306 Ga0163162_10009010 Ga0163162_100090101 251
46 3300013306 Ga0163162_10044633 Ga0163162_100446335 251
47 3300013306 Ga0163162_10891855 Ga0163162_108918551 251
48 3300013307 Ga0157372_10706495 Ga0157372_107064951 251
49 3300014325 Ga0163163_10007435 Ga0163163_100074358 251
50 3300014325 Ga0163163_10145626 Ga0163163_101456263 251
51 3300014325 Ga0163163_10310393 Ga0163163_103103931 251
52 3300014325 Ga0163163_10312194 Ga0163163_103121942 251
53 3300014325 Ga0163163_10419274 Ga0163163_104192742 251
54 3300014325 Ga0163163_10577833 Ga0163163_105778331 251
55 3300014968 Ga0157379_10025079 Ga0157379_100250796 251
56 3300037418 Ga0395900_0381631 Ga0395900_0381631_112_867 251
57 3300045051 Ga0451576_0418537 Ga0451576_0418537_51_812 251
58 3300046491 Ga0495584_0201882 Ga0495584_0201882_241_999 251
59 3300047320 Ga0495672_0138844 Ga0495672_0138844_180_938 251
60 3300048905 Ga0496102_0011427 Ga0496102_0011427_5299_6057 251
61 3300048911 Ga0496108_0368381 Ga0496108_0368381_101_859 251
62 3300049514 Ga0501291_007157 Ga0501291_007157_309_1109 251
63 3300049514 Ga0501291_018911 Ga0501291_018911_277_1032 251
64 3300049515 Ga0501292_015774 Ga0501292_015774_133_891 251
65 3300049518 Ga0501295_041091 Ga0501295_041091_37_837 251
66 3300049521 Ga0501298_002676 Ga0501298_002676_848_1606 251
67 3300049649 Ga0501198_002730 Ga0501198_002730_987_1745 251
68 3300049652 Ga0501202_001705 Ga0501202_001705_971_1729 251
69 3300049654 Ga0501207_002171 Ga0501207_002171_95_853 251
70 3300049655 Ga0501208_005660 Ga0501208_005660_455_1255 251
71 3300049659 Ga0501214_000540 Ga0501214_000540_1042_1800 251
72 3300049660 Ga0501216_002071 Ga0501216_002071_364_1122 251
73 3300049660 Ga0501216_013672 Ga0501216_013672_17_772 251
74 3300049660 Ga0501216_019021 Ga0501216_019021_271_1071 251
75 3300049661 Ga0501217_000517 Ga0501217_000517_1001_1759 251
76 3300049661 Ga0501217_015844 Ga0501217_015844_698_1498 251
77 3300049663 Ga0501223_000504 Ga0501223_000504_7104_7862 251
78 3300049663 Ga0501223_006582 Ga0501223_006582_26_826 251
79 3300049664 Ga0501224_000129 Ga0501224_000129_5172_5930 251
80 3300049665 Ga0501227_000295 Ga0501227_000295_2072_2830 251
81 3300049668 Ga0501233_000556 Ga0501233_000556_2840_3598 251
82 3300049668 Ga0501233_016218 Ga0501233_016218_502_1302 251
83 3300049668 Ga0501233_020069 Ga0501233_020069_291_1046 251
84 3300049669 Ga0501235_010239 Ga0501235_010239_846_1601 251
85 3300049673 Ga0501240_000221 Ga0501240_000221_1747_2505 251
86 3300049676 Ga0501246_004142 Ga0501246_004142_163_963 251
87 3300049679 Ga0501249_036007 Ga0501249_036007_268_1068 251
88 3300049681 Ga0501251_002794 Ga0501251_002794_744_1544 251
89 3300049688 Ga0501259_001344 Ga0501259_001344_2426_3184 251
90 3300049688 Ga0501259_020058 Ga0501259_020058_38_838 251
91 3300049705 Ga0501225_0000145 Ga0501225_0000145_15121_15879 251
92 3300049707 Ga0501234_000075 Ga0501234_000075_1795_2553 251
93 3300049708 Ga0501245_009982 Ga0501245_009982_584_1342 251
94 3300049763 Ga0501266_017453 Ga0501266_017453_47_847 251
95 3300049763 Ga0501266_017623 Ga0501266_017623_125_883 251
96 3300049765 Ga0501268_018587 Ga0501268_018587_255_1013 251
97 3300049765 Ga0501268_036007 Ga0501268_036007_27_782 251
98 3300049767 Ga0501270_014036 Ga0501270_014036_163_963 251
99 3300049769 Ga0501272_005644 Ga0501272_005644_28_786 251
100 3300049769 Ga0501272_006476 Ga0501272_006476_126_926 251
101 3300049770 Ga0501273_011924 Ga0501273_011924_62_820 251
102 3300049775 Ga0501279_001580 Ga0501279_001580_1791_2591 251
103 3300049779 Ga0501283_002494 Ga0501283_002494_122_922 251
104 3300049851 Ga0501212_002472 Ga0501212_002472_240_1040 251
105 3300050510 nmdc:mga06r32_171085_c1 nmdc:mga06r32_171085_c1_987_1745 251
106 3300050515 nmdc:mga0a205_152147_c1 nmdc:mga0a205_152147_c1_17_775 251
107 3300050515 nmdc:mga0a205_312347_c1 nmdc:mga0a205_312347_c1_60_815 251
108 3300009093 Ga0105240_10042866 Ga0105240_100428662 252
109 3300009094 Ga0111539_10083728 Ga0111539_100837284 252
110 3300009098 Ga0105245_10141499 Ga0105245_101414993 252
111 3300009101 Ga0105247_10007521 Ga0105247_1000752111 252
112 3300009147 Ga0114129_10023642 Ga0114129_100236422 252
113 3300009147 Ga0114129_10051936 Ga0114129_100519368 252
114 3300009147 Ga0114129_10114657 Ga0114129_101146575 252
115 3300009147 Ga0114129_11148137 Ga0114129_111481371 252
116 3300009147 Ga0114129_11198199 Ga0114129_111981991 252
117 3300009148 Ga0105243_10077421 Ga0105243_100774213 252
118 3300009148 Ga0105243_10077653 Ga0105243_100776532 252
119 3300009148 Ga0105243_10145993 Ga0105243_101459933 252
120 3300009148 Ga0105243_10237386 Ga0105243_102373862 252
121 3300009174 Ga0105241_10064366 Ga0105241_100643662 252
122 3300009174 Ga0105241_10362011 Ga0105241_103620112 252
123 3300009176 Ga0105242_10002192 Ga0105242_100021927 252
124 3300009176 Ga0105242_10039298 Ga0105242_100392981 252
125 3300009176 Ga0105242_10346571 Ga0105242_103465711 252
126 3300009177 Ga0105248_10033803 Ga0105248_100338032 252
127 3300009177 Ga0105248_10112607 Ga0105248_101126073 252
128 3300009177 Ga0105248_10297035 Ga0105248_102970351 252
129 3300009177 Ga0105248_10357877 Ga0105248_103578772 252
130 3300009545 Ga0105237_10010849 Ga0105237_1001084910 252
131 3300009545 Ga0105237_10019745 Ga0105237_100197456 252
132 3300009553 Ga0105249_10017459 Ga0105249_100174595 252
133 3300009553 Ga0105249_10711010 Ga0105249_107110102 252
134 3300010375 Ga0105239_10116098 Ga0105239_101160982 252
135 3300011119 Ga0105246_10079138 Ga0105246_100791382 252
136 3300011119 Ga0105246_10111502 Ga0105246_101115022 252
137 3300013102 Ga0157371_10210552 Ga0157371_102105522 252
138 3300013102 Ga0157371_10273083 Ga0157371_102730832 252
139 3300013296 Ga0157374_10015970 Ga0157374_100159707 252
140 3300013296 Ga0157374_10135043 Ga0157374_101350432 252
141 3300013297 Ga0157378_10001282 Ga0157378_1000128212 252
142 3300013297 Ga0157378_10003380 Ga0157378_100033807 252
143 3300013297 Ga0157378_10048711 Ga0157378_100487111 252
144 3300013297 Ga0157378_10194990 Ga0157378_101949902 252
145 3300013306 Ga0163162_10010751 Ga0163162_100107519 252
146 3300013306 Ga0163162_10012811 Ga0163162_100128118 252
147 3300013306 Ga0163162_10170307 Ga0163162_101703072 252
148 3300013306 Ga0163162_10463601 Ga0163162_104636012 252
149 3300013306 Ga0163162_10526133 Ga0163162_105261332 252
150 3300013306 Ga0163162_10543775 Ga0163162_105437751 252
151 3300013307 Ga0157372_10295285 Ga0157372_102952852 252
152 3300013308 Ga0157375_10004418 Ga0157375_1000441810 252
153 3300013308 Ga0157375_10067251 Ga0157375_100672516 252
154 3300013308 Ga0157375_10073908 Ga0157375_100739083 252
155 3300013308 Ga0157375_10167282 Ga0157375_101672822 252
156 3300013308 Ga0157375_10198777 Ga0157375_101987771 252
157 3300013308 Ga0157375_10262499 Ga0157375_102624992 252
158 3300014325 Ga0163163_10001831 Ga0163163_1000183112 252
159 3300014325 Ga0163163_10132213 Ga0163163_101322132 252
160 3300014325 Ga0163163_10207137 Ga0163163_102071372 252
161 3300014325 Ga0163163_10220860 Ga0163163_102208601 252
162 3300014326 Ga0157380_10001205 Ga0157380_1000120510 252
163 3300014326 Ga0157380_10015063 Ga0157380_100150634 252
164 3300014326 Ga0157380_10041006 Ga0157380_100410064 252
165 3300014745 Ga0157377_10005057 Ga0157377_100050575 252
166 3300014745 Ga0157377_10183115 Ga0157377_101831151 252
167 3300014745 Ga0157377_10480803 Ga0157377_104808031 252
168 3300014968 Ga0157379_10290117 Ga0157379_102901171 252
169 3300014969 Ga0157376_10014842 Ga0157376_100148423 252
170 3300014969 Ga0157376_10445779 Ga0157376_104457792 252
171 3300036401 Ga0373937_0026568 Ga0373937_0026568_957_1715 252
172 3300037418 Ga0395900_0071081 Ga0395900_0071081_523_1281 252
173 3300037471 Ga0395905_0343158 Ga0395905_0343158_116_877 252
174 3300038443 Ga0395901_0778767 Ga0395901_0778767_171_929 252
175 3300042012 Ga0439455_0002290 Ga0439455_0002290_602_1363 252
176 3300042157 Ga0439458_0001735 Ga0439458_0001735_3579_4340 252
177 3300045051 Ga0451576_0356829 Ga0451576_0356829_248_1006 252
178 3300046519 Ga0495632_0026354 Ga0495632_0026354_53_880 252
179 3300046684 Ga0495669_0105890 Ga0495669_0105890_479_1237 252
180 3300048903 Ga0496100_0152678 Ga0496100_0152678_736_1494 252
181 3300048913 Ga0496110_0389074 Ga0496110_0389074_434_1192 252
182 3300048915 Ga0496112_0162595 Ga0496112_0162595_940_1698 252
183 3300048916 Ga0496113_0256050 Ga0496113_0256050_470_1234 252
184 3300049514 Ga0501291_010725 Ga0501291_010725_505_1263 252
185 3300049675 Ga0501243_033213 Ga0501243_033213_96_854 252
186 3300049680 Ga0501250_001921 Ga0501250_001921_1009_1767 252
187 3300049705 Ga0501225_0085746 Ga0501225_0085746_40_798 252
188 3300049707 Ga0501234_011417 Ga0501234_011417_615_1373 252
189 3300049851 Ga0501212_001962 Ga0501212_001962_522_1280 252
190 3300050507 nmdc:mga05p37_303373_c1 nmdc:mga05p37_303373_c1_146_904 252
191 3300050507 nmdc:mga05p37_43970_c1 nmdc:mga05p37_43970_c1_805_1563 252
192 3300050507 nmdc:mga05p37_61134_c1 nmdc:mga05p37_61134_c1_1018_1776 252
193 3300050508 nmdc:mga09592_422740_c1 nmdc:mga09592_422740_c1_132_890 252
194 3300050508 nmdc:mga09592_71662_c1 nmdc:mga09592_71662_c1_1917_2675 252
195 3300050508 nmdc:mga09592_92749_c1 nmdc:mga09592_92749_c1_794_1552 252
196 3300050510 nmdc:mga06r32_136876_c1 nmdc:mga06r32_136876_c1_1121_1879 252
197 3300050511 nmdc:mga08y16_118388_c1 nmdc:mga08y16_118388_c1_569_1333 252
198 3300050511 nmdc:mga08y16_36035_c1 nmdc:mga08y16_36035_c1_1535_2293 252
199 3300050512 nmdc:mga0n895_274902_c1 nmdc:mga0n895_274902_c1_443_1201 252
200 3300050512 nmdc:mga0n895_438430_c1 nmdc:mga0n895_438430_c1_471_1232 252
201 3300050515 nmdc:mga0a205_190637_c1 nmdc:mga0a205_190637_c1_357_1115 252
202 3300050515 nmdc:mga0a205_75331_c1 nmdc:mga0a205_75331_c1_2079_2840 252
203 3300061734 Ga0530510_0073156 Ga0530510_0073156_678_1436 252
204 3300009093 Ga0105240_10191814 Ga0105240_101918144 253
205 3300009094 Ga0111539_10005075 Ga0111539_1000507510 253
206 3300009098 Ga0105245_10382373 Ga0105245_103823731 253
207 3300009174 Ga0105241_10222574 Ga0105241_102225742 253
208 3300009177 Ga0105248_10133245 Ga0105248_101332453 253
209 3300009551 Ga0105238_10008842 Ga0105238_1000884210 253
210 3300009553 Ga0105249_10004897 Ga0105249_100048977 253
211 3300013306 Ga0163162_10149517 Ga0163162_101495172 253
212 3300013308 Ga0157375_10140339 Ga0157375_101403391 253
213 3300014325 Ga0163163_10001533 Ga0163163_1000153326 253
214 3300035091 Ga0373951_0000266 Ga0373951_0000266_1549_2316 253
215 3300035207 Ga0373942_0004261 Ga0373942_0004261_2227_2991 253
216 3300035692 Ga0373935_0309885 Ga0373935_0309885_305_1081 253
217 3300048909 Ga0496106_0386594 Ga0496106_0386594_192_956 253
218 3300048915 Ga0496112_0025724 Ga0496112_0025724_4537_5298 253
219 3300048916 Ga0496113_0580913 Ga0496113_0580913_17_778 253
220 3300006871 Ga0075434_100014554 Ga0075434_1000145544 256
221 3300031548 Ga0307408_100078016 Ga0307408_1000780163 256
222 3300031731 Ga0307405_10015061 Ga0307405_100150615 256
223 3300032004 Ga0307414_10491564 Ga0307414_104915641 256
224 3300032126 Ga0307415_100277030 Ga0307415_1002770301 256
225 3300050512 nmdc:mga0n895_164400_c1 nmdc:mga0n895_164400_c1_963_1754 256
226 3300000532 CNAas_1000886 CNAas_10008864 257
227 3300005441 Ga0070700_100060229 Ga0070700_1000602293 257
228 3300005546 Ga0070696_100211143 Ga0070696_1002111431 257
229 3300005617 Ga0068859_100974884 Ga0068859_1009748841 257
230 3300005618 Ga0068864_100020637 Ga0068864_1000206375 257
231 3300005841 Ga0068863_100221915 Ga0068863_1002219152 257
232 3300006852 Ga0075433_10022852 Ga0075433_100228526 257
233 3300006871 Ga0075434_100040126 Ga0075434_1000401262 257
234 3300006931 Ga0097620_100974960 Ga0097620_1009749601 257
235 3300017792 Ga0163161_10329395 Ga0163161_103293952 257
236 3300025911 Ga0207654_10094769 Ga0207654_100947692 257
237 3300025924 Ga0207694_10087086 Ga0207694_100870862 257
238 3300025961 Ga0207712_10400078 Ga0207712_104000781 257
239 3300026035 Ga0207703_10108349 Ga0207703_101083493 257
240 3300026089 Ga0207648_10209835 Ga0207648_102098351 257
241 3300026095 Ga0207676_10014298 Ga0207676_100142983 257
242 3300028380 Ga0268265_10775501 Ga0268265_107755011 257
243 3300049574 Ga0501038_0032512 Ga0501038_0032512_2762_3562 257
244 3300005440 Ga0070705_100472910 Ga0070705_1004729101 259
245 3300009147 Ga0114129_10446440 Ga0114129_104464402 259
246 3300021384 Ga0213876_10000251 Ga0213876_1000025119 259
247 3300021384 Ga0213876_10000279 Ga0213876_1000027938 259
248 3300039437 Ga0436365_0344253 Ga0436365_0344253_20332_21126 259
249 3300039437 Ga0436365_1630086 Ga0436365_1630086_52953_53747 259
250 3300005295 Ga0065707_10233064 Ga0065707_102330641 260
251 3300005468 Ga0070707_100000197 Ga0070707_10000019735 260
252 3300005518 Ga0070699_100453036 Ga0070699_1004530361 260
253 3300005545 Ga0070695_100135304 Ga0070695_1001353042 260
254 3300005549 Ga0070704_100001685 Ga0070704_1000016853 260
255 3300005985 Ga0081539_10071166 Ga0081539_100711663 260
256 3300007076 Ga0075435_100021117 Ga0075435_1000211176 260
257 3300025922 Ga0207646_10001342 Ga0207646_1000134227 260
258 3300005467 Ga0070706_100030934 Ga0070706_1000309341 261
259 3300005468 Ga0070707_100005488 Ga0070707_1000054883 261
260 3300005471 Ga0070698_100147259 Ga0070698_1001472592 261
261 3300005518 Ga0070699_100481441 Ga0070699_1004814412 261
262 3300005536 Ga0070697_100046238 Ga0070697_1000462383 261
263 3300025922 Ga0207646_10001700 Ga0207646_1000170015 261
264 3300005546 Ga0070696_100272351 Ga0070696_1002723512 262
265 3300006846 Ga0075430_100082659 Ga0075430_1000826595 262
266 3300006880 Ga0075429_100447729 Ga0075429_1004477291 262
267 3300011119 Ga0105246_10041615 Ga0105246_100416151 262
268 3300013100 Ga0157373_10016111 Ga0157373_100161112 262
269 3300013297 Ga0157378_10070903 Ga0157378_100709031 262
270 3300025908 Ga0207643_10094051 Ga0207643_100940512 262
271 3300025935 Ga0207709_10431305 Ga0207709_104313051 262
272 3300026075 Ga0207708_10152920 Ga0207708_101529201 262
273 3300026116 Ga0207674_10141200 Ga0207674_101412002 262
274 3300031548 Ga0307408_100133239 Ga0307408_1001332392 262
275 3300005288 Ga0065714_10064433 Ga0065714_1006443366 263
276 3300005290 Ga0065712_10067731 Ga0065712_1006773166 263
277 3300005293 Ga0065715_10088984 Ga0065715_1008898410 263
278 3300005337 Ga0070682_100025067 Ga0070682_1000250675 263
279 3300005345 Ga0070692_10004444 Ga0070692_100044446 263
280 3300005345 Ga0070692_10059843 Ga0070692_100598433 263
281 3300005347 Ga0070668_100008267 Ga0070668_1000082677 263
282 3300005438 Ga0070701_10020338 Ga0070701_100203385 263
283 3300005440 Ga0070705_100004943 Ga0070705_1000049434 263
284 3300005444 Ga0070694_100010557 Ga0070694_1000105576 263
285 3300005444 Ga0070694_100139441 Ga0070694_1001394411 263
286 3300005444 Ga0070694_100167114 Ga0070694_1001671141 263
287 3300005467 Ga0070706_100005724 Ga0070706_10000572411 263
288 3300005467 Ga0070706_100026556 Ga0070706_1000265564 263
289 3300005544 Ga0070686_100101956 Ga0070686_1001019563 263
290 3300005546 Ga0070696_100083176 Ga0070696_1000831763 263
291 3300005615 Ga0070702_100051700 Ga0070702_1000517003 263
292 3300005618 Ga0068864_100411897 Ga0068864_1004118972 263
293 3300005718 Ga0068866_10011179 Ga0068866_100111793 263
294 3300005834 Ga0068851_10003618 Ga0068851_100036187 263
295 3300005842 Ga0068858_100041123 Ga0068858_1000411234 263
296 3300009094 Ga0111539_10062464 Ga0111539_100624644 263
297 3300009147 Ga0114129_10068673 Ga0114129_100686733 263
298 3300009148 Ga0105243_10042180 Ga0105243_100421802 263
299 3300009553 Ga0105249_10000052 Ga0105249_1000005289 263
300 3300010375 Ga0105239_10104143 Ga0105239_101041432 263
301 3300013297 Ga0157378_10061510 Ga0157378_100615103 263
302 3300013297 Ga0157378_10280336 Ga0157378_102803362 263
303 3300013306 Ga0163162_10000001 Ga0163162_10000001601 263
304 3300013307 Ga0157372_10113831 Ga0157372_101138312 263
305 3300013308 Ga0157375_10757279 Ga0157375_107572791 263
306 3300014326 Ga0157380_10239283 Ga0157380_102392832 263
307 3300014968 Ga0157379_10146621 Ga0157379_101466212 263
308 3300025885 Ga0207653_10001174 Ga0207653_1000117410 263
309 3300025914 Ga0207671_10010718 Ga0207671_100107182 263
310 3300025961 Ga0207712_10000925 Ga0207712_1000092516 263
311 3300025972 Ga0207668_10005063 Ga0207668_100050637 263
312 3300048909 Ga0496106_0055940 Ga0496106_0055940_1251_2042 263
313 3300048910 Ga0496107_0013028 Ga0496107_0013028_2312_3103 263
314 3300049515 Ga0501292_003582 Ga0501292_003582_275_1069 263
315 3300049649 Ga0501198_004098 Ga0501198_004098_189_983 263
316 3300049652 Ga0501202_005263 Ga0501202_005263_354_1148 263
317 3300049654 Ga0501207_008031 Ga0501207_008031_532_1326 263
318 3300049665 Ga0501227_010369 Ga0501227_010369_280_1074 263
319 3300049667 Ga0501230_003632 Ga0501230_003632_234_1028 263
320 3300049668 Ga0501233_004577 Ga0501233_004577_476_1270 263
321 3300049669 Ga0501235_004630 Ga0501235_004630_1211_2005 263
322 3300049675 Ga0501243_021776 Ga0501243_021776_240_1034 263
323 3300049679 Ga0501249_015567 Ga0501249_015567_520_1314 263
324 3300049685 Ga0501256_004876 Ga0501256_004876_324_1118 263
325 3300049688 Ga0501259_009350 Ga0501259_009350_439_1233 263
326 3300049689 Ga0501260_006541 Ga0501260_006541_155_949 263
327 3300049705 Ga0501225_0009821 Ga0501225_0009821_1101_1895 263
328 3300049851 Ga0501212_020353 Ga0501212_020353_81_875 263
329 3300050511 nmdc:mga08y16_287332_c1 nmdc:mga08y16_287332_c1_373_1167 263
330 3300005328 Ga0070676_10190390 Ga0070676_101903901 264
331 3300005330 Ga0070690_100023410 Ga0070690_1000234104 264
332 3300005330 Ga0070690_100230058 Ga0070690_1002300581 264
333 3300005334 Ga0068869_100034500 Ga0068869_1000345003 264
334 3300005338 Ga0068868_100111973 Ga0068868_1001119731 264
335 3300005338 Ga0068868_100259110 Ga0068868_1002591102 264
336 3300005340 Ga0070689_100281890 Ga0070689_1002818902 264
337 3300005345 Ga0070692_10320358 Ga0070692_103203581 264
338 3300005406 Ga0070703_10000077 Ga0070703_1000007733 264
339 3300005438 Ga0070701_10129566 Ga0070701_101295661 264
340 3300005440 Ga0070705_100041667 Ga0070705_1000416672 264
341 3300005441 Ga0070700_100005553 Ga0070700_1000055531 264
342 3300005444 Ga0070694_100001229 Ga0070694_1000012296 264
343 3300005444 Ga0070694_100001886 Ga0070694_1000018863 264
344 3300005445 Ga0070708_100463792 Ga0070708_1004637921 264
345 3300005459 Ga0068867_100455123 Ga0068867_1004551231 264
346 3300005467 Ga0070706_100660570 Ga0070706_1006605701 264
347 3300005468 Ga0070707_100021433 Ga0070707_1000214332 264
348 3300005468 Ga0070707_100042234 Ga0070707_1000422343 264
349 3300005471 Ga0070698_100004943 Ga0070698_10000494310 264
350 3300005471 Ga0070698_100407889 Ga0070698_1004078891 264
351 3300005518 Ga0070699_100083270 Ga0070699_1000832703 264
352 3300005536 Ga0070697_100096040 Ga0070697_1000960404 264
353 3300005544 Ga0070686_100011973 Ga0070686_1000119733 264
354 3300005544 Ga0070686_100196842 Ga0070686_1001968421 264
355 3300005544 Ga0070686_100236950 Ga0070686_1002369501 264
356 3300005544 Ga0070686_100334617 Ga0070686_1003346171 264
357 3300005546 Ga0070696_100165930 Ga0070696_1001659302 264
358 3300005549 Ga0070704_100022845 Ga0070704_1000228453 264
359 3300005549 Ga0070704_100060228 Ga0070704_1000602283 264
360 3300005577 Ga0068857_100496245 Ga0068857_1004962452 264
361 3300005617 Ga0068859_100010028 Ga0068859_1000100289 264
362 3300005617 Ga0068859_100339026 Ga0068859_1003390261 264
363 3300005618 Ga0068864_100207035 Ga0068864_1002070351 264
364 3300005719 Ga0068861_100032846 Ga0068861_1000328463 264
365 3300005719 Ga0068861_100340012 Ga0068861_1003400121 264
366 3300005840 Ga0068870_10052726 Ga0068870_100527262 264
367 3300005842 Ga0068858_100066492 Ga0068858_1000664923 264
368 3300005842 Ga0068858_100201172 Ga0068858_1002011722 264
369 3300005843 Ga0068860_100251887 Ga0068860_1002518871 264
370 3300005844 Ga0068862_100016914 Ga0068862_1000169145 264
371 3300006163 Ga0070715_10000010 Ga0070715_1000001043 264
372 3300006173 Ga0070716_100000004 Ga0070716_100000004257 264
373 3300006358 Ga0068871_100515700 Ga0068871_1005157001 264
374 3300006844 Ga0075428_100522689 Ga0075428_1005226891 264
375 3300006847 Ga0075431_100236813 Ga0075431_1002368131 264
376 3300006871 Ga0075434_100068253 Ga0075434_1000682533 264
377 3300006871 Ga0075434_100406254 Ga0075434_1004062542 264
378 3300006871 Ga0075434_100580678 Ga0075434_1005806782 264
379 3300006880 Ga0075429_100038505 Ga0075429_1000385055 264
380 3300006914 Ga0075436_100000009 Ga0075436_1000000096 264
381 3300006931 Ga0097620_100010027 Ga0097620_1000100279 264
382 3300006931 Ga0097620_100339046 Ga0097620_1003390462 264
383 3300007076 Ga0075435_100008534 Ga0075435_1000085345 264
384 3300009094 Ga0111539_10010333 Ga0111539_100103334 264
385 3300009098 Ga0105245_10142966 Ga0105245_101429662 264
386 3300009148 Ga0105243_10000283 Ga0105243_1000028337 264
387 3300009176 Ga0105242_10000235 Ga0105242_1000023513 264
388 3300009176 Ga0105242_10018177 Ga0105242_100181774 264
389 3300009176 Ga0105242_10285870 Ga0105242_102858701 264
390 3300009177 Ga0105248_10342618 Ga0105248_103426182 264
391 3300009177 Ga0105248_10451487 Ga0105248_104514871 264
392 3300009177 Ga0105248_10946294 Ga0105248_109462941 264
393 3300009553 Ga0105249_10013685 Ga0105249_100136853 264
394 3300009553 Ga0105249_10176017 Ga0105249_101760172 264
395 3300010375 Ga0105239_10563382 Ga0105239_105633821 264
396 3300011119 Ga0105246_10161407 Ga0105246_101614072 264
397 3300013297 Ga0157378_10010625 Ga0157378_100106254 264
398 3300013297 Ga0157378_10021341 Ga0157378_100213412 264
399 3300013297 Ga0157378_10043585 Ga0157378_100435853 264
400 3300013297 Ga0157378_10060725 Ga0157378_100607253 264
401 3300013306 Ga0163162_10039048 Ga0163162_100390484 264
402 3300013306 Ga0163162_10504261 Ga0163162_105042611 264
403 3300013308 Ga0157375_10036058 Ga0157375_100360583 264
404 3300014326 Ga0157380_10001174 Ga0157380_100011742 264
405 3300014326 Ga0157380_10379173 Ga0157380_103791732 264
406 3300014326 Ga0157380_10547028 Ga0157380_105470281 264
407 3300014745 Ga0157377_10246536 Ga0157377_102465361 264
408 3300017792 Ga0163161_10007521 Ga0163161_100075215 264
409 3300017792 Ga0163161_10282467 Ga0163161_102824672 264
410 3300025885 Ga0207653_10000171 Ga0207653_100001715 264
411 3300025905 Ga0207685_10000006 Ga0207685_10000006170 264
412 3300025918 Ga0207662_10043560 Ga0207662_100435603 264
413 3300025918 Ga0207662_10260595 Ga0207662_102605951 264
414 3300025922 Ga0207646_10020611 Ga0207646_100206116 264
415 3300025922 Ga0207646_10133647 Ga0207646_101336473 264
416 3300025934 Ga0207686_10000021 Ga0207686_1000002123 264
417 3300025934 Ga0207686_10000283 Ga0207686_1000028317 264
418 3300025935 Ga0207709_10000069 Ga0207709_10000069128 264
419 3300025935 Ga0207709_10153624 Ga0207709_101536242 264
420 3300025936 Ga0207670_10078127 Ga0207670_100781273 264
421 3300025939 Ga0207665_10000139 Ga0207665_1000013917 264
422 3300025939 Ga0207665_10078025 Ga0207665_100780252 264
423 3300025941 Ga0207711_10524660 Ga0207711_105246601 264
424 3300025942 Ga0207689_10012415 Ga0207689_100124153 264
425 3300025960 Ga0207651_10113650 Ga0207651_101136501 264
426 3300025961 Ga0207712_10194852 Ga0207712_101948521 264
427 3300025961 Ga0207712_10454617 Ga0207712_104546171 264
428 3300025961 Ga0207712_10582738 Ga0207712_105827381 264
429 3300026035 Ga0207703_10122477 Ga0207703_101224773 264
430 3300026035 Ga0207703_10304678 Ga0207703_103046782 264
431 3300026075 Ga0207708_10010047 Ga0207708_100100471 264
432 3300026088 Ga0207641_10228323 Ga0207641_102283231 264
433 3300026095 Ga0207676_10286415 Ga0207676_102864152 264
434 3300026095 Ga0207676_10632295 Ga0207676_106322951 264
435 3300026118 Ga0207675_100003693 Ga0207675_1000036939 264
436 3300026118 Ga0207675_100152890 Ga0207675_1001528901 264
437 3300027907 Ga0207428_10011034 Ga0207428_100110347 264
438 3300028381 Ga0268264_10081762 Ga0268264_100817621 264
439 3300028381 Ga0268264_10238304 Ga0268264_102383042 264
440 3300028381 Ga0268264_10576573 Ga0268264_105765731 264
441 3300038996 Ga0242420_015403 Ga0242420_015403_459_1262 264
442 3300042876 Ga0451577_0122848 Ga0451577_0122848_521_1324 264
443 3300045051 Ga0451576_0070619 Ga0451576_0070619_291_1286 264
444 3300046475 Ga0495639_0070334 Ga0495639_0070334_302_1111 264
445 3300046615 Ga0495656_0148571 Ga0495656_0148571_114_911 264
446 3300046691 Ga0495670_0126650 Ga0495670_0126650_121_918 264
447 3300047319 Ga0495674_0347914 Ga0495674_0347914_341_1150 264
448 3300050512 nmdc:mga0n895_179377_c1 nmdc:mga0n895_179377_c1_588_1397 264
449 3300050512 nmdc:mga0n895_528069_c1 nmdc:mga0n895_528069_c1_98_895 264
450 3300050513 nmdc:mga0rr50_520_c1 nmdc:mga0rr50_520_c1_3242_4039 264
451 3300050514 nmdc:mga08x19_107_c1 nmdc:mga08x19_107_c1_66771_67568 264
452 3300053083 Ga0495655_0034110 Ga0495655_0034110_310_1110 264
453 3300002074 JGI24748J21848_1000087 JGI24748J21848_100008717 265
454 3300002239 JGI24034J26672_10000070 JGI24034J26672_1000007017 265
455 3300003203 JGI25406J46586_10007246 JGI25406J46586_100072465 265
456 3300005289 Ga0065704_10160288 Ga0065704_101602881 265
457 3300005293 Ga0065715_10056887 Ga0065715_100568871 265
458 3300005295 Ga0065707_10248713 Ga0065707_102487131 265
459 3300005331 Ga0070670_100308249 Ga0070670_1003082492 265
460 3300005334 Ga0068869_100343835 Ga0068869_1003438351 265
461 3300005336 Ga0070680_100029340 Ga0070680_1000293405 265
462 3300005340 Ga0070689_100447868 Ga0070689_1004478681 265
463 3300005344 Ga0070661_100025902 Ga0070661_1000259022 265
464 3300005345 Ga0070692_10189665 Ga0070692_101896652 265
465 3300005355 Ga0070671_100024875 Ga0070671_1000248755 265
466 3300005355 Ga0070671_100781882 Ga0070671_1007818821 265
467 3300005364 Ga0070673_100364802 Ga0070673_1003648022 265
468 3300005366 Ga0070659_100008321 Ga0070659_1000083214 265
469 3300005440 Ga0070705_100063379 Ga0070705_1000633794 265
470 3300005441 Ga0070700_100000120 Ga0070700_10000012015 265
471 3300005444 Ga0070694_100046532 Ga0070694_1000465325 265
472 3300005444 Ga0070694_100082875 Ga0070694_1000828752 265
473 3300005444 Ga0070694_100233179 Ga0070694_1002331792 265
474 3300005445 Ga0070708_100148145 Ga0070708_1001481453 265
475 3300005445 Ga0070708_100621821 Ga0070708_1006218211 265
476 3300005458 Ga0070681_10006294 Ga0070681_100062948 265
477 3300005467 Ga0070706_100035284 Ga0070706_1000352845 265
478 3300005468 Ga0070707_100286500 Ga0070707_1002865001 265
479 3300005471 Ga0070698_100012974 Ga0070698_1000129746 265
480 3300005471 Ga0070698_100013753 Ga0070698_1000137538 265
481 3300005471 Ga0070698_100042470 Ga0070698_1000424701 265
482 3300005518 Ga0070699_100030729 Ga0070699_1000307295 265
483 3300005518 Ga0070699_100049948 Ga0070699_1000499481 265
484 3300005530 Ga0070679_100008421 Ga0070679_10000842112 265
485 3300005530 Ga0070679_100056125 Ga0070679_1000561253 265
486 3300005536 Ga0070697_100038063 Ga0070697_1000380632 265
487 3300005536 Ga0070697_100317176 Ga0070697_1003171762 265
488 3300005536 Ga0070697_100411310 Ga0070697_1004113101 265
489 3300005539 Ga0068853_100124344 Ga0068853_1001243441 265
490 3300005539 Ga0068853_100633730 Ga0068853_1006337301 265
491 3300005545 Ga0070695_100104505 Ga0070695_1001045053 265
492 3300005546 Ga0070696_100000807 Ga0070696_10000080715 265
493 3300005546 Ga0070696_100069441 Ga0070696_1000694412 265
494 3300005547 Ga0070693_100006647 Ga0070693_1000066475 265
495 3300005547 Ga0070693_100022522 Ga0070693_1000225223 265
496 3300005547 Ga0070693_100108136 Ga0070693_1001081363 265
497 3300005549 Ga0070704_100047366 Ga0070704_1000473663 265
498 3300005563 Ga0068855_100455794 Ga0068855_1004557942 265
499 3300005564 Ga0070664_100005757 Ga0070664_1000057576 265
500 3300005564 Ga0070664_100252396 Ga0070664_1002523962 265
501 3300005577 Ga0068857_100011647 Ga0068857_1000116475 265
502 3300005577 Ga0068857_100363002 Ga0068857_1003630022 265
503 3300005614 Ga0068856_100021795 Ga0068856_1000217957 265
504 3300005617 Ga0068859_100027113 Ga0068859_1000271138 265
505 3300005617 Ga0068859_100113336 Ga0068859_1001133361 265
506 3300005618 Ga0068864_100021333 Ga0068864_1000213333 265
507 3300005618 Ga0068864_100302488 Ga0068864_1003024882 265
508 3300005618 Ga0068864_100323995 Ga0068864_1003239953 265
509 3300005618 Ga0068864_100334544 Ga0068864_1003345442 265
510 3300005718 Ga0068866_10070708 Ga0068866_100707082 265
511 3300005841 Ga0068863_100274814 Ga0068863_1002748143 265
512 3300005842 Ga0068858_100000077 Ga0068858_10000007778 265
513 3300005843 Ga0068860_100100146 Ga0068860_1001001462 265
514 3300005844 Ga0068862_100150979 Ga0068862_1001509793 265
515 3300005983 Ga0081540_1046504 Ga0081540_10465042 265
516 3300005985 Ga0081539_10001941 Ga0081539_1000194118 265
517 3300006847 Ga0075431_100164221 Ga0075431_1001642212 265
518 3300006852 Ga0075433_10037055 Ga0075433_100370553 265
519 3300006871 Ga0075434_100067157 Ga0075434_1000671572 265
520 3300006914 Ga0075436_100209691 Ga0075436_1002096912 265
521 3300006931 Ga0097620_100027113 Ga0097620_1000271138 265
522 3300006931 Ga0097620_100113335 Ga0097620_1001133351 265
523 3300009101 Ga0105247_10000015 Ga0105247_10000015227 265
524 3300009101 Ga0105247_10171682 Ga0105247_101716821 265
525 3300009147 Ga0114129_10164259 Ga0114129_101642592 265
526 3300009147 Ga0114129_10237746 Ga0114129_102377462 265
527 3300009147 Ga0114129_10815980 Ga0114129_108159801 265
528 3300009148 Ga0105243_10000350 Ga0105243_1000035040 265
529 3300009174 Ga0105241_10021776 Ga0105241_100217764 265
530 3300009176 Ga0105242_10000694 Ga0105242_1000069424 265
531 3300013297 Ga0157378_10000095 Ga0157378_1000009538 265
532 3300013307 Ga0157372_10557490 Ga0157372_105574901 265
533 3300013308 Ga0157375_10014917 Ga0157375_100149173 265
534 3300014968 Ga0157379_10269493 Ga0157379_102694932 265
535 3300025223 Ga0207672_1000270 Ga0207672_10002705 265
536 3300025735 Ga0207713_1049101 Ga0207713_10491011 265
537 3300025900 Ga0207710_10000004 Ga0207710_10000004522 265
538 3300025910 Ga0207684_10027931 Ga0207684_100279313 265
539 3300025911 Ga0207654_10021305 Ga0207654_100213055 265
540 3300025912 Ga0207707_10266148 Ga0207707_102661481 265
541 3300025917 Ga0207660_10033557 Ga0207660_100335574 265
542 3300025920 Ga0207649_10056940 Ga0207649_100569402 265
543 3300025921 Ga0207652_10038997 Ga0207652_100389976 265
544 3300025921 Ga0207652_10126285 Ga0207652_101262854 265
545 3300025925 Ga0207650_10239752 Ga0207650_102397522 265
546 3300025931 Ga0207644_10001610 Ga0207644_100016105 265
547 3300025931 Ga0207644_10024830 Ga0207644_100248303 265
548 3300025932 Ga0207690_10102531 Ga0207690_101025313 265
549 3300025933 Ga0207706_10062945 Ga0207706_100629453 265
550 3300025934 Ga0207686_10001321 Ga0207686_100013217 265
551 3300025935 Ga0207709_10003136 Ga0207709_100031364 265
552 3300025935 Ga0207709_10037073 Ga0207709_100370734 265
553 3300025935 Ga0207709_10572715 Ga0207709_105727151 265
554 3300025941 Ga0207711_10019129 Ga0207711_100191297 265
555 3300025941 Ga0207711_10156595 Ga0207711_101565952 265
556 3300025942 Ga0207689_10002102 Ga0207689_1000210211 265
557 3300025942 Ga0207689_10009874 Ga0207689_100098745 265
558 3300025945 Ga0207679_10106366 Ga0207679_101063662 265
559 3300025945 Ga0207679_10304566 Ga0207679_103045662 265
560 3300025960 Ga0207651_10291202 Ga0207651_102912022 265
561 3300026035 Ga0207703_10000043 Ga0207703_100000438 265
562 3300026041 Ga0207639_10081730 Ga0207639_100817303 265
563 3300026075 Ga0207708_10000196 Ga0207708_1000019634 265
564 3300026078 Ga0207702_10023166 Ga0207702_100231666 265
565 3300026095 Ga0207676_10022718 Ga0207676_100227183 265
566 3300026116 Ga0207674_10001115 Ga0207674_1000111524 265
567 3300026116 Ga0207674_10276964 Ga0207674_102769642 265
568 3300028380 Ga0268265_10582847 Ga0268265_105828471 265
569 3300028381 Ga0268264_10117447 Ga0268264_101174473 265
570 3300031548 Ga0307408_100013384 Ga0307408_1000133846 265
571 3300031824 Ga0307413_10036152 Ga0307413_100361522 265
572 3300031852 Ga0307410_10002023 Ga0307410_100020235 265
573 3300031901 Ga0307406_10007704 Ga0307406_100077045 265
574 3300031911 Ga0307412_10018014 Ga0307412_100180145 265
575 3300031995 Ga0307409_100075645 Ga0307409_1000756452 265
576 3300032002 Ga0307416_100010309 Ga0307416_1000103095 265
577 3300032004 Ga0307414_10007653 Ga0307414_100076535 265
578 3300032126 Ga0307415_100007828 Ga0307415_1000078286 265
579 3300037466 Ga0395898_0216244 Ga0395898_0216244_345_1148 265
580 3300046664 Ga0495659_0092218 Ga0495659_0092218_246_1046 265
581 3300047318 Ga0495636_0105731 Ga0495636_0105731_213_1013 265
582 3300048906 Ga0496103_0089903 Ga0496103_0089903_652_1452 265
583 3300048909 Ga0496106_0415000 Ga0496106_0415000_178_978 265
584 3300050507 nmdc:mga05p37_184818_c1 nmdc:mga05p37_184818_c1_964_1761 265
585 3300050507 nmdc:mga05p37_282388_c1 nmdc:mga05p37_282388_c1_108_908 265
586 3300050507 nmdc:mga05p37_83593_c1 nmdc:mga05p37_83593_c1_3039_3839 265
587 3300050512 nmdc:mga0n895_203507_c1 nmdc:mga0n895_203507_c1_965_1765 265
588 3300050514 nmdc:mga08x19_193356_c1 nmdc:mga08x19_193356_c1_351_1154 265
589 3300059506 Ga0587085_005441 Ga0587085_005441_488_1291 265
590 3300059511 Ga0587091_037760 Ga0587091_037760_51_854 265
591 3300005289 Ga0065704_10007866 Ga0065704_100078664 266
592 3300005290 Ga0065712_10009957 Ga0065712_100099572 266
593 3300005290 Ga0065712_10073465 Ga0065712_100734654 266
594 3300005293 Ga0065715_10012000 Ga0065715_100120003 266
595 3300005293 Ga0065715_10091196 Ga0065715_100911968 266
596 3300005293 Ga0065715_10125544 Ga0065715_101255443 266
597 3300005293 Ga0065715_10129549 Ga0065715_101295493 266
598 3300005295 Ga0065707_10179265 Ga0065707_101792652 266
599 3300005328 Ga0070676_10061800 Ga0070676_100618002 266
600 3300005328 Ga0070676_10296667 Ga0070676_102966671 266
601 3300005330 Ga0070690_100001514 Ga0070690_10000151413 266
602 3300005330 Ga0070690_100079209 Ga0070690_1000792092 266
603 3300005330 Ga0070690_100158097 Ga0070690_1001580972 266
604 3300005330 Ga0070690_100593698 Ga0070690_1005936981 266
605 3300005331 Ga0070670_100128323 Ga0070670_1001283233 266
606 3300005331 Ga0070670_100153806 Ga0070670_1001538062 266
607 3300005331 Ga0070670_100318672 Ga0070670_1003186722 266
608 3300005334 Ga0068869_100048762 Ga0068869_1000487623 266
609 3300005334 Ga0068869_100077696 Ga0068869_1000776963 266
610 3300005334 Ga0068869_100211334 Ga0068869_1002113342 266
611 3300005335 Ga0070666_10009988 Ga0070666_100099886 266
612 3300005335 Ga0070666_10151870 Ga0070666_101518702 266
613 3300005336 Ga0070680_100083439 Ga0070680_1000834393 266
614 3300005337 Ga0070682_100000658 Ga0070682_10000065815 266
615 3300005338 Ga0068868_100068046 Ga0068868_1000680462 266
616 3300005338 Ga0068868_100180895 Ga0068868_1001808952 266
617 3300005340 Ga0070689_100017912 Ga0070689_1000179121 266
618 3300005340 Ga0070689_100035344 Ga0070689_1000353444 266
619 3300005340 Ga0070689_100063329 Ga0070689_1000633293 266
620 3300005343 Ga0070687_100106748 Ga0070687_1001067481 266
621 3300005343 Ga0070687_100179835 Ga0070687_1001798352 266
622 3300005345 Ga0070692_10152614 Ga0070692_101526142 266
623 3300005345 Ga0070692_10226599 Ga0070692_102265991 266
624 3300005345 Ga0070692_10233098 Ga0070692_102330981 266
625 3300005353 Ga0070669_100030178 Ga0070669_1000301786 266
626 3300005353 Ga0070669_100061319 Ga0070669_1000613194 266
627 3300005353 Ga0070669_100145666 Ga0070669_1001456661 266
628 3300005354 Ga0070675_100077534 Ga0070675_1000775342 266
629 3300005355 Ga0070671_100170372 Ga0070671_1001703722 266
630 3300005356 Ga0070674_100116112 Ga0070674_1001161123 266
631 3300005356 Ga0070674_100190414 Ga0070674_1001904141 266
632 3300005364 Ga0070673_100043302 Ga0070673_1000433024 266
633 3300005364 Ga0070673_100077183 Ga0070673_1000771832 266
634 3300005364 Ga0070673_100081737 Ga0070673_1000817373 266
635 3300005364 Ga0070673_100084407 Ga0070673_1000844072 266
636 3300005364 Ga0070673_100246507 Ga0070673_1002465072 266
637 3300005364 Ga0070673_100250396 Ga0070673_1002503962 266
638 3300005365 Ga0070688_100044481 Ga0070688_1000444812 266
639 3300005367 Ga0070667_100420358 Ga0070667_1004203581 266
640 3300005438 Ga0070701_10045910 Ga0070701_100459103 266
641 3300005438 Ga0070701_10349716 Ga0070701_103497161 266
642 3300005440 Ga0070705_100013030 Ga0070705_1000130302 266
643 3300005440 Ga0070705_100014024 Ga0070705_1000140244 266
644 3300005440 Ga0070705_100201943 Ga0070705_1002019431 266
645 3300005441 Ga0070700_100010579 Ga0070700_1000105792 266
646 3300005441 Ga0070700_100120895 Ga0070700_1001208951 266
647 3300005441 Ga0070700_100157375 Ga0070700_1001573752 266
648 3300005444 Ga0070694_100017204 Ga0070694_1000172042 266
649 3300005444 Ga0070694_100092269 Ga0070694_1000922693 266
650 3300005444 Ga0070694_100221294 Ga0070694_1002212942 266
651 3300005444 Ga0070694_100276359 Ga0070694_1002763591 266
652 3300005445 Ga0070708_100000337 Ga0070708_10000033719 266
653 3300005456 Ga0070678_100047848 Ga0070678_1000478483 266
654 3300005456 Ga0070678_100236270 Ga0070678_1002362702 266
655 3300005457 Ga0070662_100150379 Ga0070662_1001503792 266
656 3300005458 Ga0070681_10001081 Ga0070681_100010818 266
657 3300005458 Ga0070681_10054385 Ga0070681_100543855 266
658 3300005459 Ga0068867_100034591 Ga0068867_1000345912 266
659 3300005459 Ga0068867_100042795 Ga0068867_1000427953 266
660 3300005459 Ga0068867_100101133 Ga0068867_1001011332 266
661 3300005466 Ga0070685_10305426 Ga0070685_103054261 266
662 3300005467 Ga0070706_100000017 Ga0070706_10000001768 266
663 3300005467 Ga0070706_100012259 Ga0070706_1000122593 266
664 3300005467 Ga0070706_100028645 Ga0070706_1000286456 266
665 3300005467 Ga0070706_100488454 Ga0070706_1004884541 266
666 3300005468 Ga0070707_100145430 Ga0070707_1001454301 266
667 3300005471 Ga0070698_100004605 Ga0070698_10000460513 266
668 3300005471 Ga0070698_100018834 Ga0070698_1000188348 266
669 3300005471 Ga0070698_100045775 Ga0070698_1000457753 266
670 3300005471 Ga0070698_100172267 Ga0070698_1001722672 266
671 3300005518 Ga0070699_100006275 Ga0070699_1000062759 266
672 3300005518 Ga0070699_100007202 Ga0070699_10000720211 266
673 3300005536 Ga0070697_100000062 Ga0070697_10000006214 266
674 3300005536 Ga0070697_100001572 Ga0070697_1000015726 266
675 3300005536 Ga0070697_100102947 Ga0070697_1001029473 266
676 3300005536 Ga0070697_100122249 Ga0070697_1001222492 266
677 3300005536 Ga0070697_100170156 Ga0070697_1001701561 266
678 3300005539 Ga0068853_100313516 Ga0068853_1003135162 266
679 3300005543 Ga0070672_100003235 Ga0070672_10000323512 266
680 3300005543 Ga0070672_100255342 Ga0070672_1002553421 266
681 3300005543 Ga0070672_100327472 Ga0070672_1003274722 266
682 3300005544 Ga0070686_100002174 Ga0070686_10000217410 266
683 3300005545 Ga0070695_100013916 Ga0070695_1000139163 266
684 3300005545 Ga0070695_100098211 Ga0070695_1000982111 266
685 3300005545 Ga0070695_100134121 Ga0070695_1001341213 266
686 3300005545 Ga0070695_100162909 Ga0070695_1001629092 266
687 3300005545 Ga0070695_100355392 Ga0070695_1003553921 266
688 3300005546 Ga0070696_100028469 Ga0070696_1000284694 266
689 3300005547 Ga0070693_100040645 Ga0070693_1000406452 266
690 3300005548 Ga0070665_100267008 Ga0070665_1002670082 266
691 3300005549 Ga0070704_100041854 Ga0070704_1000418541 266
692 3300005549 Ga0070704_100228050 Ga0070704_1002280502 266
693 3300005549 Ga0070704_100527065 Ga0070704_1005270651 266
694 3300005564 Ga0070664_100073910 Ga0070664_1000739103 266
695 3300005564 Ga0070664_100089390 Ga0070664_1000893904 266
696 3300005564 Ga0070664_100373174 Ga0070664_1003731741 266
697 3300005577 Ga0068857_100096441 Ga0068857_1000964412 266
698 3300005577 Ga0068857_100259806 Ga0068857_1002598063 266
699 3300005578 Ga0068854_100039135 Ga0068854_1000391352 266
700 3300005614 Ga0068856_100339979 Ga0068856_1003399792 266
701 3300005615 Ga0070702_100020950 Ga0070702_1000209502 266
702 3300005615 Ga0070702_100052042 Ga0070702_1000520422 266
703 3300005615 Ga0070702_100063007 Ga0070702_1000630073 266
704 3300005615 Ga0070702_100183017 Ga0070702_1001830172 266
705 3300005616 Ga0068852_100129712 Ga0068852_1001297123 266
706 3300005616 Ga0068852_100318997 Ga0068852_1003189971 266
707 3300005617 Ga0068859_100006661 Ga0068859_1000066618 266
708 3300005617 Ga0068859_100009613 Ga0068859_1000096135 266
709 3300005617 Ga0068859_100063364 Ga0068859_1000633644 266
710 3300005617 Ga0068859_100205079 Ga0068859_1002050792 266
711 3300005617 Ga0068859_100235025 Ga0068859_1002350253 266
712 3300005618 Ga0068864_100054098 Ga0068864_1000540984 266
713 3300005618 Ga0068864_100871270 Ga0068864_1008712701 266
714 3300005718 Ga0068866_10045935 Ga0068866_100459352 266
715 3300005718 Ga0068866_10079744 Ga0068866_100797442 266
716 3300005719 Ga0068861_100004194 Ga0068861_1000041949 266
717 3300005719 Ga0068861_100151057 Ga0068861_1001510572 266
718 3300005719 Ga0068861_100218202 Ga0068861_1002182022 266
719 3300005719 Ga0068861_100332914 Ga0068861_1003329142 266
720 3300005840 Ga0068870_10054718 Ga0068870_100547182 266
721 3300005840 Ga0068870_10107101 Ga0068870_101071012 266
722 3300005840 Ga0068870_10188650 Ga0068870_101886501 266
723 3300005841 Ga0068863_100075227 Ga0068863_1000752274 266
724 3300005841 Ga0068863_100112035 Ga0068863_1001120353 266
725 3300005841 Ga0068863_100167444 Ga0068863_1001674443 266
726 3300005841 Ga0068863_100213033 Ga0068863_1002130332 266
727 3300005841 Ga0068863_100223750 Ga0068863_1002237502 266
728 3300005841 Ga0068863_100399332 Ga0068863_1003993322 266
729 3300005842 Ga0068858_100020307 Ga0068858_1000203078 266
730 3300005842 Ga0068858_100062270 Ga0068858_1000622704 266
731 3300005842 Ga0068858_100070049 Ga0068858_1000700493 266
732 3300005843 Ga0068860_100067260 Ga0068860_1000672604 266
733 3300005843 Ga0068860_100095228 Ga0068860_1000952283 266
734 3300005843 Ga0068860_100124757 Ga0068860_1001247573 266
735 3300005843 Ga0068860_100186267 Ga0068860_1001862672 266
736 3300005843 Ga0068860_100332402 Ga0068860_1003324022 266
737 3300005844 Ga0068862_100036312 Ga0068862_1000363126 266
738 3300005844 Ga0068862_100073581 Ga0068862_1000735815 266
739 3300005844 Ga0068862_100132035 Ga0068862_1001320352 266
740 3300005844 Ga0068862_100223692 Ga0068862_1002236922 266
741 3300005844 Ga0068862_100256870 Ga0068862_1002568702 266
742 3300006237 Ga0097621_100008542 Ga0097621_1000085428 266
743 3300006237 Ga0097621_100167622 Ga0097621_1001676222 266
744 3300006237 Ga0097621_100320459 Ga0097621_1003204591 266
745 3300006358 Ga0068871_100031414 Ga0068871_1000314142 266
746 3300006358 Ga0068871_100185048 Ga0068871_1001850482 266
747 3300006844 Ga0075428_100085023 Ga0075428_1000850232 266
748 3300006844 Ga0075428_100369112 Ga0075428_1003691122 266
749 3300006844 Ga0075428_100555117 Ga0075428_1005551172 266
750 3300006846 Ga0075430_100066558 Ga0075430_1000665582 266
751 3300006847 Ga0075431_100094063 Ga0075431_1000940633 266
752 3300006852 Ga0075433_10056566 Ga0075433_100565663 266
753 3300006852 Ga0075433_10171185 Ga0075433_101711853 266
754 3300006852 Ga0075433_10394577 Ga0075433_103945771 266
755 3300006871 Ga0075434_100087715 Ga0075434_1000877152 266
756 3300006871 Ga0075434_100091846 Ga0075434_1000918462 266
757 3300006880 Ga0075429_100024483 Ga0075429_1000244833 266
758 3300006880 Ga0075429_100386165 Ga0075429_1003861652 266
759 3300006881 Ga0068865_100048889 Ga0068865_1000488892 266
760 3300006931 Ga0097620_100006661 Ga0097620_1000066618 266
761 3300006931 Ga0097620_100009613 Ga0097620_1000096135 266
762 3300006931 Ga0097620_100063365 Ga0097620_1000633654 266
763 3300006931 Ga0097620_100205064 Ga0097620_1002050642 266
764 3300006931 Ga0097620_100235042 Ga0097620_1002350423 266
765 3300007076 Ga0075435_100238966 Ga0075435_1002389661 266
766 3300007076 Ga0075435_100553886 Ga0075435_1005538861 266
767 3300009093 Ga0105240_10199958 Ga0105240_101999582 266
768 3300009147 Ga0114129_10051841 Ga0114129_100518418 266
769 3300009147 Ga0114129_10066340 Ga0114129_100663405 266
770 3300009147 Ga0114129_10286870 Ga0114129_102868703 266
771 3300009147 Ga0114129_10911613 Ga0114129_109116131 266
772 3300009174 Ga0105241_10109925 Ga0105241_101099251 266
773 3300009176 Ga0105242_10062185 Ga0105242_100621853 266
774 3300009177 Ga0105248_10007251 Ga0105248_100072519 266
775 3300009553 Ga0105249_10194020 Ga0105249_101940202 266
776 3300013307 Ga0157372_10012910 Ga0157372_100129104 266
777 3300013308 Ga0157375_10296720 Ga0157375_102967202 266
778 3300014326 Ga0157380_10017030 Ga0157380_100170301 266
779 3300014326 Ga0157380_10183100 Ga0157380_101831003 266
780 3300017792 Ga0163161_10032403 Ga0163161_100324034 266
781 3300025315 Ga0207697_10013752 Ga0207697_100137523 266
782 3300025900 Ga0207710_10006048 Ga0207710_100060482 266
783 3300025901 Ga0207688_10080312 Ga0207688_100803122 266
784 3300025903 Ga0207680_10106801 Ga0207680_101068012 266
785 3300025907 Ga0207645_10034311 Ga0207645_100343112 266
786 3300025907 Ga0207645_10104839 Ga0207645_101048391 266
787 3300025908 Ga0207643_10007213 Ga0207643_100072137 266
788 3300025908 Ga0207643_10044664 Ga0207643_100446642 266
789 3300025910 Ga0207684_10000079 Ga0207684_1000007923 266
790 3300025910 Ga0207684_10007353 Ga0207684_100073536 266
791 3300025910 Ga0207684_10116395 Ga0207684_101163952 266
792 3300025912 Ga0207707_10034115 Ga0207707_100341152 266
793 3300025912 Ga0207707_10046482 Ga0207707_100464825 266
794 3300025918 Ga0207662_10003190 Ga0207662_100031902 266
795 3300025918 Ga0207662_10017971 Ga0207662_100179714 266
796 3300025918 Ga0207662_10021969 Ga0207662_100219692 266
797 3300025920 Ga0207649_10441359 Ga0207649_104413591 266
798 3300025922 Ga0207646_10102864 Ga0207646_101028642 266
799 3300025922 Ga0207646_10174609 Ga0207646_101746092 266
800 3300025922 Ga0207646_10322797 Ga0207646_103227971 266
801 3300025922 Ga0207646_10396313 Ga0207646_103963132 266
802 3300025923 Ga0207681_10001745 Ga0207681_100017455 266
803 3300025923 Ga0207681_10005262 Ga0207681_100052626 266
804 3300025923 Ga0207681_10173897 Ga0207681_101738972 266
805 3300025925 Ga0207650_10008569 Ga0207650_100085697 266
806 3300025925 Ga0207650_10122387 Ga0207650_101223872 266
807 3300025925 Ga0207650_10283155 Ga0207650_102831552 266
808 3300025925 Ga0207650_10360810 Ga0207650_103608101 266
809 3300025926 Ga0207659_10059289 Ga0207659_100592892 266
810 3300025926 Ga0207659_10591353 Ga0207659_105913531 266
811 3300025931 Ga0207644_10164322 Ga0207644_101643222 266
812 3300025933 Ga0207706_10033906 Ga0207706_100339061 266
813 3300025934 Ga0207686_10033667 Ga0207686_100336672 266
814 3300025934 Ga0207686_10072162 Ga0207686_100721624 266
815 3300025934 Ga0207686_10277884 Ga0207686_102778841 266
816 3300025935 Ga0207709_10000921 Ga0207709_100009212 266
817 3300025935 Ga0207709_10037714 Ga0207709_100377143 266
818 3300025936 Ga0207670_10000250 Ga0207670_1000025011 266
819 3300025936 Ga0207670_10161749 Ga0207670_101617491 266
820 3300025937 Ga0207669_10110184 Ga0207669_101101841 266
821 3300025938 Ga0207704_10357412 Ga0207704_103574121 266
822 3300025939 Ga0207665_10112476 Ga0207665_101124761 266
823 3300025940 Ga0207691_10001421 Ga0207691_100014215 266
824 3300025940 Ga0207691_10207170 Ga0207691_102071702 266
825 3300025941 Ga0207711_10132721 Ga0207711_101327212 266
826 3300025941 Ga0207711_10159891 Ga0207711_101598912 266
827 3300025941 Ga0207711_10438171 Ga0207711_104381712 266
828 3300025942 Ga0207689_10019251 Ga0207689_100192515 266
829 3300025942 Ga0207689_10048605 Ga0207689_100486055 266
830 3300025942 Ga0207689_10257770 Ga0207689_102577703 266
831 3300025942 Ga0207689_10495372 Ga0207689_104953721 266
832 3300025942 Ga0207689_10510471 Ga0207689_105104711 266
833 3300025945 Ga0207679_10166511 Ga0207679_101665111 266
834 3300025945 Ga0207679_10170112 Ga0207679_101701122 266
835 3300025945 Ga0207679_10469627 Ga0207679_104696272 266
836 3300025960 Ga0207651_10055671 Ga0207651_100556713 266
837 3300025960 Ga0207651_10344551 Ga0207651_103445511 266
838 3300025960 Ga0207651_10380402 Ga0207651_103804021 266
839 3300025960 Ga0207651_10719418 Ga0207651_107194181 266
840 3300025960 Ga0207651_10728768 Ga0207651_107287681 266
841 3300025961 Ga0207712_10017134 Ga0207712_100171341 266
842 3300025961 Ga0207712_10033995 Ga0207712_100339952 266
843 3300025981 Ga0207640_10012393 Ga0207640_100123931 266
844 3300025981 Ga0207640_10457192 Ga0207640_104571921 266
845 3300025986 Ga0207658_10165555 Ga0207658_101655552 266
846 3300026023 Ga0207677_10099650 Ga0207677_100996502 266
847 3300026023 Ga0207677_10147209 Ga0207677_101472092 266
848 3300026035 Ga0207703_10016211 Ga0207703_100162116 266
849 3300026035 Ga0207703_10102323 Ga0207703_101023232 266
850 3300026075 Ga0207708_10024519 Ga0207708_100245194 266
851 3300026075 Ga0207708_10038708 Ga0207708_100387085 266
852 3300026075 Ga0207708_10097546 Ga0207708_100975462 266
853 3300026088 Ga0207641_10053400 Ga0207641_100534002 266
854 3300026088 Ga0207641_10066364 Ga0207641_100663643 266
855 3300026088 Ga0207641_10235805 Ga0207641_102358052 266
856 3300026088 Ga0207641_10402557 Ga0207641_104025572 266
857 3300026089 Ga0207648_10025398 Ga0207648_100253985 266
858 3300026089 Ga0207648_10052268 Ga0207648_100522682 266
859 3300026089 Ga0207648_10052499 Ga0207648_100524994 266
860 3300026095 Ga0207676_10003808 Ga0207676_1000380811 266
861 3300026095 Ga0207676_10057488 Ga0207676_100574883 266
862 3300026095 Ga0207676_10594110 Ga0207676_105941102 266
863 3300026116 Ga0207674_10033931 Ga0207674_100339315 266
864 3300026116 Ga0207674_10147004 Ga0207674_101470042 266
865 3300026116 Ga0207674_10429880 Ga0207674_104298802 266
866 3300026116 Ga0207674_10536449 Ga0207674_105364491 266
867 3300026116 Ga0207674_10738722 Ga0207674_107387221 266
868 3300026118 Ga0207675_100008300 Ga0207675_1000083009 266
869 3300026118 Ga0207675_100017343 Ga0207675_1000173433 266
870 3300026118 Ga0207675_100027734 Ga0207675_1000277343 266
871 3300026118 Ga0207675_100188276 Ga0207675_1001882761 266
872 3300026118 Ga0207675_100408669 Ga0207675_1004086692 266
873 3300026118 Ga0207675_100964185 Ga0207675_1009641851 266
874 3300026121 Ga0207683_10146154 Ga0207683_101461542 266
875 3300026121 Ga0207683_10263611 Ga0207683_102636112 266
876 3300026142 Ga0207698_10201010 Ga0207698_102010103 266
877 3300028379 Ga0268266_10330643 Ga0268266_103306431 266
878 3300028380 Ga0268265_10160070 Ga0268265_101600702 266
879 3300028380 Ga0268265_10166170 Ga0268265_101661702 266
880 3300028380 Ga0268265_10247986 Ga0268265_102479862 266
881 3300028380 Ga0268265_10429373 Ga0268265_104293731 266
882 3300028381 Ga0268264_10027695 Ga0268264_100276954 266
883 3300028381 Ga0268264_10049768 Ga0268264_100497684 266
884 3300028381 Ga0268264_10130419 Ga0268264_101304193 266
885 3300028381 Ga0268264_10157374 Ga0268264_101573742 266
886 3300031456 Ga0307513_10322989 Ga0307513_103229891 266
887 3300031548 Ga0307408_100042473 Ga0307408_1000424733 266
888 3300031901 Ga0307406_10186241 Ga0307406_101862412 266
889 3300031995 Ga0307409_100223084 Ga0307409_1002230842 266
890 3300037312 Ga0395899_0045268 Ga0395899_0045268_328_1128 266
891 3300037418 Ga0395900_0067377 Ga0395900_0067377_2673_3473 266
892 3300037418 Ga0395900_0218954 Ga0395900_0218954_863_1663 266
893 3300038996 Ga0242420_006840 Ga0242420_006840_679_1479 266
894 3300042439 Ga0439464_0064509 Ga0439464_0064509_51_854 266
895 3300046525 Ga0495663_0001444 Ga0495663_0001444_5258_6058 266
896 3300046537 Ga0495598_0009606 Ga0495598_0009606_1115_1915 266
897 3300046539 Ga0495621_0001077 Ga0495621_0001077_1894_2694 266
898 3300047318 Ga0495636_0155542 Ga0495636_0155542_185_985 266
899 3300048905 Ga0496102_0116640 Ga0496102_0116640_1213_2013 266
900 3300049515 Ga0501292_003124 Ga0501292_003124_760_1563 266
901 3300049522 Ga0501299_000754 Ga0501299_000754_2267_3070 266
902 3300049649 Ga0501198_001879 Ga0501198_001879_110_913 266
903 3300049652 Ga0501202_006175 Ga0501202_006175_489_1292 266
904 3300049655 Ga0501208_004930 Ga0501208_004930_633_1436 266
905 3300049661 Ga0501217_002052 Ga0501217_002052_2239_3042 266
906 3300049684 Ga0501255_004304 Ga0501255_004304_531_1334 266
907 3300049690 Ga0501261_006049 Ga0501261_006049_165_968 266
908 3300049707 Ga0501234_002153 Ga0501234_002153_750_1553 266
909 3300049770 Ga0501273_003589 Ga0501273_003589_472_1275 266
910 3300049775 Ga0501279_001951 Ga0501279_001951_40_843 266
911 3300049851 Ga0501212_003670 Ga0501212_003670_161_964 266
912 3300050507 nmdc:mga05p37_275258_c1 nmdc:mga05p37_275258_c1_881_1681 266
913 3300050512 nmdc:mga0n895_236459_c1 nmdc:mga0n895_236459_c1_251_1051 266
914 3300050513 nmdc:mga0rr50_301141_c1 nmdc:mga0rr50_301141_c1_339_1274 266
915 3300050515 nmdc:mga0a205_177434_c1 nmdc:mga0a205_177434_c1_973_1773 266
916 3300050515 nmdc:mga0a205_263263_c1 nmdc:mga0a205_263263_c1_197_997 266
917 2162886007 SwRhRL2b_contig_36198 SwRhRL2b_0769.00008800 267
918 3300002459 JGI24751J29686_10000009 JGI24751J29686_1000000948 267
919 3300003203 JGI25406J46586_10004348 JGI25406J46586_100043483 267
920 3300003316 rootH1_10128632 rootH1_101286321 267
921 3300005289 Ga0065704_10071538 Ga0065704_1007153811 267
922 3300005289 Ga0065704_10150712 Ga0065704_101507122 267
923 3300005293 Ga0065715_10018282 Ga0065715_100182823 267
924 3300005295 Ga0065707_10001225 Ga0065707_1000122510 267
925 3300005331 Ga0070670_100000088 Ga0070670_10000008825 267
926 3300005331 Ga0070670_100280649 Ga0070670_1002806491 267
927 3300005331 Ga0070670_100308186 Ga0070670_1003081862 267
928 3300005334 Ga0068869_100098505 Ga0068869_1000985052 267
929 3300005337 Ga0070682_100053546 Ga0070682_1000535463 267
930 3300005340 Ga0070689_100365267 Ga0070689_1003652671 267
931 3300005345 Ga0070692_10033025 Ga0070692_100330252 267
932 3300005353 Ga0070669_100037585 Ga0070669_1000375855 267
933 3300005364 Ga0070673_100107933 Ga0070673_1001079332 267
934 3300005458 Ga0070681_10466136 Ga0070681_104661361 267
935 3300005518 Ga0070699_100788077 Ga0070699_1007880771 267
936 3300005539 Ga0068853_100180300 Ga0068853_1001803001 267
937 3300005545 Ga0070695_100141653 Ga0070695_1001416531 267
938 3300005545 Ga0070695_100280149 Ga0070695_1002801492 267
939 3300005547 Ga0070693_100275582 Ga0070693_1002755822 267
940 3300005615 Ga0070702_100118173 Ga0070702_1001181732 267
941 3300005618 Ga0068864_100387108 Ga0068864_1003871081 267
942 3300005618 Ga0068864_100617330 Ga0068864_1006173301 267
943 3300005841 Ga0068863_100027299 Ga0068863_1000272997 267
944 3300005843 Ga0068860_100014175 Ga0068860_10001417510 267
945 3300005844 Ga0068862_100211958 Ga0068862_1002119582 267
946 3300005985 Ga0081539_10000408 Ga0081539_1000040885 267
947 3300006358 Ga0068871_100079208 Ga0068871_1000792082 267
948 3300006852 Ga0075433_10168759 Ga0075433_101687591 267
949 3300006871 Ga0075434_100363644 Ga0075434_1003636441 267
950 3300025315 Ga0207697_10077790 Ga0207697_100777901 267
951 3300025899 Ga0207642_10076213 Ga0207642_100762132 267
952 3300025920 Ga0207649_10196675 Ga0207649_101966752 267
953 3300025923 Ga0207681_10011079 Ga0207681_100110795 267
954 3300025924 Ga0207694_10020544 Ga0207694_100205445 267
955 3300025925 Ga0207650_10000001 Ga0207650_10000001217 267
956 3300025931 Ga0207644_10224378 Ga0207644_102243782 267
957 3300025934 Ga0207686_10074054 Ga0207686_100740543 267
958 3300025936 Ga0207670_10060445 Ga0207670_100604453 267
959 3300025936 Ga0207670_10469109 Ga0207670_104691092 267
960 3300025941 Ga0207711_10359566 Ga0207711_103595662 267
961 3300025941 Ga0207711_10542011 Ga0207711_105420112 267
962 3300025941 Ga0207711_10654226 Ga0207711_106542261 267
963 3300025945 Ga0207679_10487633 Ga0207679_104876331 267
964 3300025961 Ga0207712_10005189 Ga0207712_100051899 267
965 3300026035 Ga0207703_10103548 Ga0207703_101035482 267
966 3300027907 Ga0207428_10003589 Ga0207428_1000358910 267
967 3300028381 Ga0268264_10317595 Ga0268264_103175952 267
968 3300028381 Ga0268264_10620847 Ga0268264_106208472 267
969 3300050511 nmdc:mga08y16_3905_c1 nmdc:mga08y16_3905_c1_7895_8698 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

103

309

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u3f-assembly2.cif.gz_B structural basis for the interaction of pyk2 pat domain with paxillin ld motifs 0.4188 125 258
2b0h-assembly1.cif.gz_A solution structure of vbs3 fragment of talin 0.4055 96 260
1ktm-assembly1.cif.gz_A solution structure of fat domain of focal adhesion kinase 0.4009 130 256
4xev-assembly1.cif.gz_A fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide 0.3976 123 261
2b0h-assembly1.cif.gz_A solution structure of vbs3 fragment of talin 0.3949 96 260
ID Description Score Start End Superfamily
af_F1Q930_116_353_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5347 4 257 1.20.1070.10
af_A0A0G2KYS3_6_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5086 165 258 1.20.140.150
af_A0A0R4IN71_16_196_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.475 161 256 1.20.140.150
af_Q2QZT1_1_211_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4735 12 261 1.20.120.550
af_Q555E4_30_180_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4648 48 256 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A3B9MGY2-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9586 25 267 GO:0016020
AF-A0A3B9MGY2-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9547 25 267 GO:0016020
AF-A0A2V8QIU2-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9513 7 267 GO:0016020
AF-A0A7Z9UY01-F1-model_v4 Antitermination protein NusG 0.9443 29 95 GO:0016020
AF-A0A2V8PQ44-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9302 1 266 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.27 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map