F487044

General Info

Members Datasets Scaffolds Average Seq Length
968 307 1936 130

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10346638|Ga0207710_103466381
Length 142
Sequence MDLLDHVAARIKDLRVNYNHGEGLSQESLATHLKVAPNTISRWETGTYRPGLKDMERLSRFFGVSINSFFPSEALDGDEDENLKALLRTARQLHPADVEELRKYAEFRRARRQRLAHTDAADAGSHHALFPGPRPMPRPHRD

Samples

Sample ID Description Type Environment
1 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
171 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
172 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
200 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
220 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
221 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
222 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
223 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
226 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
227 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
228 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
236 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
237 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
238 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
239 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
240 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
241 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
242 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
243 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
248 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
249 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
250 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
254 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
255 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
256 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
257 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
258 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
259 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
260 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
263 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
264 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
265 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
266 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
267 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
268 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
269 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
270 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
271 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
272 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
273 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
276 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
277 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
278 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
279 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
280 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
281 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
282 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
283 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
284 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
285 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
286 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
287 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
288 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
289 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
290 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
291 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
292 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
293 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
294 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
295 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
296 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.76
Rhizosphere 98.14
Stem 0
Stem Tuber 0
Unclassified 34.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207710_10346638 3300025900 Unclassified 756
2 SwRhRL2b_contig_1124966 2162886007 Unclassified 959
3 SwRhRL2b_contig_3276766 2162886007 Bacteria 3647
4 JGI24737J22298_10100234 3300001990 Bacteria 858
5 JGI24751J29686_10000019 3300002459 Bacteria 107056
6 JGI25406J46586_10024476 3300003203 Bacteria 2364
7 JGI25406J46586_10232999 3300003203 Bacteria 539
8 rootL2_10075506 3300003322 Unclassified 1461
9 Ga0065714_10028113 3300005288 Bacteria 999
10 Ga0065714_10064440 3300005288 Bacteria 109986
11 Ga0065704_10015615 3300005289 Bacteria 2038
12 Ga0065704_10074009 3300005289 Bacteria 6601
13 Ga0065704_10383613 3300005289 Unclassified 715
14 Ga0065704_10467398 3300005289 Bacteria 692
15 Ga0065704_10608295 3300005289 Unclassified 581
16 Ga0065704_10614424 3300005289 Bacteria 600
17 Ga0065712_10000120 3300005290 Bacteria 105792
18 Ga0065712_10036024 3300005290 Bacteria 2163
19 Ga0065712_10073666 3300005290 Bacteria 4311
20 Ga0065712_10101862 3300005290 Bacteria 2014
21 Ga0065712_10212885 3300005290 Bacteria 1067
22 Ga0065712_10251327 3300005290 Bacteria 950
23 Ga0065715_10012328 3300005293 Bacteria 3761
24 Ga0065715_10023030 3300005293 Unclassified 1461
25 Ga0065715_10091252 3300005293 Bacteria 5950
26 Ga0065715_10107064 3300005293 Bacteria 2792
27 Ga0065715_10140086 3300005293 Bacteria 1867
28 Ga0065715_10195369 3300005293 Bacteria 1391
29 Ga0065715_10275215 3300005293 Bacteria 1100
30 Ga0065715_10363844 3300005293 Unclassified 931
31 Ga0065715_10400984 3300005293 Bacteria 863
32 Ga0065715_10996345 3300005293 Unclassified 523
33 Ga0065707_10001216 3300005295 Bacteria 9538
34 Ga0065707_10008227 3300005295 Bacteria 2206
35 Ga0065707_10575269 3300005295 Bacteria 698
36 Ga0065707_10892237 3300005295 Bacteria 569
37 Ga0070683_100803157 3300005329 Unclassified 902
38 Ga0070683_100945892 3300005329 Unclassified 827
39 Ga0070690_100160272 3300005330 Unclassified 1541
40 Ga0070670_100000346 3300005331 Bacteria 38929
41 Ga0070670_100148222 3300005331 Unclassified 2030
42 Ga0070670_100198125 3300005331 Bacteria 1745
43 Ga0070670_100343500 3300005331 Unclassified 1310
44 Ga0070670_101441294 3300005331 Bacteria 632
45 Ga0070677_10298690 3300005333 Bacteria 817
46 Ga0068869_100199359 3300005334 Unclassified 1577
47 Ga0068869_100206140 3300005334 Unclassified 1552
48 Ga0068869_100224270 3300005334 Unclassified 1491
49 Ga0068869_100226299 3300005334 Unclassified 1484
50 Ga0068869_100282272 3300005334 Unclassified 1336
51 Ga0068869_100642531 3300005334 Unclassified 900
52 Ga0068869_100739313 3300005334 Unclassified 841
53 Ga0068869_100789054 3300005334 Bacteria 816
54 Ga0068869_101440261 3300005334 Bacteria 610
55 Ga0070680_100281067 3300005336 Bacteria 1410
56 Ga0070680_100606083 3300005336 Unclassified 940
57 Ga0070682_100001127 3300005337 Bacteria 15255
58 Ga0070682_100002771 3300005337 Bacteria 9703
59 Ga0070682_100481180 3300005337 Unclassified 958
60 Ga0068868_100339447 3300005338 Bacteria 1284
61 Ga0068868_100805469 3300005338 Bacteria 848
62 Ga0070689_100000044 3300005340 Bacteria 76920
63 Ga0070689_101116892 3300005340 Unclassified 705
64 Ga0070691_10106190 3300005341 Bacteria 1400
65 Ga0070687_100103136 3300005343 Unclassified 1601
66 Ga0070687_100394599 3300005343 Unclassified 905
67 Ga0070687_100527385 3300005343 Unclassified 800
68 Ga0070687_101051527 3300005343 Bacteria 593
69 Ga0070661_100534659 3300005344 Unclassified 942
70 Ga0070661_100589647 3300005344 Unclassified 898
71 Ga0070661_100664141 3300005344 Unclassified 847
72 Ga0070692_10110613 3300005345 Bacteria 1519
73 Ga0070692_10199863 3300005345 Bacteria 1170
74 Ga0070692_10903215 3300005345 Unclassified 611
75 Ga0070669_100063784 3300005353 Bacteria 2712
76 Ga0070669_100360586 3300005353 Unclassified 1182
77 Ga0070669_101279372 3300005353 Unclassified 635
78 Ga0070675_100219303 3300005354 Bacteria 1656
79 Ga0070675_100333294 3300005354 Bacteria 1343
80 Ga0070673_100189065 3300005364 Bacteria 1767
81 Ga0070673_100586563 3300005364 Bacteria 1015
82 Ga0070673_100623107 3300005364 Unclassified 985
83 Ga0070673_101184016 3300005364 Unclassified 716
84 Ga0070688_100235639 3300005365 Bacteria 1297
85 Ga0070688_100459069 3300005365 Unclassified 954
86 Ga0070659_100911218 3300005366 Unclassified 769
87 Ga0070703_10004025 3300005406 Unclassified 4155
88 Ga0070703_10382669 3300005406 Unclassified 608
89 Ga0070701_10134677 3300005438 Bacteria 1407
90 Ga0070701_10149871 3300005438 Bacteria 1342
91 Ga0070701_10260345 3300005438 Bacteria 1051
92 Ga0070701_10272710 3300005438 Unclassified 1030
93 Ga0070705_100003873 3300005440 Bacteria 7317
94 Ga0070705_100019681 3300005440 Bacteria 3557
95 Ga0070705_100071739 3300005440 Bacteria 2095
96 Ga0070705_100117920 3300005440 Bacteria 1708
97 Ga0070705_100539883 3300005440 Unclassified 892
98 Ga0070700_100000125 3300005441 Bacteria 46684
99 Ga0070700_100018353 3300005441 Bacteria 4021
100 Ga0070700_100028526 3300005441 Bacteria 3321
101 Ga0070700_100266213 3300005441 Bacteria 1236
102 Ga0070700_100349402 3300005441 Bacteria 1096
103 Ga0070700_100349497 3300005441 Bacteria 1096
104 Ga0070694_100034035 3300005444 Bacteria 3358
105 Ga0070694_100059546 3300005444 Bacteria 2601
106 Ga0070694_100173294 3300005444 Unclassified 1591
107 Ga0070694_100258185 3300005444 Bacteria 1321
108 Ga0070694_100569866 3300005444 Bacteria 909
109 Ga0070694_100766803 3300005444 Unclassified 789
110 Ga0070708_100779372 3300005445 Unclassified 899
111 Ga0070678_100097754 3300005456 Bacteria 2268
112 Ga0070678_100289489 3300005456 Bacteria 1388
113 Ga0070662_100022249 3300005457 Bacteria 4337
114 Ga0070681_10003957 3300005458 Bacteria 13968
115 Ga0070681_10136690 3300005458 Bacteria 2381
116 Ga0070681_10496249 3300005458 Bacteria 1134
117 Ga0070681_11826302 3300005458 Unclassified 535
118 Ga0068867_100078052 3300005459 Bacteria 2490
119 Ga0068867_100166503 3300005459 Unclassified 1742
120 Ga0068867_100870548 3300005459 Unclassified 809
121 Ga0070685_10555776 3300005466 Unclassified 820
122 Ga0070685_10842882 3300005466 Unclassified 679
123 Ga0070706_100000023 3300005467 Bacteria 159966
124 Ga0070706_100447585 3300005467 Bacteria 1202
125 Ga0070707_101604091 3300005468 Unclassified 618
126 Ga0070698_100050650 3300005471 Bacteria 4232
127 Ga0070698_100067587 3300005471 Bacteria 3593
128 Ga0070699_100041196 3300005518 Unclassified 3998
129 Ga0070699_100056039 3300005518 Bacteria 3413
130 Ga0070699_100391197 3300005518 Bacteria 1256
131 Ga0070679_100597419 3300005530 Unclassified 1047
132 Ga0070679_100880406 3300005530 Unclassified 839
133 Ga0070679_100987123 3300005530 Bacteria 786
134 Ga0070697_100432860 3300005536 Bacteria 1144
135 Ga0070697_100504831 3300005536 Bacteria 1058
136 Ga0070697_100890790 3300005536 Unclassified 789
137 Ga0070697_101679883 3300005536 Unclassified 568
138 Ga0068853_100013781 3300005539 Bacteria 6605
139 Ga0068853_100676114 3300005539 Unclassified 983
140 Ga0068853_101322753 3300005539 Unclassified 696
141 Ga0070672_100180546 3300005543 Unclassified 1759
142 Ga0070672_100396513 3300005543 Unclassified 1182
143 Ga0070686_100313842 3300005544 Bacteria 1167
144 Ga0070695_100039347 3300005545 Bacteria 2989
145 Ga0070695_100044915 3300005545 Unclassified 2815
146 Ga0070695_100066712 3300005545 Unclassified 2346
147 Ga0070695_100186141 3300005545 Bacteria 1475
148 Ga0070695_100194280 3300005545 Bacteria 1446
149 Ga0070695_100255941 3300005545 Bacteria 1276
150 Ga0070695_100267086 3300005545 Bacteria 1252
151 Ga0070695_100309997 3300005545 Bacteria 1170
152 Ga0070695_100501393 3300005545 Bacteria 939
153 Ga0070695_100813042 3300005545 Bacteria 750
154 Ga0070696_100049945 3300005546 Bacteria 2906
155 Ga0070696_100149979 3300005546 Bacteria 1710
156 Ga0070696_100268401 3300005546 Bacteria 1297
157 Ga0070696_100279213 3300005546 Bacteria 1273
158 Ga0070696_100455879 3300005546 Unclassified 1010
159 Ga0070696_100699564 3300005546 Bacteria 826
160 Ga0070696_100787870 3300005546 Unclassified 782
161 Ga0070696_101576540 3300005546 Unclassified 564
162 Ga0070693_100002115 3300005547 Bacteria 9093
163 Ga0070693_100010152 3300005547 Bacteria 4707
164 Ga0070693_100102297 3300005547 Unclassified 1747
165 Ga0070693_100110154 3300005547 Bacteria 1693
166 Ga0070693_100143052 3300005547 Bacteria 1508
167 Ga0070693_100175281 3300005547 Bacteria 1376
168 Ga0070693_100196021 3300005547 Bacteria 1309
169 Ga0070693_100246651 3300005547 Bacteria 1182
170 Ga0070693_100268671 3300005547 Bacteria 1137
171 Ga0070693_100300001 3300005547 Unclassified 1083
172 Ga0070704_100037087 3300005549 Bacteria 3327
173 Ga0070704_100041111 3300005549 Unclassified 3189
174 Ga0070704_100054561 3300005549 Unclassified 2828
175 Ga0070704_100078819 3300005549 Bacteria 2418
176 Ga0070704_100266615 3300005549 Bacteria 1413
177 Ga0070704_100674464 3300005549 Unclassified 914
178 Ga0070704_101394970 3300005549 Unclassified 643
179 Ga0068855_100551379 3300005563 Bacteria 1248
180 Ga0068855_100725061 3300005563 Bacteria 1062
181 Ga0068855_100726442 3300005563 Bacteria 1061
182 Ga0068855_101093209 3300005563 Unclassified 834
183 Ga0070664_100264479 3300005564 Bacteria 1548
184 Ga0070664_100322560 3300005564 Bacteria 1400
185 Ga0070664_100441668 3300005564 Bacteria 1193
186 Ga0070664_100539897 3300005564 Bacteria 1078
187 Ga0070664_100736540 3300005564 Bacteria 920
188 Ga0068857_100054622 3300005577 Bacteria 3544
189 Ga0068857_100353659 3300005577 Bacteria 1361
190 Ga0068857_100394831 3300005577 Bacteria 1286
191 Ga0068857_100419777 3300005577 Unclassified 1247
192 Ga0068857_100478377 3300005577 Bacteria 1167
193 Ga0068857_101350599 3300005577 Bacteria 693
194 Ga0068857_102039674 3300005577 Unclassified 563
195 Ga0068854_100057865 3300005578 Bacteria 2797
196 Ga0068854_100310574 3300005578 Bacteria 1278
197 Ga0068854_100361376 3300005578 Bacteria 1191
198 Ga0068854_100489336 3300005578 Bacteria 1034
199 Ga0068854_100499931 3300005578 Bacteria 1024
200 Ga0068854_101022609 3300005578 Unclassified 733
201 Ga0068856_101476969 3300005614 Bacteria 694
202 Ga0070702_100018928 3300005615 Bacteria 3580
203 Ga0070702_100022971 3300005615 Bacteria 3307
204 Ga0070702_100035209 3300005615 Bacteria 2765
205 Ga0070702_100122415 3300005615 Bacteria 1630
206 Ga0070702_100270011 3300005615 Bacteria 1162
207 Ga0070702_100749365 3300005615 Unclassified 750
208 Ga0068852_100039203 3300005616 Unclassified 3988
209 Ga0068852_100291188 3300005616 Bacteria 1577
210 Ga0068852_100387216 3300005616 Bacteria 1373
211 Ga0068852_101657042 3300005616 Unclassified 662
212 Ga0068859_100015015 3300005617 Bacteria 7774
213 Ga0068859_100022720 3300005617 Bacteria 6289
214 Ga0068859_100073575 3300005617 Bacteria 3455
215 Ga0068859_100080338 3300005617 Bacteria 3302
216 Ga0068859_100089077 3300005617 Unclassified 3136
217 Ga0068859_100109980 3300005617 Bacteria 2817
218 Ga0068859_100134085 3300005617 Unclassified 2548
219 Ga0068859_100164410 3300005617 Bacteria 2298
220 Ga0068859_100189562 3300005617 Bacteria 2140
221 Ga0068859_100278784 3300005617 Bacteria 1764
222 Ga0068859_100465154 3300005617 Unclassified 1360
223 Ga0068859_101350484 3300005617 Bacteria 786
224 Ga0068859_102262485 3300005617 Bacteria 600
225 Ga0068864_100027054 3300005618 Bacteria 4839
226 Ga0068864_100359568 3300005618 Bacteria 1375
227 Ga0068864_100395480 3300005618 Bacteria 1312
228 Ga0068864_100401501 3300005618 Bacteria 1302
229 Ga0068864_100451381 3300005618 Bacteria 1229
230 Ga0068864_100470316 3300005618 Unclassified 1205
231 Ga0068864_100664557 3300005618 Bacteria 1015
232 Ga0068864_100862142 3300005618 Bacteria 893
233 Ga0068864_100954837 3300005618 Bacteria 848
234 Ga0068864_101004663 3300005618 Unclassified 827
235 Ga0068864_101075341 3300005618 Bacteria 800
236 Ga0068864_101244968 3300005618 Bacteria 743
237 Ga0068864_101374496 3300005618 Unclassified 707
238 Ga0068864_102435512 3300005618 Bacteria 530
239 Ga0068866_10665161 3300005718 Unclassified 710
240 Ga0068861_100002213 3300005719 Bacteria 12614
241 Ga0068861_100169838 3300005719 Bacteria 1807
242 Ga0068861_100194343 3300005719 Bacteria 1699
243 Ga0068861_100786484 3300005719 Unclassified 892
244 Ga0068851_10025301 3300005834 Unclassified 2911
245 Ga0068870_10013965 3300005840 Unclassified 3784
246 Ga0068870_10056984 3300005840 Bacteria 2088
247 Ga0068870_10119803 3300005840 Bacteria 1514
248 Ga0068870_10524120 3300005840 Unclassified 794
249 Ga0068870_11357262 3300005840 Unclassified 519
250 Ga0068863_100094641 3300005841 Unclassified 2835
251 Ga0068863_100116160 3300005841 Bacteria 2550
252 Ga0068863_100162102 3300005841 Bacteria 2143
253 Ga0068863_100293623 3300005841 Bacteria 1576
254 Ga0068863_100375113 3300005841 Bacteria 1388
255 Ga0068863_100438495 3300005841 Bacteria 1281
256 Ga0068863_100520756 3300005841 Bacteria 1172
257 Ga0068863_100682732 3300005841 Bacteria 1020
258 Ga0068858_100046058 3300005842 Unclassified 4043
259 Ga0068858_100053496 3300005842 Bacteria 3734
260 Ga0068858_100206277 3300005842 Bacteria 1859
261 Ga0068858_100327596 3300005842 Bacteria 1465
262 Ga0068858_100749164 3300005842 Unclassified 952
263 Ga0068858_100943256 3300005842 Bacteria 844
264 Ga0068858_101069755 3300005842 Bacteria 791
265 Ga0068858_101719198 3300005842 Bacteria 620
266 Ga0068860_100023687 3300005843 Bacteria 5935
267 Ga0068860_100028498 3300005843 Bacteria 5375
268 Ga0068860_100063050 3300005843 Bacteria 3521
269 Ga0068860_100174895 3300005843 Bacteria 2075
270 Ga0068860_100586881 3300005843 Bacteria 1119
271 Ga0068860_100810442 3300005843 Unclassified 950
272 Ga0068860_101403472 3300005843 Unclassified 720
273 Ga0068860_102460137 3300005843 Unclassified 540
274 Ga0068862_100108748 3300005844 Bacteria 2432
275 Ga0068862_100247811 3300005844 Bacteria 1622
276 Ga0068862_100385764 3300005844 Bacteria 1308
277 Ga0068862_100399463 3300005844 Bacteria 1285
278 Ga0068862_100485844 3300005844 Bacteria 1170
279 Ga0068862_100590506 3300005844 Bacteria 1065
280 Ga0068862_101228612 3300005844 Bacteria 749
281 Ga0068862_101800365 3300005844 Unclassified 622
282 Ga0081455_10309459 3300005937 Bacteria 1130
283 Ga0081539_10002717 3300005985 Bacteria 23958
284 Ga0081539_10004414 3300005985 Bacteria 15576
285 Ga0081539_10087171 3300005985 Bacteria 1622
286 Ga0081539_10355351 3300005985 Bacteria 615
287 Ga0075432_10344755 3300006058 Unclassified 630
288 Ga0070716_100026339 3300006173 Unclassified 3113
289 Ga0097621_100046192 3300006237 Bacteria 3522
290 Ga0068871_100000760 3300006358 Bacteria 21770
291 Ga0068871_100127823 3300006358 Bacteria 2152
292 Ga0068871_100385439 3300006358 Bacteria 1246
293 Ga0075428_100751609 3300006844 Bacteria 1037
294 Ga0075428_102316314 3300006844 Unclassified 552
295 Ga0075430_100107057 3300006846 Unclassified 2332
296 Ga0075430_100119214 3300006846 Bacteria 2200
297 Ga0075430_100182855 3300006846 Bacteria 1743
298 Ga0075430_100736298 3300006846 Bacteria 813
299 Ga0075431_100086739 3300006847 Unclassified 3230
300 Ga0075431_102118497 3300006847 Bacteria 517
301 Ga0075433_10049633 3300006852 Unclassified 3651
302 Ga0075433_10075408 3300006852 Bacteria 2968
303 Ga0075433_10116880 3300006852 Unclassified 2366
304 Ga0075433_10358402 3300006852 Bacteria 1288
305 Ga0075433_10452587 3300006852 Bacteria 1132
306 Ga0075433_10495570 3300006852 Bacteria 1076
307 Ga0075433_11605457 3300006852 Unclassified 561
308 Ga0075434_100005377 3300006871 Bacteria 11649
309 Ga0075434_100026013 3300006871 Bacteria 5730
310 Ga0075434_100536018 3300006871 Bacteria 1190
311 Ga0075434_100640168 3300006871 Bacteria 1082
312 Ga0075429_100019970 3300006880 Bacteria 5810
313 Ga0075429_100398090 3300006880 Bacteria 1206
314 Ga0075429_101364963 3300006880 Unclassified 617
315 Ga0068865_100356413 3300006881 Bacteria 1186
316 Ga0068865_100919402 3300006881 Bacteria 762
317 Ga0068865_101728428 3300006881 Unclassified 564
318 Ga0075436_100005064 3300006914 Bacteria 9071
319 Ga0097620_100015018 3300006931 Bacteria 7774
320 Ga0097620_100022719 3300006931 Bacteria 6289
321 Ga0097620_100073578 3300006931 Bacteria 3455
322 Ga0097620_100080340 3300006931 Bacteria 3302
323 Ga0097620_100089070 3300006931 Unclassified 3136
324 Ga0097620_100109974 3300006931 Bacteria 2817
325 Ga0097620_100134082 3300006931 Unclassified 2548
326 Ga0097620_100164405 3300006931 Bacteria 2298
327 Ga0097620_100189572 3300006931 Bacteria 2140
328 Ga0097620_100278784 3300006931 Bacteria 1764
329 Ga0097620_100465192 3300006931 Unclassified 1360
330 Ga0097620_101350300 3300006931 Bacteria 786
331 Ga0097620_102262491 3300006931 Bacteria 600
332 Ga0075435_100152686 3300007076 Bacteria 1942
333 Ga0105251_10076915 3300009011 Bacteria 1548
334 Ga0105251_10133622 3300009011 Bacteria 1124
335 Ga0105251_10143094 3300009011 Bacteria 1082
336 Ga0105250_10091857 3300009092 Bacteria 1235
337 Ga0105240_10040645 3300009093 Bacteria 5945
338 Ga0105240_10072551 3300009093 Unclassified 4255
339 Ga0105240_10715680 3300009093 Bacteria 1091
340 Ga0105240_10767635 3300009093 Bacteria 1047
341 Ga0105240_11351954 3300009093 Unclassified 750
342 Ga0111539_10004211 3300009094 Bacteria 18875
343 Ga0111539_10008723 3300009094 Bacteria 12862
344 Ga0111539_10422488 3300009094 Bacteria 1553
345 Ga0111539_10718129 3300009094 Bacteria 1163
346 Ga0111539_11173111 3300009094 Unclassified 892
347 Ga0105245_10168589 3300009098 Unclassified 2083
348 Ga0105245_10624677 3300009098 Bacteria 1106
349 Ga0105245_10820521 3300009098 Bacteria 969
350 Ga0105245_10913224 3300009098 Unclassified 920
351 Ga0105245_11116709 3300009098 Unclassified 835
352 Ga0105247_10000526 3300009101 Bacteria 31200
353 Ga0105247_10011661 3300009101 Bacteria 5293
354 Ga0105247_10091931 3300009101 Bacteria 1927
355 Ga0105247_10112380 3300009101 Bacteria 1755
356 Ga0105247_10315655 3300009101 Bacteria 1089
357 Ga0105247_10842272 3300009101 Bacteria 703
358 Ga0105247_10883234 3300009101 Bacteria 689
359 Ga0105247_10944991 3300009101 Unclassified 669
360 Ga0105247_11484842 3300009101 Bacteria 552
361 Ga0105247_11810374 3300009101 Unclassified 508
362 Ga0114129_10055687 3300009147 Bacteria 5542
363 Ga0114129_10075834 3300009147 Unclassified 4682
364 Ga0114129_10204705 3300009147 Unclassified 2671
365 Ga0114129_10214769 3300009147 Bacteria 2598
366 Ga0114129_10674603 3300009147 Unclassified 1331
367 Ga0114129_10856146 3300009147 Bacteria 1155
368 Ga0114129_11017787 3300009147 Bacteria 1042
369 Ga0105243_10044582 3300009148 Bacteria 3480
370 Ga0105243_10116416 3300009148 Bacteria 2245
371 Ga0105243_10146413 3300009148 Bacteria 2021
372 Ga0105243_10190904 3300009148 Bacteria 1789
373 Ga0105243_10518573 3300009148 Bacteria 1133
374 Ga0105243_10643001 3300009148 Bacteria 1027
375 Ga0105243_10647786 3300009148 Bacteria 1023
376 Ga0105243_10666645 3300009148 Bacteria 1010
377 Ga0105243_11434271 3300009148 Unclassified 712
378 Ga0105243_11483407 3300009148 Unclassified 701
379 Ga0105243_12434719 3300009148 Unclassified 562
380 Ga0105241_10007263 3300009174 Bacteria 8155
381 Ga0105241_10020968 3300009174 Unclassified 4830
382 Ga0105241_10052871 3300009174 Bacteria 3103
383 Ga0105241_10188566 3300009174 Bacteria 1715
384 Ga0105241_10194947 3300009174 Bacteria 1688
385 Ga0105241_10219684 3300009174 Bacteria 1596
386 Ga0105241_10228436 3300009174 Bacteria 1568
387 Ga0105241_11087016 3300009174 Bacteria 752
388 Ga0105241_11244961 3300009174 Unclassified 706
389 Ga0105241_11303406 3300009174 Unclassified 692
390 Ga0105241_11805001 3300009174 Unclassified 597
391 Ga0105242_10007475 3300009176 Bacteria 8411
392 Ga0105242_12340846 3300009176 Unclassified 581
393 Ga0105248_10018844 3300009177 Bacteria 7634
394 Ga0105248_10041271 3300009177 Bacteria 5172
395 Ga0105248_10078702 3300009177 Bacteria 3706
396 Ga0105248_10162038 3300009177 Unclassified 2522
397 Ga0105248_10387052 3300009177 Unclassified 1574
398 Ga0105248_10793108 3300009177 Bacteria 1069
399 Ga0105248_11117821 3300009177 Unclassified 891
400 Ga0105248_11405565 3300009177 Unclassified 790
401 Ga0105248_12480896 3300009177 Unclassified 591
402 Ga0105237_10000816 3300009545 Bacteria 42597
403 Ga0105237_10125406 3300009545 Bacteria 2562
404 Ga0105237_10162913 3300009545 Bacteria 2229
405 Ga0105238_10000779 3300009551 Bacteria 33108
406 Ga0105238_10034315 3300009551 Bacteria 5162
407 Ga0105238_12410789 3300009551 Bacteria 562
408 Ga0105249_10001132 3300009553 Bacteria 23574
409 Ga0105249_10347192 3300009553 Bacteria 1502
410 Ga0105249_10594359 3300009553 Bacteria 1161
411 Ga0105249_10773835 3300009553 Bacteria 1023
412 Ga0105249_11292843 3300009553 Unclassified 801
413 Ga0105239_10208485 3300010375 Bacteria 2190
414 Ga0105239_10221569 3300010375 Bacteria 2121
415 Ga0105239_10634642 3300010375 Bacteria 1219
416 Ga0105239_10848848 3300010375 Bacteria 1047
417 Ga0105239_11036882 3300010375 Bacteria 943
418 Ga0105239_11520367 3300010375 Unclassified 774
419 Ga0105246_10040674 3300011119 Bacteria 3139
420 Ga0105246_10156568 3300011119 Bacteria 1731
421 Ga0105246_10491808 3300011119 Bacteria 1040
422 Ga0105246_11610308 3300011119 Bacteria 614
423 Ga0157373_10000670 3300013100 Bacteria 26739
424 Ga0157373_10029505 3300013100 Bacteria 3950
425 Ga0157373_10044202 3300013100 Bacteria 3180
426 Ga0157373_10122376 3300013100 Bacteria 1829
427 Ga0157373_10163982 3300013100 Bacteria 1564
428 Ga0157373_10277372 3300013100 Bacteria 1187
429 Ga0157373_10315535 3300013100 Bacteria 1111
430 Ga0157371_10148491 3300013102 Unclassified 1671
431 Ga0157371_10949458 3300013102 Unclassified 654
432 Ga0157374_10494099 3300013296 Unclassified 1228
433 Ga0157374_10526494 3300013296 Bacteria 1188
434 Ga0157378_10062988 3300013297 Bacteria 3313
435 Ga0157378_11090305 3300013297 Unclassified 835
436 Ga0157378_12017694 3300013297 Unclassified 627
437 Ga0163162_10375476 3300013306 Unclassified 1555
438 Ga0163162_10394326 3300013306 Unclassified 1517
439 Ga0163162_10427141 3300013306 Bacteria 1457
440 Ga0163162_10662625 3300013306 Bacteria 1167
441 Ga0163162_12832608 3300013306 Unclassified 558
442 Ga0157372_10177506 3300013307 Unclassified 2465
443 Ga0157372_10607100 3300013307 Bacteria 1275
444 Ga0157372_10631850 3300013307 Bacteria 1247
445 Ga0157372_11252430 3300013307 Bacteria 856
446 Ga0157375_10040579 3300013308 Bacteria 4488
447 Ga0157375_10233948 3300013308 Unclassified 1996
448 Ga0157375_10440343 3300013308 Bacteria 1469
449 Ga0157375_10527911 3300013308 Bacteria 1343
450 Ga0157375_10593771 3300013308 Bacteria 1267
451 Ga0163163_10000214 3300014325 Bacteria 60034
452 Ga0163163_10010530 3300014325 Bacteria 8321
453 Ga0163163_10140964 3300014325 Bacteria 2453
454 Ga0163163_10839098 3300014325 Bacteria 982
455 Ga0163163_10849856 3300014325 Unclassified 976
456 Ga0163163_11701924 3300014325 Unclassified 691
457 Ga0163163_12748263 3300014325 Unclassified 549
458 Ga0157380_10336642 3300014326 Bacteria 1406
459 Ga0157380_10597182 3300014326 Bacteria 1091
460 Ga0157377_10418705 3300014745 Unclassified 917
461 Ga0157377_10623590 3300014745 Unclassified 772
462 Ga0157377_10682880 3300014745 Unclassified 743
463 Ga0157377_10769297 3300014745 Unclassified 707
464 Ga0157379_10261251 3300014968 Unclassified 1573
465 Ga0157379_10338600 3300014968 Bacteria 1375
466 Ga0157379_10542242 3300014968 Bacteria 1082
467 Ga0182006_1096172 3300015261 Unclassified 1058
468 Ga0207697_10059731 3300025315 Bacteria 1585
469 Ga0207656_10001265 3300025321 Bacteria 8329
470 Ga0207713_1083399 3300025735 Bacteria 1143
471 Ga0207653_10000549 3300025885 Bacteria 13841
472 Ga0207653_10072643 3300025885 Unclassified 1178
473 Ga0207653_10404532 3300025885 Unclassified 535
474 Ga0207642_10588919 3300025899 Unclassified 691
475 Ga0207710_10004418 3300025900 Bacteria 6141
476 Ga0207710_10034363 3300025900 Unclassified 2227
477 Ga0207710_10058172 3300025900 Bacteria 1747
478 Ga0207710_10135421 3300025900 Unclassified 1186
479 Ga0207688_10058121 3300025901 Bacteria 2176
480 Ga0207647_10003121 3300025904 Bacteria 12445
481 Ga0207647_10049025 3300025904 Bacteria 2621
482 Ga0207647_10067515 3300025904 Unclassified 2167
483 Ga0207647_10168814 3300025904 Bacteria 1274
484 Ga0207647_10184030 3300025904 Unclassified 1212
485 Ga0207647_10459084 3300025904 Unclassified 713
486 Ga0207645_10283368 3300025907 Bacteria 1101
487 Ga0207643_10001972 3300025908 Bacteria 11330
488 Ga0207643_10018839 3300025908 Unclassified 3781
489 Ga0207643_10045371 3300025908 Bacteria 2482
490 Ga0207643_10185295 3300025908 Bacteria 1261
491 Ga0207643_10274162 3300025908 Bacteria 1045
492 Ga0207684_10000146 3300025910 Bacteria 125829
493 Ga0207684_10213385 3300025910 Bacteria 1665
494 Ga0207654_10009731 3300025911 Bacteria 4890
495 Ga0207654_10029368 3300025911 Bacteria 3009
496 Ga0207654_10087240 3300025911 Bacteria 1893
497 Ga0207654_10154278 3300025911 Bacteria 1477
498 Ga0207654_10187495 3300025911 Bacteria 1353
499 Ga0207654_10273949 3300025911 Bacteria 1139
500 Ga0207707_10038582 3300025912 Bacteria 4174
501 Ga0207707_10083812 3300025912 Bacteria 2784
502 Ga0207707_10516932 3300025912 Bacteria 1017
503 Ga0207695_10034759 3300025913 Bacteria 5476
504 Ga0207695_10036854 3300025913 Bacteria 5281
505 Ga0207671_10001750 3300025914 Bacteria 24416
506 Ga0207671_10071998 3300025914 Bacteria 2579
507 Ga0207671_10256967 3300025914 Bacteria 1374
508 Ga0207671_10767142 3300025914 Unclassified 766
509 Ga0207660_10130214 3300025917 Bacteria 1914
510 Ga0207660_10254739 3300025917 Bacteria 1386
511 Ga0207660_10392781 3300025917 Bacteria 1116
512 Ga0207660_11046238 3300025917 Unclassified 666
513 Ga0207662_10027016 3300025918 Bacteria 3313
514 Ga0207662_10045339 3300025918 Bacteria 2599
515 Ga0207662_10157424 3300025918 Bacteria 1449
516 Ga0207662_10743454 3300025918 Bacteria 689
517 Ga0207657_10333296 3300025919 Bacteria 1198
518 Ga0207652_10809222 3300025921 Unclassified 832
519 Ga0207646_10152022 3300025922 Bacteria 2088
520 Ga0207681_10008794 3300025923 Bacteria 6169
521 Ga0207681_10083516 3300025923 Bacteria 2261
522 Ga0207681_10341017 3300025923 Unclassified 1197
523 Ga0207694_10004094 3300025924 Bacteria 11463
524 Ga0207694_10435291 3300025924 Bacteria 1093
525 Ga0207650_10000007 3300025925 Bacteria 530810
526 Ga0207650_10078606 3300025925 Bacteria 2496
527 Ga0207650_10312213 3300025925 Bacteria 1286
528 Ga0207650_10404006 3300025925 Bacteria 1131
529 Ga0207650_10657401 3300025925 Unclassified 884
530 Ga0207650_10874816 3300025925 Bacteria 763
531 Ga0207650_11474641 3300025925 Bacteria 578
532 Ga0207659_10173923 3300025926 Bacteria 1701
533 Ga0207659_11359529 3300025926 Unclassified 609
534 Ga0207659_11614303 3300025926 Bacteria 553
535 Ga0207687_10266134 3300025927 Unclassified 1368
536 Ga0207687_10479736 3300025927 Bacteria 1035
537 Ga0207690_10618443 3300025932 Bacteria 885
538 Ga0207690_10715667 3300025932 Unclassified 824
539 Ga0207706_10029540 3300025933 Bacteria 4893
540 Ga0207706_10246264 3300025933 Bacteria 1562
541 Ga0207686_10022224 3300025934 Bacteria 3651
542 Ga0207709_10006367 3300025935 Bacteria 6627
543 Ga0207709_10030077 3300025935 Bacteria 3156
544 Ga0207709_10233290 3300025935 Bacteria 1334
545 Ga0207709_10484306 3300025935 Unclassified 962
546 Ga0207709_10756140 3300025935 Bacteria 782
547 Ga0207709_10908230 3300025935 Bacteria 716
548 Ga0207709_11727958 3300025935 Bacteria 520
549 Ga0207670_10030125 3300025936 Bacteria 3464
550 Ga0207670_10370270 3300025936 Bacteria 1139
551 Ga0207670_10453648 3300025936 Bacteria 1034
552 Ga0207670_10459477 3300025936 Bacteria 1028
553 Ga0207670_10802581 3300025936 Unclassified 784
554 Ga0207704_10462736 3300025938 Bacteria 1015
555 Ga0207665_10021765 3300025939 Unclassified 4219
556 Ga0207691_10181576 3300025940 Unclassified 1838
557 Ga0207691_10214582 3300025940 Bacteria 1671
558 Ga0207691_10464779 3300025940 Bacteria 1076
559 Ga0207711_10008195 3300025941 Bacteria 8747
560 Ga0207711_10081257 3300025941 Bacteria 2832
561 Ga0207711_10166388 3300025941 Unclassified 1999
562 Ga0207711_10210726 3300025941 Bacteria 1775
563 Ga0207711_10435264 3300025941 Bacteria 1220
564 Ga0207689_10026381 3300025942 Bacteria 4865
565 Ga0207689_10096461 3300025942 Unclassified 2428
566 Ga0207689_10096959 3300025942 Bacteria 2422
567 Ga0207689_10117175 3300025942 Bacteria 2190
568 Ga0207689_10128589 3300025942 Bacteria 2084
569 Ga0207689_10164173 3300025942 Bacteria 1830
570 Ga0207689_10186976 3300025942 Bacteria 1708
571 Ga0207689_10312321 3300025942 Bacteria 1304
572 Ga0207689_10580843 3300025942 Unclassified 942
573 Ga0207689_10722868 3300025942 Bacteria 840
574 Ga0207689_10761279 3300025942 Bacteria 817
575 Ga0207661_10893470 3300025944 Unclassified 818
576 Ga0207679_10395855 3300025945 Bacteria 1214
577 Ga0207679_10487078 3300025945 Bacteria 1099
578 Ga0207679_11245287 3300025945 Unclassified 683
579 Ga0207679_11274958 3300025945 Bacteria 674
580 Ga0207679_11751042 3300025945 Unclassified 568
581 Ga0207667_10359971 3300025949 Bacteria 1484
582 Ga0207667_11738995 3300025949 Bacteria 589
583 Ga0207651_10182392 3300025960 Unclassified 1666
584 Ga0207651_10202213 3300025960 Bacteria 1593
585 Ga0207651_10242796 3300025960 Bacteria 1469
586 Ga0207651_10522093 3300025960 Bacteria 1029
587 Ga0207651_10617340 3300025960 Bacteria 949
588 Ga0207651_10709629 3300025960 Bacteria 887
589 Ga0207651_11947664 3300025960 Unclassified 528
590 Ga0207712_10004684 3300025961 Bacteria 8648
591 Ga0207640_10046220 3300025981 Bacteria 2800
592 Ga0207640_10208212 3300025981 Bacteria 1488
593 Ga0207640_10412281 3300025981 Bacteria 1103
594 Ga0207640_10472686 3300025981 Unclassified 1038
595 Ga0207640_10503827 3300025981 Bacteria 1009
596 Ga0207640_11090062 3300025981 Unclassified 706
597 Ga0207640_11286694 3300025981 Unclassified 652
598 Ga0207677_10739036 3300026023 Bacteria 876
599 Ga0207677_11094795 3300026023 Bacteria 726
600 Ga0207703_10253793 3300026035 Bacteria 1586
601 Ga0207703_10257710 3300026035 Bacteria 1575
602 Ga0207703_10305664 3300026035 Unclassified 1452
603 Ga0207703_10493513 3300026035 Bacteria 1148
604 Ga0207703_11579756 3300026035 Unclassified 631
605 Ga0207639_10365318 3300026041 Bacteria 1292
606 Ga0207639_10396027 3300026041 Bacteria 1243
607 Ga0207639_10520845 3300026041 Unclassified 1089
608 Ga0207639_11184573 3300026041 Unclassified 717
609 Ga0207708_10000069 3300026075 Bacteria 82187
610 Ga0207708_10046121 3300026075 Bacteria 3320
611 Ga0207708_10210405 3300026075 Bacteria 1554
612 Ga0207708_10390290 3300026075 Bacteria 1149
613 Ga0207708_10875689 3300026075 Unclassified 776
614 Ga0207708_11287876 3300026075 Bacteria 640
615 Ga0207702_11366362 3300026078 Bacteria 702
616 Ga0207641_10011847 3300026088 Bacteria 7156
617 Ga0207641_10144160 3300026088 Bacteria 2152
618 Ga0207641_10240139 3300026088 Bacteria 1688
619 Ga0207641_10345902 3300026088 Bacteria 1416
620 Ga0207641_10350355 3300026088 Bacteria 1407
621 Ga0207641_10427498 3300026088 Bacteria 1276
622 Ga0207641_10519567 3300026088 Bacteria 1158
623 Ga0207641_11000453 3300026088 Unclassified 833
624 Ga0207648_10031671 3300026089 Bacteria 4674
625 Ga0207648_10092414 3300026089 Unclassified 2646
626 Ga0207648_10355248 3300026089 Unclassified 1322
627 Ga0207648_10427253 3300026089 Unclassified 1204
628 Ga0207648_11845803 3300026089 Bacteria 566
629 Ga0207648_12040826 3300026089 Bacteria 535
630 Ga0207676_10000753 3300026095 Bacteria 25322
631 Ga0207676_10001748 3300026095 Bacteria 15937
632 Ga0207676_10121064 3300026095 Bacteria 2207
633 Ga0207676_10505232 3300026095 Bacteria 1148
634 Ga0207676_10557628 3300026095 Bacteria 1095
635 Ga0207676_10941831 3300026095 Unclassified 849
636 Ga0207674_10030422 3300026116 Bacteria 5676
637 Ga0207674_10107197 3300026116 Bacteria 2771
638 Ga0207674_10144627 3300026116 Bacteria 2336
639 Ga0207674_10222155 3300026116 Bacteria 1837
640 Ga0207674_10228584 3300026116 Bacteria 1808
641 Ga0207674_10412398 3300026116 Bacteria 1305
642 Ga0207674_11389211 3300026116 Bacteria 671
643 Ga0207674_11599950 3300026116 Unclassified 620
644 Ga0207674_11798875 3300026116 Unclassified 580
645 Ga0207675_100005671 3300026118 Bacteria 11949
646 Ga0207675_100028141 3300026118 Bacteria 5233
647 Ga0207675_100209979 3300026118 Bacteria 1872
648 Ga0207675_100320690 3300026118 Unclassified 1513
649 Ga0207675_100524414 3300026118 Unclassified 1181
650 Ga0207675_100552483 3300026118 Bacteria 1151
651 Ga0207675_101146063 3300026118 Unclassified 798
652 Ga0207683_10220277 3300026121 Bacteria 1729
653 Ga0207698_10110417 3300026142 Bacteria 2303
654 Ga0207698_10380254 3300026142 Bacteria 1343
655 Ga0207698_10974584 3300026142 Bacteria 858
656 Ga0207698_11287880 3300026142 Bacteria 745
657 Ga0207428_10001993 3300027907 Bacteria 20707
658 Ga0207428_10046030 3300027907 Unclassified 3510
659 Ga0207428_10506298 3300027907 Unclassified 877
660 Ga0268265_10046161 3300028380 Bacteria 3255
661 Ga0268265_10124782 3300028380 Bacteria 2128
662 Ga0268265_10763397 3300028380 Bacteria 939
663 Ga0268265_10904433 3300028380 Unclassified 867
664 Ga0268265_11187130 3300028380 Unclassified 760
665 Ga0268265_11216414 3300028380 Bacteria 751
666 Ga0268264_10026404 3300028381 Unclassified 4745
667 Ga0268264_10069770 3300028381 Bacteria 2973
668 Ga0268264_10255478 3300028381 Bacteria 1630
669 Ga0268264_10292869 3300028381 Unclassified 1529
670 Ga0268264_10449001 3300028381 Bacteria 1249
671 Ga0268264_10789535 3300028381 Unclassified 948
672 Ga0268264_11124432 3300028381 Bacteria 794
673 Ga0316176_1111201 3300030732 Bacteria 1130
674 Ga0316180_1134593 3300030736 Unclassified 781
675 Ga0316182_1320039 3300030745 Unclassified 598
676 Ga0307408_100047715 3300031548 Bacteria 3068
677 Ga0307408_100873740 3300031548 Unclassified 821
678 Ga0307408_101676379 3300031548 Unclassified 605
679 Ga0307405_10001266 3300031731 Bacteria 10521
680 Ga0307405_10136607 3300031731 Unclassified 1703
681 Ga0307413_10091342 3300031824 Unclassified 1983
682 Ga0307410_10184906 3300031852 Unclassified 1581
683 Ga0307410_11373518 3300031852 Unclassified 619
684 Ga0307410_11601822 3300031852 Bacteria 575
685 Ga0307406_10022523 3300031901 Bacteria 3738
686 Ga0307406_10298908 3300031901 Unclassified 1236
687 Ga0307407_10034692 3300031903 Bacteria 2765
688 Ga0307407_10050890 3300031903 Bacteria 2372
689 Ga0307412_10022476 3300031911 Bacteria 3867
690 Ga0307412_10212485 3300031911 Bacteria 1477
691 Ga0307412_10469908 3300031911 Bacteria 1040
692 Ga0307409_100272729 3300031995 Unclassified 1559
693 Ga0307416_100015473 3300032002 Bacteria 5273
694 Ga0307416_100060710 3300032002 Bacteria 3081
695 Ga0307416_100109850 3300032002 Bacteria 2426
696 Ga0307416_102959421 3300032002 Unclassified 568
697 Ga0307414_10016235 3300032004 Bacteria 4521
698 Ga0307414_10203463 3300032004 Bacteria 1612
699 Ga0307414_10659530 3300032004 Unclassified 944
700 Ga0307414_11226252 3300032004 Bacteria 695
701 Ga0307411_10246161 3300032005 Bacteria 1403
702 Ga0307415_100000375 3300032126 Bacteria 19088
703 Ga0307415_100216286 3300032126 Bacteria 1533
704 Ga0307415_100474467 3300032126 Bacteria 1087
705 Ga0373959_0061593 3300034820 Unclassified 831
706 Ga0373938_0048186 3300034957 Unclassified 966
707 Ga0373940_0064128 3300035088 Bacteria 1057
708 Ga0373951_0010365 3300035091 Bacteria 2092
709 Ga0373951_0089713 3300035091 Bacteria 805
710 Ga0373932_0064128 3300035112 Bacteria 1124
711 Ga0373939_0128842 3300035114 Unclassified 901
712 Ga0373939_0491898 3300035114 Unclassified 522
713 Ga0373941_0002449 3300035115 Bacteria 4088
714 Ga0373942_0003998 3300035207 Bacteria 3441
715 Ga0373942_0142212 3300035207 Unclassified 765
716 Ga0373961_0088464 3300035241 Unclassified 986
717 Ga0373961_0295844 3300035241 Unclassified 598
718 Ga0373931_0087837 3300035691 Bacteria 1727
719 Ga0373931_0494317 3300035691 Unclassified 788
720 Ga0395899_0150951 3300037312 Bacteria 1647
721 Ga0395900_0226509 3300037418 Bacteria 1882
722 Ga0395898_0268191 3300037466 Unclassified 1628
723 Ga0395898_0696047 3300037466 Unclassified 958
724 Ga0395898_1414375 3300037466 Unclassified 623
725 Ga0395901_0251002 3300038443 Unclassified 1843
726 Ga0242422_07582 3300038699 Unclassified 640
727 Ga0242420_012891 3300038996 Bacteria 1420
728 Ga0439448_0025831 3300042005 Bacteria 1844
729 Ga0439455_0001489 3300042012 Bacteria 3933
730 Ga0439457_112530 3300042014 Unclassified 640
731 Ga0439458_0006143 3300042157 Bacteria 2680
732 Ga0451577_0904680 3300042876 Unclassified 795
733 Ga0466972_0649523 3300044658 Unclassified 500
734 Ga0453683_0116842 3300044673 Bacteria 1679
735 Ga0451576_1180412 3300045051 Bacteria 800
736 Ga0451576_1940287 3300045051 Unclassified 607
737 Ga0495663_0406864 3300046525 Unclassified 501
738 Ga0496102_0372481 3300048905 Bacteria 1344
739 Ga0496102_1006893 3300048905 Unclassified 754
740 Ga0496102_1387675 3300048905 Unclassified 622
741 Ga0496104_0082361 3300048907 Bacteria 3069
742 Ga0496104_0366317 3300048907 Unclassified 1353
743 Ga0496106_0049595 3300048909 Bacteria 3163
744 Ga0496107_0154217 3300048910 Bacteria 1700
745 Ga0496108_0042092 3300048911 Bacteria 3813
746 Ga0496109_0700046 3300048912 Bacteria 951
747 Ga0496110_0466489 3300048913 Bacteria 1151
748 Ga0496110_0873555 3300048913 Unclassified 805
749 Ga0496112_0268596 3300048915 Bacteria 1654
750 Ga0496112_0485785 3300048915 Bacteria 1171
751 Ga0496112_0659028 3300048915 Unclassified 976
752 Ga0496112_0773800 3300048915 Bacteria 885
753 Ga0496113_0208993 3300048916 Bacteria 1553
754 Ga0496113_0819984 3300048916 Unclassified 739
755 Ga0501290_026583 3300049513 Unclassified 813
756 Ga0501291_002130 3300049514 Bacteria 2346
757 Ga0501291_003011 3300049514 Bacteria 2072
758 Ga0501291_007620 3300049514 Bacteria 1473
759 Ga0501291_116694 3300049514 Unclassified 574
760 Ga0501292_001379 3300049515 Bacteria 2994
761 Ga0501292_010563 3300049515 Bacteria 1384
762 Ga0501292_073847 3300049515 Unclassified 638
763 Ga0501293_010365 3300049516 Bacteria 805
764 Ga0501296_005614 3300049519 Bacteria 1404
765 Ga0501298_001973 3300049521 Bacteria 3067
766 Ga0501298_003501 3300049521 Unclassified 2433
767 Ga0501298_014168 3300049521 Bacteria 1421
768 Ga0501298_107312 3300049521 Unclassified 643
769 Ga0501299_002214 3300049522 Bacteria 2668
770 Ga0501299_010732 3300049522 Bacteria 1535
771 Ga0501300_004924 3300049523 Unclassified 1972
772 Ga0501300_011974 3300049523 Bacteria 1263
773 Ga0501300_063493 3300049523 Unclassified 588
774 Ga0501301_008783 3300049524 Unclassified 802
775 Ga0501303_008649 3300049526 Bacteria 928
776 Ga0501031_0432013 3300049568 Bacteria 851
777 Ga0501038_0001802 3300049574 Bacteria 19834
778 Ga0501041_0902727 3300049577 Bacteria 568
779 Ga0501042_0940212 3300049578 Unclassified 630
780 Ga0501048_0462086 3300049582 Unclassified 909
781 Ga0501072_1198950 3300049588 Unclassified 590
782 Ga0501198_013133 3300049649 Bacteria 1251
783 Ga0501198_023616 3300049649 Unclassified 991
784 Ga0501198_033894 3300049649 Bacteria 862
785 Ga0501201_054135 3300049651 Bacteria 507
786 Ga0501202_004634 3300049652 Bacteria 2409
787 Ga0501202_005769 3300049652 Unclassified 2198
788 Ga0501202_015314 3300049652 Bacteria 1476
789 Ga0501202_016307 3300049652 Unclassified 1440
790 Ga0501206_002749 3300049653 Unclassified 2216
791 Ga0501206_013405 3300049653 Bacteria 1120
792 Ga0501207_000243 3300049654 Bacteria 5547
793 Ga0501207_000328 3300049654 Bacteria 5092
794 Ga0501207_009415 3300049654 Bacteria 1427
795 Ga0501208_009992 3300049655 Bacteria 1328
796 Ga0501208_015630 3300049655 Bacteria 1168
797 Ga0501208_133014 3300049655 Unclassified 556
798 Ga0501209_082716 3300049656 Unclassified 927
799 Ga0501209_085449 3300049656 Bacteria 913
800 Ga0501209_095116 3300049656 Unclassified 869
801 Ga0501210_016444 3300049657 Unclassified 658
802 Ga0501214_023338 3300049659 Unclassified 802
803 Ga0501214_033098 3300049659 Bacteria 719
804 Ga0501216_001725 3300049660 Bacteria 2995
805 Ga0501216_004822 3300049660 Bacteria 2014
806 Ga0501216_006278 3300049660 Bacteria 1819
807 Ga0501216_017236 3300049660 Bacteria 1233
808 Ga0501216_024233 3300049660 Bacteria 1083
809 Ga0501216_051807 3300049660 Unclassified 808
810 Ga0501217_003031 3300049661 Bacteria 3362
811 Ga0501217_010805 3300049661 Bacteria 2008
812 Ga0501217_020253 3300049661 Bacteria 1560
813 Ga0501217_031870 3300049661 Bacteria 1301
814 Ga0501217_053574 3300049661 Bacteria 1061
815 Ga0501223_005568 3300049663 Bacteria 2642
816 Ga0501223_006250 3300049663 Bacteria 2470
817 Ga0501223_008333 3300049663 Unclassified 2113
818 Ga0501224_003122 3300049664 Unclassified 2298
819 Ga0501224_009291 3300049664 Unclassified 1437
820 Ga0501224_047533 3300049664 Unclassified 654
821 Ga0501227_000264 3300049665 Bacteria 10779
822 Ga0501227_011726 3300049665 Bacteria 1913
823 Ga0501227_013977 3300049665 Bacteria 1775
824 Ga0501227_040502 3300049665 Unclassified 1149
825 Ga0501228_061674 3300049666 Unclassified 532
826 Ga0501230_005475 3300049667 Unclassified 1799
827 Ga0501230_051332 3300049667 Unclassified 819
828 Ga0501230_073089 3300049667 Unclassified 708
829 Ga0501233_002416 3300049668 Bacteria 3290
830 Ga0501233_014660 3300049668 Bacteria 1604
831 Ga0501233_015988 3300049668 Unclassified 1551
832 Ga0501233_075661 3300049668 Bacteria 859
833 Ga0501235_001704 3300049669 Bacteria 4715
834 Ga0501235_002761 3300049669 Unclassified 3777
835 Ga0501235_015445 3300049669 Bacteria 1683
836 Ga0501235_227515 3300049669 Unclassified 514
837 Ga0501236_012753 3300049670 Bacteria 1139
838 Ga0501236_020415 3300049670 Unclassified 974
839 Ga0501236_090886 3300049670 Unclassified 586
840 Ga0501238_064168 3300049671 Unclassified 564
841 Ga0501239_001995 3300049672 Bacteria 1818
842 Ga0501240_000173 3300049673 Bacteria 4514
843 Ga0501240_004253 3300049673 Bacteria 1651
844 Ga0501240_017489 3300049673 Bacteria 1044
845 Ga0501242_020884 3300049674 Bacteria 843
846 Ga0501242_022613 3300049674 Unclassified 817
847 Ga0501242_063013 3300049674 Unclassified 567
848 Ga0501243_022966 3300049675 Bacteria 1036
849 Ga0501243_027693 3300049675 Unclassified 957
850 Ga0501246_003852 3300049676 Bacteria 1221
851 Ga0501247_006989 3300049677 Bacteria 1289
852 Ga0501249_007895 3300049679 Bacteria 2208
853 Ga0501249_015272 3300049679 Bacteria 1641
854 Ga0501250_001645 3300049680 Bacteria 1894
855 Ga0501250_016698 3300049680 Unclassified 914
856 Ga0501251_017904 3300049681 Unclassified 914
857 Ga0501252_042433 3300049682 Unclassified 664
858 Ga0501253_004530 3300049683 Bacteria 1761
859 Ga0501253_009782 3300049683 Bacteria 1424
860 Ga0501253_012514 3300049683 Bacteria 1331
861 Ga0501253_110525 3300049683 Unclassified 655
862 Ga0501255_008451 3300049684 Unclassified 1117
863 Ga0501256_012512 3300049685 Unclassified 828
864 Ga0501256_030350 3300049685 Unclassified 606
865 Ga0501257_001820 3300049686 Bacteria 4445
866 Ga0501257_005864 3300049686 Unclassified 2716
867 Ga0501257_015735 3300049686 Bacteria 1749
868 Ga0501257_047427 3300049686 Bacteria 1065
869 Ga0501259_018625 3300049688 Bacteria 1215
870 Ga0501259_076384 3300049688 Bacteria 728
871 Ga0501260_011351 3300049689 Unclassified 901
872 Ga0501260_029988 3300049689 Unclassified 623
873 Ga0501261_000683 3300049690 Unclassified 4248
874 Ga0501261_031007 3300049690 Unclassified 808
875 Ga0501219_004579 3300049703 Unclassified 985
876 Ga0501221_006580 3300049704 Bacteria 1970
877 Ga0501221_014961 3300049704 Bacteria 1450
878 Ga0501221_027860 3300049704 Bacteria 1158
879 Ga0501221_033346 3300049704 Unclassified 1086
880 Ga0501221_063479 3300049704 Bacteria 858
881 Ga0501225_0000255 3300049705 Bacteria 16710
882 Ga0501225_0007131 3300049705 Unclassified 3247
883 Ga0501225_0019122 3300049705 Bacteria 1896
884 Ga0501225_0049482 3300049705 Unclassified 1168
885 Ga0501229_000443 3300049706 Bacteria 4669
886 Ga0501229_016227 3300049706 Unclassified 968
887 Ga0501234_001246 3300049707 Bacteria 4001
888 Ga0501234_001773 3300049707 Bacteria 3401
889 Ga0501234_006158 3300049707 Unclassified 1879
890 Ga0501234_007689 3300049707 Bacteria 1684
891 Ga0501234_023985 3300049707 Unclassified 977
892 Ga0501245_002483 3300049708 Unclassified 2465
893 Ga0501245_006282 3300049708 Bacteria 1658
894 Ga0501245_047214 3300049708 Bacteria 754
895 Ga0501241_010082 3300049758 Bacteria 1719
896 Ga0501263_005824 3300049760 Unclassified 1404
897 Ga0501263_018365 3300049760 Unclassified 925
898 Ga0501264_016961 3300049761 Bacteria 745
899 Ga0501266_016744 3300049763 Unclassified 976
900 Ga0501266_017684 3300049763 Unclassified 955
901 Ga0501268_006787 3300049765 Unclassified 1691
902 Ga0501268_026299 3300049765 Unclassified 1028
903 Ga0501268_026997 3300049765 Bacteria 1018
904 Ga0501269_030538 3300049766 Unclassified 692
905 Ga0501269_052760 3300049766 Unclassified 562
906 Ga0501270_025712 3300049767 Bacteria 934
907 Ga0501271_000594 3300049768 Bacteria 3132
908 Ga0501271_026267 3300049768 Bacteria 699
909 Ga0501272_010858 3300049769 Bacteria 1020
910 Ga0501272_011181 3300049769 Bacteria 1008
911 Ga0501273_000966 3300049770 Unclassified 2568
912 Ga0501273_001672 3300049770 Unclassified 2157
913 Ga0501273_007344 3300049770 Unclassified 1295
914 Ga0501273_034211 3300049770 Unclassified 733
915 Ga0501274_004002 3300049771 Unclassified 1203
916 Ga0501275_028747 3300049772 Bacteria 725
917 Ga0501276_005476 3300049773 Unclassified 978
918 Ga0501278_003275 3300049774 Unclassified 1146
919 Ga0501278_007524 3300049774 Unclassified 829
920 Ga0501279_003311 3300049775 Bacteria 2099
921 Ga0501283_001125 3300049779 Bacteria 3514
922 Ga0501283_013820 3300049779 Bacteria 1227
923 Ga0501283_058875 3300049779 Unclassified 691
924 Ga0501204_027285 3300049850 Unclassified 776
925 Ga0501212_001115 3300049851 Unclassified 2937
926 Ga0501212_002576 3300049851 Bacteria 2200
927 Ga0501212_006039 3300049851 Unclassified 1622
928 Ga0501212_011387 3300049851 Bacteria 1281
929 Ga0501226_001661 3300049853 Bacteria 2820
930 nmdc:mga05p37_22998_c1 3300050507 Bacteria 7561
931 nmdc:mga05p37_260656_c1 3300050507 Bacteria 2075
932 nmdc:mga05p37_362983_c1 3300050507 Bacteria 1702
933 nmdc:mga05p37_401054_c1 3300050507 Unclassified 1601
934 nmdc:mga05p37_709207_c1 3300050507 Bacteria 1116
935 nmdc:mga05p37_78462_c1 3300050507 Bacteria 4066
936 nmdc:mga09592_138414_c1 3300050508 Unclassified 2098
937 nmdc:mga09592_198544_c1 3300050508 Bacteria 1737
938 nmdc:mga0qj67_13032_c1 3300050509 Bacteria 6277
939 nmdc:mga0qj67_1430355_c1 3300050509 Unclassified 533
940 nmdc:mga0qj67_450897_c1 3300050509 Bacteria 1036
941 nmdc:mga06r32_121344_c1 3300050510 Unclassified 2578
942 nmdc:mga06r32_204216_c1 3300050510 Unclassified 1964
943 nmdc:mga06r32_633132_c1 3300050510 Bacteria 1039
944 nmdc:mga08y16_1008811_c1 3300050511 Unclassified 812
945 nmdc:mga08y16_115750_c1 3300050511 Bacteria 2791
946 nmdc:mga08y16_2184_c1 3300050511 Bacteria 20071
947 nmdc:mga08y16_30513_c1 3300050511 Bacteria 5673
948 nmdc:mga08y16_518259_c1 3300050511 Bacteria 1209
949 nmdc:mga0n895_188701_c1 3300050512 Unclassified 2092
950 nmdc:mga0n895_26852_c1 3300050512 Bacteria 5461
951 nmdc:mga0n895_396683_c1 3300050512 Bacteria 1395
952 nmdc:mga0n895_518106_c1 3300050512 Bacteria 1200
953 nmdc:mga0n895_71086_c1 3300050512 Unclassified 3450
954 nmdc:mga0n895_745174_c1 3300050512 Bacteria 973
955 nmdc:mga0n895_750056_c1 3300050512 Unclassified 969
956 nmdc:mga0rr50_31296_c1 3300050513 Bacteria 3777
957 nmdc:mga08x19_127361_c1 3300050514 Bacteria 1711
958 nmdc:mga0a205_170024_c1 3300050515 Bacteria 2076
959 nmdc:mga0a205_22810_c1 3300050515 Bacteria 5934
960 nmdc:mga0a205_275634_c1 3300050515 Bacteria 1558
961 nmdc:mga0a205_36146_c1 3300050515 Bacteria 4745
962 nmdc:mga0a205_417190_c1 3300050515 Bacteria 1205
963 nmdc:mga0a205_528573_c1 3300050515 Unclassified 1036
964 nmdc:mga0a205_651859_c1 3300050515 Unclassified 904
965 nmdc:mga0a205_921649_c1 3300050515 Unclassified 720
966 nmdc:mga0a205_9431_c1 3300050515 Bacteria 8923
967 Ga0590075_085919 3300059424 Unclassified 816
968 Ga0530510_0068410 3300061734 Bacteria 2576
969 Ga0207710_10346638
970 SwRhRL2b_contig_1124966
971 SwRhRL2b_contig_3276766
972 JGI24737J22298_10100234
973 JGI24751J29686_10000019
974 JGI25406J46586_10024476
975 JGI25406J46586_10232999
976 rootL2_10075506
977 Ga0065714_10028113
978 Ga0065714_10064440
979 Ga0065704_10015615
980 Ga0065704_10074009
981 Ga0065704_10383613
982 Ga0065704_10467398
983 Ga0065704_10608295
984 Ga0065704_10614424
985 Ga0065712_10000120
986 Ga0065712_10036024
987 Ga0065712_10073666
988 Ga0065712_10101862
989 Ga0065712_10212885
990 Ga0065712_10251327
991 Ga0065715_10012328
992 Ga0065715_10023030
993 Ga0065715_10091252
994 Ga0065715_10107064
995 Ga0065715_10140086
996 Ga0065715_10195369
997 Ga0065715_10275215
998 Ga0065715_10363844
999 Ga0065715_10400984
1000 Ga0065715_10996345
1001 Ga0065707_10001216
1002 Ga0065707_10008227
1003 Ga0065707_10575269
1004 Ga0065707_10892237
1005 Ga0070683_100803157
1006 Ga0070683_100945892
1007 Ga0070690_100160272
1008 Ga0070670_100000346
1009 Ga0070670_100148222
1010 Ga0070670_100198125
1011 Ga0070670_100343500
1012 Ga0070670_101441294
1013 Ga0070677_10298690
1014 Ga0068869_100199359
1015 Ga0068869_100206140
1016 Ga0068869_100224270
1017 Ga0068869_100226299
1018 Ga0068869_100282272
1019 Ga0068869_100642531
1020 Ga0068869_100739313
1021 Ga0068869_100789054
1022 Ga0068869_101440261
1023 Ga0070680_100281067
1024 Ga0070680_100606083
1025 Ga0070682_100001127
1026 Ga0070682_100002771
1027 Ga0070682_100481180
1028 Ga0068868_100339447
1029 Ga0068868_100805469
1030 Ga0070689_100000044
1031 Ga0070689_101116892
1032 Ga0070691_10106190
1033 Ga0070687_100103136
1034 Ga0070687_100394599
1035 Ga0070687_100527385
1036 Ga0070687_101051527
1037 Ga0070661_100534659
1038 Ga0070661_100589647
1039 Ga0070661_100664141
1040 Ga0070692_10110613
1041 Ga0070692_10199863
1042 Ga0070692_10903215
1043 Ga0070669_100063784
1044 Ga0070669_100360586
1045 Ga0070669_101279372
1046 Ga0070675_100219303
1047 Ga0070675_100333294
1048 Ga0070673_100189065
1049 Ga0070673_100586563
1050 Ga0070673_100623107
1051 Ga0070673_101184016
1052 Ga0070688_100235639
1053 Ga0070688_100459069
1054 Ga0070659_100911218
1055 Ga0070703_10004025
1056 Ga0070703_10382669
1057 Ga0070701_10134677
1058 Ga0070701_10149871
1059 Ga0070701_10260345
1060 Ga0070701_10272710
1061 Ga0070705_100003873
1062 Ga0070705_100019681
1063 Ga0070705_100071739
1064 Ga0070705_100117920
1065 Ga0070705_100539883
1066 Ga0070700_100000125
1067 Ga0070700_100018353
1068 Ga0070700_100028526
1069 Ga0070700_100266213
1070 Ga0070700_100349402
1071 Ga0070700_100349497
1072 Ga0070694_100034035
1073 Ga0070694_100059546
1074 Ga0070694_100173294
1075 Ga0070694_100258185
1076 Ga0070694_100569866
1077 Ga0070694_100766803
1078 Ga0070708_100779372
1079 Ga0070678_100097754
1080 Ga0070678_100289489
1081 Ga0070662_100022249
1082 Ga0070681_10003957
1083 Ga0070681_10136690
1084 Ga0070681_10496249
1085 Ga0070681_11826302
1086 Ga0068867_100078052
1087 Ga0068867_100166503
1088 Ga0068867_100870548
1089 Ga0070685_10555776
1090 Ga0070685_10842882
1091 Ga0070706_100000023
1092 Ga0070706_100447585
1093 Ga0070707_101604091
1094 Ga0070698_100050650
1095 Ga0070698_100067587
1096 Ga0070699_100041196
1097 Ga0070699_100056039
1098 Ga0070699_100391197
1099 Ga0070679_100597419
1100 Ga0070679_100880406
1101 Ga0070679_100987123
1102 Ga0070697_100432860
1103 Ga0070697_100504831
1104 Ga0070697_100890790
1105 Ga0070697_101679883
1106 Ga0068853_100013781
1107 Ga0068853_100676114
1108 Ga0068853_101322753
1109 Ga0070672_100180546
1110 Ga0070672_100396513
1111 Ga0070686_100313842
1112 Ga0070695_100039347
1113 Ga0070695_100044915
1114 Ga0070695_100066712
1115 Ga0070695_100186141
1116 Ga0070695_100194280
1117 Ga0070695_100255941
1118 Ga0070695_100267086
1119 Ga0070695_100309997
1120 Ga0070695_100501393
1121 Ga0070695_100813042
1122 Ga0070696_100049945
1123 Ga0070696_100149979
1124 Ga0070696_100268401
1125 Ga0070696_100279213
1126 Ga0070696_100455879
1127 Ga0070696_100699564
1128 Ga0070696_100787870
1129 Ga0070696_101576540
1130 Ga0070693_100002115
1131 Ga0070693_100010152
1132 Ga0070693_100102297
1133 Ga0070693_100110154
1134 Ga0070693_100143052
1135 Ga0070693_100175281
1136 Ga0070693_100196021
1137 Ga0070693_100246651
1138 Ga0070693_100268671
1139 Ga0070693_100300001
1140 Ga0070704_100037087
1141 Ga0070704_100041111
1142 Ga0070704_100054561
1143 Ga0070704_100078819
1144 Ga0070704_100266615
1145 Ga0070704_100674464
1146 Ga0070704_101394970
1147 Ga0068855_100551379
1148 Ga0068855_100725061
1149 Ga0068855_100726442
1150 Ga0068855_101093209
1151 Ga0070664_100264479
1152 Ga0070664_100322560
1153 Ga0070664_100441668
1154 Ga0070664_100539897
1155 Ga0070664_100736540
1156 Ga0068857_100054622
1157 Ga0068857_100353659
1158 Ga0068857_100394831
1159 Ga0068857_100419777
1160 Ga0068857_100478377
1161 Ga0068857_101350599
1162 Ga0068857_102039674
1163 Ga0068854_100057865
1164 Ga0068854_100310574
1165 Ga0068854_100361376
1166 Ga0068854_100489336
1167 Ga0068854_100499931
1168 Ga0068854_101022609
1169 Ga0068856_101476969
1170 Ga0070702_100018928
1171 Ga0070702_100022971
1172 Ga0070702_100035209
1173 Ga0070702_100122415
1174 Ga0070702_100270011
1175 Ga0070702_100749365
1176 Ga0068852_100039203
1177 Ga0068852_100291188
1178 Ga0068852_100387216
1179 Ga0068852_101657042
1180 Ga0068859_100015015
1181 Ga0068859_100022720
1182 Ga0068859_100073575
1183 Ga0068859_100080338
1184 Ga0068859_100089077
1185 Ga0068859_100109980
1186 Ga0068859_100134085
1187 Ga0068859_100164410
1188 Ga0068859_100189562
1189 Ga0068859_100278784
1190 Ga0068859_100465154
1191 Ga0068859_101350484
1192 Ga0068859_102262485
1193 Ga0068864_100027054
1194 Ga0068864_100359568
1195 Ga0068864_100395480
1196 Ga0068864_100401501
1197 Ga0068864_100451381
1198 Ga0068864_100470316
1199 Ga0068864_100664557
1200 Ga0068864_100862142
1201 Ga0068864_100954837
1202 Ga0068864_101004663
1203 Ga0068864_101075341
1204 Ga0068864_101244968
1205 Ga0068864_101374496
1206 Ga0068864_102435512
1207 Ga0068866_10665161
1208 Ga0068861_100002213
1209 Ga0068861_100169838
1210 Ga0068861_100194343
1211 Ga0068861_100786484
1212 Ga0068851_10025301
1213 Ga0068870_10013965
1214 Ga0068870_10056984
1215 Ga0068870_10119803
1216 Ga0068870_10524120
1217 Ga0068870_11357262
1218 Ga0068863_100094641
1219 Ga0068863_100116160
1220 Ga0068863_100162102
1221 Ga0068863_100293623
1222 Ga0068863_100375113
1223 Ga0068863_100438495
1224 Ga0068863_100520756
1225 Ga0068863_100682732
1226 Ga0068858_100046058
1227 Ga0068858_100053496
1228 Ga0068858_100206277
1229 Ga0068858_100327596
1230 Ga0068858_100749164
1231 Ga0068858_100943256
1232 Ga0068858_101069755
1233 Ga0068858_101719198
1234 Ga0068860_100023687
1235 Ga0068860_100028498
1236 Ga0068860_100063050
1237 Ga0068860_100174895
1238 Ga0068860_100586881
1239 Ga0068860_100810442
1240 Ga0068860_101403472
1241 Ga0068860_102460137
1242 Ga0068862_100108748
1243 Ga0068862_100247811
1244 Ga0068862_100385764
1245 Ga0068862_100399463
1246 Ga0068862_100485844
1247 Ga0068862_100590506
1248 Ga0068862_101228612
1249 Ga0068862_101800365
1250 Ga0081455_10309459
1251 Ga0081539_10002717
1252 Ga0081539_10004414
1253 Ga0081539_10087171
1254 Ga0081539_10355351
1255 Ga0075432_10344755
1256 Ga0070716_100026339
1257 Ga0097621_100046192
1258 Ga0068871_100000760
1259 Ga0068871_100127823
1260 Ga0068871_100385439
1261 Ga0075428_100751609
1262 Ga0075428_102316314
1263 Ga0075430_100107057
1264 Ga0075430_100119214
1265 Ga0075430_100182855
1266 Ga0075430_100736298
1267 Ga0075431_100086739
1268 Ga0075431_102118497
1269 Ga0075433_10049633
1270 Ga0075433_10075408
1271 Ga0075433_10116880
1272 Ga0075433_10358402
1273 Ga0075433_10452587
1274 Ga0075433_10495570
1275 Ga0075433_11605457
1276 Ga0075434_100005377
1277 Ga0075434_100026013
1278 Ga0075434_100536018
1279 Ga0075434_100640168
1280 Ga0075429_100019970
1281 Ga0075429_100398090
1282 Ga0075429_101364963
1283 Ga0068865_100356413
1284 Ga0068865_100919402
1285 Ga0068865_101728428
1286 Ga0075436_100005064
1287 Ga0097620_100015018
1288 Ga0097620_100022719
1289 Ga0097620_100073578
1290 Ga0097620_100080340
1291 Ga0097620_100089070
1292 Ga0097620_100109974
1293 Ga0097620_100134082
1294 Ga0097620_100164405
1295 Ga0097620_100189572
1296 Ga0097620_100278784
1297 Ga0097620_100465192
1298 Ga0097620_101350300
1299 Ga0097620_102262491
1300 Ga0075435_100152686
1301 Ga0105251_10076915
1302 Ga0105251_10133622
1303 Ga0105251_10143094
1304 Ga0105250_10091857
1305 Ga0105240_10040645
1306 Ga0105240_10072551
1307 Ga0105240_10715680
1308 Ga0105240_10767635
1309 Ga0105240_11351954
1310 Ga0111539_10004211
1311 Ga0111539_10008723
1312 Ga0111539_10422488
1313 Ga0111539_10718129
1314 Ga0111539_11173111
1315 Ga0105245_10168589
1316 Ga0105245_10624677
1317 Ga0105245_10820521
1318 Ga0105245_10913224
1319 Ga0105245_11116709
1320 Ga0105247_10000526
1321 Ga0105247_10011661
1322 Ga0105247_10091931
1323 Ga0105247_10112380
1324 Ga0105247_10315655
1325 Ga0105247_10842272
1326 Ga0105247_10883234
1327 Ga0105247_10944991
1328 Ga0105247_11484842
1329 Ga0105247_11810374
1330 Ga0114129_10055687
1331 Ga0114129_10075834
1332 Ga0114129_10204705
1333 Ga0114129_10214769
1334 Ga0114129_10674603
1335 Ga0114129_10856146
1336 Ga0114129_11017787
1337 Ga0105243_10044582
1338 Ga0105243_10116416
1339 Ga0105243_10146413
1340 Ga0105243_10190904
1341 Ga0105243_10518573
1342 Ga0105243_10643001
1343 Ga0105243_10647786
1344 Ga0105243_10666645
1345 Ga0105243_11434271
1346 Ga0105243_11483407
1347 Ga0105243_12434719
1348 Ga0105241_10007263
1349 Ga0105241_10020968
1350 Ga0105241_10052871
1351 Ga0105241_10188566
1352 Ga0105241_10194947
1353 Ga0105241_10219684
1354 Ga0105241_10228436
1355 Ga0105241_11087016
1356 Ga0105241_11244961
1357 Ga0105241_11303406
1358 Ga0105241_11805001
1359 Ga0105242_10007475
1360 Ga0105242_12340846
1361 Ga0105248_10018844
1362 Ga0105248_10041271
1363 Ga0105248_10078702
1364 Ga0105248_10162038
1365 Ga0105248_10387052
1366 Ga0105248_10793108
1367 Ga0105248_11117821
1368 Ga0105248_11405565
1369 Ga0105248_12480896
1370 Ga0105237_10000816
1371 Ga0105237_10125406
1372 Ga0105237_10162913
1373 Ga0105238_10000779
1374 Ga0105238_10034315
1375 Ga0105238_12410789
1376 Ga0105249_10001132
1377 Ga0105249_10347192
1378 Ga0105249_10594359
1379 Ga0105249_10773835
1380 Ga0105249_11292843
1381 Ga0105239_10208485
1382 Ga0105239_10221569
1383 Ga0105239_10634642
1384 Ga0105239_10848848
1385 Ga0105239_11036882
1386 Ga0105239_11520367
1387 Ga0105246_10040674
1388 Ga0105246_10156568
1389 Ga0105246_10491808
1390 Ga0105246_11610308
1391 Ga0157373_10000670
1392 Ga0157373_10029505
1393 Ga0157373_10044202
1394 Ga0157373_10122376
1395 Ga0157373_10163982
1396 Ga0157373_10277372
1397 Ga0157373_10315535
1398 Ga0157371_10148491
1399 Ga0157371_10949458
1400 Ga0157374_10494099
1401 Ga0157374_10526494
1402 Ga0157378_10062988
1403 Ga0157378_11090305
1404 Ga0157378_12017694
1405 Ga0163162_10375476
1406 Ga0163162_10394326
1407 Ga0163162_10427141
1408 Ga0163162_10662625
1409 Ga0163162_12832608
1410 Ga0157372_10177506
1411 Ga0157372_10607100
1412 Ga0157372_10631850
1413 Ga0157372_11252430
1414 Ga0157375_10040579
1415 Ga0157375_10233948
1416 Ga0157375_10440343
1417 Ga0157375_10527911
1418 Ga0157375_10593771
1419 Ga0163163_10000214
1420 Ga0163163_10010530
1421 Ga0163163_10140964
1422 Ga0163163_10839098
1423 Ga0163163_10849856
1424 Ga0163163_11701924
1425 Ga0163163_12748263
1426 Ga0157380_10336642
1427 Ga0157380_10597182
1428 Ga0157377_10418705
1429 Ga0157377_10623590
1430 Ga0157377_10682880
1431 Ga0157377_10769297
1432 Ga0157379_10261251
1433 Ga0157379_10338600
1434 Ga0157379_10542242
1435 Ga0182006_1096172
1436 Ga0207697_10059731
1437 Ga0207656_10001265
1438 Ga0207713_1083399
1439 Ga0207653_10000549
1440 Ga0207653_10072643
1441 Ga0207653_10404532
1442 Ga0207642_10588919
1443 Ga0207710_10004418
1444 Ga0207710_10034363
1445 Ga0207710_10058172
1446 Ga0207710_10135421
1447 Ga0207688_10058121
1448 Ga0207647_10003121
1449 Ga0207647_10049025
1450 Ga0207647_10067515
1451 Ga0207647_10168814
1452 Ga0207647_10184030
1453 Ga0207647_10459084
1454 Ga0207645_10283368
1455 Ga0207643_10001972
1456 Ga0207643_10018839
1457 Ga0207643_10045371
1458 Ga0207643_10185295
1459 Ga0207643_10274162
1460 Ga0207684_10000146
1461 Ga0207684_10213385
1462 Ga0207654_10009731
1463 Ga0207654_10029368
1464 Ga0207654_10087240
1465 Ga0207654_10154278
1466 Ga0207654_10187495
1467 Ga0207654_10273949
1468 Ga0207707_10038582
1469 Ga0207707_10083812
1470 Ga0207707_10516932
1471 Ga0207695_10034759
1472 Ga0207695_10036854
1473 Ga0207671_10001750
1474 Ga0207671_10071998
1475 Ga0207671_10256967
1476 Ga0207671_10767142
1477 Ga0207660_10130214
1478 Ga0207660_10254739
1479 Ga0207660_10392781
1480 Ga0207660_11046238
1481 Ga0207662_10027016
1482 Ga0207662_10045339
1483 Ga0207662_10157424
1484 Ga0207662_10743454
1485 Ga0207657_10333296
1486 Ga0207652_10809222
1487 Ga0207646_10152022
1488 Ga0207681_10008794
1489 Ga0207681_10083516
1490 Ga0207681_10341017
1491 Ga0207694_10004094
1492 Ga0207694_10435291
1493 Ga0207650_10000007
1494 Ga0207650_10078606
1495 Ga0207650_10312213
1496 Ga0207650_10404006
1497 Ga0207650_10657401
1498 Ga0207650_10874816
1499 Ga0207650_11474641
1500 Ga0207659_10173923
1501 Ga0207659_11359529
1502 Ga0207659_11614303
1503 Ga0207687_10266134
1504 Ga0207687_10479736
1505 Ga0207690_10618443
1506 Ga0207690_10715667
1507 Ga0207706_10029540
1508 Ga0207706_10246264
1509 Ga0207686_10022224
1510 Ga0207709_10006367
1511 Ga0207709_10030077
1512 Ga0207709_10233290
1513 Ga0207709_10484306
1514 Ga0207709_10756140
1515 Ga0207709_10908230
1516 Ga0207709_11727958
1517 Ga0207670_10030125
1518 Ga0207670_10370270
1519 Ga0207670_10453648
1520 Ga0207670_10459477
1521 Ga0207670_10802581
1522 Ga0207704_10462736
1523 Ga0207665_10021765
1524 Ga0207691_10181576
1525 Ga0207691_10214582
1526 Ga0207691_10464779
1527 Ga0207711_10008195
1528 Ga0207711_10081257
1529 Ga0207711_10166388
1530 Ga0207711_10210726
1531 Ga0207711_10435264
1532 Ga0207689_10026381
1533 Ga0207689_10096461
1534 Ga0207689_10096959
1535 Ga0207689_10117175
1536 Ga0207689_10128589
1537 Ga0207689_10164173
1538 Ga0207689_10186976
1539 Ga0207689_10312321
1540 Ga0207689_10580843
1541 Ga0207689_10722868
1542 Ga0207689_10761279
1543 Ga0207661_10893470
1544 Ga0207679_10395855
1545 Ga0207679_10487078
1546 Ga0207679_11245287
1547 Ga0207679_11274958
1548 Ga0207679_11751042
1549 Ga0207667_10359971
1550 Ga0207667_11738995
1551 Ga0207651_10182392
1552 Ga0207651_10202213
1553 Ga0207651_10242796
1554 Ga0207651_10522093
1555 Ga0207651_10617340
1556 Ga0207651_10709629
1557 Ga0207651_11947664
1558 Ga0207712_10004684
1559 Ga0207640_10046220
1560 Ga0207640_10208212
1561 Ga0207640_10412281
1562 Ga0207640_10472686
1563 Ga0207640_10503827
1564 Ga0207640_11090062
1565 Ga0207640_11286694
1566 Ga0207677_10739036
1567 Ga0207677_11094795
1568 Ga0207703_10253793
1569 Ga0207703_10257710
1570 Ga0207703_10305664
1571 Ga0207703_10493513
1572 Ga0207703_11579756
1573 Ga0207639_10365318
1574 Ga0207639_10396027
1575 Ga0207639_10520845
1576 Ga0207639_11184573
1577 Ga0207708_10000069
1578 Ga0207708_10046121
1579 Ga0207708_10210405
1580 Ga0207708_10390290
1581 Ga0207708_10875689
1582 Ga0207708_11287876
1583 Ga0207702_11366362
1584 Ga0207641_10011847
1585 Ga0207641_10144160
1586 Ga0207641_10240139
1587 Ga0207641_10345902
1588 Ga0207641_10350355
1589 Ga0207641_10427498
1590 Ga0207641_10519567
1591 Ga0207641_11000453
1592 Ga0207648_10031671
1593 Ga0207648_10092414
1594 Ga0207648_10355248
1595 Ga0207648_10427253
1596 Ga0207648_11845803
1597 Ga0207648_12040826
1598 Ga0207676_10000753
1599 Ga0207676_10001748
1600 Ga0207676_10121064
1601 Ga0207676_10505232
1602 Ga0207676_10557628
1603 Ga0207676_10941831
1604 Ga0207674_10030422
1605 Ga0207674_10107197
1606 Ga0207674_10144627
1607 Ga0207674_10222155
1608 Ga0207674_10228584
1609 Ga0207674_10412398
1610 Ga0207674_11389211
1611 Ga0207674_11599950
1612 Ga0207674_11798875
1613 Ga0207675_100005671
1614 Ga0207675_100028141
1615 Ga0207675_100209979
1616 Ga0207675_100320690
1617 Ga0207675_100524414
1618 Ga0207675_100552483
1619 Ga0207675_101146063
1620 Ga0207683_10220277
1621 Ga0207698_10110417
1622 Ga0207698_10380254
1623 Ga0207698_10974584
1624 Ga0207698_11287880
1625 Ga0207428_10001993
1626 Ga0207428_10046030
1627 Ga0207428_10506298
1628 Ga0268265_10046161
1629 Ga0268265_10124782
1630 Ga0268265_10763397
1631 Ga0268265_10904433
1632 Ga0268265_11187130
1633 Ga0268265_11216414
1634 Ga0268264_10026404
1635 Ga0268264_10069770
1636 Ga0268264_10255478
1637 Ga0268264_10292869
1638 Ga0268264_10449001
1639 Ga0268264_10789535
1640 Ga0268264_11124432
1641 Ga0316176_1111201
1642 Ga0316180_1134593
1643 Ga0316182_1320039
1644 Ga0307408_100047715
1645 Ga0307408_100873740
1646 Ga0307408_101676379
1647 Ga0307405_10001266
1648 Ga0307405_10136607
1649 Ga0307413_10091342
1650 Ga0307410_10184906
1651 Ga0307410_11373518
1652 Ga0307410_11601822
1653 Ga0307406_10022523
1654 Ga0307406_10298908
1655 Ga0307407_10034692
1656 Ga0307407_10050890
1657 Ga0307412_10022476
1658 Ga0307412_10212485
1659 Ga0307412_10469908
1660 Ga0307409_100272729
1661 Ga0307416_100015473
1662 Ga0307416_100060710
1663 Ga0307416_100109850
1664 Ga0307416_102959421
1665 Ga0307414_10016235
1666 Ga0307414_10203463
1667 Ga0307414_10659530
1668 Ga0307414_11226252
1669 Ga0307411_10246161
1670 Ga0307415_100000375
1671 Ga0307415_100216286
1672 Ga0307415_100474467
1673 Ga0373959_0061593
1674 Ga0373938_0048186
1675 Ga0373940_0064128
1676 Ga0373951_0010365
1677 Ga0373951_0089713
1678 Ga0373932_0064128
1679 Ga0373939_0128842
1680 Ga0373939_0491898
1681 Ga0373941_0002449
1682 Ga0373942_0003998
1683 Ga0373942_0142212
1684 Ga0373961_0088464
1685 Ga0373961_0295844
1686 Ga0373931_0087837
1687 Ga0373931_0494317
1688 Ga0395899_0150951
1689 Ga0395900_0226509
1690 Ga0395898_0268191
1691 Ga0395898_0696047
1692 Ga0395898_1414375
1693 Ga0395901_0251002
1694 Ga0242422_07582
1695 Ga0242420_012891
1696 Ga0439448_0025831
1697 Ga0439455_0001489
1698 Ga0439457_112530
1699 Ga0439458_0006143
1700 Ga0451577_0904680
1701 Ga0466972_0649523
1702 Ga0453683_0116842
1703 Ga0451576_1180412
1704 Ga0451576_1940287
1705 Ga0495663_0406864
1706 Ga0496102_0372481
1707 Ga0496102_1006893
1708 Ga0496102_1387675
1709 Ga0496104_0082361
1710 Ga0496104_0366317
1711 Ga0496106_0049595
1712 Ga0496107_0154217
1713 Ga0496108_0042092
1714 Ga0496109_0700046
1715 Ga0496110_0466489
1716 Ga0496110_0873555
1717 Ga0496112_0268596
1718 Ga0496112_0485785
1719 Ga0496112_0659028
1720 Ga0496112_0773800
1721 Ga0496113_0208993
1722 Ga0496113_0819984
1723 Ga0501290_026583
1724 Ga0501291_002130
1725 Ga0501291_003011
1726 Ga0501291_007620
1727 Ga0501291_116694
1728 Ga0501292_001379
1729 Ga0501292_010563
1730 Ga0501292_073847
1731 Ga0501293_010365
1732 Ga0501296_005614
1733 Ga0501298_001973
1734 Ga0501298_003501
1735 Ga0501298_014168
1736 Ga0501298_107312
1737 Ga0501299_002214
1738 Ga0501299_010732
1739 Ga0501300_004924
1740 Ga0501300_011974
1741 Ga0501300_063493
1742 Ga0501301_008783
1743 Ga0501303_008649
1744 Ga0501031_0432013
1745 Ga0501038_0001802
1746 Ga0501041_0902727
1747 Ga0501042_0940212
1748 Ga0501048_0462086
1749 Ga0501072_1198950
1750 Ga0501198_013133
1751 Ga0501198_023616
1752 Ga0501198_033894
1753 Ga0501201_054135
1754 Ga0501202_004634
1755 Ga0501202_005769
1756 Ga0501202_015314
1757 Ga0501202_016307
1758 Ga0501206_002749
1759 Ga0501206_013405
1760 Ga0501207_000243
1761 Ga0501207_000328
1762 Ga0501207_009415
1763 Ga0501208_009992
1764 Ga0501208_015630
1765 Ga0501208_133014
1766 Ga0501209_082716
1767 Ga0501209_085449
1768 Ga0501209_095116
1769 Ga0501210_016444
1770 Ga0501214_023338
1771 Ga0501214_033098
1772 Ga0501216_001725
1773 Ga0501216_004822
1774 Ga0501216_006278
1775 Ga0501216_017236
1776 Ga0501216_024233
1777 Ga0501216_051807
1778 Ga0501217_003031
1779 Ga0501217_010805
1780 Ga0501217_020253
1781 Ga0501217_031870
1782 Ga0501217_053574
1783 Ga0501223_005568
1784 Ga0501223_006250
1785 Ga0501223_008333
1786 Ga0501224_003122
1787 Ga0501224_009291
1788 Ga0501224_047533
1789 Ga0501227_000264
1790 Ga0501227_011726
1791 Ga0501227_013977
1792 Ga0501227_040502
1793 Ga0501228_061674
1794 Ga0501230_005475
1795 Ga0501230_051332
1796 Ga0501230_073089
1797 Ga0501233_002416
1798 Ga0501233_014660
1799 Ga0501233_015988
1800 Ga0501233_075661
1801 Ga0501235_001704
1802 Ga0501235_002761
1803 Ga0501235_015445
1804 Ga0501235_227515
1805 Ga0501236_012753
1806 Ga0501236_020415
1807 Ga0501236_090886
1808 Ga0501238_064168
1809 Ga0501239_001995
1810 Ga0501240_000173
1811 Ga0501240_004253
1812 Ga0501240_017489
1813 Ga0501242_020884
1814 Ga0501242_022613
1815 Ga0501242_063013
1816 Ga0501243_022966
1817 Ga0501243_027693
1818 Ga0501246_003852
1819 Ga0501247_006989
1820 Ga0501249_007895
1821 Ga0501249_015272
1822 Ga0501250_001645
1823 Ga0501250_016698
1824 Ga0501251_017904
1825 Ga0501252_042433
1826 Ga0501253_004530
1827 Ga0501253_009782
1828 Ga0501253_012514
1829 Ga0501253_110525
1830 Ga0501255_008451
1831 Ga0501256_012512
1832 Ga0501256_030350
1833 Ga0501257_001820
1834 Ga0501257_005864
1835 Ga0501257_015735
1836 Ga0501257_047427
1837 Ga0501259_018625
1838 Ga0501259_076384
1839 Ga0501260_011351
1840 Ga0501260_029988
1841 Ga0501261_000683
1842 Ga0501261_031007
1843 Ga0501219_004579
1844 Ga0501221_006580
1845 Ga0501221_014961
1846 Ga0501221_027860
1847 Ga0501221_033346
1848 Ga0501221_063479
1849 Ga0501225_0000255
1850 Ga0501225_0007131
1851 Ga0501225_0019122
1852 Ga0501225_0049482
1853 Ga0501229_000443
1854 Ga0501229_016227
1855 Ga0501234_001246
1856 Ga0501234_001773
1857 Ga0501234_006158
1858 Ga0501234_007689
1859 Ga0501234_023985
1860 Ga0501245_002483
1861 Ga0501245_006282
1862 Ga0501245_047214
1863 Ga0501241_010082
1864 Ga0501263_005824
1865 Ga0501263_018365
1866 Ga0501264_016961
1867 Ga0501266_016744
1868 Ga0501266_017684
1869 Ga0501268_006787
1870 Ga0501268_026299
1871 Ga0501268_026997
1872 Ga0501269_030538
1873 Ga0501269_052760
1874 Ga0501270_025712
1875 Ga0501271_000594
1876 Ga0501271_026267
1877 Ga0501272_010858
1878 Ga0501272_011181
1879 Ga0501273_000966
1880 Ga0501273_001672
1881 Ga0501273_007344
1882 Ga0501273_034211
1883 Ga0501274_004002
1884 Ga0501275_028747
1885 Ga0501276_005476
1886 Ga0501278_003275
1887 Ga0501278_007524
1888 Ga0501279_003311
1889 Ga0501283_001125
1890 Ga0501283_013820
1891 Ga0501283_058875
1892 Ga0501204_027285
1893 Ga0501212_001115
1894 Ga0501212_002576
1895 Ga0501212_006039
1896 Ga0501212_011387
1897 Ga0501226_001661
1898 nmdc:mga05p37_22998_c1
1899 nmdc:mga05p37_260656_c1
1900 nmdc:mga05p37_362983_c1
1901 nmdc:mga05p37_401054_c1
1902 nmdc:mga05p37_709207_c1
1903 nmdc:mga05p37_78462_c1
1904 nmdc:mga09592_138414_c1
1905 nmdc:mga09592_198544_c1
1906 nmdc:mga0qj67_13032_c1
1907 nmdc:mga0qj67_1430355_c1
1908 nmdc:mga0qj67_450897_c1
1909 nmdc:mga06r32_121344_c1
1910 nmdc:mga06r32_204216_c1
1911 nmdc:mga06r32_633132_c1
1912 nmdc:mga08y16_1008811_c1
1913 nmdc:mga08y16_115750_c1
1914 nmdc:mga08y16_2184_c1
1915 nmdc:mga08y16_30513_c1
1916 nmdc:mga08y16_518259_c1
1917 nmdc:mga0n895_188701_c1
1918 nmdc:mga0n895_26852_c1
1919 nmdc:mga0n895_396683_c1
1920 nmdc:mga0n895_518106_c1
1921 nmdc:mga0n895_71086_c1
1922 nmdc:mga0n895_745174_c1
1923 nmdc:mga0n895_750056_c1
1924 nmdc:mga0rr50_31296_c1
1925 nmdc:mga08x19_127361_c1
1926 nmdc:mga0a205_170024_c1
1927 nmdc:mga0a205_22810_c1
1928 nmdc:mga0a205_275634_c1
1929 nmdc:mga0a205_36146_c1
1930 nmdc:mga0a205_417190_c1
1931 nmdc:mga0a205_528573_c1
1932 nmdc:mga0a205_651859_c1
1933 nmdc:mga0a205_921649_c1
1934 nmdc:mga0a205_9431_c1
1935 Ga0590075_085919
1936 Ga0530510_0068410

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

11

69

0.95

PF13560

HTH_31

Helix-turn-helix domain

6

67

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9656 24 68
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9635 24 68
7t8i-assembly1.cif.gz_B crystal structure of the immr transcriptional regulator dna-binding domain of bacillus subtilis 0.9343 7 69
3omt-assembly1.cif.gz_B putative antitoxin component, chu_2935 protein, from xre family from prevotella buccae. 0.9254 26 68
1adr-assembly1.cif.gz_A determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor 0.9241 7 70
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9332 10 68 1.10.260.40
3omtB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9253 26 68 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9241 7 70 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9085 7 69 1.10.260.40
3op9A01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9067 7 70 1.10.260.40
ID Description Score Start End GO Terms
AF-B6IN19-F1-model_v4 DNA-binding protein, putative 0.9696 3 69 GO:0003677
AF-A0A7C2EQZ4-F1-model_v4 XRE family transcriptional regulator 0.9651 6 69 GO:0003677
GO:0003700
GO:0005829
AF-A0A2A3LLY6-F1-model_v4 Transcriptional regulator 0.9509 3 71 GO:0003677
AF-Q026G4-F1-model_v4 Transcriptional regulator, XRE family 0.9489 4 69 GO:0003677
GO:0003700
GO:0005829
AF-A0A1G8Y130-F1-model_v4 DNA-binding transcriptional regulator, XRE-family HTH domain 0.9476 3 71 GO:0003677

Map