F487044
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 968 | 307 | 1936 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300025900|Ga0207710_10346638|Ga0207710_103466381 |
| Length | 142 |
| Sequence | MDLLDHVAARIKDLRVNYNHGEGLSQESLATHLKVAPNTISRWETGTYRPGLKDMERLSRFFGVSINSFFPSEALDGDEDENLKALLRTARQLHPADVEELRKYAEFRRARRQRLAHTDAADAGSHHALFPGPRPMPRPHRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 171 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 172 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 200 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 203 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 204 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 208 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 209 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 220 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 221 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 224 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 226 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 227 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 228 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 236 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 238 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 239 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 240 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 241 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 242 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 243 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 244 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 245 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 246 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 250 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 251 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 256 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 259 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 260 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 261 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 262 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 263 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 266 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 267 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 268 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 269 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 273 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 274 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 276 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 278 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 279 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 280 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 281 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 282 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 283 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 284 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 287 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 288 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 289 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 290 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 291 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 292 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 294 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 295 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 296 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.76 |
| Rhizosphere | 98.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207710_10346638 | 3300025900 | Unclassified | 756 |
| 2 | SwRhRL2b_contig_1124966 | 2162886007 | Unclassified | 959 |
| 3 | SwRhRL2b_contig_3276766 | 2162886007 | Bacteria | 3647 |
| 4 | JGI24737J22298_10100234 | 3300001990 | Bacteria | 858 |
| 5 | JGI24751J29686_10000019 | 3300002459 | Bacteria | 107056 |
| 6 | JGI25406J46586_10024476 | 3300003203 | Bacteria | 2364 |
| 7 | JGI25406J46586_10232999 | 3300003203 | Bacteria | 539 |
| 8 | rootL2_10075506 | 3300003322 | Unclassified | 1461 |
| 9 | Ga0065714_10028113 | 3300005288 | Bacteria | 999 |
| 10 | Ga0065714_10064440 | 3300005288 | Bacteria | 109986 |
| 11 | Ga0065704_10015615 | 3300005289 | Bacteria | 2038 |
| 12 | Ga0065704_10074009 | 3300005289 | Bacteria | 6601 |
| 13 | Ga0065704_10383613 | 3300005289 | Unclassified | 715 |
| 14 | Ga0065704_10467398 | 3300005289 | Bacteria | 692 |
| 15 | Ga0065704_10608295 | 3300005289 | Unclassified | 581 |
| 16 | Ga0065704_10614424 | 3300005289 | Bacteria | 600 |
| 17 | Ga0065712_10000120 | 3300005290 | Bacteria | 105792 |
| 18 | Ga0065712_10036024 | 3300005290 | Bacteria | 2163 |
| 19 | Ga0065712_10073666 | 3300005290 | Bacteria | 4311 |
| 20 | Ga0065712_10101862 | 3300005290 | Bacteria | 2014 |
| 21 | Ga0065712_10212885 | 3300005290 | Bacteria | 1067 |
| 22 | Ga0065712_10251327 | 3300005290 | Bacteria | 950 |
| 23 | Ga0065715_10012328 | 3300005293 | Bacteria | 3761 |
| 24 | Ga0065715_10023030 | 3300005293 | Unclassified | 1461 |
| 25 | Ga0065715_10091252 | 3300005293 | Bacteria | 5950 |
| 26 | Ga0065715_10107064 | 3300005293 | Bacteria | 2792 |
| 27 | Ga0065715_10140086 | 3300005293 | Bacteria | 1867 |
| 28 | Ga0065715_10195369 | 3300005293 | Bacteria | 1391 |
| 29 | Ga0065715_10275215 | 3300005293 | Bacteria | 1100 |
| 30 | Ga0065715_10363844 | 3300005293 | Unclassified | 931 |
| 31 | Ga0065715_10400984 | 3300005293 | Bacteria | 863 |
| 32 | Ga0065715_10996345 | 3300005293 | Unclassified | 523 |
| 33 | Ga0065707_10001216 | 3300005295 | Bacteria | 9538 |
| 34 | Ga0065707_10008227 | 3300005295 | Bacteria | 2206 |
| 35 | Ga0065707_10575269 | 3300005295 | Bacteria | 698 |
| 36 | Ga0065707_10892237 | 3300005295 | Bacteria | 569 |
| 37 | Ga0070683_100803157 | 3300005329 | Unclassified | 902 |
| 38 | Ga0070683_100945892 | 3300005329 | Unclassified | 827 |
| 39 | Ga0070690_100160272 | 3300005330 | Unclassified | 1541 |
| 40 | Ga0070670_100000346 | 3300005331 | Bacteria | 38929 |
| 41 | Ga0070670_100148222 | 3300005331 | Unclassified | 2030 |
| 42 | Ga0070670_100198125 | 3300005331 | Bacteria | 1745 |
| 43 | Ga0070670_100343500 | 3300005331 | Unclassified | 1310 |
| 44 | Ga0070670_101441294 | 3300005331 | Bacteria | 632 |
| 45 | Ga0070677_10298690 | 3300005333 | Bacteria | 817 |
| 46 | Ga0068869_100199359 | 3300005334 | Unclassified | 1577 |
| 47 | Ga0068869_100206140 | 3300005334 | Unclassified | 1552 |
| 48 | Ga0068869_100224270 | 3300005334 | Unclassified | 1491 |
| 49 | Ga0068869_100226299 | 3300005334 | Unclassified | 1484 |
| 50 | Ga0068869_100282272 | 3300005334 | Unclassified | 1336 |
| 51 | Ga0068869_100642531 | 3300005334 | Unclassified | 900 |
| 52 | Ga0068869_100739313 | 3300005334 | Unclassified | 841 |
| 53 | Ga0068869_100789054 | 3300005334 | Bacteria | 816 |
| 54 | Ga0068869_101440261 | 3300005334 | Bacteria | 610 |
| 55 | Ga0070680_100281067 | 3300005336 | Bacteria | 1410 |
| 56 | Ga0070680_100606083 | 3300005336 | Unclassified | 940 |
| 57 | Ga0070682_100001127 | 3300005337 | Bacteria | 15255 |
| 58 | Ga0070682_100002771 | 3300005337 | Bacteria | 9703 |
| 59 | Ga0070682_100481180 | 3300005337 | Unclassified | 958 |
| 60 | Ga0068868_100339447 | 3300005338 | Bacteria | 1284 |
| 61 | Ga0068868_100805469 | 3300005338 | Bacteria | 848 |
| 62 | Ga0070689_100000044 | 3300005340 | Bacteria | 76920 |
| 63 | Ga0070689_101116892 | 3300005340 | Unclassified | 705 |
| 64 | Ga0070691_10106190 | 3300005341 | Bacteria | 1400 |
| 65 | Ga0070687_100103136 | 3300005343 | Unclassified | 1601 |
| 66 | Ga0070687_100394599 | 3300005343 | Unclassified | 905 |
| 67 | Ga0070687_100527385 | 3300005343 | Unclassified | 800 |
| 68 | Ga0070687_101051527 | 3300005343 | Bacteria | 593 |
| 69 | Ga0070661_100534659 | 3300005344 | Unclassified | 942 |
| 70 | Ga0070661_100589647 | 3300005344 | Unclassified | 898 |
| 71 | Ga0070661_100664141 | 3300005344 | Unclassified | 847 |
| 72 | Ga0070692_10110613 | 3300005345 | Bacteria | 1519 |
| 73 | Ga0070692_10199863 | 3300005345 | Bacteria | 1170 |
| 74 | Ga0070692_10903215 | 3300005345 | Unclassified | 611 |
| 75 | Ga0070669_100063784 | 3300005353 | Bacteria | 2712 |
| 76 | Ga0070669_100360586 | 3300005353 | Unclassified | 1182 |
| 77 | Ga0070669_101279372 | 3300005353 | Unclassified | 635 |
| 78 | Ga0070675_100219303 | 3300005354 | Bacteria | 1656 |
| 79 | Ga0070675_100333294 | 3300005354 | Bacteria | 1343 |
| 80 | Ga0070673_100189065 | 3300005364 | Bacteria | 1767 |
| 81 | Ga0070673_100586563 | 3300005364 | Bacteria | 1015 |
| 82 | Ga0070673_100623107 | 3300005364 | Unclassified | 985 |
| 83 | Ga0070673_101184016 | 3300005364 | Unclassified | 716 |
| 84 | Ga0070688_100235639 | 3300005365 | Bacteria | 1297 |
| 85 | Ga0070688_100459069 | 3300005365 | Unclassified | 954 |
| 86 | Ga0070659_100911218 | 3300005366 | Unclassified | 769 |
| 87 | Ga0070703_10004025 | 3300005406 | Unclassified | 4155 |
| 88 | Ga0070703_10382669 | 3300005406 | Unclassified | 608 |
| 89 | Ga0070701_10134677 | 3300005438 | Bacteria | 1407 |
| 90 | Ga0070701_10149871 | 3300005438 | Bacteria | 1342 |
| 91 | Ga0070701_10260345 | 3300005438 | Bacteria | 1051 |
| 92 | Ga0070701_10272710 | 3300005438 | Unclassified | 1030 |
| 93 | Ga0070705_100003873 | 3300005440 | Bacteria | 7317 |
| 94 | Ga0070705_100019681 | 3300005440 | Bacteria | 3557 |
| 95 | Ga0070705_100071739 | 3300005440 | Bacteria | 2095 |
| 96 | Ga0070705_100117920 | 3300005440 | Bacteria | 1708 |
| 97 | Ga0070705_100539883 | 3300005440 | Unclassified | 892 |
| 98 | Ga0070700_100000125 | 3300005441 | Bacteria | 46684 |
| 99 | Ga0070700_100018353 | 3300005441 | Bacteria | 4021 |
| 100 | Ga0070700_100028526 | 3300005441 | Bacteria | 3321 |
| 101 | Ga0070700_100266213 | 3300005441 | Bacteria | 1236 |
| 102 | Ga0070700_100349402 | 3300005441 | Bacteria | 1096 |
| 103 | Ga0070700_100349497 | 3300005441 | Bacteria | 1096 |
| 104 | Ga0070694_100034035 | 3300005444 | Bacteria | 3358 |
| 105 | Ga0070694_100059546 | 3300005444 | Bacteria | 2601 |
| 106 | Ga0070694_100173294 | 3300005444 | Unclassified | 1591 |
| 107 | Ga0070694_100258185 | 3300005444 | Bacteria | 1321 |
| 108 | Ga0070694_100569866 | 3300005444 | Bacteria | 909 |
| 109 | Ga0070694_100766803 | 3300005444 | Unclassified | 789 |
| 110 | Ga0070708_100779372 | 3300005445 | Unclassified | 899 |
| 111 | Ga0070678_100097754 | 3300005456 | Bacteria | 2268 |
| 112 | Ga0070678_100289489 | 3300005456 | Bacteria | 1388 |
| 113 | Ga0070662_100022249 | 3300005457 | Bacteria | 4337 |
| 114 | Ga0070681_10003957 | 3300005458 | Bacteria | 13968 |
| 115 | Ga0070681_10136690 | 3300005458 | Bacteria | 2381 |
| 116 | Ga0070681_10496249 | 3300005458 | Bacteria | 1134 |
| 117 | Ga0070681_11826302 | 3300005458 | Unclassified | 535 |
| 118 | Ga0068867_100078052 | 3300005459 | Bacteria | 2490 |
| 119 | Ga0068867_100166503 | 3300005459 | Unclassified | 1742 |
| 120 | Ga0068867_100870548 | 3300005459 | Unclassified | 809 |
| 121 | Ga0070685_10555776 | 3300005466 | Unclassified | 820 |
| 122 | Ga0070685_10842882 | 3300005466 | Unclassified | 679 |
| 123 | Ga0070706_100000023 | 3300005467 | Bacteria | 159966 |
| 124 | Ga0070706_100447585 | 3300005467 | Bacteria | 1202 |
| 125 | Ga0070707_101604091 | 3300005468 | Unclassified | 618 |
| 126 | Ga0070698_100050650 | 3300005471 | Bacteria | 4232 |
| 127 | Ga0070698_100067587 | 3300005471 | Bacteria | 3593 |
| 128 | Ga0070699_100041196 | 3300005518 | Unclassified | 3998 |
| 129 | Ga0070699_100056039 | 3300005518 | Bacteria | 3413 |
| 130 | Ga0070699_100391197 | 3300005518 | Bacteria | 1256 |
| 131 | Ga0070679_100597419 | 3300005530 | Unclassified | 1047 |
| 132 | Ga0070679_100880406 | 3300005530 | Unclassified | 839 |
| 133 | Ga0070679_100987123 | 3300005530 | Bacteria | 786 |
| 134 | Ga0070697_100432860 | 3300005536 | Bacteria | 1144 |
| 135 | Ga0070697_100504831 | 3300005536 | Bacteria | 1058 |
| 136 | Ga0070697_100890790 | 3300005536 | Unclassified | 789 |
| 137 | Ga0070697_101679883 | 3300005536 | Unclassified | 568 |
| 138 | Ga0068853_100013781 | 3300005539 | Bacteria | 6605 |
| 139 | Ga0068853_100676114 | 3300005539 | Unclassified | 983 |
| 140 | Ga0068853_101322753 | 3300005539 | Unclassified | 696 |
| 141 | Ga0070672_100180546 | 3300005543 | Unclassified | 1759 |
| 142 | Ga0070672_100396513 | 3300005543 | Unclassified | 1182 |
| 143 | Ga0070686_100313842 | 3300005544 | Bacteria | 1167 |
| 144 | Ga0070695_100039347 | 3300005545 | Bacteria | 2989 |
| 145 | Ga0070695_100044915 | 3300005545 | Unclassified | 2815 |
| 146 | Ga0070695_100066712 | 3300005545 | Unclassified | 2346 |
| 147 | Ga0070695_100186141 | 3300005545 | Bacteria | 1475 |
| 148 | Ga0070695_100194280 | 3300005545 | Bacteria | 1446 |
| 149 | Ga0070695_100255941 | 3300005545 | Bacteria | 1276 |
| 150 | Ga0070695_100267086 | 3300005545 | Bacteria | 1252 |
| 151 | Ga0070695_100309997 | 3300005545 | Bacteria | 1170 |
| 152 | Ga0070695_100501393 | 3300005545 | Bacteria | 939 |
| 153 | Ga0070695_100813042 | 3300005545 | Bacteria | 750 |
| 154 | Ga0070696_100049945 | 3300005546 | Bacteria | 2906 |
| 155 | Ga0070696_100149979 | 3300005546 | Bacteria | 1710 |
| 156 | Ga0070696_100268401 | 3300005546 | Bacteria | 1297 |
| 157 | Ga0070696_100279213 | 3300005546 | Bacteria | 1273 |
| 158 | Ga0070696_100455879 | 3300005546 | Unclassified | 1010 |
| 159 | Ga0070696_100699564 | 3300005546 | Bacteria | 826 |
| 160 | Ga0070696_100787870 | 3300005546 | Unclassified | 782 |
| 161 | Ga0070696_101576540 | 3300005546 | Unclassified | 564 |
| 162 | Ga0070693_100002115 | 3300005547 | Bacteria | 9093 |
| 163 | Ga0070693_100010152 | 3300005547 | Bacteria | 4707 |
| 164 | Ga0070693_100102297 | 3300005547 | Unclassified | 1747 |
| 165 | Ga0070693_100110154 | 3300005547 | Bacteria | 1693 |
| 166 | Ga0070693_100143052 | 3300005547 | Bacteria | 1508 |
| 167 | Ga0070693_100175281 | 3300005547 | Bacteria | 1376 |
| 168 | Ga0070693_100196021 | 3300005547 | Bacteria | 1309 |
| 169 | Ga0070693_100246651 | 3300005547 | Bacteria | 1182 |
| 170 | Ga0070693_100268671 | 3300005547 | Bacteria | 1137 |
| 171 | Ga0070693_100300001 | 3300005547 | Unclassified | 1083 |
| 172 | Ga0070704_100037087 | 3300005549 | Bacteria | 3327 |
| 173 | Ga0070704_100041111 | 3300005549 | Unclassified | 3189 |
| 174 | Ga0070704_100054561 | 3300005549 | Unclassified | 2828 |
| 175 | Ga0070704_100078819 | 3300005549 | Bacteria | 2418 |
| 176 | Ga0070704_100266615 | 3300005549 | Bacteria | 1413 |
| 177 | Ga0070704_100674464 | 3300005549 | Unclassified | 914 |
| 178 | Ga0070704_101394970 | 3300005549 | Unclassified | 643 |
| 179 | Ga0068855_100551379 | 3300005563 | Bacteria | 1248 |
| 180 | Ga0068855_100725061 | 3300005563 | Bacteria | 1062 |
| 181 | Ga0068855_100726442 | 3300005563 | Bacteria | 1061 |
| 182 | Ga0068855_101093209 | 3300005563 | Unclassified | 834 |
| 183 | Ga0070664_100264479 | 3300005564 | Bacteria | 1548 |
| 184 | Ga0070664_100322560 | 3300005564 | Bacteria | 1400 |
| 185 | Ga0070664_100441668 | 3300005564 | Bacteria | 1193 |
| 186 | Ga0070664_100539897 | 3300005564 | Bacteria | 1078 |
| 187 | Ga0070664_100736540 | 3300005564 | Bacteria | 920 |
| 188 | Ga0068857_100054622 | 3300005577 | Bacteria | 3544 |
| 189 | Ga0068857_100353659 | 3300005577 | Bacteria | 1361 |
| 190 | Ga0068857_100394831 | 3300005577 | Bacteria | 1286 |
| 191 | Ga0068857_100419777 | 3300005577 | Unclassified | 1247 |
| 192 | Ga0068857_100478377 | 3300005577 | Bacteria | 1167 |
| 193 | Ga0068857_101350599 | 3300005577 | Bacteria | 693 |
| 194 | Ga0068857_102039674 | 3300005577 | Unclassified | 563 |
| 195 | Ga0068854_100057865 | 3300005578 | Bacteria | 2797 |
| 196 | Ga0068854_100310574 | 3300005578 | Bacteria | 1278 |
| 197 | Ga0068854_100361376 | 3300005578 | Bacteria | 1191 |
| 198 | Ga0068854_100489336 | 3300005578 | Bacteria | 1034 |
| 199 | Ga0068854_100499931 | 3300005578 | Bacteria | 1024 |
| 200 | Ga0068854_101022609 | 3300005578 | Unclassified | 733 |
| 201 | Ga0068856_101476969 | 3300005614 | Bacteria | 694 |
| 202 | Ga0070702_100018928 | 3300005615 | Bacteria | 3580 |
| 203 | Ga0070702_100022971 | 3300005615 | Bacteria | 3307 |
| 204 | Ga0070702_100035209 | 3300005615 | Bacteria | 2765 |
| 205 | Ga0070702_100122415 | 3300005615 | Bacteria | 1630 |
| 206 | Ga0070702_100270011 | 3300005615 | Bacteria | 1162 |
| 207 | Ga0070702_100749365 | 3300005615 | Unclassified | 750 |
| 208 | Ga0068852_100039203 | 3300005616 | Unclassified | 3988 |
| 209 | Ga0068852_100291188 | 3300005616 | Bacteria | 1577 |
| 210 | Ga0068852_100387216 | 3300005616 | Bacteria | 1373 |
| 211 | Ga0068852_101657042 | 3300005616 | Unclassified | 662 |
| 212 | Ga0068859_100015015 | 3300005617 | Bacteria | 7774 |
| 213 | Ga0068859_100022720 | 3300005617 | Bacteria | 6289 |
| 214 | Ga0068859_100073575 | 3300005617 | Bacteria | 3455 |
| 215 | Ga0068859_100080338 | 3300005617 | Bacteria | 3302 |
| 216 | Ga0068859_100089077 | 3300005617 | Unclassified | 3136 |
| 217 | Ga0068859_100109980 | 3300005617 | Bacteria | 2817 |
| 218 | Ga0068859_100134085 | 3300005617 | Unclassified | 2548 |
| 219 | Ga0068859_100164410 | 3300005617 | Bacteria | 2298 |
| 220 | Ga0068859_100189562 | 3300005617 | Bacteria | 2140 |
| 221 | Ga0068859_100278784 | 3300005617 | Bacteria | 1764 |
| 222 | Ga0068859_100465154 | 3300005617 | Unclassified | 1360 |
| 223 | Ga0068859_101350484 | 3300005617 | Bacteria | 786 |
| 224 | Ga0068859_102262485 | 3300005617 | Bacteria | 600 |
| 225 | Ga0068864_100027054 | 3300005618 | Bacteria | 4839 |
| 226 | Ga0068864_100359568 | 3300005618 | Bacteria | 1375 |
| 227 | Ga0068864_100395480 | 3300005618 | Bacteria | 1312 |
| 228 | Ga0068864_100401501 | 3300005618 | Bacteria | 1302 |
| 229 | Ga0068864_100451381 | 3300005618 | Bacteria | 1229 |
| 230 | Ga0068864_100470316 | 3300005618 | Unclassified | 1205 |
| 231 | Ga0068864_100664557 | 3300005618 | Bacteria | 1015 |
| 232 | Ga0068864_100862142 | 3300005618 | Bacteria | 893 |
| 233 | Ga0068864_100954837 | 3300005618 | Bacteria | 848 |
| 234 | Ga0068864_101004663 | 3300005618 | Unclassified | 827 |
| 235 | Ga0068864_101075341 | 3300005618 | Bacteria | 800 |
| 236 | Ga0068864_101244968 | 3300005618 | Bacteria | 743 |
| 237 | Ga0068864_101374496 | 3300005618 | Unclassified | 707 |
| 238 | Ga0068864_102435512 | 3300005618 | Bacteria | 530 |
| 239 | Ga0068866_10665161 | 3300005718 | Unclassified | 710 |
| 240 | Ga0068861_100002213 | 3300005719 | Bacteria | 12614 |
| 241 | Ga0068861_100169838 | 3300005719 | Bacteria | 1807 |
| 242 | Ga0068861_100194343 | 3300005719 | Bacteria | 1699 |
| 243 | Ga0068861_100786484 | 3300005719 | Unclassified | 892 |
| 244 | Ga0068851_10025301 | 3300005834 | Unclassified | 2911 |
| 245 | Ga0068870_10013965 | 3300005840 | Unclassified | 3784 |
| 246 | Ga0068870_10056984 | 3300005840 | Bacteria | 2088 |
| 247 | Ga0068870_10119803 | 3300005840 | Bacteria | 1514 |
| 248 | Ga0068870_10524120 | 3300005840 | Unclassified | 794 |
| 249 | Ga0068870_11357262 | 3300005840 | Unclassified | 519 |
| 250 | Ga0068863_100094641 | 3300005841 | Unclassified | 2835 |
| 251 | Ga0068863_100116160 | 3300005841 | Bacteria | 2550 |
| 252 | Ga0068863_100162102 | 3300005841 | Bacteria | 2143 |
| 253 | Ga0068863_100293623 | 3300005841 | Bacteria | 1576 |
| 254 | Ga0068863_100375113 | 3300005841 | Bacteria | 1388 |
| 255 | Ga0068863_100438495 | 3300005841 | Bacteria | 1281 |
| 256 | Ga0068863_100520756 | 3300005841 | Bacteria | 1172 |
| 257 | Ga0068863_100682732 | 3300005841 | Bacteria | 1020 |
| 258 | Ga0068858_100046058 | 3300005842 | Unclassified | 4043 |
| 259 | Ga0068858_100053496 | 3300005842 | Bacteria | 3734 |
| 260 | Ga0068858_100206277 | 3300005842 | Bacteria | 1859 |
| 261 | Ga0068858_100327596 | 3300005842 | Bacteria | 1465 |
| 262 | Ga0068858_100749164 | 3300005842 | Unclassified | 952 |
| 263 | Ga0068858_100943256 | 3300005842 | Bacteria | 844 |
| 264 | Ga0068858_101069755 | 3300005842 | Bacteria | 791 |
| 265 | Ga0068858_101719198 | 3300005842 | Bacteria | 620 |
| 266 | Ga0068860_100023687 | 3300005843 | Bacteria | 5935 |
| 267 | Ga0068860_100028498 | 3300005843 | Bacteria | 5375 |
| 268 | Ga0068860_100063050 | 3300005843 | Bacteria | 3521 |
| 269 | Ga0068860_100174895 | 3300005843 | Bacteria | 2075 |
| 270 | Ga0068860_100586881 | 3300005843 | Bacteria | 1119 |
| 271 | Ga0068860_100810442 | 3300005843 | Unclassified | 950 |
| 272 | Ga0068860_101403472 | 3300005843 | Unclassified | 720 |
| 273 | Ga0068860_102460137 | 3300005843 | Unclassified | 540 |
| 274 | Ga0068862_100108748 | 3300005844 | Bacteria | 2432 |
| 275 | Ga0068862_100247811 | 3300005844 | Bacteria | 1622 |
| 276 | Ga0068862_100385764 | 3300005844 | Bacteria | 1308 |
| 277 | Ga0068862_100399463 | 3300005844 | Bacteria | 1285 |
| 278 | Ga0068862_100485844 | 3300005844 | Bacteria | 1170 |
| 279 | Ga0068862_100590506 | 3300005844 | Bacteria | 1065 |
| 280 | Ga0068862_101228612 | 3300005844 | Bacteria | 749 |
| 281 | Ga0068862_101800365 | 3300005844 | Unclassified | 622 |
| 282 | Ga0081455_10309459 | 3300005937 | Bacteria | 1130 |
| 283 | Ga0081539_10002717 | 3300005985 | Bacteria | 23958 |
| 284 | Ga0081539_10004414 | 3300005985 | Bacteria | 15576 |
| 285 | Ga0081539_10087171 | 3300005985 | Bacteria | 1622 |
| 286 | Ga0081539_10355351 | 3300005985 | Bacteria | 615 |
| 287 | Ga0075432_10344755 | 3300006058 | Unclassified | 630 |
| 288 | Ga0070716_100026339 | 3300006173 | Unclassified | 3113 |
| 289 | Ga0097621_100046192 | 3300006237 | Bacteria | 3522 |
| 290 | Ga0068871_100000760 | 3300006358 | Bacteria | 21770 |
| 291 | Ga0068871_100127823 | 3300006358 | Bacteria | 2152 |
| 292 | Ga0068871_100385439 | 3300006358 | Bacteria | 1246 |
| 293 | Ga0075428_100751609 | 3300006844 | Bacteria | 1037 |
| 294 | Ga0075428_102316314 | 3300006844 | Unclassified | 552 |
| 295 | Ga0075430_100107057 | 3300006846 | Unclassified | 2332 |
| 296 | Ga0075430_100119214 | 3300006846 | Bacteria | 2200 |
| 297 | Ga0075430_100182855 | 3300006846 | Bacteria | 1743 |
| 298 | Ga0075430_100736298 | 3300006846 | Bacteria | 813 |
| 299 | Ga0075431_100086739 | 3300006847 | Unclassified | 3230 |
| 300 | Ga0075431_102118497 | 3300006847 | Bacteria | 517 |
| 301 | Ga0075433_10049633 | 3300006852 | Unclassified | 3651 |
| 302 | Ga0075433_10075408 | 3300006852 | Bacteria | 2968 |
| 303 | Ga0075433_10116880 | 3300006852 | Unclassified | 2366 |
| 304 | Ga0075433_10358402 | 3300006852 | Bacteria | 1288 |
| 305 | Ga0075433_10452587 | 3300006852 | Bacteria | 1132 |
| 306 | Ga0075433_10495570 | 3300006852 | Bacteria | 1076 |
| 307 | Ga0075433_11605457 | 3300006852 | Unclassified | 561 |
| 308 | Ga0075434_100005377 | 3300006871 | Bacteria | 11649 |
| 309 | Ga0075434_100026013 | 3300006871 | Bacteria | 5730 |
| 310 | Ga0075434_100536018 | 3300006871 | Bacteria | 1190 |
| 311 | Ga0075434_100640168 | 3300006871 | Bacteria | 1082 |
| 312 | Ga0075429_100019970 | 3300006880 | Bacteria | 5810 |
| 313 | Ga0075429_100398090 | 3300006880 | Bacteria | 1206 |
| 314 | Ga0075429_101364963 | 3300006880 | Unclassified | 617 |
| 315 | Ga0068865_100356413 | 3300006881 | Bacteria | 1186 |
| 316 | Ga0068865_100919402 | 3300006881 | Bacteria | 762 |
| 317 | Ga0068865_101728428 | 3300006881 | Unclassified | 564 |
| 318 | Ga0075436_100005064 | 3300006914 | Bacteria | 9071 |
| 319 | Ga0097620_100015018 | 3300006931 | Bacteria | 7774 |
| 320 | Ga0097620_100022719 | 3300006931 | Bacteria | 6289 |
| 321 | Ga0097620_100073578 | 3300006931 | Bacteria | 3455 |
| 322 | Ga0097620_100080340 | 3300006931 | Bacteria | 3302 |
| 323 | Ga0097620_100089070 | 3300006931 | Unclassified | 3136 |
| 324 | Ga0097620_100109974 | 3300006931 | Bacteria | 2817 |
| 325 | Ga0097620_100134082 | 3300006931 | Unclassified | 2548 |
| 326 | Ga0097620_100164405 | 3300006931 | Bacteria | 2298 |
| 327 | Ga0097620_100189572 | 3300006931 | Bacteria | 2140 |
| 328 | Ga0097620_100278784 | 3300006931 | Bacteria | 1764 |
| 329 | Ga0097620_100465192 | 3300006931 | Unclassified | 1360 |
| 330 | Ga0097620_101350300 | 3300006931 | Bacteria | 786 |
| 331 | Ga0097620_102262491 | 3300006931 | Bacteria | 600 |
| 332 | Ga0075435_100152686 | 3300007076 | Bacteria | 1942 |
| 333 | Ga0105251_10076915 | 3300009011 | Bacteria | 1548 |
| 334 | Ga0105251_10133622 | 3300009011 | Bacteria | 1124 |
| 335 | Ga0105251_10143094 | 3300009011 | Bacteria | 1082 |
| 336 | Ga0105250_10091857 | 3300009092 | Bacteria | 1235 |
| 337 | Ga0105240_10040645 | 3300009093 | Bacteria | 5945 |
| 338 | Ga0105240_10072551 | 3300009093 | Unclassified | 4255 |
| 339 | Ga0105240_10715680 | 3300009093 | Bacteria | 1091 |
| 340 | Ga0105240_10767635 | 3300009093 | Bacteria | 1047 |
| 341 | Ga0105240_11351954 | 3300009093 | Unclassified | 750 |
| 342 | Ga0111539_10004211 | 3300009094 | Bacteria | 18875 |
| 343 | Ga0111539_10008723 | 3300009094 | Bacteria | 12862 |
| 344 | Ga0111539_10422488 | 3300009094 | Bacteria | 1553 |
| 345 | Ga0111539_10718129 | 3300009094 | Bacteria | 1163 |
| 346 | Ga0111539_11173111 | 3300009094 | Unclassified | 892 |
| 347 | Ga0105245_10168589 | 3300009098 | Unclassified | 2083 |
| 348 | Ga0105245_10624677 | 3300009098 | Bacteria | 1106 |
| 349 | Ga0105245_10820521 | 3300009098 | Bacteria | 969 |
| 350 | Ga0105245_10913224 | 3300009098 | Unclassified | 920 |
| 351 | Ga0105245_11116709 | 3300009098 | Unclassified | 835 |
| 352 | Ga0105247_10000526 | 3300009101 | Bacteria | 31200 |
| 353 | Ga0105247_10011661 | 3300009101 | Bacteria | 5293 |
| 354 | Ga0105247_10091931 | 3300009101 | Bacteria | 1927 |
| 355 | Ga0105247_10112380 | 3300009101 | Bacteria | 1755 |
| 356 | Ga0105247_10315655 | 3300009101 | Bacteria | 1089 |
| 357 | Ga0105247_10842272 | 3300009101 | Bacteria | 703 |
| 358 | Ga0105247_10883234 | 3300009101 | Bacteria | 689 |
| 359 | Ga0105247_10944991 | 3300009101 | Unclassified | 669 |
| 360 | Ga0105247_11484842 | 3300009101 | Bacteria | 552 |
| 361 | Ga0105247_11810374 | 3300009101 | Unclassified | 508 |
| 362 | Ga0114129_10055687 | 3300009147 | Bacteria | 5542 |
| 363 | Ga0114129_10075834 | 3300009147 | Unclassified | 4682 |
| 364 | Ga0114129_10204705 | 3300009147 | Unclassified | 2671 |
| 365 | Ga0114129_10214769 | 3300009147 | Bacteria | 2598 |
| 366 | Ga0114129_10674603 | 3300009147 | Unclassified | 1331 |
| 367 | Ga0114129_10856146 | 3300009147 | Bacteria | 1155 |
| 368 | Ga0114129_11017787 | 3300009147 | Bacteria | 1042 |
| 369 | Ga0105243_10044582 | 3300009148 | Bacteria | 3480 |
| 370 | Ga0105243_10116416 | 3300009148 | Bacteria | 2245 |
| 371 | Ga0105243_10146413 | 3300009148 | Bacteria | 2021 |
| 372 | Ga0105243_10190904 | 3300009148 | Bacteria | 1789 |
| 373 | Ga0105243_10518573 | 3300009148 | Bacteria | 1133 |
| 374 | Ga0105243_10643001 | 3300009148 | Bacteria | 1027 |
| 375 | Ga0105243_10647786 | 3300009148 | Bacteria | 1023 |
| 376 | Ga0105243_10666645 | 3300009148 | Bacteria | 1010 |
| 377 | Ga0105243_11434271 | 3300009148 | Unclassified | 712 |
| 378 | Ga0105243_11483407 | 3300009148 | Unclassified | 701 |
| 379 | Ga0105243_12434719 | 3300009148 | Unclassified | 562 |
| 380 | Ga0105241_10007263 | 3300009174 | Bacteria | 8155 |
| 381 | Ga0105241_10020968 | 3300009174 | Unclassified | 4830 |
| 382 | Ga0105241_10052871 | 3300009174 | Bacteria | 3103 |
| 383 | Ga0105241_10188566 | 3300009174 | Bacteria | 1715 |
| 384 | Ga0105241_10194947 | 3300009174 | Bacteria | 1688 |
| 385 | Ga0105241_10219684 | 3300009174 | Bacteria | 1596 |
| 386 | Ga0105241_10228436 | 3300009174 | Bacteria | 1568 |
| 387 | Ga0105241_11087016 | 3300009174 | Bacteria | 752 |
| 388 | Ga0105241_11244961 | 3300009174 | Unclassified | 706 |
| 389 | Ga0105241_11303406 | 3300009174 | Unclassified | 692 |
| 390 | Ga0105241_11805001 | 3300009174 | Unclassified | 597 |
| 391 | Ga0105242_10007475 | 3300009176 | Bacteria | 8411 |
| 392 | Ga0105242_12340846 | 3300009176 | Unclassified | 581 |
| 393 | Ga0105248_10018844 | 3300009177 | Bacteria | 7634 |
| 394 | Ga0105248_10041271 | 3300009177 | Bacteria | 5172 |
| 395 | Ga0105248_10078702 | 3300009177 | Bacteria | 3706 |
| 396 | Ga0105248_10162038 | 3300009177 | Unclassified | 2522 |
| 397 | Ga0105248_10387052 | 3300009177 | Unclassified | 1574 |
| 398 | Ga0105248_10793108 | 3300009177 | Bacteria | 1069 |
| 399 | Ga0105248_11117821 | 3300009177 | Unclassified | 891 |
| 400 | Ga0105248_11405565 | 3300009177 | Unclassified | 790 |
| 401 | Ga0105248_12480896 | 3300009177 | Unclassified | 591 |
| 402 | Ga0105237_10000816 | 3300009545 | Bacteria | 42597 |
| 403 | Ga0105237_10125406 | 3300009545 | Bacteria | 2562 |
| 404 | Ga0105237_10162913 | 3300009545 | Bacteria | 2229 |
| 405 | Ga0105238_10000779 | 3300009551 | Bacteria | 33108 |
| 406 | Ga0105238_10034315 | 3300009551 | Bacteria | 5162 |
| 407 | Ga0105238_12410789 | 3300009551 | Bacteria | 562 |
| 408 | Ga0105249_10001132 | 3300009553 | Bacteria | 23574 |
| 409 | Ga0105249_10347192 | 3300009553 | Bacteria | 1502 |
| 410 | Ga0105249_10594359 | 3300009553 | Bacteria | 1161 |
| 411 | Ga0105249_10773835 | 3300009553 | Bacteria | 1023 |
| 412 | Ga0105249_11292843 | 3300009553 | Unclassified | 801 |
| 413 | Ga0105239_10208485 | 3300010375 | Bacteria | 2190 |
| 414 | Ga0105239_10221569 | 3300010375 | Bacteria | 2121 |
| 415 | Ga0105239_10634642 | 3300010375 | Bacteria | 1219 |
| 416 | Ga0105239_10848848 | 3300010375 | Bacteria | 1047 |
| 417 | Ga0105239_11036882 | 3300010375 | Bacteria | 943 |
| 418 | Ga0105239_11520367 | 3300010375 | Unclassified | 774 |
| 419 | Ga0105246_10040674 | 3300011119 | Bacteria | 3139 |
| 420 | Ga0105246_10156568 | 3300011119 | Bacteria | 1731 |
| 421 | Ga0105246_10491808 | 3300011119 | Bacteria | 1040 |
| 422 | Ga0105246_11610308 | 3300011119 | Bacteria | 614 |
| 423 | Ga0157373_10000670 | 3300013100 | Bacteria | 26739 |
| 424 | Ga0157373_10029505 | 3300013100 | Bacteria | 3950 |
| 425 | Ga0157373_10044202 | 3300013100 | Bacteria | 3180 |
| 426 | Ga0157373_10122376 | 3300013100 | Bacteria | 1829 |
| 427 | Ga0157373_10163982 | 3300013100 | Bacteria | 1564 |
| 428 | Ga0157373_10277372 | 3300013100 | Bacteria | 1187 |
| 429 | Ga0157373_10315535 | 3300013100 | Bacteria | 1111 |
| 430 | Ga0157371_10148491 | 3300013102 | Unclassified | 1671 |
| 431 | Ga0157371_10949458 | 3300013102 | Unclassified | 654 |
| 432 | Ga0157374_10494099 | 3300013296 | Unclassified | 1228 |
| 433 | Ga0157374_10526494 | 3300013296 | Bacteria | 1188 |
| 434 | Ga0157378_10062988 | 3300013297 | Bacteria | 3313 |
| 435 | Ga0157378_11090305 | 3300013297 | Unclassified | 835 |
| 436 | Ga0157378_12017694 | 3300013297 | Unclassified | 627 |
| 437 | Ga0163162_10375476 | 3300013306 | Unclassified | 1555 |
| 438 | Ga0163162_10394326 | 3300013306 | Unclassified | 1517 |
| 439 | Ga0163162_10427141 | 3300013306 | Bacteria | 1457 |
| 440 | Ga0163162_10662625 | 3300013306 | Bacteria | 1167 |
| 441 | Ga0163162_12832608 | 3300013306 | Unclassified | 558 |
| 442 | Ga0157372_10177506 | 3300013307 | Unclassified | 2465 |
| 443 | Ga0157372_10607100 | 3300013307 | Bacteria | 1275 |
| 444 | Ga0157372_10631850 | 3300013307 | Bacteria | 1247 |
| 445 | Ga0157372_11252430 | 3300013307 | Bacteria | 856 |
| 446 | Ga0157375_10040579 | 3300013308 | Bacteria | 4488 |
| 447 | Ga0157375_10233948 | 3300013308 | Unclassified | 1996 |
| 448 | Ga0157375_10440343 | 3300013308 | Bacteria | 1469 |
| 449 | Ga0157375_10527911 | 3300013308 | Bacteria | 1343 |
| 450 | Ga0157375_10593771 | 3300013308 | Bacteria | 1267 |
| 451 | Ga0163163_10000214 | 3300014325 | Bacteria | 60034 |
| 452 | Ga0163163_10010530 | 3300014325 | Bacteria | 8321 |
| 453 | Ga0163163_10140964 | 3300014325 | Bacteria | 2453 |
| 454 | Ga0163163_10839098 | 3300014325 | Bacteria | 982 |
| 455 | Ga0163163_10849856 | 3300014325 | Unclassified | 976 |
| 456 | Ga0163163_11701924 | 3300014325 | Unclassified | 691 |
| 457 | Ga0163163_12748263 | 3300014325 | Unclassified | 549 |
| 458 | Ga0157380_10336642 | 3300014326 | Bacteria | 1406 |
| 459 | Ga0157380_10597182 | 3300014326 | Bacteria | 1091 |
| 460 | Ga0157377_10418705 | 3300014745 | Unclassified | 917 |
| 461 | Ga0157377_10623590 | 3300014745 | Unclassified | 772 |
| 462 | Ga0157377_10682880 | 3300014745 | Unclassified | 743 |
| 463 | Ga0157377_10769297 | 3300014745 | Unclassified | 707 |
| 464 | Ga0157379_10261251 | 3300014968 | Unclassified | 1573 |
| 465 | Ga0157379_10338600 | 3300014968 | Bacteria | 1375 |
| 466 | Ga0157379_10542242 | 3300014968 | Bacteria | 1082 |
| 467 | Ga0182006_1096172 | 3300015261 | Unclassified | 1058 |
| 468 | Ga0207697_10059731 | 3300025315 | Bacteria | 1585 |
| 469 | Ga0207656_10001265 | 3300025321 | Bacteria | 8329 |
| 470 | Ga0207713_1083399 | 3300025735 | Bacteria | 1143 |
| 471 | Ga0207653_10000549 | 3300025885 | Bacteria | 13841 |
| 472 | Ga0207653_10072643 | 3300025885 | Unclassified | 1178 |
| 473 | Ga0207653_10404532 | 3300025885 | Unclassified | 535 |
| 474 | Ga0207642_10588919 | 3300025899 | Unclassified | 691 |
| 475 | Ga0207710_10004418 | 3300025900 | Bacteria | 6141 |
| 476 | Ga0207710_10034363 | 3300025900 | Unclassified | 2227 |
| 477 | Ga0207710_10058172 | 3300025900 | Bacteria | 1747 |
| 478 | Ga0207710_10135421 | 3300025900 | Unclassified | 1186 |
| 479 | Ga0207688_10058121 | 3300025901 | Bacteria | 2176 |
| 480 | Ga0207647_10003121 | 3300025904 | Bacteria | 12445 |
| 481 | Ga0207647_10049025 | 3300025904 | Bacteria | 2621 |
| 482 | Ga0207647_10067515 | 3300025904 | Unclassified | 2167 |
| 483 | Ga0207647_10168814 | 3300025904 | Bacteria | 1274 |
| 484 | Ga0207647_10184030 | 3300025904 | Unclassified | 1212 |
| 485 | Ga0207647_10459084 | 3300025904 | Unclassified | 713 |
| 486 | Ga0207645_10283368 | 3300025907 | Bacteria | 1101 |
| 487 | Ga0207643_10001972 | 3300025908 | Bacteria | 11330 |
| 488 | Ga0207643_10018839 | 3300025908 | Unclassified | 3781 |
| 489 | Ga0207643_10045371 | 3300025908 | Bacteria | 2482 |
| 490 | Ga0207643_10185295 | 3300025908 | Bacteria | 1261 |
| 491 | Ga0207643_10274162 | 3300025908 | Bacteria | 1045 |
| 492 | Ga0207684_10000146 | 3300025910 | Bacteria | 125829 |
| 493 | Ga0207684_10213385 | 3300025910 | Bacteria | 1665 |
| 494 | Ga0207654_10009731 | 3300025911 | Bacteria | 4890 |
| 495 | Ga0207654_10029368 | 3300025911 | Bacteria | 3009 |
| 496 | Ga0207654_10087240 | 3300025911 | Bacteria | 1893 |
| 497 | Ga0207654_10154278 | 3300025911 | Bacteria | 1477 |
| 498 | Ga0207654_10187495 | 3300025911 | Bacteria | 1353 |
| 499 | Ga0207654_10273949 | 3300025911 | Bacteria | 1139 |
| 500 | Ga0207707_10038582 | 3300025912 | Bacteria | 4174 |
| 501 | Ga0207707_10083812 | 3300025912 | Bacteria | 2784 |
| 502 | Ga0207707_10516932 | 3300025912 | Bacteria | 1017 |
| 503 | Ga0207695_10034759 | 3300025913 | Bacteria | 5476 |
| 504 | Ga0207695_10036854 | 3300025913 | Bacteria | 5281 |
| 505 | Ga0207671_10001750 | 3300025914 | Bacteria | 24416 |
| 506 | Ga0207671_10071998 | 3300025914 | Bacteria | 2579 |
| 507 | Ga0207671_10256967 | 3300025914 | Bacteria | 1374 |
| 508 | Ga0207671_10767142 | 3300025914 | Unclassified | 766 |
| 509 | Ga0207660_10130214 | 3300025917 | Bacteria | 1914 |
| 510 | Ga0207660_10254739 | 3300025917 | Bacteria | 1386 |
| 511 | Ga0207660_10392781 | 3300025917 | Bacteria | 1116 |
| 512 | Ga0207660_11046238 | 3300025917 | Unclassified | 666 |
| 513 | Ga0207662_10027016 | 3300025918 | Bacteria | 3313 |
| 514 | Ga0207662_10045339 | 3300025918 | Bacteria | 2599 |
| 515 | Ga0207662_10157424 | 3300025918 | Bacteria | 1449 |
| 516 | Ga0207662_10743454 | 3300025918 | Bacteria | 689 |
| 517 | Ga0207657_10333296 | 3300025919 | Bacteria | 1198 |
| 518 | Ga0207652_10809222 | 3300025921 | Unclassified | 832 |
| 519 | Ga0207646_10152022 | 3300025922 | Bacteria | 2088 |
| 520 | Ga0207681_10008794 | 3300025923 | Bacteria | 6169 |
| 521 | Ga0207681_10083516 | 3300025923 | Bacteria | 2261 |
| 522 | Ga0207681_10341017 | 3300025923 | Unclassified | 1197 |
| 523 | Ga0207694_10004094 | 3300025924 | Bacteria | 11463 |
| 524 | Ga0207694_10435291 | 3300025924 | Bacteria | 1093 |
| 525 | Ga0207650_10000007 | 3300025925 | Bacteria | 530810 |
| 526 | Ga0207650_10078606 | 3300025925 | Bacteria | 2496 |
| 527 | Ga0207650_10312213 | 3300025925 | Bacteria | 1286 |
| 528 | Ga0207650_10404006 | 3300025925 | Bacteria | 1131 |
| 529 | Ga0207650_10657401 | 3300025925 | Unclassified | 884 |
| 530 | Ga0207650_10874816 | 3300025925 | Bacteria | 763 |
| 531 | Ga0207650_11474641 | 3300025925 | Bacteria | 578 |
| 532 | Ga0207659_10173923 | 3300025926 | Bacteria | 1701 |
| 533 | Ga0207659_11359529 | 3300025926 | Unclassified | 609 |
| 534 | Ga0207659_11614303 | 3300025926 | Bacteria | 553 |
| 535 | Ga0207687_10266134 | 3300025927 | Unclassified | 1368 |
| 536 | Ga0207687_10479736 | 3300025927 | Bacteria | 1035 |
| 537 | Ga0207690_10618443 | 3300025932 | Bacteria | 885 |
| 538 | Ga0207690_10715667 | 3300025932 | Unclassified | 824 |
| 539 | Ga0207706_10029540 | 3300025933 | Bacteria | 4893 |
| 540 | Ga0207706_10246264 | 3300025933 | Bacteria | 1562 |
| 541 | Ga0207686_10022224 | 3300025934 | Bacteria | 3651 |
| 542 | Ga0207709_10006367 | 3300025935 | Bacteria | 6627 |
| 543 | Ga0207709_10030077 | 3300025935 | Bacteria | 3156 |
| 544 | Ga0207709_10233290 | 3300025935 | Bacteria | 1334 |
| 545 | Ga0207709_10484306 | 3300025935 | Unclassified | 962 |
| 546 | Ga0207709_10756140 | 3300025935 | Bacteria | 782 |
| 547 | Ga0207709_10908230 | 3300025935 | Bacteria | 716 |
| 548 | Ga0207709_11727958 | 3300025935 | Bacteria | 520 |
| 549 | Ga0207670_10030125 | 3300025936 | Bacteria | 3464 |
| 550 | Ga0207670_10370270 | 3300025936 | Bacteria | 1139 |
| 551 | Ga0207670_10453648 | 3300025936 | Bacteria | 1034 |
| 552 | Ga0207670_10459477 | 3300025936 | Bacteria | 1028 |
| 553 | Ga0207670_10802581 | 3300025936 | Unclassified | 784 |
| 554 | Ga0207704_10462736 | 3300025938 | Bacteria | 1015 |
| 555 | Ga0207665_10021765 | 3300025939 | Unclassified | 4219 |
| 556 | Ga0207691_10181576 | 3300025940 | Unclassified | 1838 |
| 557 | Ga0207691_10214582 | 3300025940 | Bacteria | 1671 |
| 558 | Ga0207691_10464779 | 3300025940 | Bacteria | 1076 |
| 559 | Ga0207711_10008195 | 3300025941 | Bacteria | 8747 |
| 560 | Ga0207711_10081257 | 3300025941 | Bacteria | 2832 |
| 561 | Ga0207711_10166388 | 3300025941 | Unclassified | 1999 |
| 562 | Ga0207711_10210726 | 3300025941 | Bacteria | 1775 |
| 563 | Ga0207711_10435264 | 3300025941 | Bacteria | 1220 |
| 564 | Ga0207689_10026381 | 3300025942 | Bacteria | 4865 |
| 565 | Ga0207689_10096461 | 3300025942 | Unclassified | 2428 |
| 566 | Ga0207689_10096959 | 3300025942 | Bacteria | 2422 |
| 567 | Ga0207689_10117175 | 3300025942 | Bacteria | 2190 |
| 568 | Ga0207689_10128589 | 3300025942 | Bacteria | 2084 |
| 569 | Ga0207689_10164173 | 3300025942 | Bacteria | 1830 |
| 570 | Ga0207689_10186976 | 3300025942 | Bacteria | 1708 |
| 571 | Ga0207689_10312321 | 3300025942 | Bacteria | 1304 |
| 572 | Ga0207689_10580843 | 3300025942 | Unclassified | 942 |
| 573 | Ga0207689_10722868 | 3300025942 | Bacteria | 840 |
| 574 | Ga0207689_10761279 | 3300025942 | Bacteria | 817 |
| 575 | Ga0207661_10893470 | 3300025944 | Unclassified | 818 |
| 576 | Ga0207679_10395855 | 3300025945 | Bacteria | 1214 |
| 577 | Ga0207679_10487078 | 3300025945 | Bacteria | 1099 |
| 578 | Ga0207679_11245287 | 3300025945 | Unclassified | 683 |
| 579 | Ga0207679_11274958 | 3300025945 | Bacteria | 674 |
| 580 | Ga0207679_11751042 | 3300025945 | Unclassified | 568 |
| 581 | Ga0207667_10359971 | 3300025949 | Bacteria | 1484 |
| 582 | Ga0207667_11738995 | 3300025949 | Bacteria | 589 |
| 583 | Ga0207651_10182392 | 3300025960 | Unclassified | 1666 |
| 584 | Ga0207651_10202213 | 3300025960 | Bacteria | 1593 |
| 585 | Ga0207651_10242796 | 3300025960 | Bacteria | 1469 |
| 586 | Ga0207651_10522093 | 3300025960 | Bacteria | 1029 |
| 587 | Ga0207651_10617340 | 3300025960 | Bacteria | 949 |
| 588 | Ga0207651_10709629 | 3300025960 | Bacteria | 887 |
| 589 | Ga0207651_11947664 | 3300025960 | Unclassified | 528 |
| 590 | Ga0207712_10004684 | 3300025961 | Bacteria | 8648 |
| 591 | Ga0207640_10046220 | 3300025981 | Bacteria | 2800 |
| 592 | Ga0207640_10208212 | 3300025981 | Bacteria | 1488 |
| 593 | Ga0207640_10412281 | 3300025981 | Bacteria | 1103 |
| 594 | Ga0207640_10472686 | 3300025981 | Unclassified | 1038 |
| 595 | Ga0207640_10503827 | 3300025981 | Bacteria | 1009 |
| 596 | Ga0207640_11090062 | 3300025981 | Unclassified | 706 |
| 597 | Ga0207640_11286694 | 3300025981 | Unclassified | 652 |
| 598 | Ga0207677_10739036 | 3300026023 | Bacteria | 876 |
| 599 | Ga0207677_11094795 | 3300026023 | Bacteria | 726 |
| 600 | Ga0207703_10253793 | 3300026035 | Bacteria | 1586 |
| 601 | Ga0207703_10257710 | 3300026035 | Bacteria | 1575 |
| 602 | Ga0207703_10305664 | 3300026035 | Unclassified | 1452 |
| 603 | Ga0207703_10493513 | 3300026035 | Bacteria | 1148 |
| 604 | Ga0207703_11579756 | 3300026035 | Unclassified | 631 |
| 605 | Ga0207639_10365318 | 3300026041 | Bacteria | 1292 |
| 606 | Ga0207639_10396027 | 3300026041 | Bacteria | 1243 |
| 607 | Ga0207639_10520845 | 3300026041 | Unclassified | 1089 |
| 608 | Ga0207639_11184573 | 3300026041 | Unclassified | 717 |
| 609 | Ga0207708_10000069 | 3300026075 | Bacteria | 82187 |
| 610 | Ga0207708_10046121 | 3300026075 | Bacteria | 3320 |
| 611 | Ga0207708_10210405 | 3300026075 | Bacteria | 1554 |
| 612 | Ga0207708_10390290 | 3300026075 | Bacteria | 1149 |
| 613 | Ga0207708_10875689 | 3300026075 | Unclassified | 776 |
| 614 | Ga0207708_11287876 | 3300026075 | Bacteria | 640 |
| 615 | Ga0207702_11366362 | 3300026078 | Bacteria | 702 |
| 616 | Ga0207641_10011847 | 3300026088 | Bacteria | 7156 |
| 617 | Ga0207641_10144160 | 3300026088 | Bacteria | 2152 |
| 618 | Ga0207641_10240139 | 3300026088 | Bacteria | 1688 |
| 619 | Ga0207641_10345902 | 3300026088 | Bacteria | 1416 |
| 620 | Ga0207641_10350355 | 3300026088 | Bacteria | 1407 |
| 621 | Ga0207641_10427498 | 3300026088 | Bacteria | 1276 |
| 622 | Ga0207641_10519567 | 3300026088 | Bacteria | 1158 |
| 623 | Ga0207641_11000453 | 3300026088 | Unclassified | 833 |
| 624 | Ga0207648_10031671 | 3300026089 | Bacteria | 4674 |
| 625 | Ga0207648_10092414 | 3300026089 | Unclassified | 2646 |
| 626 | Ga0207648_10355248 | 3300026089 | Unclassified | 1322 |
| 627 | Ga0207648_10427253 | 3300026089 | Unclassified | 1204 |
| 628 | Ga0207648_11845803 | 3300026089 | Bacteria | 566 |
| 629 | Ga0207648_12040826 | 3300026089 | Bacteria | 535 |
| 630 | Ga0207676_10000753 | 3300026095 | Bacteria | 25322 |
| 631 | Ga0207676_10001748 | 3300026095 | Bacteria | 15937 |
| 632 | Ga0207676_10121064 | 3300026095 | Bacteria | 2207 |
| 633 | Ga0207676_10505232 | 3300026095 | Bacteria | 1148 |
| 634 | Ga0207676_10557628 | 3300026095 | Bacteria | 1095 |
| 635 | Ga0207676_10941831 | 3300026095 | Unclassified | 849 |
| 636 | Ga0207674_10030422 | 3300026116 | Bacteria | 5676 |
| 637 | Ga0207674_10107197 | 3300026116 | Bacteria | 2771 |
| 638 | Ga0207674_10144627 | 3300026116 | Bacteria | 2336 |
| 639 | Ga0207674_10222155 | 3300026116 | Bacteria | 1837 |
| 640 | Ga0207674_10228584 | 3300026116 | Bacteria | 1808 |
| 641 | Ga0207674_10412398 | 3300026116 | Bacteria | 1305 |
| 642 | Ga0207674_11389211 | 3300026116 | Bacteria | 671 |
| 643 | Ga0207674_11599950 | 3300026116 | Unclassified | 620 |
| 644 | Ga0207674_11798875 | 3300026116 | Unclassified | 580 |
| 645 | Ga0207675_100005671 | 3300026118 | Bacteria | 11949 |
| 646 | Ga0207675_100028141 | 3300026118 | Bacteria | 5233 |
| 647 | Ga0207675_100209979 | 3300026118 | Bacteria | 1872 |
| 648 | Ga0207675_100320690 | 3300026118 | Unclassified | 1513 |
| 649 | Ga0207675_100524414 | 3300026118 | Unclassified | 1181 |
| 650 | Ga0207675_100552483 | 3300026118 | Bacteria | 1151 |
| 651 | Ga0207675_101146063 | 3300026118 | Unclassified | 798 |
| 652 | Ga0207683_10220277 | 3300026121 | Bacteria | 1729 |
| 653 | Ga0207698_10110417 | 3300026142 | Bacteria | 2303 |
| 654 | Ga0207698_10380254 | 3300026142 | Bacteria | 1343 |
| 655 | Ga0207698_10974584 | 3300026142 | Bacteria | 858 |
| 656 | Ga0207698_11287880 | 3300026142 | Bacteria | 745 |
| 657 | Ga0207428_10001993 | 3300027907 | Bacteria | 20707 |
| 658 | Ga0207428_10046030 | 3300027907 | Unclassified | 3510 |
| 659 | Ga0207428_10506298 | 3300027907 | Unclassified | 877 |
| 660 | Ga0268265_10046161 | 3300028380 | Bacteria | 3255 |
| 661 | Ga0268265_10124782 | 3300028380 | Bacteria | 2128 |
| 662 | Ga0268265_10763397 | 3300028380 | Bacteria | 939 |
| 663 | Ga0268265_10904433 | 3300028380 | Unclassified | 867 |
| 664 | Ga0268265_11187130 | 3300028380 | Unclassified | 760 |
| 665 | Ga0268265_11216414 | 3300028380 | Bacteria | 751 |
| 666 | Ga0268264_10026404 | 3300028381 | Unclassified | 4745 |
| 667 | Ga0268264_10069770 | 3300028381 | Bacteria | 2973 |
| 668 | Ga0268264_10255478 | 3300028381 | Bacteria | 1630 |
| 669 | Ga0268264_10292869 | 3300028381 | Unclassified | 1529 |
| 670 | Ga0268264_10449001 | 3300028381 | Bacteria | 1249 |
| 671 | Ga0268264_10789535 | 3300028381 | Unclassified | 948 |
| 672 | Ga0268264_11124432 | 3300028381 | Bacteria | 794 |
| 673 | Ga0316176_1111201 | 3300030732 | Bacteria | 1130 |
| 674 | Ga0316180_1134593 | 3300030736 | Unclassified | 781 |
| 675 | Ga0316182_1320039 | 3300030745 | Unclassified | 598 |
| 676 | Ga0307408_100047715 | 3300031548 | Bacteria | 3068 |
| 677 | Ga0307408_100873740 | 3300031548 | Unclassified | 821 |
| 678 | Ga0307408_101676379 | 3300031548 | Unclassified | 605 |
| 679 | Ga0307405_10001266 | 3300031731 | Bacteria | 10521 |
| 680 | Ga0307405_10136607 | 3300031731 | Unclassified | 1703 |
| 681 | Ga0307413_10091342 | 3300031824 | Unclassified | 1983 |
| 682 | Ga0307410_10184906 | 3300031852 | Unclassified | 1581 |
| 683 | Ga0307410_11373518 | 3300031852 | Unclassified | 619 |
| 684 | Ga0307410_11601822 | 3300031852 | Bacteria | 575 |
| 685 | Ga0307406_10022523 | 3300031901 | Bacteria | 3738 |
| 686 | Ga0307406_10298908 | 3300031901 | Unclassified | 1236 |
| 687 | Ga0307407_10034692 | 3300031903 | Bacteria | 2765 |
| 688 | Ga0307407_10050890 | 3300031903 | Bacteria | 2372 |
| 689 | Ga0307412_10022476 | 3300031911 | Bacteria | 3867 |
| 690 | Ga0307412_10212485 | 3300031911 | Bacteria | 1477 |
| 691 | Ga0307412_10469908 | 3300031911 | Bacteria | 1040 |
| 692 | Ga0307409_100272729 | 3300031995 | Unclassified | 1559 |
| 693 | Ga0307416_100015473 | 3300032002 | Bacteria | 5273 |
| 694 | Ga0307416_100060710 | 3300032002 | Bacteria | 3081 |
| 695 | Ga0307416_100109850 | 3300032002 | Bacteria | 2426 |
| 696 | Ga0307416_102959421 | 3300032002 | Unclassified | 568 |
| 697 | Ga0307414_10016235 | 3300032004 | Bacteria | 4521 |
| 698 | Ga0307414_10203463 | 3300032004 | Bacteria | 1612 |
| 699 | Ga0307414_10659530 | 3300032004 | Unclassified | 944 |
| 700 | Ga0307414_11226252 | 3300032004 | Bacteria | 695 |
| 701 | Ga0307411_10246161 | 3300032005 | Bacteria | 1403 |
| 702 | Ga0307415_100000375 | 3300032126 | Bacteria | 19088 |
| 703 | Ga0307415_100216286 | 3300032126 | Bacteria | 1533 |
| 704 | Ga0307415_100474467 | 3300032126 | Bacteria | 1087 |
| 705 | Ga0373959_0061593 | 3300034820 | Unclassified | 831 |
| 706 | Ga0373938_0048186 | 3300034957 | Unclassified | 966 |
| 707 | Ga0373940_0064128 | 3300035088 | Bacteria | 1057 |
| 708 | Ga0373951_0010365 | 3300035091 | Bacteria | 2092 |
| 709 | Ga0373951_0089713 | 3300035091 | Bacteria | 805 |
| 710 | Ga0373932_0064128 | 3300035112 | Bacteria | 1124 |
| 711 | Ga0373939_0128842 | 3300035114 | Unclassified | 901 |
| 712 | Ga0373939_0491898 | 3300035114 | Unclassified | 522 |
| 713 | Ga0373941_0002449 | 3300035115 | Bacteria | 4088 |
| 714 | Ga0373942_0003998 | 3300035207 | Bacteria | 3441 |
| 715 | Ga0373942_0142212 | 3300035207 | Unclassified | 765 |
| 716 | Ga0373961_0088464 | 3300035241 | Unclassified | 986 |
| 717 | Ga0373961_0295844 | 3300035241 | Unclassified | 598 |
| 718 | Ga0373931_0087837 | 3300035691 | Bacteria | 1727 |
| 719 | Ga0373931_0494317 | 3300035691 | Unclassified | 788 |
| 720 | Ga0395899_0150951 | 3300037312 | Bacteria | 1647 |
| 721 | Ga0395900_0226509 | 3300037418 | Bacteria | 1882 |
| 722 | Ga0395898_0268191 | 3300037466 | Unclassified | 1628 |
| 723 | Ga0395898_0696047 | 3300037466 | Unclassified | 958 |
| 724 | Ga0395898_1414375 | 3300037466 | Unclassified | 623 |
| 725 | Ga0395901_0251002 | 3300038443 | Unclassified | 1843 |
| 726 | Ga0242422_07582 | 3300038699 | Unclassified | 640 |
| 727 | Ga0242420_012891 | 3300038996 | Bacteria | 1420 |
| 728 | Ga0439448_0025831 | 3300042005 | Bacteria | 1844 |
| 729 | Ga0439455_0001489 | 3300042012 | Bacteria | 3933 |
| 730 | Ga0439457_112530 | 3300042014 | Unclassified | 640 |
| 731 | Ga0439458_0006143 | 3300042157 | Bacteria | 2680 |
| 732 | Ga0451577_0904680 | 3300042876 | Unclassified | 795 |
| 733 | Ga0466972_0649523 | 3300044658 | Unclassified | 500 |
| 734 | Ga0453683_0116842 | 3300044673 | Bacteria | 1679 |
| 735 | Ga0451576_1180412 | 3300045051 | Bacteria | 800 |
| 736 | Ga0451576_1940287 | 3300045051 | Unclassified | 607 |
| 737 | Ga0495663_0406864 | 3300046525 | Unclassified | 501 |
| 738 | Ga0496102_0372481 | 3300048905 | Bacteria | 1344 |
| 739 | Ga0496102_1006893 | 3300048905 | Unclassified | 754 |
| 740 | Ga0496102_1387675 | 3300048905 | Unclassified | 622 |
| 741 | Ga0496104_0082361 | 3300048907 | Bacteria | 3069 |
| 742 | Ga0496104_0366317 | 3300048907 | Unclassified | 1353 |
| 743 | Ga0496106_0049595 | 3300048909 | Bacteria | 3163 |
| 744 | Ga0496107_0154217 | 3300048910 | Bacteria | 1700 |
| 745 | Ga0496108_0042092 | 3300048911 | Bacteria | 3813 |
| 746 | Ga0496109_0700046 | 3300048912 | Bacteria | 951 |
| 747 | Ga0496110_0466489 | 3300048913 | Bacteria | 1151 |
| 748 | Ga0496110_0873555 | 3300048913 | Unclassified | 805 |
| 749 | Ga0496112_0268596 | 3300048915 | Bacteria | 1654 |
| 750 | Ga0496112_0485785 | 3300048915 | Bacteria | 1171 |
| 751 | Ga0496112_0659028 | 3300048915 | Unclassified | 976 |
| 752 | Ga0496112_0773800 | 3300048915 | Bacteria | 885 |
| 753 | Ga0496113_0208993 | 3300048916 | Bacteria | 1553 |
| 754 | Ga0496113_0819984 | 3300048916 | Unclassified | 739 |
| 755 | Ga0501290_026583 | 3300049513 | Unclassified | 813 |
| 756 | Ga0501291_002130 | 3300049514 | Bacteria | 2346 |
| 757 | Ga0501291_003011 | 3300049514 | Bacteria | 2072 |
| 758 | Ga0501291_007620 | 3300049514 | Bacteria | 1473 |
| 759 | Ga0501291_116694 | 3300049514 | Unclassified | 574 |
| 760 | Ga0501292_001379 | 3300049515 | Bacteria | 2994 |
| 761 | Ga0501292_010563 | 3300049515 | Bacteria | 1384 |
| 762 | Ga0501292_073847 | 3300049515 | Unclassified | 638 |
| 763 | Ga0501293_010365 | 3300049516 | Bacteria | 805 |
| 764 | Ga0501296_005614 | 3300049519 | Bacteria | 1404 |
| 765 | Ga0501298_001973 | 3300049521 | Bacteria | 3067 |
| 766 | Ga0501298_003501 | 3300049521 | Unclassified | 2433 |
| 767 | Ga0501298_014168 | 3300049521 | Bacteria | 1421 |
| 768 | Ga0501298_107312 | 3300049521 | Unclassified | 643 |
| 769 | Ga0501299_002214 | 3300049522 | Bacteria | 2668 |
| 770 | Ga0501299_010732 | 3300049522 | Bacteria | 1535 |
| 771 | Ga0501300_004924 | 3300049523 | Unclassified | 1972 |
| 772 | Ga0501300_011974 | 3300049523 | Bacteria | 1263 |
| 773 | Ga0501300_063493 | 3300049523 | Unclassified | 588 |
| 774 | Ga0501301_008783 | 3300049524 | Unclassified | 802 |
| 775 | Ga0501303_008649 | 3300049526 | Bacteria | 928 |
| 776 | Ga0501031_0432013 | 3300049568 | Bacteria | 851 |
| 777 | Ga0501038_0001802 | 3300049574 | Bacteria | 19834 |
| 778 | Ga0501041_0902727 | 3300049577 | Bacteria | 568 |
| 779 | Ga0501042_0940212 | 3300049578 | Unclassified | 630 |
| 780 | Ga0501048_0462086 | 3300049582 | Unclassified | 909 |
| 781 | Ga0501072_1198950 | 3300049588 | Unclassified | 590 |
| 782 | Ga0501198_013133 | 3300049649 | Bacteria | 1251 |
| 783 | Ga0501198_023616 | 3300049649 | Unclassified | 991 |
| 784 | Ga0501198_033894 | 3300049649 | Bacteria | 862 |
| 785 | Ga0501201_054135 | 3300049651 | Bacteria | 507 |
| 786 | Ga0501202_004634 | 3300049652 | Bacteria | 2409 |
| 787 | Ga0501202_005769 | 3300049652 | Unclassified | 2198 |
| 788 | Ga0501202_015314 | 3300049652 | Bacteria | 1476 |
| 789 | Ga0501202_016307 | 3300049652 | Unclassified | 1440 |
| 790 | Ga0501206_002749 | 3300049653 | Unclassified | 2216 |
| 791 | Ga0501206_013405 | 3300049653 | Bacteria | 1120 |
| 792 | Ga0501207_000243 | 3300049654 | Bacteria | 5547 |
| 793 | Ga0501207_000328 | 3300049654 | Bacteria | 5092 |
| 794 | Ga0501207_009415 | 3300049654 | Bacteria | 1427 |
| 795 | Ga0501208_009992 | 3300049655 | Bacteria | 1328 |
| 796 | Ga0501208_015630 | 3300049655 | Bacteria | 1168 |
| 797 | Ga0501208_133014 | 3300049655 | Unclassified | 556 |
| 798 | Ga0501209_082716 | 3300049656 | Unclassified | 927 |
| 799 | Ga0501209_085449 | 3300049656 | Bacteria | 913 |
| 800 | Ga0501209_095116 | 3300049656 | Unclassified | 869 |
| 801 | Ga0501210_016444 | 3300049657 | Unclassified | 658 |
| 802 | Ga0501214_023338 | 3300049659 | Unclassified | 802 |
| 803 | Ga0501214_033098 | 3300049659 | Bacteria | 719 |
| 804 | Ga0501216_001725 | 3300049660 | Bacteria | 2995 |
| 805 | Ga0501216_004822 | 3300049660 | Bacteria | 2014 |
| 806 | Ga0501216_006278 | 3300049660 | Bacteria | 1819 |
| 807 | Ga0501216_017236 | 3300049660 | Bacteria | 1233 |
| 808 | Ga0501216_024233 | 3300049660 | Bacteria | 1083 |
| 809 | Ga0501216_051807 | 3300049660 | Unclassified | 808 |
| 810 | Ga0501217_003031 | 3300049661 | Bacteria | 3362 |
| 811 | Ga0501217_010805 | 3300049661 | Bacteria | 2008 |
| 812 | Ga0501217_020253 | 3300049661 | Bacteria | 1560 |
| 813 | Ga0501217_031870 | 3300049661 | Bacteria | 1301 |
| 814 | Ga0501217_053574 | 3300049661 | Bacteria | 1061 |
| 815 | Ga0501223_005568 | 3300049663 | Bacteria | 2642 |
| 816 | Ga0501223_006250 | 3300049663 | Bacteria | 2470 |
| 817 | Ga0501223_008333 | 3300049663 | Unclassified | 2113 |
| 818 | Ga0501224_003122 | 3300049664 | Unclassified | 2298 |
| 819 | Ga0501224_009291 | 3300049664 | Unclassified | 1437 |
| 820 | Ga0501224_047533 | 3300049664 | Unclassified | 654 |
| 821 | Ga0501227_000264 | 3300049665 | Bacteria | 10779 |
| 822 | Ga0501227_011726 | 3300049665 | Bacteria | 1913 |
| 823 | Ga0501227_013977 | 3300049665 | Bacteria | 1775 |
| 824 | Ga0501227_040502 | 3300049665 | Unclassified | 1149 |
| 825 | Ga0501228_061674 | 3300049666 | Unclassified | 532 |
| 826 | Ga0501230_005475 | 3300049667 | Unclassified | 1799 |
| 827 | Ga0501230_051332 | 3300049667 | Unclassified | 819 |
| 828 | Ga0501230_073089 | 3300049667 | Unclassified | 708 |
| 829 | Ga0501233_002416 | 3300049668 | Bacteria | 3290 |
| 830 | Ga0501233_014660 | 3300049668 | Bacteria | 1604 |
| 831 | Ga0501233_015988 | 3300049668 | Unclassified | 1551 |
| 832 | Ga0501233_075661 | 3300049668 | Bacteria | 859 |
| 833 | Ga0501235_001704 | 3300049669 | Bacteria | 4715 |
| 834 | Ga0501235_002761 | 3300049669 | Unclassified | 3777 |
| 835 | Ga0501235_015445 | 3300049669 | Bacteria | 1683 |
| 836 | Ga0501235_227515 | 3300049669 | Unclassified | 514 |
| 837 | Ga0501236_012753 | 3300049670 | Bacteria | 1139 |
| 838 | Ga0501236_020415 | 3300049670 | Unclassified | 974 |
| 839 | Ga0501236_090886 | 3300049670 | Unclassified | 586 |
| 840 | Ga0501238_064168 | 3300049671 | Unclassified | 564 |
| 841 | Ga0501239_001995 | 3300049672 | Bacteria | 1818 |
| 842 | Ga0501240_000173 | 3300049673 | Bacteria | 4514 |
| 843 | Ga0501240_004253 | 3300049673 | Bacteria | 1651 |
| 844 | Ga0501240_017489 | 3300049673 | Bacteria | 1044 |
| 845 | Ga0501242_020884 | 3300049674 | Bacteria | 843 |
| 846 | Ga0501242_022613 | 3300049674 | Unclassified | 817 |
| 847 | Ga0501242_063013 | 3300049674 | Unclassified | 567 |
| 848 | Ga0501243_022966 | 3300049675 | Bacteria | 1036 |
| 849 | Ga0501243_027693 | 3300049675 | Unclassified | 957 |
| 850 | Ga0501246_003852 | 3300049676 | Bacteria | 1221 |
| 851 | Ga0501247_006989 | 3300049677 | Bacteria | 1289 |
| 852 | Ga0501249_007895 | 3300049679 | Bacteria | 2208 |
| 853 | Ga0501249_015272 | 3300049679 | Bacteria | 1641 |
| 854 | Ga0501250_001645 | 3300049680 | Bacteria | 1894 |
| 855 | Ga0501250_016698 | 3300049680 | Unclassified | 914 |
| 856 | Ga0501251_017904 | 3300049681 | Unclassified | 914 |
| 857 | Ga0501252_042433 | 3300049682 | Unclassified | 664 |
| 858 | Ga0501253_004530 | 3300049683 | Bacteria | 1761 |
| 859 | Ga0501253_009782 | 3300049683 | Bacteria | 1424 |
| 860 | Ga0501253_012514 | 3300049683 | Bacteria | 1331 |
| 861 | Ga0501253_110525 | 3300049683 | Unclassified | 655 |
| 862 | Ga0501255_008451 | 3300049684 | Unclassified | 1117 |
| 863 | Ga0501256_012512 | 3300049685 | Unclassified | 828 |
| 864 | Ga0501256_030350 | 3300049685 | Unclassified | 606 |
| 865 | Ga0501257_001820 | 3300049686 | Bacteria | 4445 |
| 866 | Ga0501257_005864 | 3300049686 | Unclassified | 2716 |
| 867 | Ga0501257_015735 | 3300049686 | Bacteria | 1749 |
| 868 | Ga0501257_047427 | 3300049686 | Bacteria | 1065 |
| 869 | Ga0501259_018625 | 3300049688 | Bacteria | 1215 |
| 870 | Ga0501259_076384 | 3300049688 | Bacteria | 728 |
| 871 | Ga0501260_011351 | 3300049689 | Unclassified | 901 |
| 872 | Ga0501260_029988 | 3300049689 | Unclassified | 623 |
| 873 | Ga0501261_000683 | 3300049690 | Unclassified | 4248 |
| 874 | Ga0501261_031007 | 3300049690 | Unclassified | 808 |
| 875 | Ga0501219_004579 | 3300049703 | Unclassified | 985 |
| 876 | Ga0501221_006580 | 3300049704 | Bacteria | 1970 |
| 877 | Ga0501221_014961 | 3300049704 | Bacteria | 1450 |
| 878 | Ga0501221_027860 | 3300049704 | Bacteria | 1158 |
| 879 | Ga0501221_033346 | 3300049704 | Unclassified | 1086 |
| 880 | Ga0501221_063479 | 3300049704 | Bacteria | 858 |
| 881 | Ga0501225_0000255 | 3300049705 | Bacteria | 16710 |
| 882 | Ga0501225_0007131 | 3300049705 | Unclassified | 3247 |
| 883 | Ga0501225_0019122 | 3300049705 | Bacteria | 1896 |
| 884 | Ga0501225_0049482 | 3300049705 | Unclassified | 1168 |
| 885 | Ga0501229_000443 | 3300049706 | Bacteria | 4669 |
| 886 | Ga0501229_016227 | 3300049706 | Unclassified | 968 |
| 887 | Ga0501234_001246 | 3300049707 | Bacteria | 4001 |
| 888 | Ga0501234_001773 | 3300049707 | Bacteria | 3401 |
| 889 | Ga0501234_006158 | 3300049707 | Unclassified | 1879 |
| 890 | Ga0501234_007689 | 3300049707 | Bacteria | 1684 |
| 891 | Ga0501234_023985 | 3300049707 | Unclassified | 977 |
| 892 | Ga0501245_002483 | 3300049708 | Unclassified | 2465 |
| 893 | Ga0501245_006282 | 3300049708 | Bacteria | 1658 |
| 894 | Ga0501245_047214 | 3300049708 | Bacteria | 754 |
| 895 | Ga0501241_010082 | 3300049758 | Bacteria | 1719 |
| 896 | Ga0501263_005824 | 3300049760 | Unclassified | 1404 |
| 897 | Ga0501263_018365 | 3300049760 | Unclassified | 925 |
| 898 | Ga0501264_016961 | 3300049761 | Bacteria | 745 |
| 899 | Ga0501266_016744 | 3300049763 | Unclassified | 976 |
| 900 | Ga0501266_017684 | 3300049763 | Unclassified | 955 |
| 901 | Ga0501268_006787 | 3300049765 | Unclassified | 1691 |
| 902 | Ga0501268_026299 | 3300049765 | Unclassified | 1028 |
| 903 | Ga0501268_026997 | 3300049765 | Bacteria | 1018 |
| 904 | Ga0501269_030538 | 3300049766 | Unclassified | 692 |
| 905 | Ga0501269_052760 | 3300049766 | Unclassified | 562 |
| 906 | Ga0501270_025712 | 3300049767 | Bacteria | 934 |
| 907 | Ga0501271_000594 | 3300049768 | Bacteria | 3132 |
| 908 | Ga0501271_026267 | 3300049768 | Bacteria | 699 |
| 909 | Ga0501272_010858 | 3300049769 | Bacteria | 1020 |
| 910 | Ga0501272_011181 | 3300049769 | Bacteria | 1008 |
| 911 | Ga0501273_000966 | 3300049770 | Unclassified | 2568 |
| 912 | Ga0501273_001672 | 3300049770 | Unclassified | 2157 |
| 913 | Ga0501273_007344 | 3300049770 | Unclassified | 1295 |
| 914 | Ga0501273_034211 | 3300049770 | Unclassified | 733 |
| 915 | Ga0501274_004002 | 3300049771 | Unclassified | 1203 |
| 916 | Ga0501275_028747 | 3300049772 | Bacteria | 725 |
| 917 | Ga0501276_005476 | 3300049773 | Unclassified | 978 |
| 918 | Ga0501278_003275 | 3300049774 | Unclassified | 1146 |
| 919 | Ga0501278_007524 | 3300049774 | Unclassified | 829 |
| 920 | Ga0501279_003311 | 3300049775 | Bacteria | 2099 |
| 921 | Ga0501283_001125 | 3300049779 | Bacteria | 3514 |
| 922 | Ga0501283_013820 | 3300049779 | Bacteria | 1227 |
| 923 | Ga0501283_058875 | 3300049779 | Unclassified | 691 |
| 924 | Ga0501204_027285 | 3300049850 | Unclassified | 776 |
| 925 | Ga0501212_001115 | 3300049851 | Unclassified | 2937 |
| 926 | Ga0501212_002576 | 3300049851 | Bacteria | 2200 |
| 927 | Ga0501212_006039 | 3300049851 | Unclassified | 1622 |
| 928 | Ga0501212_011387 | 3300049851 | Bacteria | 1281 |
| 929 | Ga0501226_001661 | 3300049853 | Bacteria | 2820 |
| 930 | nmdc:mga05p37_22998_c1 | 3300050507 | Bacteria | 7561 |
| 931 | nmdc:mga05p37_260656_c1 | 3300050507 | Bacteria | 2075 |
| 932 | nmdc:mga05p37_362983_c1 | 3300050507 | Bacteria | 1702 |
| 933 | nmdc:mga05p37_401054_c1 | 3300050507 | Unclassified | 1601 |
| 934 | nmdc:mga05p37_709207_c1 | 3300050507 | Bacteria | 1116 |
| 935 | nmdc:mga05p37_78462_c1 | 3300050507 | Bacteria | 4066 |
| 936 | nmdc:mga09592_138414_c1 | 3300050508 | Unclassified | 2098 |
| 937 | nmdc:mga09592_198544_c1 | 3300050508 | Bacteria | 1737 |
| 938 | nmdc:mga0qj67_13032_c1 | 3300050509 | Bacteria | 6277 |
| 939 | nmdc:mga0qj67_1430355_c1 | 3300050509 | Unclassified | 533 |
| 940 | nmdc:mga0qj67_450897_c1 | 3300050509 | Bacteria | 1036 |
| 941 | nmdc:mga06r32_121344_c1 | 3300050510 | Unclassified | 2578 |
| 942 | nmdc:mga06r32_204216_c1 | 3300050510 | Unclassified | 1964 |
| 943 | nmdc:mga06r32_633132_c1 | 3300050510 | Bacteria | 1039 |
| 944 | nmdc:mga08y16_1008811_c1 | 3300050511 | Unclassified | 812 |
| 945 | nmdc:mga08y16_115750_c1 | 3300050511 | Bacteria | 2791 |
| 946 | nmdc:mga08y16_2184_c1 | 3300050511 | Bacteria | 20071 |
| 947 | nmdc:mga08y16_30513_c1 | 3300050511 | Bacteria | 5673 |
| 948 | nmdc:mga08y16_518259_c1 | 3300050511 | Bacteria | 1209 |
| 949 | nmdc:mga0n895_188701_c1 | 3300050512 | Unclassified | 2092 |
| 950 | nmdc:mga0n895_26852_c1 | 3300050512 | Bacteria | 5461 |
| 951 | nmdc:mga0n895_396683_c1 | 3300050512 | Bacteria | 1395 |
| 952 | nmdc:mga0n895_518106_c1 | 3300050512 | Bacteria | 1200 |
| 953 | nmdc:mga0n895_71086_c1 | 3300050512 | Unclassified | 3450 |
| 954 | nmdc:mga0n895_745174_c1 | 3300050512 | Bacteria | 973 |
| 955 | nmdc:mga0n895_750056_c1 | 3300050512 | Unclassified | 969 |
| 956 | nmdc:mga0rr50_31296_c1 | 3300050513 | Bacteria | 3777 |
| 957 | nmdc:mga08x19_127361_c1 | 3300050514 | Bacteria | 1711 |
| 958 | nmdc:mga0a205_170024_c1 | 3300050515 | Bacteria | 2076 |
| 959 | nmdc:mga0a205_22810_c1 | 3300050515 | Bacteria | 5934 |
| 960 | nmdc:mga0a205_275634_c1 | 3300050515 | Bacteria | 1558 |
| 961 | nmdc:mga0a205_36146_c1 | 3300050515 | Bacteria | 4745 |
| 962 | nmdc:mga0a205_417190_c1 | 3300050515 | Bacteria | 1205 |
| 963 | nmdc:mga0a205_528573_c1 | 3300050515 | Unclassified | 1036 |
| 964 | nmdc:mga0a205_651859_c1 | 3300050515 | Unclassified | 904 |
| 965 | nmdc:mga0a205_921649_c1 | 3300050515 | Unclassified | 720 |
| 966 | nmdc:mga0a205_9431_c1 | 3300050515 | Bacteria | 8923 |
| 967 | Ga0590075_085919 | 3300059424 | Unclassified | 816 |
| 968 | Ga0530510_0068410 | 3300061734 | Bacteria | 2576 |
| 969 | Ga0207710_10346638 | |||
| 970 | SwRhRL2b_contig_1124966 | |||
| 971 | SwRhRL2b_contig_3276766 | |||
| 972 | JGI24737J22298_10100234 | |||
| 973 | JGI24751J29686_10000019 | |||
| 974 | JGI25406J46586_10024476 | |||
| 975 | JGI25406J46586_10232999 | |||
| 976 | rootL2_10075506 | |||
| 977 | Ga0065714_10028113 | |||
| 978 | Ga0065714_10064440 | |||
| 979 | Ga0065704_10015615 | |||
| 980 | Ga0065704_10074009 | |||
| 981 | Ga0065704_10383613 | |||
| 982 | Ga0065704_10467398 | |||
| 983 | Ga0065704_10608295 | |||
| 984 | Ga0065704_10614424 | |||
| 985 | Ga0065712_10000120 | |||
| 986 | Ga0065712_10036024 | |||
| 987 | Ga0065712_10073666 | |||
| 988 | Ga0065712_10101862 | |||
| 989 | Ga0065712_10212885 | |||
| 990 | Ga0065712_10251327 | |||
| 991 | Ga0065715_10012328 | |||
| 992 | Ga0065715_10023030 | |||
| 993 | Ga0065715_10091252 | |||
| 994 | Ga0065715_10107064 | |||
| 995 | Ga0065715_10140086 | |||
| 996 | Ga0065715_10195369 | |||
| 997 | Ga0065715_10275215 | |||
| 998 | Ga0065715_10363844 | |||
| 999 | Ga0065715_10400984 | |||
| 1000 | Ga0065715_10996345 | |||
| 1001 | Ga0065707_10001216 | |||
| 1002 | Ga0065707_10008227 | |||
| 1003 | Ga0065707_10575269 | |||
| 1004 | Ga0065707_10892237 | |||
| 1005 | Ga0070683_100803157 | |||
| 1006 | Ga0070683_100945892 | |||
| 1007 | Ga0070690_100160272 | |||
| 1008 | Ga0070670_100000346 | |||
| 1009 | Ga0070670_100148222 | |||
| 1010 | Ga0070670_100198125 | |||
| 1011 | Ga0070670_100343500 | |||
| 1012 | Ga0070670_101441294 | |||
| 1013 | Ga0070677_10298690 | |||
| 1014 | Ga0068869_100199359 | |||
| 1015 | Ga0068869_100206140 | |||
| 1016 | Ga0068869_100224270 | |||
| 1017 | Ga0068869_100226299 | |||
| 1018 | Ga0068869_100282272 | |||
| 1019 | Ga0068869_100642531 | |||
| 1020 | Ga0068869_100739313 | |||
| 1021 | Ga0068869_100789054 | |||
| 1022 | Ga0068869_101440261 | |||
| 1023 | Ga0070680_100281067 | |||
| 1024 | Ga0070680_100606083 | |||
| 1025 | Ga0070682_100001127 | |||
| 1026 | Ga0070682_100002771 | |||
| 1027 | Ga0070682_100481180 | |||
| 1028 | Ga0068868_100339447 | |||
| 1029 | Ga0068868_100805469 | |||
| 1030 | Ga0070689_100000044 | |||
| 1031 | Ga0070689_101116892 | |||
| 1032 | Ga0070691_10106190 | |||
| 1033 | Ga0070687_100103136 | |||
| 1034 | Ga0070687_100394599 | |||
| 1035 | Ga0070687_100527385 | |||
| 1036 | Ga0070687_101051527 | |||
| 1037 | Ga0070661_100534659 | |||
| 1038 | Ga0070661_100589647 | |||
| 1039 | Ga0070661_100664141 | |||
| 1040 | Ga0070692_10110613 | |||
| 1041 | Ga0070692_10199863 | |||
| 1042 | Ga0070692_10903215 | |||
| 1043 | Ga0070669_100063784 | |||
| 1044 | Ga0070669_100360586 | |||
| 1045 | Ga0070669_101279372 | |||
| 1046 | Ga0070675_100219303 | |||
| 1047 | Ga0070675_100333294 | |||
| 1048 | Ga0070673_100189065 | |||
| 1049 | Ga0070673_100586563 | |||
| 1050 | Ga0070673_100623107 | |||
| 1051 | Ga0070673_101184016 | |||
| 1052 | Ga0070688_100235639 | |||
| 1053 | Ga0070688_100459069 | |||
| 1054 | Ga0070659_100911218 | |||
| 1055 | Ga0070703_10004025 | |||
| 1056 | Ga0070703_10382669 | |||
| 1057 | Ga0070701_10134677 | |||
| 1058 | Ga0070701_10149871 | |||
| 1059 | Ga0070701_10260345 | |||
| 1060 | Ga0070701_10272710 | |||
| 1061 | Ga0070705_100003873 | |||
| 1062 | Ga0070705_100019681 | |||
| 1063 | Ga0070705_100071739 | |||
| 1064 | Ga0070705_100117920 | |||
| 1065 | Ga0070705_100539883 | |||
| 1066 | Ga0070700_100000125 | |||
| 1067 | Ga0070700_100018353 | |||
| 1068 | Ga0070700_100028526 | |||
| 1069 | Ga0070700_100266213 | |||
| 1070 | Ga0070700_100349402 | |||
| 1071 | Ga0070700_100349497 | |||
| 1072 | Ga0070694_100034035 | |||
| 1073 | Ga0070694_100059546 | |||
| 1074 | Ga0070694_100173294 | |||
| 1075 | Ga0070694_100258185 | |||
| 1076 | Ga0070694_100569866 | |||
| 1077 | Ga0070694_100766803 | |||
| 1078 | Ga0070708_100779372 | |||
| 1079 | Ga0070678_100097754 | |||
| 1080 | Ga0070678_100289489 | |||
| 1081 | Ga0070662_100022249 | |||
| 1082 | Ga0070681_10003957 | |||
| 1083 | Ga0070681_10136690 | |||
| 1084 | Ga0070681_10496249 | |||
| 1085 | Ga0070681_11826302 | |||
| 1086 | Ga0068867_100078052 | |||
| 1087 | Ga0068867_100166503 | |||
| 1088 | Ga0068867_100870548 | |||
| 1089 | Ga0070685_10555776 | |||
| 1090 | Ga0070685_10842882 | |||
| 1091 | Ga0070706_100000023 | |||
| 1092 | Ga0070706_100447585 | |||
| 1093 | Ga0070707_101604091 | |||
| 1094 | Ga0070698_100050650 | |||
| 1095 | Ga0070698_100067587 | |||
| 1096 | Ga0070699_100041196 | |||
| 1097 | Ga0070699_100056039 | |||
| 1098 | Ga0070699_100391197 | |||
| 1099 | Ga0070679_100597419 | |||
| 1100 | Ga0070679_100880406 | |||
| 1101 | Ga0070679_100987123 | |||
| 1102 | Ga0070697_100432860 | |||
| 1103 | Ga0070697_100504831 | |||
| 1104 | Ga0070697_100890790 | |||
| 1105 | Ga0070697_101679883 | |||
| 1106 | Ga0068853_100013781 | |||
| 1107 | Ga0068853_100676114 | |||
| 1108 | Ga0068853_101322753 | |||
| 1109 | Ga0070672_100180546 | |||
| 1110 | Ga0070672_100396513 | |||
| 1111 | Ga0070686_100313842 | |||
| 1112 | Ga0070695_100039347 | |||
| 1113 | Ga0070695_100044915 | |||
| 1114 | Ga0070695_100066712 | |||
| 1115 | Ga0070695_100186141 | |||
| 1116 | Ga0070695_100194280 | |||
| 1117 | Ga0070695_100255941 | |||
| 1118 | Ga0070695_100267086 | |||
| 1119 | Ga0070695_100309997 | |||
| 1120 | Ga0070695_100501393 | |||
| 1121 | Ga0070695_100813042 | |||
| 1122 | Ga0070696_100049945 | |||
| 1123 | Ga0070696_100149979 | |||
| 1124 | Ga0070696_100268401 | |||
| 1125 | Ga0070696_100279213 | |||
| 1126 | Ga0070696_100455879 | |||
| 1127 | Ga0070696_100699564 | |||
| 1128 | Ga0070696_100787870 | |||
| 1129 | Ga0070696_101576540 | |||
| 1130 | Ga0070693_100002115 | |||
| 1131 | Ga0070693_100010152 | |||
| 1132 | Ga0070693_100102297 | |||
| 1133 | Ga0070693_100110154 | |||
| 1134 | Ga0070693_100143052 | |||
| 1135 | Ga0070693_100175281 | |||
| 1136 | Ga0070693_100196021 | |||
| 1137 | Ga0070693_100246651 | |||
| 1138 | Ga0070693_100268671 | |||
| 1139 | Ga0070693_100300001 | |||
| 1140 | Ga0070704_100037087 | |||
| 1141 | Ga0070704_100041111 | |||
| 1142 | Ga0070704_100054561 | |||
| 1143 | Ga0070704_100078819 | |||
| 1144 | Ga0070704_100266615 | |||
| 1145 | Ga0070704_100674464 | |||
| 1146 | Ga0070704_101394970 | |||
| 1147 | Ga0068855_100551379 | |||
| 1148 | Ga0068855_100725061 | |||
| 1149 | Ga0068855_100726442 | |||
| 1150 | Ga0068855_101093209 | |||
| 1151 | Ga0070664_100264479 | |||
| 1152 | Ga0070664_100322560 | |||
| 1153 | Ga0070664_100441668 | |||
| 1154 | Ga0070664_100539897 | |||
| 1155 | Ga0070664_100736540 | |||
| 1156 | Ga0068857_100054622 | |||
| 1157 | Ga0068857_100353659 | |||
| 1158 | Ga0068857_100394831 | |||
| 1159 | Ga0068857_100419777 | |||
| 1160 | Ga0068857_100478377 | |||
| 1161 | Ga0068857_101350599 | |||
| 1162 | Ga0068857_102039674 | |||
| 1163 | Ga0068854_100057865 | |||
| 1164 | Ga0068854_100310574 | |||
| 1165 | Ga0068854_100361376 | |||
| 1166 | Ga0068854_100489336 | |||
| 1167 | Ga0068854_100499931 | |||
| 1168 | Ga0068854_101022609 | |||
| 1169 | Ga0068856_101476969 | |||
| 1170 | Ga0070702_100018928 | |||
| 1171 | Ga0070702_100022971 | |||
| 1172 | Ga0070702_100035209 | |||
| 1173 | Ga0070702_100122415 | |||
| 1174 | Ga0070702_100270011 | |||
| 1175 | Ga0070702_100749365 | |||
| 1176 | Ga0068852_100039203 | |||
| 1177 | Ga0068852_100291188 | |||
| 1178 | Ga0068852_100387216 | |||
| 1179 | Ga0068852_101657042 | |||
| 1180 | Ga0068859_100015015 | |||
| 1181 | Ga0068859_100022720 | |||
| 1182 | Ga0068859_100073575 | |||
| 1183 | Ga0068859_100080338 | |||
| 1184 | Ga0068859_100089077 | |||
| 1185 | Ga0068859_100109980 | |||
| 1186 | Ga0068859_100134085 | |||
| 1187 | Ga0068859_100164410 | |||
| 1188 | Ga0068859_100189562 | |||
| 1189 | Ga0068859_100278784 | |||
| 1190 | Ga0068859_100465154 | |||
| 1191 | Ga0068859_101350484 | |||
| 1192 | Ga0068859_102262485 | |||
| 1193 | Ga0068864_100027054 | |||
| 1194 | Ga0068864_100359568 | |||
| 1195 | Ga0068864_100395480 | |||
| 1196 | Ga0068864_100401501 | |||
| 1197 | Ga0068864_100451381 | |||
| 1198 | Ga0068864_100470316 | |||
| 1199 | Ga0068864_100664557 | |||
| 1200 | Ga0068864_100862142 | |||
| 1201 | Ga0068864_100954837 | |||
| 1202 | Ga0068864_101004663 | |||
| 1203 | Ga0068864_101075341 | |||
| 1204 | Ga0068864_101244968 | |||
| 1205 | Ga0068864_101374496 | |||
| 1206 | Ga0068864_102435512 | |||
| 1207 | Ga0068866_10665161 | |||
| 1208 | Ga0068861_100002213 | |||
| 1209 | Ga0068861_100169838 | |||
| 1210 | Ga0068861_100194343 | |||
| 1211 | Ga0068861_100786484 | |||
| 1212 | Ga0068851_10025301 | |||
| 1213 | Ga0068870_10013965 | |||
| 1214 | Ga0068870_10056984 | |||
| 1215 | Ga0068870_10119803 | |||
| 1216 | Ga0068870_10524120 | |||
| 1217 | Ga0068870_11357262 | |||
| 1218 | Ga0068863_100094641 | |||
| 1219 | Ga0068863_100116160 | |||
| 1220 | Ga0068863_100162102 | |||
| 1221 | Ga0068863_100293623 | |||
| 1222 | Ga0068863_100375113 | |||
| 1223 | Ga0068863_100438495 | |||
| 1224 | Ga0068863_100520756 | |||
| 1225 | Ga0068863_100682732 | |||
| 1226 | Ga0068858_100046058 | |||
| 1227 | Ga0068858_100053496 | |||
| 1228 | Ga0068858_100206277 | |||
| 1229 | Ga0068858_100327596 | |||
| 1230 | Ga0068858_100749164 | |||
| 1231 | Ga0068858_100943256 | |||
| 1232 | Ga0068858_101069755 | |||
| 1233 | Ga0068858_101719198 | |||
| 1234 | Ga0068860_100023687 | |||
| 1235 | Ga0068860_100028498 | |||
| 1236 | Ga0068860_100063050 | |||
| 1237 | Ga0068860_100174895 | |||
| 1238 | Ga0068860_100586881 | |||
| 1239 | Ga0068860_100810442 | |||
| 1240 | Ga0068860_101403472 | |||
| 1241 | Ga0068860_102460137 | |||
| 1242 | Ga0068862_100108748 | |||
| 1243 | Ga0068862_100247811 | |||
| 1244 | Ga0068862_100385764 | |||
| 1245 | Ga0068862_100399463 | |||
| 1246 | Ga0068862_100485844 | |||
| 1247 | Ga0068862_100590506 | |||
| 1248 | Ga0068862_101228612 | |||
| 1249 | Ga0068862_101800365 | |||
| 1250 | Ga0081455_10309459 | |||
| 1251 | Ga0081539_10002717 | |||
| 1252 | Ga0081539_10004414 | |||
| 1253 | Ga0081539_10087171 | |||
| 1254 | Ga0081539_10355351 | |||
| 1255 | Ga0075432_10344755 | |||
| 1256 | Ga0070716_100026339 | |||
| 1257 | Ga0097621_100046192 | |||
| 1258 | Ga0068871_100000760 | |||
| 1259 | Ga0068871_100127823 | |||
| 1260 | Ga0068871_100385439 | |||
| 1261 | Ga0075428_100751609 | |||
| 1262 | Ga0075428_102316314 | |||
| 1263 | Ga0075430_100107057 | |||
| 1264 | Ga0075430_100119214 | |||
| 1265 | Ga0075430_100182855 | |||
| 1266 | Ga0075430_100736298 | |||
| 1267 | Ga0075431_100086739 | |||
| 1268 | Ga0075431_102118497 | |||
| 1269 | Ga0075433_10049633 | |||
| 1270 | Ga0075433_10075408 | |||
| 1271 | Ga0075433_10116880 | |||
| 1272 | Ga0075433_10358402 | |||
| 1273 | Ga0075433_10452587 | |||
| 1274 | Ga0075433_10495570 | |||
| 1275 | Ga0075433_11605457 | |||
| 1276 | Ga0075434_100005377 | |||
| 1277 | Ga0075434_100026013 | |||
| 1278 | Ga0075434_100536018 | |||
| 1279 | Ga0075434_100640168 | |||
| 1280 | Ga0075429_100019970 | |||
| 1281 | Ga0075429_100398090 | |||
| 1282 | Ga0075429_101364963 | |||
| 1283 | Ga0068865_100356413 | |||
| 1284 | Ga0068865_100919402 | |||
| 1285 | Ga0068865_101728428 | |||
| 1286 | Ga0075436_100005064 | |||
| 1287 | Ga0097620_100015018 | |||
| 1288 | Ga0097620_100022719 | |||
| 1289 | Ga0097620_100073578 | |||
| 1290 | Ga0097620_100080340 | |||
| 1291 | Ga0097620_100089070 | |||
| 1292 | Ga0097620_100109974 | |||
| 1293 | Ga0097620_100134082 | |||
| 1294 | Ga0097620_100164405 | |||
| 1295 | Ga0097620_100189572 | |||
| 1296 | Ga0097620_100278784 | |||
| 1297 | Ga0097620_100465192 | |||
| 1298 | Ga0097620_101350300 | |||
| 1299 | Ga0097620_102262491 | |||
| 1300 | Ga0075435_100152686 | |||
| 1301 | Ga0105251_10076915 | |||
| 1302 | Ga0105251_10133622 | |||
| 1303 | Ga0105251_10143094 | |||
| 1304 | Ga0105250_10091857 | |||
| 1305 | Ga0105240_10040645 | |||
| 1306 | Ga0105240_10072551 | |||
| 1307 | Ga0105240_10715680 | |||
| 1308 | Ga0105240_10767635 | |||
| 1309 | Ga0105240_11351954 | |||
| 1310 | Ga0111539_10004211 | |||
| 1311 | Ga0111539_10008723 | |||
| 1312 | Ga0111539_10422488 | |||
| 1313 | Ga0111539_10718129 | |||
| 1314 | Ga0111539_11173111 | |||
| 1315 | Ga0105245_10168589 | |||
| 1316 | Ga0105245_10624677 | |||
| 1317 | Ga0105245_10820521 | |||
| 1318 | Ga0105245_10913224 | |||
| 1319 | Ga0105245_11116709 | |||
| 1320 | Ga0105247_10000526 | |||
| 1321 | Ga0105247_10011661 | |||
| 1322 | Ga0105247_10091931 | |||
| 1323 | Ga0105247_10112380 | |||
| 1324 | Ga0105247_10315655 | |||
| 1325 | Ga0105247_10842272 | |||
| 1326 | Ga0105247_10883234 | |||
| 1327 | Ga0105247_10944991 | |||
| 1328 | Ga0105247_11484842 | |||
| 1329 | Ga0105247_11810374 | |||
| 1330 | Ga0114129_10055687 | |||
| 1331 | Ga0114129_10075834 | |||
| 1332 | Ga0114129_10204705 | |||
| 1333 | Ga0114129_10214769 | |||
| 1334 | Ga0114129_10674603 | |||
| 1335 | Ga0114129_10856146 | |||
| 1336 | Ga0114129_11017787 | |||
| 1337 | Ga0105243_10044582 | |||
| 1338 | Ga0105243_10116416 | |||
| 1339 | Ga0105243_10146413 | |||
| 1340 | Ga0105243_10190904 | |||
| 1341 | Ga0105243_10518573 | |||
| 1342 | Ga0105243_10643001 | |||
| 1343 | Ga0105243_10647786 | |||
| 1344 | Ga0105243_10666645 | |||
| 1345 | Ga0105243_11434271 | |||
| 1346 | Ga0105243_11483407 | |||
| 1347 | Ga0105243_12434719 | |||
| 1348 | Ga0105241_10007263 | |||
| 1349 | Ga0105241_10020968 | |||
| 1350 | Ga0105241_10052871 | |||
| 1351 | Ga0105241_10188566 | |||
| 1352 | Ga0105241_10194947 | |||
| 1353 | Ga0105241_10219684 | |||
| 1354 | Ga0105241_10228436 | |||
| 1355 | Ga0105241_11087016 | |||
| 1356 | Ga0105241_11244961 | |||
| 1357 | Ga0105241_11303406 | |||
| 1358 | Ga0105241_11805001 | |||
| 1359 | Ga0105242_10007475 | |||
| 1360 | Ga0105242_12340846 | |||
| 1361 | Ga0105248_10018844 | |||
| 1362 | Ga0105248_10041271 | |||
| 1363 | Ga0105248_10078702 | |||
| 1364 | Ga0105248_10162038 | |||
| 1365 | Ga0105248_10387052 | |||
| 1366 | Ga0105248_10793108 | |||
| 1367 | Ga0105248_11117821 | |||
| 1368 | Ga0105248_11405565 | |||
| 1369 | Ga0105248_12480896 | |||
| 1370 | Ga0105237_10000816 | |||
| 1371 | Ga0105237_10125406 | |||
| 1372 | Ga0105237_10162913 | |||
| 1373 | Ga0105238_10000779 | |||
| 1374 | Ga0105238_10034315 | |||
| 1375 | Ga0105238_12410789 | |||
| 1376 | Ga0105249_10001132 | |||
| 1377 | Ga0105249_10347192 | |||
| 1378 | Ga0105249_10594359 | |||
| 1379 | Ga0105249_10773835 | |||
| 1380 | Ga0105249_11292843 | |||
| 1381 | Ga0105239_10208485 | |||
| 1382 | Ga0105239_10221569 | |||
| 1383 | Ga0105239_10634642 | |||
| 1384 | Ga0105239_10848848 | |||
| 1385 | Ga0105239_11036882 | |||
| 1386 | Ga0105239_11520367 | |||
| 1387 | Ga0105246_10040674 | |||
| 1388 | Ga0105246_10156568 | |||
| 1389 | Ga0105246_10491808 | |||
| 1390 | Ga0105246_11610308 | |||
| 1391 | Ga0157373_10000670 | |||
| 1392 | Ga0157373_10029505 | |||
| 1393 | Ga0157373_10044202 | |||
| 1394 | Ga0157373_10122376 | |||
| 1395 | Ga0157373_10163982 | |||
| 1396 | Ga0157373_10277372 | |||
| 1397 | Ga0157373_10315535 | |||
| 1398 | Ga0157371_10148491 | |||
| 1399 | Ga0157371_10949458 | |||
| 1400 | Ga0157374_10494099 | |||
| 1401 | Ga0157374_10526494 | |||
| 1402 | Ga0157378_10062988 | |||
| 1403 | Ga0157378_11090305 | |||
| 1404 | Ga0157378_12017694 | |||
| 1405 | Ga0163162_10375476 | |||
| 1406 | Ga0163162_10394326 | |||
| 1407 | Ga0163162_10427141 | |||
| 1408 | Ga0163162_10662625 | |||
| 1409 | Ga0163162_12832608 | |||
| 1410 | Ga0157372_10177506 | |||
| 1411 | Ga0157372_10607100 | |||
| 1412 | Ga0157372_10631850 | |||
| 1413 | Ga0157372_11252430 | |||
| 1414 | Ga0157375_10040579 | |||
| 1415 | Ga0157375_10233948 | |||
| 1416 | Ga0157375_10440343 | |||
| 1417 | Ga0157375_10527911 | |||
| 1418 | Ga0157375_10593771 | |||
| 1419 | Ga0163163_10000214 | |||
| 1420 | Ga0163163_10010530 | |||
| 1421 | Ga0163163_10140964 | |||
| 1422 | Ga0163163_10839098 | |||
| 1423 | Ga0163163_10849856 | |||
| 1424 | Ga0163163_11701924 | |||
| 1425 | Ga0163163_12748263 | |||
| 1426 | Ga0157380_10336642 | |||
| 1427 | Ga0157380_10597182 | |||
| 1428 | Ga0157377_10418705 | |||
| 1429 | Ga0157377_10623590 | |||
| 1430 | Ga0157377_10682880 | |||
| 1431 | Ga0157377_10769297 | |||
| 1432 | Ga0157379_10261251 | |||
| 1433 | Ga0157379_10338600 | |||
| 1434 | Ga0157379_10542242 | |||
| 1435 | Ga0182006_1096172 | |||
| 1436 | Ga0207697_10059731 | |||
| 1437 | Ga0207656_10001265 | |||
| 1438 | Ga0207713_1083399 | |||
| 1439 | Ga0207653_10000549 | |||
| 1440 | Ga0207653_10072643 | |||
| 1441 | Ga0207653_10404532 | |||
| 1442 | Ga0207642_10588919 | |||
| 1443 | Ga0207710_10004418 | |||
| 1444 | Ga0207710_10034363 | |||
| 1445 | Ga0207710_10058172 | |||
| 1446 | Ga0207710_10135421 | |||
| 1447 | Ga0207688_10058121 | |||
| 1448 | Ga0207647_10003121 | |||
| 1449 | Ga0207647_10049025 | |||
| 1450 | Ga0207647_10067515 | |||
| 1451 | Ga0207647_10168814 | |||
| 1452 | Ga0207647_10184030 | |||
| 1453 | Ga0207647_10459084 | |||
| 1454 | Ga0207645_10283368 | |||
| 1455 | Ga0207643_10001972 | |||
| 1456 | Ga0207643_10018839 | |||
| 1457 | Ga0207643_10045371 | |||
| 1458 | Ga0207643_10185295 | |||
| 1459 | Ga0207643_10274162 | |||
| 1460 | Ga0207684_10000146 | |||
| 1461 | Ga0207684_10213385 | |||
| 1462 | Ga0207654_10009731 | |||
| 1463 | Ga0207654_10029368 | |||
| 1464 | Ga0207654_10087240 | |||
| 1465 | Ga0207654_10154278 | |||
| 1466 | Ga0207654_10187495 | |||
| 1467 | Ga0207654_10273949 | |||
| 1468 | Ga0207707_10038582 | |||
| 1469 | Ga0207707_10083812 | |||
| 1470 | Ga0207707_10516932 | |||
| 1471 | Ga0207695_10034759 | |||
| 1472 | Ga0207695_10036854 | |||
| 1473 | Ga0207671_10001750 | |||
| 1474 | Ga0207671_10071998 | |||
| 1475 | Ga0207671_10256967 | |||
| 1476 | Ga0207671_10767142 | |||
| 1477 | Ga0207660_10130214 | |||
| 1478 | Ga0207660_10254739 | |||
| 1479 | Ga0207660_10392781 | |||
| 1480 | Ga0207660_11046238 | |||
| 1481 | Ga0207662_10027016 | |||
| 1482 | Ga0207662_10045339 | |||
| 1483 | Ga0207662_10157424 | |||
| 1484 | Ga0207662_10743454 | |||
| 1485 | Ga0207657_10333296 | |||
| 1486 | Ga0207652_10809222 | |||
| 1487 | Ga0207646_10152022 | |||
| 1488 | Ga0207681_10008794 | |||
| 1489 | Ga0207681_10083516 | |||
| 1490 | Ga0207681_10341017 | |||
| 1491 | Ga0207694_10004094 | |||
| 1492 | Ga0207694_10435291 | |||
| 1493 | Ga0207650_10000007 | |||
| 1494 | Ga0207650_10078606 | |||
| 1495 | Ga0207650_10312213 | |||
| 1496 | Ga0207650_10404006 | |||
| 1497 | Ga0207650_10657401 | |||
| 1498 | Ga0207650_10874816 | |||
| 1499 | Ga0207650_11474641 | |||
| 1500 | Ga0207659_10173923 | |||
| 1501 | Ga0207659_11359529 | |||
| 1502 | Ga0207659_11614303 | |||
| 1503 | Ga0207687_10266134 | |||
| 1504 | Ga0207687_10479736 | |||
| 1505 | Ga0207690_10618443 | |||
| 1506 | Ga0207690_10715667 | |||
| 1507 | Ga0207706_10029540 | |||
| 1508 | Ga0207706_10246264 | |||
| 1509 | Ga0207686_10022224 | |||
| 1510 | Ga0207709_10006367 | |||
| 1511 | Ga0207709_10030077 | |||
| 1512 | Ga0207709_10233290 | |||
| 1513 | Ga0207709_10484306 | |||
| 1514 | Ga0207709_10756140 | |||
| 1515 | Ga0207709_10908230 | |||
| 1516 | Ga0207709_11727958 | |||
| 1517 | Ga0207670_10030125 | |||
| 1518 | Ga0207670_10370270 | |||
| 1519 | Ga0207670_10453648 | |||
| 1520 | Ga0207670_10459477 | |||
| 1521 | Ga0207670_10802581 | |||
| 1522 | Ga0207704_10462736 | |||
| 1523 | Ga0207665_10021765 | |||
| 1524 | Ga0207691_10181576 | |||
| 1525 | Ga0207691_10214582 | |||
| 1526 | Ga0207691_10464779 | |||
| 1527 | Ga0207711_10008195 | |||
| 1528 | Ga0207711_10081257 | |||
| 1529 | Ga0207711_10166388 | |||
| 1530 | Ga0207711_10210726 | |||
| 1531 | Ga0207711_10435264 | |||
| 1532 | Ga0207689_10026381 | |||
| 1533 | Ga0207689_10096461 | |||
| 1534 | Ga0207689_10096959 | |||
| 1535 | Ga0207689_10117175 | |||
| 1536 | Ga0207689_10128589 | |||
| 1537 | Ga0207689_10164173 | |||
| 1538 | Ga0207689_10186976 | |||
| 1539 | Ga0207689_10312321 | |||
| 1540 | Ga0207689_10580843 | |||
| 1541 | Ga0207689_10722868 | |||
| 1542 | Ga0207689_10761279 | |||
| 1543 | Ga0207661_10893470 | |||
| 1544 | Ga0207679_10395855 | |||
| 1545 | Ga0207679_10487078 | |||
| 1546 | Ga0207679_11245287 | |||
| 1547 | Ga0207679_11274958 | |||
| 1548 | Ga0207679_11751042 | |||
| 1549 | Ga0207667_10359971 | |||
| 1550 | Ga0207667_11738995 | |||
| 1551 | Ga0207651_10182392 | |||
| 1552 | Ga0207651_10202213 | |||
| 1553 | Ga0207651_10242796 | |||
| 1554 | Ga0207651_10522093 | |||
| 1555 | Ga0207651_10617340 | |||
| 1556 | Ga0207651_10709629 | |||
| 1557 | Ga0207651_11947664 | |||
| 1558 | Ga0207712_10004684 | |||
| 1559 | Ga0207640_10046220 | |||
| 1560 | Ga0207640_10208212 | |||
| 1561 | Ga0207640_10412281 | |||
| 1562 | Ga0207640_10472686 | |||
| 1563 | Ga0207640_10503827 | |||
| 1564 | Ga0207640_11090062 | |||
| 1565 | Ga0207640_11286694 | |||
| 1566 | Ga0207677_10739036 | |||
| 1567 | Ga0207677_11094795 | |||
| 1568 | Ga0207703_10253793 | |||
| 1569 | Ga0207703_10257710 | |||
| 1570 | Ga0207703_10305664 | |||
| 1571 | Ga0207703_10493513 | |||
| 1572 | Ga0207703_11579756 | |||
| 1573 | Ga0207639_10365318 | |||
| 1574 | Ga0207639_10396027 | |||
| 1575 | Ga0207639_10520845 | |||
| 1576 | Ga0207639_11184573 | |||
| 1577 | Ga0207708_10000069 | |||
| 1578 | Ga0207708_10046121 | |||
| 1579 | Ga0207708_10210405 | |||
| 1580 | Ga0207708_10390290 | |||
| 1581 | Ga0207708_10875689 | |||
| 1582 | Ga0207708_11287876 | |||
| 1583 | Ga0207702_11366362 | |||
| 1584 | Ga0207641_10011847 | |||
| 1585 | Ga0207641_10144160 | |||
| 1586 | Ga0207641_10240139 | |||
| 1587 | Ga0207641_10345902 | |||
| 1588 | Ga0207641_10350355 | |||
| 1589 | Ga0207641_10427498 | |||
| 1590 | Ga0207641_10519567 | |||
| 1591 | Ga0207641_11000453 | |||
| 1592 | Ga0207648_10031671 | |||
| 1593 | Ga0207648_10092414 | |||
| 1594 | Ga0207648_10355248 | |||
| 1595 | Ga0207648_10427253 | |||
| 1596 | Ga0207648_11845803 | |||
| 1597 | Ga0207648_12040826 | |||
| 1598 | Ga0207676_10000753 | |||
| 1599 | Ga0207676_10001748 | |||
| 1600 | Ga0207676_10121064 | |||
| 1601 | Ga0207676_10505232 | |||
| 1602 | Ga0207676_10557628 | |||
| 1603 | Ga0207676_10941831 | |||
| 1604 | Ga0207674_10030422 | |||
| 1605 | Ga0207674_10107197 | |||
| 1606 | Ga0207674_10144627 | |||
| 1607 | Ga0207674_10222155 | |||
| 1608 | Ga0207674_10228584 | |||
| 1609 | Ga0207674_10412398 | |||
| 1610 | Ga0207674_11389211 | |||
| 1611 | Ga0207674_11599950 | |||
| 1612 | Ga0207674_11798875 | |||
| 1613 | Ga0207675_100005671 | |||
| 1614 | Ga0207675_100028141 | |||
| 1615 | Ga0207675_100209979 | |||
| 1616 | Ga0207675_100320690 | |||
| 1617 | Ga0207675_100524414 | |||
| 1618 | Ga0207675_100552483 | |||
| 1619 | Ga0207675_101146063 | |||
| 1620 | Ga0207683_10220277 | |||
| 1621 | Ga0207698_10110417 | |||
| 1622 | Ga0207698_10380254 | |||
| 1623 | Ga0207698_10974584 | |||
| 1624 | Ga0207698_11287880 | |||
| 1625 | Ga0207428_10001993 | |||
| 1626 | Ga0207428_10046030 | |||
| 1627 | Ga0207428_10506298 | |||
| 1628 | Ga0268265_10046161 | |||
| 1629 | Ga0268265_10124782 | |||
| 1630 | Ga0268265_10763397 | |||
| 1631 | Ga0268265_10904433 | |||
| 1632 | Ga0268265_11187130 | |||
| 1633 | Ga0268265_11216414 | |||
| 1634 | Ga0268264_10026404 | |||
| 1635 | Ga0268264_10069770 | |||
| 1636 | Ga0268264_10255478 | |||
| 1637 | Ga0268264_10292869 | |||
| 1638 | Ga0268264_10449001 | |||
| 1639 | Ga0268264_10789535 | |||
| 1640 | Ga0268264_11124432 | |||
| 1641 | Ga0316176_1111201 | |||
| 1642 | Ga0316180_1134593 | |||
| 1643 | Ga0316182_1320039 | |||
| 1644 | Ga0307408_100047715 | |||
| 1645 | Ga0307408_100873740 | |||
| 1646 | Ga0307408_101676379 | |||
| 1647 | Ga0307405_10001266 | |||
| 1648 | Ga0307405_10136607 | |||
| 1649 | Ga0307413_10091342 | |||
| 1650 | Ga0307410_10184906 | |||
| 1651 | Ga0307410_11373518 | |||
| 1652 | Ga0307410_11601822 | |||
| 1653 | Ga0307406_10022523 | |||
| 1654 | Ga0307406_10298908 | |||
| 1655 | Ga0307407_10034692 | |||
| 1656 | Ga0307407_10050890 | |||
| 1657 | Ga0307412_10022476 | |||
| 1658 | Ga0307412_10212485 | |||
| 1659 | Ga0307412_10469908 | |||
| 1660 | Ga0307409_100272729 | |||
| 1661 | Ga0307416_100015473 | |||
| 1662 | Ga0307416_100060710 | |||
| 1663 | Ga0307416_100109850 | |||
| 1664 | Ga0307416_102959421 | |||
| 1665 | Ga0307414_10016235 | |||
| 1666 | Ga0307414_10203463 | |||
| 1667 | Ga0307414_10659530 | |||
| 1668 | Ga0307414_11226252 | |||
| 1669 | Ga0307411_10246161 | |||
| 1670 | Ga0307415_100000375 | |||
| 1671 | Ga0307415_100216286 | |||
| 1672 | Ga0307415_100474467 | |||
| 1673 | Ga0373959_0061593 | |||
| 1674 | Ga0373938_0048186 | |||
| 1675 | Ga0373940_0064128 | |||
| 1676 | Ga0373951_0010365 | |||
| 1677 | Ga0373951_0089713 | |||
| 1678 | Ga0373932_0064128 | |||
| 1679 | Ga0373939_0128842 | |||
| 1680 | Ga0373939_0491898 | |||
| 1681 | Ga0373941_0002449 | |||
| 1682 | Ga0373942_0003998 | |||
| 1683 | Ga0373942_0142212 | |||
| 1684 | Ga0373961_0088464 | |||
| 1685 | Ga0373961_0295844 | |||
| 1686 | Ga0373931_0087837 | |||
| 1687 | Ga0373931_0494317 | |||
| 1688 | Ga0395899_0150951 | |||
| 1689 | Ga0395900_0226509 | |||
| 1690 | Ga0395898_0268191 | |||
| 1691 | Ga0395898_0696047 | |||
| 1692 | Ga0395898_1414375 | |||
| 1693 | Ga0395901_0251002 | |||
| 1694 | Ga0242422_07582 | |||
| 1695 | Ga0242420_012891 | |||
| 1696 | Ga0439448_0025831 | |||
| 1697 | Ga0439455_0001489 | |||
| 1698 | Ga0439457_112530 | |||
| 1699 | Ga0439458_0006143 | |||
| 1700 | Ga0451577_0904680 | |||
| 1701 | Ga0466972_0649523 | |||
| 1702 | Ga0453683_0116842 | |||
| 1703 | Ga0451576_1180412 | |||
| 1704 | Ga0451576_1940287 | |||
| 1705 | Ga0495663_0406864 | |||
| 1706 | Ga0496102_0372481 | |||
| 1707 | Ga0496102_1006893 | |||
| 1708 | Ga0496102_1387675 | |||
| 1709 | Ga0496104_0082361 | |||
| 1710 | Ga0496104_0366317 | |||
| 1711 | Ga0496106_0049595 | |||
| 1712 | Ga0496107_0154217 | |||
| 1713 | Ga0496108_0042092 | |||
| 1714 | Ga0496109_0700046 | |||
| 1715 | Ga0496110_0466489 | |||
| 1716 | Ga0496110_0873555 | |||
| 1717 | Ga0496112_0268596 | |||
| 1718 | Ga0496112_0485785 | |||
| 1719 | Ga0496112_0659028 | |||
| 1720 | Ga0496112_0773800 | |||
| 1721 | Ga0496113_0208993 | |||
| 1722 | Ga0496113_0819984 | |||
| 1723 | Ga0501290_026583 | |||
| 1724 | Ga0501291_002130 | |||
| 1725 | Ga0501291_003011 | |||
| 1726 | Ga0501291_007620 | |||
| 1727 | Ga0501291_116694 | |||
| 1728 | Ga0501292_001379 | |||
| 1729 | Ga0501292_010563 | |||
| 1730 | Ga0501292_073847 | |||
| 1731 | Ga0501293_010365 | |||
| 1732 | Ga0501296_005614 | |||
| 1733 | Ga0501298_001973 | |||
| 1734 | Ga0501298_003501 | |||
| 1735 | Ga0501298_014168 | |||
| 1736 | Ga0501298_107312 | |||
| 1737 | Ga0501299_002214 | |||
| 1738 | Ga0501299_010732 | |||
| 1739 | Ga0501300_004924 | |||
| 1740 | Ga0501300_011974 | |||
| 1741 | Ga0501300_063493 | |||
| 1742 | Ga0501301_008783 | |||
| 1743 | Ga0501303_008649 | |||
| 1744 | Ga0501031_0432013 | |||
| 1745 | Ga0501038_0001802 | |||
| 1746 | Ga0501041_0902727 | |||
| 1747 | Ga0501042_0940212 | |||
| 1748 | Ga0501048_0462086 | |||
| 1749 | Ga0501072_1198950 | |||
| 1750 | Ga0501198_013133 | |||
| 1751 | Ga0501198_023616 | |||
| 1752 | Ga0501198_033894 | |||
| 1753 | Ga0501201_054135 | |||
| 1754 | Ga0501202_004634 | |||
| 1755 | Ga0501202_005769 | |||
| 1756 | Ga0501202_015314 | |||
| 1757 | Ga0501202_016307 | |||
| 1758 | Ga0501206_002749 | |||
| 1759 | Ga0501206_013405 | |||
| 1760 | Ga0501207_000243 | |||
| 1761 | Ga0501207_000328 | |||
| 1762 | Ga0501207_009415 | |||
| 1763 | Ga0501208_009992 | |||
| 1764 | Ga0501208_015630 | |||
| 1765 | Ga0501208_133014 | |||
| 1766 | Ga0501209_082716 | |||
| 1767 | Ga0501209_085449 | |||
| 1768 | Ga0501209_095116 | |||
| 1769 | Ga0501210_016444 | |||
| 1770 | Ga0501214_023338 | |||
| 1771 | Ga0501214_033098 | |||
| 1772 | Ga0501216_001725 | |||
| 1773 | Ga0501216_004822 | |||
| 1774 | Ga0501216_006278 | |||
| 1775 | Ga0501216_017236 | |||
| 1776 | Ga0501216_024233 | |||
| 1777 | Ga0501216_051807 | |||
| 1778 | Ga0501217_003031 | |||
| 1779 | Ga0501217_010805 | |||
| 1780 | Ga0501217_020253 | |||
| 1781 | Ga0501217_031870 | |||
| 1782 | Ga0501217_053574 | |||
| 1783 | Ga0501223_005568 | |||
| 1784 | Ga0501223_006250 | |||
| 1785 | Ga0501223_008333 | |||
| 1786 | Ga0501224_003122 | |||
| 1787 | Ga0501224_009291 | |||
| 1788 | Ga0501224_047533 | |||
| 1789 | Ga0501227_000264 | |||
| 1790 | Ga0501227_011726 | |||
| 1791 | Ga0501227_013977 | |||
| 1792 | Ga0501227_040502 | |||
| 1793 | Ga0501228_061674 | |||
| 1794 | Ga0501230_005475 | |||
| 1795 | Ga0501230_051332 | |||
| 1796 | Ga0501230_073089 | |||
| 1797 | Ga0501233_002416 | |||
| 1798 | Ga0501233_014660 | |||
| 1799 | Ga0501233_015988 | |||
| 1800 | Ga0501233_075661 | |||
| 1801 | Ga0501235_001704 | |||
| 1802 | Ga0501235_002761 | |||
| 1803 | Ga0501235_015445 | |||
| 1804 | Ga0501235_227515 | |||
| 1805 | Ga0501236_012753 | |||
| 1806 | Ga0501236_020415 | |||
| 1807 | Ga0501236_090886 | |||
| 1808 | Ga0501238_064168 | |||
| 1809 | Ga0501239_001995 | |||
| 1810 | Ga0501240_000173 | |||
| 1811 | Ga0501240_004253 | |||
| 1812 | Ga0501240_017489 | |||
| 1813 | Ga0501242_020884 | |||
| 1814 | Ga0501242_022613 | |||
| 1815 | Ga0501242_063013 | |||
| 1816 | Ga0501243_022966 | |||
| 1817 | Ga0501243_027693 | |||
| 1818 | Ga0501246_003852 | |||
| 1819 | Ga0501247_006989 | |||
| 1820 | Ga0501249_007895 | |||
| 1821 | Ga0501249_015272 | |||
| 1822 | Ga0501250_001645 | |||
| 1823 | Ga0501250_016698 | |||
| 1824 | Ga0501251_017904 | |||
| 1825 | Ga0501252_042433 | |||
| 1826 | Ga0501253_004530 | |||
| 1827 | Ga0501253_009782 | |||
| 1828 | Ga0501253_012514 | |||
| 1829 | Ga0501253_110525 | |||
| 1830 | Ga0501255_008451 | |||
| 1831 | Ga0501256_012512 | |||
| 1832 | Ga0501256_030350 | |||
| 1833 | Ga0501257_001820 | |||
| 1834 | Ga0501257_005864 | |||
| 1835 | Ga0501257_015735 | |||
| 1836 | Ga0501257_047427 | |||
| 1837 | Ga0501259_018625 | |||
| 1838 | Ga0501259_076384 | |||
| 1839 | Ga0501260_011351 | |||
| 1840 | Ga0501260_029988 | |||
| 1841 | Ga0501261_000683 | |||
| 1842 | Ga0501261_031007 | |||
| 1843 | Ga0501219_004579 | |||
| 1844 | Ga0501221_006580 | |||
| 1845 | Ga0501221_014961 | |||
| 1846 | Ga0501221_027860 | |||
| 1847 | Ga0501221_033346 | |||
| 1848 | Ga0501221_063479 | |||
| 1849 | Ga0501225_0000255 | |||
| 1850 | Ga0501225_0007131 | |||
| 1851 | Ga0501225_0019122 | |||
| 1852 | Ga0501225_0049482 | |||
| 1853 | Ga0501229_000443 | |||
| 1854 | Ga0501229_016227 | |||
| 1855 | Ga0501234_001246 | |||
| 1856 | Ga0501234_001773 | |||
| 1857 | Ga0501234_006158 | |||
| 1858 | Ga0501234_007689 | |||
| 1859 | Ga0501234_023985 | |||
| 1860 | Ga0501245_002483 | |||
| 1861 | Ga0501245_006282 | |||
| 1862 | Ga0501245_047214 | |||
| 1863 | Ga0501241_010082 | |||
| 1864 | Ga0501263_005824 | |||
| 1865 | Ga0501263_018365 | |||
| 1866 | Ga0501264_016961 | |||
| 1867 | Ga0501266_016744 | |||
| 1868 | Ga0501266_017684 | |||
| 1869 | Ga0501268_006787 | |||
| 1870 | Ga0501268_026299 | |||
| 1871 | Ga0501268_026997 | |||
| 1872 | Ga0501269_030538 | |||
| 1873 | Ga0501269_052760 | |||
| 1874 | Ga0501270_025712 | |||
| 1875 | Ga0501271_000594 | |||
| 1876 | Ga0501271_026267 | |||
| 1877 | Ga0501272_010858 | |||
| 1878 | Ga0501272_011181 | |||
| 1879 | Ga0501273_000966 | |||
| 1880 | Ga0501273_001672 | |||
| 1881 | Ga0501273_007344 | |||
| 1882 | Ga0501273_034211 | |||
| 1883 | Ga0501274_004002 | |||
| 1884 | Ga0501275_028747 | |||
| 1885 | Ga0501276_005476 | |||
| 1886 | Ga0501278_003275 | |||
| 1887 | Ga0501278_007524 | |||
| 1888 | Ga0501279_003311 | |||
| 1889 | Ga0501283_001125 | |||
| 1890 | Ga0501283_013820 | |||
| 1891 | Ga0501283_058875 | |||
| 1892 | Ga0501204_027285 | |||
| 1893 | Ga0501212_001115 | |||
| 1894 | Ga0501212_002576 | |||
| 1895 | Ga0501212_006039 | |||
| 1896 | Ga0501212_011387 | |||
| 1897 | Ga0501226_001661 | |||
| 1898 | nmdc:mga05p37_22998_c1 | |||
| 1899 | nmdc:mga05p37_260656_c1 | |||
| 1900 | nmdc:mga05p37_362983_c1 | |||
| 1901 | nmdc:mga05p37_401054_c1 | |||
| 1902 | nmdc:mga05p37_709207_c1 | |||
| 1903 | nmdc:mga05p37_78462_c1 | |||
| 1904 | nmdc:mga09592_138414_c1 | |||
| 1905 | nmdc:mga09592_198544_c1 | |||
| 1906 | nmdc:mga0qj67_13032_c1 | |||
| 1907 | nmdc:mga0qj67_1430355_c1 | |||
| 1908 | nmdc:mga0qj67_450897_c1 | |||
| 1909 | nmdc:mga06r32_121344_c1 | |||
| 1910 | nmdc:mga06r32_204216_c1 | |||
| 1911 | nmdc:mga06r32_633132_c1 | |||
| 1912 | nmdc:mga08y16_1008811_c1 | |||
| 1913 | nmdc:mga08y16_115750_c1 | |||
| 1914 | nmdc:mga08y16_2184_c1 | |||
| 1915 | nmdc:mga08y16_30513_c1 | |||
| 1916 | nmdc:mga08y16_518259_c1 | |||
| 1917 | nmdc:mga0n895_188701_c1 | |||
| 1918 | nmdc:mga0n895_26852_c1 | |||
| 1919 | nmdc:mga0n895_396683_c1 | |||
| 1920 | nmdc:mga0n895_518106_c1 | |||
| 1921 | nmdc:mga0n895_71086_c1 | |||
| 1922 | nmdc:mga0n895_745174_c1 | |||
| 1923 | nmdc:mga0n895_750056_c1 | |||
| 1924 | nmdc:mga0rr50_31296_c1 | |||
| 1925 | nmdc:mga08x19_127361_c1 | |||
| 1926 | nmdc:mga0a205_170024_c1 | |||
| 1927 | nmdc:mga0a205_22810_c1 | |||
| 1928 | nmdc:mga0a205_275634_c1 | |||
| 1929 | nmdc:mga0a205_36146_c1 | |||
| 1930 | nmdc:mga0a205_417190_c1 | |||
| 1931 | nmdc:mga0a205_528573_c1 | |||
| 1932 | nmdc:mga0a205_651859_c1 | |||
| 1933 | nmdc:mga0a205_921649_c1 | |||
| 1934 | nmdc:mga0a205_9431_c1 | |||
| 1935 | Ga0590075_085919 | |||
| 1936 | Ga0530510_0068410 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xj3-assembly1.cif.gz_A | high resolution structure of the t55c mutant of cylr2. | 0.9656 | 24 | 68 |
| 2xi8-assembly1.cif.gz_A | high resolution structure of native cylr2 | 0.9635 | 24 | 68 |
| 7t8i-assembly1.cif.gz_B | crystal structure of the immr transcriptional regulator dna-binding domain of bacillus subtilis | 0.9343 | 7 | 69 |
| 3omt-assembly1.cif.gz_B | putative antitoxin component, chu_2935 protein, from xre family from prevotella buccae. | 0.9254 | 26 | 68 |
| 1adr-assembly1.cif.gz_A | determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor | 0.9241 | 7 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57720_1_65_1.10.260.40 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9332 | 10 | 68 | 1.10.260.40 |
| 3omtB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9253 | 26 | 68 | 1.10.260.40 |
| 1adrA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9241 | 7 | 70 | 1.10.260.40 |
| 2r1jL00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9085 | 7 | 69 | 1.10.260.40 |
| 3op9A01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9067 | 7 | 70 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B6IN19-F1-model_v4 | DNA-binding protein, putative | 0.9696 | 3 | 69 |
GO:0003677
|
| AF-A0A7C2EQZ4-F1-model_v4 | XRE family transcriptional regulator | 0.9651 | 6 | 69 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A2A3LLY6-F1-model_v4 | Transcriptional regulator | 0.9509 | 3 | 71 |
GO:0003677
|
| AF-Q026G4-F1-model_v4 | Transcriptional regulator, XRE family | 0.9489 | 4 | 69 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A1G8Y130-F1-model_v4 | DNA-binding transcriptional regulator, XRE-family HTH domain | 0.9476 | 3 | 71 |
GO:0003677
|