F486934

General Info

Members Datasets Scaffolds Average Seq Length
964 301 1928 153

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101860463|Ga0075434_1018604632
Length 153
Sequence VTLEQQLTETLTRAIREKDQRTADVVRMLKTKITERRTAKGFTGEVDDAVILDVVGAYRKQLQKALGEYEKAGGDRVAAPIAQLRFEIGFCERYLPKGMDESALRALVKERIGTLGISDVKQAGRLVGDIMKTHKGQVDAADVKRVAEDLLRG

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
219 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
280 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
281 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 98.34
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_101860463 3300006871 Bacteria 608
2 JGI25406J46586_10005819 3300003203 Bacteria 5707
3 JGI25404J52841_10105087 3300003659 Bacteria 593
4 Ga0065712_10141318 3300005290 Bacteria 1447
5 Ga0065715_10113974 3300005293 Bacteria 2452
6 Ga0065707_10185628 3300005295 Bacteria 1390
7 Ga0065707_10244704 3300005295 Bacteria 1144
8 Ga0065707_10479327 3300005295 Unclassified 775
9 Ga0070658_10660707 3300005327 Unclassified 907
10 Ga0070676_10000005 3300005328 Bacteria 76787
11 Ga0070676_10011118 3300005328 Bacteria 4892
12 Ga0070676_10237672 3300005328 Bacteria 1210
13 Ga0070683_100038454 3300005329 Bacteria 4387
14 Ga0070690_100256890 3300005330 Bacteria 1238
15 Ga0070670_100001199 3300005331 Bacteria 20587
16 Ga0070677_10213424 3300005333 Bacteria 938
17 Ga0068869_100002745 3300005334 Bacteria 10659
18 Ga0068869_100009337 3300005334 Bacteria 6361
19 Ga0068869_100050419 3300005334 Bacteria 3017
20 Ga0070666_10219720 3300005335 Bacteria 1340
21 Ga0070680_100000094 3300005336 Bacteria 50344
22 Ga0070680_100039088 3300005336 Bacteria 3839
23 Ga0070680_100062111 3300005336 Bacteria 3058
24 Ga0070680_100437265 3300005336 Unclassified 1117
25 Ga0070680_101041210 3300005336 Unclassified 707
26 Ga0070682_100003884 3300005337 Bacteria 8290
27 Ga0068868_100014283 3300005338 Bacteria 5850
28 Ga0068868_100133018 3300005338 Bacteria 2037
29 Ga0070660_100003125 3300005339 Bacteria 11376
30 Ga0070689_100003437 3300005340 Bacteria 10539
31 Ga0070689_100419278 3300005340 Bacteria 1134
32 Ga0070691_10006218 3300005341 Bacteria 5447
33 Ga0070691_10049587 3300005341 Bacteria 2001
34 Ga0070691_10093272 3300005341 Bacteria 1487
35 Ga0070691_10537802 3300005341 Bacteria 681
36 Ga0070687_100079182 3300005343 Bacteria 1788
37 Ga0070661_100006165 3300005344 Bacteria 8266
38 Ga0070692_10001646 3300005345 Bacteria 8240
39 Ga0070692_10004232 3300005345 Bacteria 5954
40 Ga0070668_100326905 3300005347 Bacteria 1292
41 Ga0070668_100562170 3300005347 Bacteria 994
42 Ga0070669_100040023 3300005353 Bacteria 3406
43 Ga0070669_100068744 3300005353 Bacteria 2615
44 Ga0070669_100101399 3300005353 Bacteria 2172
45 Ga0070669_100164531 3300005353 Bacteria 1726
46 Ga0070669_100623873 3300005353 Unclassified 905
47 Ga0070671_100189336 3300005355 Bacteria 1744
48 Ga0070674_100548612 3300005356 Bacteria 969
49 Ga0070673_100017616 3300005364 Bacteria 5085
50 Ga0070688_100135114 3300005365 Bacteria 1669
51 Ga0070688_100386324 3300005365 Bacteria 1033
52 Ga0070659_100001138 3300005366 Bacteria 19392
53 Ga0070659_101987984 3300005366 Unclassified 522
54 Ga0070703_10039928 3300005406 Bacteria 1457
55 Ga0070703_10043334 3300005406 Bacteria 1411
56 Ga0070703_10081142 3300005406 Bacteria 1105
57 Ga0070703_10195063 3300005406 Bacteria 791
58 Ga0070701_10046764 3300005438 Bacteria 2226
59 Ga0070701_10097707 3300005438 Bacteria 1621
60 Ga0070711_100107027 3300005439 Bacteria 2045
61 Ga0070711_100259608 3300005439 Bacteria 1366
62 Ga0070705_100028364 3300005440 Bacteria 3065
63 Ga0070705_100029223 3300005440 Bacteria 3028
64 Ga0070705_100031904 3300005440 Bacteria 2922
65 Ga0070705_100038776 3300005440 Bacteria 2698
66 Ga0070705_100215705 3300005440 Bacteria 1326
67 Ga0070700_100051404 3300005441 Bacteria 2565
68 Ga0070700_100095624 3300005441 Bacteria 1948
69 Ga0070694_100002997 3300005444 Bacteria 10041
70 Ga0070694_100004403 3300005444 Bacteria 8468
71 Ga0070694_100115083 3300005444 Bacteria 1921
72 Ga0070694_100331669 3300005444 Bacteria 1174
73 Ga0070694_100795933 3300005444 Unclassified 775
74 Ga0070708_100015531 3300005445 Bacteria 6292
75 Ga0070708_100023561 3300005445 Bacteria 5237
76 Ga0070708_100024205 3300005445 Bacteria 5175
77 Ga0070708_100051214 3300005445 Bacteria 3658
78 Ga0070708_100159238 3300005445 Bacteria 2103
79 Ga0070708_100231582 3300005445 Bacteria 1733
80 Ga0070708_100321554 3300005445 Bacteria 1457
81 Ga0070708_100321786 3300005445 Bacteria 1457
82 Ga0070708_100384527 3300005445 Bacteria 1323
83 Ga0070708_101417996 3300005445 Bacteria 648
84 Ga0070663_100000763 3300005455 Bacteria 17474
85 Ga0070662_100042435 3300005457 Bacteria 3249
86 Ga0070662_100081362 3300005457 Bacteria 2413
87 Ga0070681_10034394 3300005458 Bacteria 5088
88 Ga0070681_10058087 3300005458 Bacteria 3848
89 Ga0070681_10062606 3300005458 Bacteria 3694
90 Ga0070681_10390843 3300005458 Bacteria 1302
91 Ga0068867_100002733 3300005459 Bacteria 12440
92 Ga0068867_100019737 3300005459 Bacteria 4802
93 Ga0068867_100157437 3300005459 Bacteria 1789
94 Ga0068867_100884171 3300005459 Bacteria 803
95 Ga0070706_100004618 3300005467 Bacteria 13217
96 Ga0070706_100008662 3300005467 Bacteria 9481
97 Ga0070706_100043566 3300005467 Bacteria 4147
98 Ga0070706_100075697 3300005467 Bacteria 3115
99 Ga0070706_100090200 3300005467 Bacteria 2842
100 Ga0070706_100136905 3300005467 Bacteria 2285
101 Ga0070706_100159881 3300005467 Bacteria 2103
102 Ga0070706_100314395 3300005467 Bacteria 1461
103 Ga0070706_100327919 3300005467 Bacteria 1427
104 Ga0070706_100531695 3300005467 Bacteria 1094
105 Ga0070707_100001786 3300005468 Bacteria 20710
106 Ga0070707_100005318 3300005468 Bacteria 12047
107 Ga0070707_100011093 3300005468 Bacteria 8393
108 Ga0070707_100014433 3300005468 Bacteria 7404
109 Ga0070707_100018600 3300005468 Bacteria 6537
110 Ga0070707_100045167 3300005468 Bacteria 4216
111 Ga0070707_100061661 3300005468 Bacteria 3597
112 Ga0070707_100087596 3300005468 Bacteria 3011
113 Ga0070707_100133354 3300005468 Bacteria 2416
114 Ga0070707_100139937 3300005468 Bacteria 2355
115 Ga0070707_100417330 3300005468 Bacteria 1302
116 Ga0070707_100666676 3300005468 Bacteria 1003
117 Ga0070707_100879946 3300005468 Bacteria 860
118 Ga0070707_100975812 3300005468 Bacteria 812
119 Ga0070698_100006315 3300005471 Bacteria 12870
120 Ga0070698_100118659 3300005471 Bacteria 2606
121 Ga0070698_100331196 3300005471 Bacteria 1454
122 Ga0070698_100570296 3300005471 Bacteria 1072
123 Ga0070698_100654502 3300005471 Bacteria 992
124 Ga0070699_100002516 3300005518 Bacteria 16458
125 Ga0070699_100019945 3300005518 Bacteria 5778
126 Ga0070699_100037281 3300005518 Bacteria 4206
127 Ga0070699_100051010 3300005518 Bacteria 3583
128 Ga0070699_100081806 3300005518 Bacteria 2815
129 Ga0070699_100091875 3300005518 Bacteria 2654
130 Ga0070699_100185087 3300005518 Bacteria 1849
131 Ga0070699_100294785 3300005518 Bacteria 1455
132 Ga0070699_100319775 3300005518 Bacteria 1395
133 Ga0070699_100350177 3300005518 Unclassified 1330
134 Ga0070699_100445390 3300005518 Bacteria 1174
135 Ga0070699_100489209 3300005518 Bacteria 1117
136 Ga0070699_100917110 3300005518 Unclassified 802
137 Ga0070679_100001113 3300005530 Bacteria 23470
138 Ga0070679_100034545 3300005530 Bacteria 5012
139 Ga0070679_100036717 3300005530 Bacteria 4863
140 Ga0070679_100234132 3300005530 Bacteria 1796
141 Ga0070679_100309895 3300005530 Bacteria 1528
142 Ga0070684_100241528 3300005535 Bacteria 1650
143 Ga0070697_100000676 3300005536 Bacteria 25620
144 Ga0070697_100002183 3300005536 Bacteria 15009
145 Ga0070697_100025430 3300005536 Bacteria 4723
146 Ga0070697_100048316 3300005536 Bacteria 3450
147 Ga0070697_100182974 3300005536 Bacteria 1777
148 Ga0070697_100188915 3300005536 Bacteria 1748
149 Ga0070697_100189402 3300005536 Bacteria 1746
150 Ga0070697_100225229 3300005536 Bacteria 1598
151 Ga0070697_100261986 3300005536 Bacteria 1480
152 Ga0070697_100359912 3300005536 Bacteria 1258
153 Ga0070697_100874309 3300005536 Bacteria 797
154 Ga0068853_100008227 3300005539 Bacteria 8372
155 Ga0070672_100024688 3300005543 Bacteria 4447
156 Ga0070672_100164052 3300005543 Bacteria 1845
157 Ga0070672_100448181 3300005543 Bacteria 1111
158 Ga0070686_100310061 3300005544 Bacteria 1173
159 Ga0070686_101247849 3300005544 Bacteria 619
160 Ga0070695_100001443 3300005545 Bacteria 13186
161 Ga0070695_100005056 3300005545 Bacteria 7770
162 Ga0070695_100096571 3300005545 Bacteria 1983
163 Ga0070695_100134677 3300005545 Bacteria 1706
164 Ga0070696_100001369 3300005546 Bacteria 15910
165 Ga0070696_100017182 3300005546 Bacteria 4882
166 Ga0070696_100025044 3300005546 Bacteria 4055
167 Ga0070696_100079526 3300005546 Bacteria 2320
168 Ga0070696_100085349 3300005546 Bacteria 2241
169 Ga0070696_100330285 3300005546 Bacteria 1176
170 Ga0070696_101718551 3300005546 Bacteria 541
171 Ga0070693_100000104 3300005547 Bacteria 37548
172 Ga0070693_100356053 3300005547 Unclassified 1003
173 Ga0070665_101162564 3300005548 Unclassified 783
174 Ga0070704_100014114 3300005549 Bacteria 4981
175 Ga0070704_100018081 3300005549 Bacteria 4498
176 Ga0070704_100033390 3300005549 Bacteria 3479
177 Ga0070704_100066200 3300005549 Bacteria 2604
178 Ga0070704_100266623 3300005549 Bacteria 1413
179 Ga0070704_100720848 3300005549 Bacteria 886
180 Ga0070704_100881208 3300005549 Bacteria 804
181 Ga0070704_100952440 3300005549 Bacteria 774
182 Ga0070704_101587799 3300005549 Bacteria 603
183 Ga0068855_100016998 3300005563 Bacteria 8749
184 Ga0068855_100518680 3300005563 Bacteria 1293
185 Ga0068855_100577014 3300005563 Bacteria 1215
186 Ga0068855_100611731 3300005563 Unclassified 1174
187 Ga0068857_100094550 3300005577 Bacteria 2677
188 Ga0068857_100175503 3300005577 Unclassified 1949
189 Ga0068857_100214239 3300005577 Bacteria 1758
190 Ga0068854_100004651 3300005578 Bacteria 8662
191 Ga0068856_100012614 3300005614 Bacteria 8180
192 Ga0068856_100071511 3300005614 Bacteria 3434
193 Ga0068856_100298801 3300005614 Unclassified 1627
194 Ga0070702_100024931 3300005615 Bacteria 3198
195 Ga0070702_101046941 3300005615 Unclassified 649
196 Ga0068852_100389912 3300005616 Bacteria 1368
197 Ga0068859_100001562 3300005617 Bacteria 23360
198 Ga0068859_100127803 3300005617 Bacteria 2612
199 Ga0068859_100268466 3300005617 Bacteria 1798
200 Ga0068859_100338727 3300005617 Unclassified 1598
201 Ga0068859_100446312 3300005617 Bacteria 1390
202 Ga0068859_100501533 3300005617 Bacteria 1309
203 Ga0068859_100641229 3300005617 Bacteria 1154
204 Ga0068864_100000991 3300005618 Bacteria 23779
205 Ga0068864_100047381 3300005618 Bacteria 3691
206 Ga0068864_101256791 3300005618 Bacteria 740
207 Ga0068866_10073428 3300005718 Bacteria 1815
208 Ga0068866_10618098 3300005718 Bacteria 734
209 Ga0068861_100018444 3300005719 Bacteria 4972
210 Ga0068861_100154005 3300005719 Bacteria 1889
211 Ga0068861_100237858 3300005719 Bacteria 1548
212 Ga0068851_10198680 3300005834 Bacteria 1118
213 Ga0068870_10002820 3300005840 Bacteria 7310
214 Ga0068863_100010104 3300005841 Bacteria 9179
215 Ga0068863_100708195 3300005841 Bacteria 1001
216 Ga0068863_101154134 3300005841 Bacteria 780
217 Ga0068863_101522666 3300005841 Bacteria 677
218 Ga0068863_101948999 3300005841 Bacteria 597
219 Ga0068858_100033406 3300005842 Bacteria 4775
220 Ga0068858_100157079 3300005842 Bacteria 2140
221 Ga0068860_100022117 3300005843 Bacteria 6156
222 Ga0068860_100336400 3300005843 Bacteria 1484
223 Ga0068860_100878726 3300005843 Bacteria 912
224 Ga0068860_100882234 3300005843 Bacteria 910
225 Ga0068862_100007685 3300005844 Bacteria 8919
226 Ga0068862_100013048 3300005844 Bacteria 6873
227 Ga0068862_100023027 3300005844 Bacteria 5216
228 Ga0068862_100043608 3300005844 Bacteria 3825
229 Ga0068862_100098268 3300005844 Bacteria 2557
230 Ga0068862_100212790 3300005844 Bacteria 1747
231 Ga0068862_100468936 3300005844 Bacteria 1190
232 Ga0068862_100591516 3300005844 Bacteria 1064
233 Ga0068862_101279850 3300005844 Bacteria 734
234 Ga0081540_1001963 3300005983 Bacteria 17161
235 Ga0081539_10000590 3300005985 Bacteria 74293
236 Ga0075432_10080745 3300006058 Bacteria 1179
237 Ga0070715_10267494 3300006163 Unclassified 901
238 Ga0070715_11017775 3300006163 Bacteria 517
239 Ga0070716_100007870 3300006173 Bacteria 5272
240 Ga0075427_10021528 3300006194 Bacteria 1026
241 Ga0097621_101244755 3300006237 Bacteria 702
242 Ga0068871_100762236 3300006358 Bacteria 890
243 Ga0075428_100000730 3300006844 Bacteria 34154
244 Ga0075428_100008047 3300006844 Bacteria 11701
245 Ga0075428_100017939 3300006844 Bacteria 7821
246 Ga0075428_100030783 3300006844 Bacteria 5934
247 Ga0075428_100063364 3300006844 Bacteria 4047
248 Ga0075428_100161255 3300006844 Bacteria 2434
249 Ga0075428_100175668 3300006844 Unclassified 2320
250 Ga0075428_100188259 3300006844 Bacteria 2232
251 Ga0075428_100304698 3300006844 Bacteria 1713
252 Ga0075428_100466585 3300006844 Bacteria 1352
253 Ga0075428_100563045 3300006844 Unclassified 1218
254 Ga0075428_100842283 3300006844 Bacteria 974
255 Ga0075428_101009790 3300006844 Bacteria 881
256 Ga0075430_100002036 3300006846 Bacteria 16684
257 Ga0075430_100006370 3300006846 Bacteria 9952
258 Ga0075430_100018856 3300006846 Bacteria 5869
259 Ga0075430_100111721 3300006846 Bacteria 2279
260 Ga0075430_100176534 3300006846 Bacteria 1777
261 Ga0075430_100198464 3300006846 Bacteria 1666
262 Ga0075430_100309158 3300006846 Bacteria 1307
263 Ga0075430_100350342 3300006846 Unclassified 1219
264 Ga0075430_100395150 3300006846 Unclassified 1141
265 Ga0075430_100490427 3300006846 Bacteria 1014
266 Ga0075431_100007203 3300006847 Bacteria 11065
267 Ga0075431_100008661 3300006847 Bacteria 10194
268 Ga0075431_100010364 3300006847 Bacteria 9365
269 Ga0075431_100019710 3300006847 Bacteria 6883
270 Ga0075431_100035297 3300006847 Bacteria 5147
271 Ga0075431_100070228 3300006847 Bacteria 3613
272 Ga0075431_100089673 3300006847 Bacteria 3174
273 Ga0075431_100093074 3300006847 Bacteria 3111
274 Ga0075431_100110736 3300006847 Bacteria 2833
275 Ga0075431_100219357 3300006847 Bacteria 1940
276 Ga0075431_100270914 3300006847 Bacteria 1720
277 Ga0075431_100307066 3300006847 Bacteria 1602
278 Ga0075431_100471721 3300006847 Bacteria 1249
279 Ga0075431_100781618 3300006847 Bacteria 929
280 Ga0075431_101567585 3300006847 Bacteria 617
281 Ga0075433_10001209 3300006852 Bacteria 18826
282 Ga0075433_10002879 3300006852 Bacteria 13188
283 Ga0075433_10005890 3300006852 Bacteria 9653
284 Ga0075433_10018092 3300006852 Bacteria 5850
285 Ga0075433_10022899 3300006852 Bacteria 5250
286 Ga0075433_10025739 3300006852 Bacteria 4975
287 Ga0075433_10040876 3300006852 Bacteria 4016
288 Ga0075433_10080500 3300006852 Bacteria 2872
289 Ga0075433_10085717 3300006852 Bacteria 2781
290 Ga0075433_10086269 3300006852 Bacteria 2772
291 Ga0075433_10088588 3300006852 Bacteria 2735
292 Ga0075433_10161430 3300006852 Bacteria 1995
293 Ga0075433_10444063 3300006852 Bacteria 1144
294 Ga0075433_10536391 3300006852 Unclassified 1029
295 Ga0075433_10819915 3300006852 Bacteria 813
296 Ga0075434_100000039 3300006871 Bacteria 59823
297 Ga0075434_100004221 3300006871 Bacteria 12880
298 Ga0075434_100011543 3300006871 Bacteria 8335
299 Ga0075434_100061715 3300006871 Bacteria 3730
300 Ga0075434_100071242 3300006871 Bacteria 3467
301 Ga0075434_100092860 3300006871 Bacteria 3021
302 Ga0075434_100118891 3300006871 Bacteria 2657
303 Ga0075434_100120734 3300006871 Bacteria 2636
304 Ga0075434_100149544 3300006871 Unclassified 2355
305 Ga0075434_100185820 3300006871 Bacteria 2099
306 Ga0075434_100235777 3300006871 Bacteria 1850
307 Ga0075434_100436959 3300006871 Bacteria 1330
308 Ga0075434_100597562 3300006871 Bacteria 1123
309 Ga0075434_100911680 3300006871 Bacteria 894
310 Ga0075434_101756525 3300006871 Bacteria 628
311 Ga0075429_100002010 3300006880 Bacteria 16905
312 Ga0075429_100010977 3300006880 Bacteria 7838
313 Ga0075429_100011741 3300006880 Bacteria 7597
314 Ga0075429_100013899 3300006880 Bacteria 6982
315 Ga0075429_100014322 3300006880 Bacteria 6878
316 Ga0075429_100023491 3300006880 Bacteria 5351
317 Ga0075429_100095349 3300006880 Bacteria 2595
318 Ga0075429_100102898 3300006880 Bacteria 2494
319 Ga0075429_100175753 3300006880 Bacteria 1876
320 Ga0075429_100178014 3300006880 Bacteria 1863
321 Ga0075429_100183632 3300006880 Bacteria 1833
322 Ga0075429_100230963 3300006880 Bacteria 1620
323 Ga0075429_100312326 3300006880 Unclassified 1376
324 Ga0068865_100078896 3300006881 Bacteria 2357
325 Ga0068865_100080105 3300006881 Bacteria 2341
326 Ga0075436_100044437 3300006914 Bacteria 3063
327 Ga0075436_100084670 3300006914 Bacteria 2200
328 Ga0075436_100086429 3300006914 Bacteria 2178
329 Ga0075436_100127043 3300006914 Bacteria 1787
330 Ga0075436_100383659 3300006914 Unclassified 1016
331 Ga0075436_100466309 3300006914 Bacteria 921
332 Ga0075436_100625026 3300006914 Archaea 794
333 Ga0097620_100001562 3300006931 Bacteria 23360
334 Ga0097620_100127803 3300006931 Bacteria 2612
335 Ga0097620_100268459 3300006931 Bacteria 1798
336 Ga0097620_100338733 3300006931 Unclassified 1598
337 Ga0097620_100446301 3300006931 Bacteria 1390
338 Ga0097620_100501536 3300006931 Bacteria 1309
339 Ga0097620_100641246 3300006931 Bacteria 1154
340 Ga0075435_100008582 3300007076 Bacteria 7343
341 Ga0075435_100017075 3300007076 Bacteria 5484
342 Ga0075435_100028763 3300007076 Bacteria 4360
343 Ga0075435_100041954 3300007076 Bacteria 3658
344 Ga0075435_100065361 3300007076 Bacteria 2957
345 Ga0075435_100128630 3300007076 Bacteria 2118
346 Ga0075435_100142348 3300007076 Bacteria 2012
347 Ga0075435_100222577 3300007076 Bacteria 1603
348 Ga0075435_100711065 3300007076 Archaea 873
349 Ga0075435_100750633 3300007076 Bacteria 849
350 Ga0099794_10003785 3300007265 Bacteria 5836
351 Ga0099794_10007317 3300007265 Bacteria 4528
352 Ga0099794_10053082 3300007265 Bacteria 1954
353 Ga0099794_10399742 3300007265 Bacteria 717
354 Ga0099794_10455910 3300007265 Unclassified 671
355 Ga0111539_10000715 3300009094 Bacteria 43156
356 Ga0111539_10000819 3300009094 Bacteria 40336
357 Ga0111539_10001430 3300009094 Bacteria 31850
358 Ga0111539_10047551 3300009094 Bacteria 5128
359 Ga0111539_10076175 3300009094 Bacteria 3950
360 Ga0105245_10800644 3300009098 Bacteria 980
361 Ga0114129_10000409 3300009147 Bacteria 50603
362 Ga0114129_10003438 3300009147 Bacteria 22264
363 Ga0114129_10005405 3300009147 Bacteria 18037
364 Ga0114129_10008975 3300009147 Bacteria 14257
365 Ga0114129_10059492 3300009147 Bacteria 5341
366 Ga0114129_10077976 3300009147 Bacteria 4608
367 Ga0114129_10082816 3300009147 Bacteria 4457
368 Ga0114129_10083036 3300009147 Bacteria 4451
369 Ga0114129_10097283 3300009147 Bacteria 4075
370 Ga0114129_10138195 3300009147 Bacteria 3343
371 Ga0114129_10143481 3300009147 Bacteria 3272
372 Ga0114129_10199854 3300009147 Bacteria 2708
373 Ga0114129_10224251 3300009147 Bacteria 2534
374 Ga0114129_10335894 3300009147 Bacteria 2005
375 Ga0114129_10542462 3300009147 Bacteria 1513
376 Ga0114129_10990084 3300009147 Bacteria 1059
377 Ga0114129_11239651 3300009147 Bacteria 927
378 Ga0114129_11562390 3300009147 Bacteria 809
379 Ga0105243_10161636 3300009148 Bacteria 1931
380 Ga0105243_10338732 3300009148 Bacteria 1377
381 Ga0105243_10613718 3300009148 Bacteria 1049
382 Ga0105241_10001344 3300009174 Bacteria 18669
383 Ga0105241_10615983 3300009174 Bacteria 982
384 Ga0105242_10021975 3300009176 Bacteria 5014
385 Ga0105242_10190262 3300009176 Bacteria 1816
386 Ga0105248_10186725 3300009177 Bacteria 2336
387 Ga0105248_10189571 3300009177 Bacteria 2317
388 Ga0105248_11738923 3300009177 Unclassified 707
389 Ga0105237_10058839 3300009545 Bacteria 3846
390 Ga0105238_10389887 3300009551 Unclassified 1385
391 Ga0105249_10061301 3300009553 Bacteria 3452
392 Ga0105249_10096471 3300009553 Bacteria 2774
393 Ga0105249_10099318 3300009553 Bacteria 2735
394 Ga0105249_10147254 3300009553 Bacteria 2263
395 Ga0105249_10333816 3300009553 Bacteria 1531
396 Ga0105249_10575338 3300009553 Bacteria 1179
397 Ga0105249_11114596 3300009553 Bacteria 859
398 Ga0105249_11652903 3300009553 Bacteria 713
399 Ga0105246_10012663 3300011119 Bacteria 5269
400 Ga0157373_10000101 3300013100 Bacteria 68799
401 Ga0157371_10437079 3300013102 Bacteria 961
402 Ga0157370_10275494 3300013104 Bacteria 1555
403 Ga0157369_10012134 3300013105 Bacteria 9783
404 Ga0157374_10446432 3300013296 Bacteria 1294
405 Ga0157374_11080543 3300013296 Bacteria 823
406 Ga0157378_10058823 3300013297 Bacteria 3428
407 Ga0157378_12506964 3300013297 Bacteria 568
408 Ga0163162_10489108 3300013306 Bacteria 1362
409 Ga0163162_10884082 3300013306 Bacteria 1007
410 Ga0157372_10000703 3300013307 Bacteria 36772
411 Ga0157372_11118195 3300013307 Bacteria 911
412 Ga0157375_10048022 3300013308 Bacteria 4173
413 Ga0157375_10524051 3300013308 Bacteria 1348
414 Ga0157375_10711959 3300013308 Bacteria 1157
415 Ga0157375_12641858 3300013308 Bacteria 600
416 Ga0163163_10152202 3300014325 Bacteria 2357
417 Ga0163163_10159045 3300014325 Archaea 2304
418 Ga0163163_10736290 3300014325 Bacteria 1049
419 Ga0157380_10056424 3300014326 Bacteria 3123
420 Ga0157380_10162064 3300014326 Bacteria 1945
421 Ga0157380_10496505 3300014326 Bacteria 1184
422 Ga0182008_10397785 3300014497 Bacteria 739
423 Ga0157377_10303813 3300014745 Bacteria 1054
424 Ga0157379_10166896 3300014968 Bacteria 1987
425 Ga0157379_10902559 3300014968 Bacteria 838
426 Ga0163161_10224342 3300017792 Unclassified 1456
427 Ga0163161_11869771 3300017792 Bacteria 534
428 Ga0206356_11442960 3300020070 Bacteria 782
429 Ga0206354_10938711 3300020081 Bacteria 909
430 Ga0207656_10067904 3300025321 Bacteria 1579
431 Ga0207653_10019640 3300025885 Bacteria 2132
432 Ga0207653_10071663 3300025885 Bacteria 1185
433 Ga0207653_10229018 3300025885 Bacteria 708
434 Ga0207692_10397937 3300025898 Bacteria 858
435 Ga0207642_10292696 3300025899 Bacteria 941
436 Ga0207642_10805140 3300025899 Bacteria 598
437 Ga0207680_10158576 3300025903 Bacteria 1515
438 Ga0207647_10049061 3300025904 Bacteria 2620
439 Ga0207645_10000852 3300025907 Bacteria 25412
440 Ga0207645_10013648 3300025907 Bacteria 5467
441 Ga0207643_10000150 3300025908 Bacteria 47605
442 Ga0207684_10000996 3300025910 Bacteria 31775
443 Ga0207684_10001569 3300025910 Bacteria 24376
444 Ga0207684_10002411 3300025910 Bacteria 18877
445 Ga0207684_10008157 3300025910 Bacteria 9330
446 Ga0207684_10028553 3300025910 Bacteria 4753
447 Ga0207684_10052166 3300025910 Bacteria 3471
448 Ga0207684_10182336 3300025910 Bacteria 1810
449 Ga0207684_10239761 3300025910 Bacteria 1564
450 Ga0207684_10284387 3300025910 Bacteria 1426
451 Ga0207684_10313165 3300025910 Bacteria 1353
452 Ga0207684_10387267 3300025910 Bacteria 1202
453 Ga0207684_10462277 3300025910 Bacteria 1089
454 Ga0207684_10506424 3300025910 Bacteria 1035
455 Ga0207684_10521690 3300025910 Bacteria 1017
456 Ga0207654_10029377 3300025911 Bacteria 3009
457 Ga0207654_10119642 3300025911 Bacteria 1652
458 Ga0207707_10000076 3300025912 Bacteria 100491
459 Ga0207707_10031856 3300025912 Bacteria 4616
460 Ga0207707_10102064 3300025912 Bacteria 2507
461 Ga0207707_10140157 3300025912 Bacteria 2115
462 Ga0207707_10336183 3300025912 Bacteria 1303
463 Ga0207663_10698262 3300025916 Bacteria 803
464 Ga0207660_10000022 3300025917 Bacteria 72537
465 Ga0207660_10048361 3300025917 Bacteria 3009
466 Ga0207662_10023135 3300025918 Bacteria 3567
467 Ga0207657_10000005 3300025919 Bacteria 213481
468 Ga0207649_10003591 3300025920 Bacteria 8473
469 Ga0207652_10000060 3300025921 Bacteria 113511
470 Ga0207652_10023677 3300025921 Bacteria 5088
471 Ga0207652_10069077 3300025921 Bacteria 3066
472 Ga0207652_10078641 3300025921 Bacteria 2880
473 Ga0207652_10349596 3300025921 Bacteria 1334
474 Ga0207646_10001766 3300025922 Bacteria 26193
475 Ga0207646_10006356 3300025922 Bacteria 12224
476 Ga0207646_10008955 3300025922 Bacteria 9961
477 Ga0207646_10016669 3300025922 Bacteria 6891
478 Ga0207646_10040356 3300025922 Bacteria 4197
479 Ga0207646_10114641 3300025922 Bacteria 2420
480 Ga0207646_10141204 3300025922 Bacteria 2169
481 Ga0207646_10159756 3300025922 Bacteria 2033
482 Ga0207646_10424425 3300025922 Unclassified 1200
483 Ga0207646_10487366 3300025922 Unclassified 1111
484 Ga0207646_10601260 3300025922 Bacteria 987
485 Ga0207646_11349769 3300025922 Bacteria 621
486 Ga0207681_10007091 3300025923 Bacteria 6872
487 Ga0207681_10211310 3300025923 Unclassified 1496
488 Ga0207681_10459040 3300025923 Bacteria 1037
489 Ga0207681_10605141 3300025923 Unclassified 906
490 Ga0207681_10681995 3300025923 Bacteria 853
491 Ga0207694_11095009 3300025924 Unclassified 674
492 Ga0207694_11661090 3300025924 Bacteria 538
493 Ga0207650_10072410 3300025925 Bacteria 2594
494 Ga0207659_10248049 3300025926 Bacteria 1444
495 Ga0207659_10916707 3300025926 Unclassified 753
496 Ga0207644_10458373 3300025931 Bacteria 1048
497 Ga0207690_10006358 3300025932 Bacteria 7000
498 Ga0207706_10027460 3300025933 Bacteria 5088
499 Ga0207706_10063115 3300025933 Bacteria 3262
500 Ga0207686_10322557 3300025934 Bacteria 1154
501 Ga0207709_10017341 3300025935 Bacteria 4018
502 Ga0207709_10380646 3300025935 Bacteria 1074
503 Ga0207709_10697026 3300025935 Bacteria 812
504 Ga0207709_10725893 3300025935 Bacteria 797
505 Ga0207670_10008129 3300025936 Bacteria 5903
506 Ga0207704_10233523 3300025938 Bacteria 1369
507 Ga0207704_10308151 3300025938 Bacteria 1216
508 Ga0207704_10502297 3300025938 Bacteria 978
509 Ga0207665_10005354 3300025939 Bacteria 8566
510 Ga0207691_10037324 3300025940 Bacteria 4499
511 Ga0207691_10216845 3300025940 Bacteria 1660
512 Ga0207711_10279211 3300025941 Bacteria 1538
513 Ga0207711_11332540 3300025941 Bacteria 660
514 Ga0207689_10000050 3300025942 Bacteria 88556
515 Ga0207689_10004262 3300025942 Bacteria 13006
516 Ga0207689_10198354 3300025942 Bacteria 1656
517 Ga0207661_10109543 3300025944 Bacteria 2333
518 Ga0207661_10436733 3300025944 Bacteria 1191
519 Ga0207661_10651228 3300025944 Unclassified 968
520 Ga0207679_10002376 3300025945 Bacteria 11579
521 Ga0207667_10000587 3300025949 Bacteria 47372
522 Ga0207667_10343624 3300025949 Unclassified 1523
523 Ga0207651_10011721 3300025960 Bacteria 4920
524 Ga0207712_10050600 3300025961 Bacteria 2902
525 Ga0207712_10306567 3300025961 Bacteria 1305
526 Ga0207712_10670257 3300025961 Bacteria 903
527 Ga0207712_10768261 3300025961 Bacteria 845
528 Ga0207712_11199756 3300025961 Bacteria 677
529 Ga0207668_10401152 3300025972 Bacteria 1159
530 Ga0207668_10630763 3300025972 Bacteria 936
531 Ga0207640_10049758 3300025981 Bacteria 2715
532 Ga0207640_10211929 3300025981 Bacteria 1476
533 Ga0207640_11060467 3300025981 Bacteria 715
534 Ga0207677_10436860 3300026023 Unclassified 1118
535 Ga0207677_10836824 3300026023 Bacteria 826
536 Ga0207703_10060648 3300026035 Bacteria 3093
537 Ga0207639_10049105 3300026041 Bacteria 3197
538 Ga0207639_11404783 3300026041 Unclassified 655
539 Ga0207678_10001742 3300026067 Bacteria 19912
540 Ga0207678_10318709 3300026067 Bacteria 1337
541 Ga0207708_10124948 3300026075 Bacteria 2007
542 Ga0207708_10542310 3300026075 Bacteria 980
543 Ga0207702_10098091 3300026078 Bacteria 2580
544 Ga0207702_10691902 3300026078 Bacteria 1004
545 Ga0207702_10928924 3300026078 Bacteria 862
546 Ga0207641_10022956 3300026088 Bacteria 5139
547 Ga0207641_10335830 3300026088 Bacteria 1437
548 Ga0207641_10520199 3300026088 Bacteria 1157
549 Ga0207641_11021133 3300026088 Bacteria 824
550 Ga0207648_10005797 3300026089 Bacteria 12374
551 Ga0207648_10038731 3300026089 Bacteria 4194
552 Ga0207648_10067171 3300026089 Bacteria 3126
553 Ga0207648_10131629 3300026089 Bacteria 2202
554 Ga0207648_10146922 3300026089 Bacteria 2080
555 Ga0207676_10061331 3300026095 Bacteria 2977
556 Ga0207676_10197607 3300026095 Bacteria 1774
557 Ga0207676_11038288 3300026095 Unclassified 809
558 Ga0207674_10000075 3300026116 Bacteria 105297
559 Ga0207674_10036958 3300026116 Bacteria 5082
560 Ga0207674_10067327 3300026116 Bacteria 3605
561 Ga0207674_10084664 3300026116 Bacteria 3168
562 Ga0207675_100012152 3300026118 Bacteria 8042
563 Ga0207675_100229606 3300026118 Bacteria 1790
564 Ga0210000_1009137 3300027462 Bacteria 1457
565 Ga0209983_1022072 3300027665 Bacteria 1333
566 Ga0209588_1002125 3300027671 Bacteria 5346
567 Ga0209588_1077971 3300027671 Bacteria 1071
568 Ga0209998_10141696 3300027717 Bacteria 614
569 Ga0209974_10046506 3300027876 Bacteria 1451
570 Ga0207428_10000009 3300027907 Bacteria 410565
571 Ga0207428_10000631 3300027907 Bacteria 41443
572 Ga0207428_10109497 3300027907 Bacteria 2127
573 Ga0207428_10560977 3300027907 Bacteria 825
574 Ga0207428_10970037 3300027907 Bacteria 598
575 Ga0268266_10873953 3300028379 Unclassified 869
576 Ga0268265_10007375 3300028380 Bacteria 7425
577 Ga0268265_10067642 3300028380 Bacteria 2766
578 Ga0268265_10090858 3300028380 Bacteria 2440
579 Ga0268265_10177003 3300028380 Unclassified 1829
580 Ga0268265_10467559 3300028380 Bacteria 1181
581 Ga0268265_10945312 3300028380 Unclassified 849
582 Ga0268264_10020679 3300028381 Bacteria 5377
583 Ga0268264_10030980 3300028381 Bacteria 4386
584 Ga0268264_10092992 3300028381 Bacteria 2604
585 Ga0268264_10260110 3300028381 Bacteria 1616
586 Ga0268264_10657248 3300028381 Bacteria 1038
587 Ga0268264_10710385 3300028381 Bacteria 999
588 Ga0268264_11928651 3300028381 Bacteria 600
589 Ga0265325_10005355 3300031241 Bacteria 7935
590 Ga0307509_10067942 3300031507 Bacteria 3731
591 Ga0307408_100029740 3300031548 Bacteria 3788
592 Ga0307408_100044097 3300031548 Bacteria 3177
593 Ga0307408_100222053 3300031548 Bacteria 1542
594 Ga0307405_10111668 3300031731 Unclassified 1853
595 Ga0307405_10273264 3300031731 Bacteria 1268
596 Ga0307410_11763437 3300031852 Unclassified 549
597 Ga0307406_10078084 3300031901 Bacteria 2192
598 Ga0307407_10585805 3300031903 Bacteria 829
599 Ga0307412_10923570 3300031911 Bacteria 766
600 Ga0307416_100001116 3300032002 Bacteria 14425
601 Ga0307416_100521610 3300032002 Bacteria 1256
602 Ga0307416_102064962 3300032002 Bacteria 672
603 Ga0307411_10100729 3300032005 Bacteria 2042
604 Ga0307411_10491308 3300032005 Bacteria 1036
605 Ga0307411_10961862 3300032005 Bacteria 762
606 Ga0307415_100263008 3300032126 Bacteria 1409
607 Ga0307415_101943541 3300032126 Bacteria 572
608 Ga0373930_0045200 3300034816 Bacteria 948
609 Ga0373948_0022860 3300034817 Bacteria 1208
610 Ga0373958_0038403 3300034819 Unclassified 970
611 Ga0373959_0011123 3300034820 Bacteria 1584
612 Ga0373934_0263500 3300035086 Bacteria 713
613 Ga0373940_0002057 3300035088 Bacteria 3821
614 Ga0373940_0022837 3300035088 Bacteria 1610
615 Ga0373949_0001137 3300035090 Bacteria 7993
616 Ga0373949_0154028 3300035090 Bacteria 666
617 Ga0373951_0021372 3300035091 Bacteria 1486
618 Ga0373952_0051068 3300035092 Bacteria 986
619 Ga0373952_0066762 3300035092 Bacteria 891
620 Ga0373932_0114584 3300035112 Bacteria 892
621 Ga0373939_0390273 3300035114 Bacteria 575
622 Ga0373941_0124486 3300035115 Bacteria 922
623 Ga0373945_0460582 3300035116 Unclassified 563
624 Ga0373960_0032851 3300035121 Bacteria 1459
625 Ga0373960_0246812 3300035121 Unclassified 647
626 Ga0373943_0011173 3300035170 Bacteria 4037
627 Ga0373942_0057071 3300035207 Bacteria 1110
628 Ga0373942_0080498 3300035207 Bacteria 966
629 Ga0373961_0003927 3300035241 Bacteria 3630
630 Ga0373961_0076866 3300035241 Bacteria 1043
631 Ga0373962_0006756 3300035242 Bacteria 2786
632 Ga0373962_0011889 3300035242 Bacteria 2188
633 Ga0373931_0005358 3300035691 Bacteria 5920
634 Ga0373931_0009773 3300035691 Bacteria 4594
635 Ga0373931_0104028 3300035691 Bacteria 1601
636 Ga0373931_0315703 3300035691 Bacteria 969
637 Ga0373933_0329719 3300035724 Bacteria 990
638 Ga0395899_0005710 3300037312 Bacteria 9659
639 Ga0395900_0005301 3300037418 Bacteria 13516
640 Ga0395900_0254312 3300037418 Bacteria 1757
641 Ga0395898_0007244 3300037466 Bacteria 11772
642 Ga0395898_1322176 3300037466 Unclassified 650
643 Ga0395905_0048060 3300037471 Bacteria 3999
644 Ga0395901_0137841 3300038443 Bacteria 2564
645 Ga0395901_0718524 3300038443 Bacteria 995
646 Ga0395901_0915858 3300038443 Bacteria 858
647 Ga0436361_0067535 3300039447 Unclassified 1083
648 Ga0436363_0822832 3300039450 Unclassified 615
649 Ga0436363_1398976 3300039450 Unclassified 731
650 Ga0439448_0020856 3300042005 Bacteria 2031
651 Ga0439455_0025065 3300042012 Bacteria 1447
652 Ga0439455_0049398 3300042012 Bacteria 1096
653 Ga0450889_013854 3300042144 Bacteria 855
654 Ga0439458_0008415 3300042157 Bacteria 2296
655 Ga0439459_0024084 3300042438 Unclassified 1191
656 Ga0439459_0046145 3300042438 Bacteria 942
657 Ga0439460_0077985 3300042461 Bacteria 1036
658 Ga0451577_0003313 3300042876 Bacteria 18095
659 Ga0451577_0054622 3300042876 Bacteria 3565
660 Ga0451577_0100573 3300042876 Bacteria 2582
661 Ga0451577_0182142 3300042876 Bacteria 1894
662 Ga0451577_0510865 3300042876 Bacteria 1091
663 Ga0466972_0207976 3300044658 Bacteria 916
664 Ga0453683_0008769 3300044673 Bacteria 6778
665 Ga0453683_0107187 3300044673 Unclassified 1756
666 Ga0453683_0137695 3300044673 Bacteria 1540
667 Ga0466961_0608984 3300044693 Bacteria 657
668 Ga0453684_0023688 3300044712 Bacteria 9021
669 Ga0453684_0030957 3300044712 Bacteria 7540
670 Ga0453684_0082959 3300044712 Bacteria 3991
671 Ga0451576_0006637 3300045051 Bacteria 14133
672 Ga0451576_0022946 3300045051 Bacteria 6762
673 Ga0451576_0024715 3300045051 Bacteria 6486
674 Ga0451576_0029219 3300045051 Bacteria 5899
675 Ga0451576_0051221 3300045051 Bacteria 4328
676 Ga0451576_0678385 3300045051 Bacteria 1083
677 Ga0466967_0536850 3300045976 Bacteria 1150
678 Ga0466967_1580040 3300045976 Bacteria 653
679 Ga0466967_2054182 3300045976 Bacteria 568
680 Ga0495603_0538655 3300046455 Bacteria 669
681 Ga0495651_0537884 3300046462 Bacteria 744
682 Ga0495580_0001861 3300046472 Bacteria 18550
683 Ga0495580_0472434 3300046472 Bacteria 839
684 Ga0495584_0669906 3300046491 Bacteria 529
685 Ga0495584_0674244 3300046491 Unclassified 527
686 Ga0495594_0091689 3300046499 Bacteria 1703
687 Ga0495607_0335206 3300046501 Bacteria 702
688 Ga0495628_0289371 3300046516 Bacteria 1215
689 Ga0495642_0098964 3300046528 Bacteria 1240
690 Ga0495642_0402460 3300046528 Bacteria 604
691 Ga0495642_0528914 3300046528 Bacteria 523
692 Ga0495652_0554207 3300046529 Bacteria 790
693 Ga0495656_0350537 3300046615 Bacteria 765
694 Ga0495599_0178882 3300046678 Bacteria 1308
695 Ga0495623_0102012 3300046679 Bacteria 1748
696 Ga0495646_0522226 3300046680 Bacteria 608
697 Ga0495669_0099714 3300046684 Bacteria 1348
698 Ga0495669_0637634 3300046684 Bacteria 518
699 Ga0495613_0474799 3300046689 Bacteria 845
700 Ga0495636_0592228 3300047318 Bacteria 542
701 Ga0495674_1209400 3300047319 Bacteria 571
702 Ga0495602_0056861 3300048088 Bacteria 3437
703 Ga0495602_0190760 3300048088 Unclassified 1572
704 Ga0496102_0030748 3300048905 Bacteria 4808
705 Ga0496102_0100319 3300048905 Bacteria 2688
706 Ga0496104_0307557 3300048907 Bacteria 1498
707 Ga0496106_0066708 3300048909 Bacteria 2742
708 Ga0496106_0165429 3300048909 Bacteria 1751
709 Ga0496107_0155165 3300048910 Bacteria 1695
710 Ga0496109_0350859 3300048912 Bacteria 1394
711 Ga0496109_0833305 3300048912 Bacteria 860
712 Ga0496110_0166215 3300048913 Bacteria 2001
713 Ga0496111_0188069 3300048914 Bacteria 1535
714 Ga0496112_0037103 3300048915 Bacteria 4758
715 Ga0496112_0812371 3300048915 Unclassified 859
716 Ga0496113_0344742 3300048916 Unclassified 1195
717 Ga0501298_043407 3300049521 Bacteria 916
718 Ga0501033_0060859 3300049570 Bacteria 2784
719 Ga0501034_0430056 3300049571 Unclassified 1240
720 Ga0501036_0497695 3300049572 Bacteria 1014
721 Ga0501036_0949161 3300049572 Bacteria 705
722 Ga0501036_1038556 3300049572 Unclassified 670
723 Ga0501037_0167325 3300049573 Bacteria 1565
724 Ga0501037_0970061 3300049573 Unclassified 555
725 Ga0501038_0372246 3300049574 Bacteria 1109
726 Ga0501038_0394070 3300049574 Bacteria 1072
727 Ga0501039_0073727 3300049575 Bacteria 2652
728 Ga0501040_0005074 3300049576 Bacteria 8508
729 Ga0501040_0033093 3300049576 Bacteria 3500
730 Ga0501040_0050315 3300049576 Bacteria 2850
731 Ga0501040_0169625 3300049576 Bacteria 1545
732 Ga0501040_1098407 3300049576 Bacteria 577
733 Ga0501041_0059321 3300049577 Bacteria 2342
734 Ga0501041_0200888 3300049577 Bacteria 1249
735 Ga0501041_0318678 3300049577 Bacteria 981
736 Ga0501041_0712555 3300049577 Unclassified 642
737 Ga0501042_0135706 3300049578 Bacteria 1774
738 Ga0501042_0531805 3300049578 Bacteria 854
739 Ga0501042_1023688 3300049578 Bacteria 602
740 Ga0501043_0361466 3300049579 Bacteria 1102
741 Ga0501043_0548862 3300049579 Bacteria 859
742 Ga0501043_0738110 3300049579 Bacteria 717
743 Ga0501043_0814236 3300049579 Bacteria 675
744 Ga0501043_0940766 3300049579 Bacteria 618
745 Ga0501046_0090245 3300049580 Bacteria 2358
746 Ga0501046_0486811 3300049580 Unclassified 885
747 Ga0501048_0078831 3300049582 Bacteria 2325
748 Ga0501048_0556054 3300049582 Bacteria 823
749 Ga0501067_0018104 3300049583 Bacteria 3901
750 Ga0501067_0065519 3300049583 Bacteria 2011
751 Ga0501068_0029632 3300049584 Bacteria 3242
752 Ga0501068_0077246 3300049584 Bacteria 2039
753 Ga0501068_0195644 3300049584 Bacteria 1282
754 Ga0501068_0442146 3300049584 Bacteria 841
755 Ga0501069_0030340 3300049585 Bacteria 2969
756 Ga0501069_0129532 3300049585 Bacteria 1444
757 Ga0501069_0475263 3300049585 Bacteria 744
758 Ga0501071_0074452 3300049587 Bacteria 2478
759 Ga0501071_0128859 3300049587 Bacteria 1879
760 Ga0501071_0302888 3300049587 Bacteria 1212
761 Ga0501072_0136345 3300049588 Bacteria 1957
762 Ga0501072_0181917 3300049588 Bacteria 1677
763 Ga0501072_0206515 3300049588 Bacteria 1566
764 Ga0501072_0935520 3300049588 Bacteria 677
765 Ga0501072_1383178 3300049588 Bacteria 544
766 Ga0501074_0219130 3300049590 Bacteria 1355
767 Ga0501074_0381183 3300049590 Bacteria 1000
768 Ga0501074_0439368 3300049590 Bacteria 925
769 Ga0501074_0921760 3300049590 Bacteria 615
770 Ga0501075_0039504 3300049591 Bacteria 3532
771 Ga0501075_0050064 3300049591 Bacteria 3140
772 Ga0501075_0103517 3300049591 Bacteria 2163
773 Ga0501075_0108776 3300049591 Bacteria 2107
774 Ga0501075_0120193 3300049591 Bacteria 1999
775 Ga0501075_0143600 3300049591 Bacteria 1819
776 Ga0501075_0178358 3300049591 Bacteria 1621
777 Ga0501075_0181089 3300049591 Unclassified 1607
778 Ga0501075_0324184 3300049591 Bacteria 1174
779 Ga0501075_0427783 3300049591 Bacteria 1009
780 Ga0501075_0595065 3300049591 Unclassified 844
781 Ga0501075_0630076 3300049591 Bacteria 818
782 Ga0501076_0016029 3300049592 Bacteria 5672
783 Ga0501076_0019510 3300049592 Bacteria 5184
784 Ga0501076_0178291 3300049592 Bacteria 1732
785 Ga0501076_0986157 3300049592 Unclassified 694
786 Ga0501077_0020298 3300049593 Bacteria 4205
787 Ga0501077_0023045 3300049593 Bacteria 3949
788 Ga0501077_0057806 3300049593 Bacteria 2462
789 Ga0501077_0526450 3300049593 Bacteria 758
790 Ga0501077_0585850 3300049593 Bacteria 716
791 Ga0501077_0800068 3300049593 Unclassified 606
792 Ga0501235_180068 3300049669 Bacteria 563
793 Ga0501236_032159 3300049670 Bacteria 835
794 Ga0501239_072033 3300049672 Bacteria 539
795 Ga0501079_0002847 3300049741 Bacteria 12617
796 Ga0501079_0035747 3300049741 Bacteria 3825
797 Ga0501079_0083660 3300049741 Bacteria 2468
798 Ga0501079_0186289 3300049741 Bacteria 1620
799 Ga0501079_0256263 3300049741 Bacteria 1367
800 Ga0501079_0344740 3300049741 Unclassified 1167
801 Ga0501079_0404663 3300049741 Bacteria 1070
802 Ga0501079_1232217 3300049741 Bacteria 589
803 Ga0501080_0074798 3300049742 Bacteria 3151
804 Ga0501080_0364878 3300049742 Unclassified 1303
805 Ga0501080_0660533 3300049742 Bacteria 924
806 Ga0501080_0957166 3300049742 Bacteria 744
807 Ga0501081_0003659 3300049743 Bacteria 9845
808 Ga0501081_0054040 3300049743 Bacteria 2774
809 Ga0501081_0056281 3300049743 Bacteria 2718
810 Ga0501081_0094403 3300049743 Bacteria 2107
811 Ga0501081_0173265 3300049743 Bacteria 1558
812 Ga0501081_0296014 3300049743 Bacteria 1187
813 Ga0501081_0644455 3300049743 Bacteria 794
814 Ga0501081_1271718 3300049743 Unclassified 558
815 Ga0501081_1351810 3300049743 Bacteria 540
816 Ga0501083_0506763 3300049744 Bacteria 786
817 Ga0501035_0503081 3300049822 Bacteria 997
818 Ga0501045_0075038 3300049824 Bacteria 2490
819 Ga0501045_0182607 3300049824 Unclassified 1563
820 Ga0501045_0279710 3300049824 Unclassified 1242
821 Ga0501045_0408178 3300049824 Bacteria 1011
822 Ga0501045_0536946 3300049824 Bacteria 868
823 Ga0501045_0622047 3300049824 Unclassified 799
824 Ga0501045_0762198 3300049824 Unclassified 713
825 Ga0501045_1002928 3300049824 Bacteria 612
826 nmdc:mga05p37_100067_c1 3300050507 Bacteria 3570
827 nmdc:mga05p37_109212_c1 3300050507 Bacteria 3403
828 nmdc:mga05p37_110969_c2 3300050507 Bacteria 2096
829 nmdc:mga05p37_11843_c1 3300050507 Bacteria 10394
830 nmdc:mga05p37_168904_c1 3300050507 Bacteria 2669
831 nmdc:mga05p37_17944_c1 3300050507 Bacteria 8544
832 nmdc:mga05p37_219498_c1 3300050507 Bacteria 2295
833 nmdc:mga05p37_251625_c1 3300050507 Bacteria 2119
834 nmdc:mga05p37_358580_c1 3300050507 Bacteria 1715
835 nmdc:mga05p37_3637_c1 3300050507 Bacteria 18022
836 nmdc:mga05p37_43265_c1 3300050507 Bacteria 5540
837 nmdc:mga05p37_434265_c1 3300050507 Bacteria 1525
838 nmdc:mga05p37_449532_c1 3300050507 Bacteria 1492
839 nmdc:mga05p37_56510_c1 3300050507 Bacteria 4833
840 nmdc:mga05p37_634435_c1 3300050507 Archaea 1200
841 nmdc:mga05p37_72141_c1 3300050507 Bacteria 4248
842 nmdc:mga05p37_8064_c1 3300050507 Bacteria 12441
843 nmdc:mga05p37_8089_c1 3300050507 Bacteria 12428
844 nmdc:mga09592_108170_c1 3300050508 Bacteria 2385
845 nmdc:mga09592_1470980_c1 3300050508 Unclassified 555
846 nmdc:mga09592_153742_c1 3300050508 Bacteria 1985
847 nmdc:mga09592_254165_c1 3300050508 Bacteria 1523
848 nmdc:mga09592_26657_c1 3300050508 Bacteria 4790
849 nmdc:mga09592_302111_c1 3300050508 Bacteria 1388
850 nmdc:mga09592_313007_c1 3300050508 Unclassified 1360
851 nmdc:mga09592_333651_c1 3300050508 Bacteria 1313
852 nmdc:mga09592_417946_c1 3300050508 Bacteria 1159
853 nmdc:mga09592_4377_c1 3300050508 Bacteria 11419
854 nmdc:mga09592_7564_c1 3300050508 Bacteria 8838
855 nmdc:mga09592_780320_c1 3300050508 Bacteria 809
856 nmdc:mga09592_818_c1 3300050508 Bacteria 24062
857 nmdc:mga09592_82381_c1 3300050508 Bacteria 2742
858 nmdc:mga09592_95033_c1 3300050508 Bacteria 2549
859 nmdc:mga0qj67_18174_c1 3300050509 Bacteria 5356
860 nmdc:mga0qj67_247092_c1 3300050509 Bacteria 1448
861 nmdc:mga0qj67_316281_c1 3300050509 Bacteria 1264
862 nmdc:mga0qj67_392533_c1 3300050509 Unclassified 1120
863 nmdc:mga0qj67_39748_c1 3300050509 Bacteria 3696
864 nmdc:mga0qj67_638740_c1 3300050509 Bacteria 850
865 nmdc:mga0qj67_67554_c1 3300050509 Bacteria 2848
866 nmdc:mga0qj67_68714_c1 3300050509 Bacteria 2824
867 nmdc:mga0qj67_730_c1 3300050509 Bacteria 22368
868 nmdc:mga0qj67_93875_c1 3300050509 Bacteria 2413
869 nmdc:mga0qj67_9771_c1 3300050509 Bacteria 7148
870 nmdc:mga06r32_1170494_c1 3300050510 Unclassified 716
871 nmdc:mga06r32_117512_c1 3300050510 Bacteria 2621
872 nmdc:mga06r32_128690_c1 3300050510 Bacteria 2502
873 nmdc:mga06r32_12991_c1 3300050510 Bacteria 7532
874 nmdc:mga06r32_14279_c1 3300050510 Bacteria 7204
875 nmdc:mga06r32_2111_c1 3300050510 Bacteria 17801
876 nmdc:mga06r32_237426_c1 3300050510 Bacteria 1811
877 nmdc:mga06r32_326076_c1 3300050510 Bacteria 1521
878 nmdc:mga06r32_399277_c1 3300050510 Bacteria 1357
879 nmdc:mga06r32_41550_c1 3300050510 Bacteria 4370
880 nmdc:mga06r32_454447_c1 3300050510 Bacteria 1260
881 nmdc:mga06r32_4632_c1 3300050510 Bacteria 12337
882 nmdc:mga06r32_484863_c1 3300050510 Bacteria 1214
883 nmdc:mga06r32_786815_c1 3300050510 Bacteria 913
884 nmdc:mga06r32_828564_c1 3300050510 Bacteria 885
885 nmdc:mga08y16_1317_c1 3300050511 Bacteria 24673
886 nmdc:mga08y16_162187_c1 3300050511 Bacteria 2323
887 nmdc:mga08y16_171_c1 3300050511 Bacteria 56769
888 nmdc:mga08y16_1739795_c1 3300050511 Bacteria 578
889 nmdc:mga08y16_428483_c1 3300050511 Bacteria 1351
890 nmdc:mga08y16_64546_c1 3300050511 Bacteria 3823
891 nmdc:mga08y16_7918_c1 3300050511 Bacteria 11120
892 nmdc:mga0n895_10084_c1 3300050512 Bacteria 8317
893 nmdc:mga0n895_152601_c1 3300050512 Bacteria 2341
894 nmdc:mga0n895_17404_c1 3300050512 Bacteria 6622
895 nmdc:mga0n895_19948_c1 3300050512 Bacteria 6242
896 nmdc:mga0n895_334791_c1 3300050512 Bacteria 1534
897 nmdc:mga0n895_43883_c2 3300050512 Bacteria 2657
898 nmdc:mga0n895_4527_c1 3300050512 Bacteria 11439
899 nmdc:mga0n895_47458_c1 3300050512 Unclassified 4199
900 nmdc:mga0n895_51094_c1 3300050512 Bacteria 4055
901 nmdc:mga0n895_544513_c1 3300050512 Bacteria 1167
902 nmdc:mga0n895_709893_c1 3300050512 Bacteria 1001
903 nmdc:mga0n895_75696_c1 3300050512 Bacteria 3346
904 nmdc:mga0n895_861910_c1 3300050512 Bacteria 893
905 nmdc:mga0rr50_1027680_c1 3300050513 Bacteria 702
906 nmdc:mga0rr50_1280_c1 3300050513 Bacteria 13707
907 nmdc:mga0rr50_139984_c1 3300050513 Bacteria 1946
908 nmdc:mga0rr50_1590746_c1 3300050513 Bacteria 552
909 nmdc:mga0rr50_1684107_c1 3300050513 Bacteria 535
910 nmdc:mga0rr50_26347_c1 3300050513 Bacteria 4055
911 nmdc:mga0rr50_32838_c1 3300050513 Bacteria 3703
912 nmdc:mga0rr50_5599_c1 3300050513 Bacteria 7516
913 nmdc:mga0rr50_91452_c1 3300050513 Bacteria 2370
914 nmdc:mga08x19_361052_c1 3300050514 Unclassified 1015
915 nmdc:mga08x19_45966_c1 3300050514 Bacteria 2791
916 nmdc:mga08x19_5649_c1 3300050514 Bacteria 7392
917 nmdc:mga08x19_601847_c1 3300050514 Bacteria 779
918 nmdc:mga08x19_76845_c1 3300050514 Bacteria 2186
919 nmdc:mga08x19_9252_c1 3300050514 Bacteria 5888
920 nmdc:mga0a205_111571_c1 3300050515 Bacteria 2634
921 nmdc:mga0a205_120630_c1 3300050515 Bacteria 2521
922 nmdc:mga0a205_144582_c1 3300050515 Bacteria 2278
923 nmdc:mga0a205_178729_c1 3300050515 Bacteria 2017
924 nmdc:mga0a205_189823_c1 3300050515 Bacteria 1947
925 nmdc:mga0a205_19596_c1 3300050515 Bacteria 6381
926 nmdc:mga0a205_24698_c1 3300050515 Bacteria 5718
927 nmdc:mga0a205_4101_c1 3300050515 Bacteria 13035
928 nmdc:mga0a205_480572_c1 3300050515 Bacteria 1101
929 nmdc:mga0a205_49683_c1 3300050515 Bacteria 3129
930 nmdc:mga0a205_502462_c1 3300050515 Unclassified 1069
931 nmdc:mga0a205_64423_c1 3300050515 Bacteria 3540
932 nmdc:mga0a205_72713_c1 3300050515 Bacteria 3322
933 nmdc:mga0a205_7301_c1 3300050515 Bacteria 6084
934 nmdc:mga0a205_747144_c1 3300050515 Bacteria 827
935 nmdc:mga0a205_796_c1 3300050515 Bacteria 25603
936 nmdc:mga0a205_9201_c1 3300050515 Bacteria 9018
937 Ga0495619_0430549 3300053085 Bacteria 910
938 Ga0501084_0007316 3300054114 Bacteria 9092
939 Ga0501084_0019852 3300054114 Bacteria 5601
940 Ga0501084_0039408 3300054114 Bacteria 3952
941 Ga0501084_0111022 3300054114 Bacteria 2304
942 Ga0501084_0117599 3300054114 Bacteria 2235
943 Ga0501084_0139932 3300054114 Bacteria 2038
944 Ga0501084_0522945 3300054114 Bacteria 1003
945 Ga0501084_0843721 3300054114 Bacteria 771
946 Ga0501084_1442183 3300054114 Unclassified 576
947 Ga0590075_016660 3300059424 Bacteria 1808
948 Ga0590075_024665 3300059424 Bacteria 1510
949 Ga0501082_0070725 3300060353 Bacteria 3004
950 Ga0501082_0083559 3300060353 Bacteria 2755
951 Ga0501082_0090616 3300060353 Bacteria 2640
952 Ga0501082_0168589 3300060353 Bacteria 1903
953 Ga0501082_0222579 3300060353 Bacteria 1642
954 Ga0501082_0483426 3300060353 Unclassified 1082
955 Ga0501082_0536677 3300060353 Bacteria 1023
956 Ga0501082_0566207 3300060353 Bacteria 994
957 Ga0501082_1090843 3300060353 Bacteria 698
958 Ga0530510_0029602 3300061734 Bacteria 3931
959 Ga0530510_0047462 3300061734 Bacteria 3103
960 Ga0530510_0064878 3300061734 Bacteria 2645
961 Ga0530510_0091456 3300061734 Bacteria 2220
962 Ga0530510_0312353 3300061734 Unclassified 1177
963 Ga0530510_0529217 3300061734 Bacteria 894
964 Ga0530510_0572390 3300061734 Bacteria 858
965 Ga0075434_101860463
966 JGI25406J46586_10005819
967 JGI25404J52841_10105087
968 Ga0065712_10141318
969 Ga0065715_10113974
970 Ga0065707_10185628
971 Ga0065707_10244704
972 Ga0065707_10479327
973 Ga0070658_10660707
974 Ga0070676_10000005
975 Ga0070676_10011118
976 Ga0070676_10237672
977 Ga0070683_100038454
978 Ga0070690_100256890
979 Ga0070670_100001199
980 Ga0070677_10213424
981 Ga0068869_100002745
982 Ga0068869_100009337
983 Ga0068869_100050419
984 Ga0070666_10219720
985 Ga0070680_100000094
986 Ga0070680_100039088
987 Ga0070680_100062111
988 Ga0070680_100437265
989 Ga0070680_101041210
990 Ga0070682_100003884
991 Ga0068868_100014283
992 Ga0068868_100133018
993 Ga0070660_100003125
994 Ga0070689_100003437
995 Ga0070689_100419278
996 Ga0070691_10006218
997 Ga0070691_10049587
998 Ga0070691_10093272
999 Ga0070691_10537802
1000 Ga0070687_100079182
1001 Ga0070661_100006165
1002 Ga0070692_10001646
1003 Ga0070692_10004232
1004 Ga0070668_100326905
1005 Ga0070668_100562170
1006 Ga0070669_100040023
1007 Ga0070669_100068744
1008 Ga0070669_100101399
1009 Ga0070669_100164531
1010 Ga0070669_100623873
1011 Ga0070671_100189336
1012 Ga0070674_100548612
1013 Ga0070673_100017616
1014 Ga0070688_100135114
1015 Ga0070688_100386324
1016 Ga0070659_100001138
1017 Ga0070659_101987984
1018 Ga0070703_10039928
1019 Ga0070703_10043334
1020 Ga0070703_10081142
1021 Ga0070703_10195063
1022 Ga0070701_10046764
1023 Ga0070701_10097707
1024 Ga0070711_100107027
1025 Ga0070711_100259608
1026 Ga0070705_100028364
1027 Ga0070705_100029223
1028 Ga0070705_100031904
1029 Ga0070705_100038776
1030 Ga0070705_100215705
1031 Ga0070700_100051404
1032 Ga0070700_100095624
1033 Ga0070694_100002997
1034 Ga0070694_100004403
1035 Ga0070694_100115083
1036 Ga0070694_100331669
1037 Ga0070694_100795933
1038 Ga0070708_100015531
1039 Ga0070708_100023561
1040 Ga0070708_100024205
1041 Ga0070708_100051214
1042 Ga0070708_100159238
1043 Ga0070708_100231582
1044 Ga0070708_100321554
1045 Ga0070708_100321786
1046 Ga0070708_100384527
1047 Ga0070708_101417996
1048 Ga0070663_100000763
1049 Ga0070662_100042435
1050 Ga0070662_100081362
1051 Ga0070681_10034394
1052 Ga0070681_10058087
1053 Ga0070681_10062606
1054 Ga0070681_10390843
1055 Ga0068867_100002733
1056 Ga0068867_100019737
1057 Ga0068867_100157437
1058 Ga0068867_100884171
1059 Ga0070706_100004618
1060 Ga0070706_100008662
1061 Ga0070706_100043566
1062 Ga0070706_100075697
1063 Ga0070706_100090200
1064 Ga0070706_100136905
1065 Ga0070706_100159881
1066 Ga0070706_100314395
1067 Ga0070706_100327919
1068 Ga0070706_100531695
1069 Ga0070707_100001786
1070 Ga0070707_100005318
1071 Ga0070707_100011093
1072 Ga0070707_100014433
1073 Ga0070707_100018600
1074 Ga0070707_100045167
1075 Ga0070707_100061661
1076 Ga0070707_100087596
1077 Ga0070707_100133354
1078 Ga0070707_100139937
1079 Ga0070707_100417330
1080 Ga0070707_100666676
1081 Ga0070707_100879946
1082 Ga0070707_100975812
1083 Ga0070698_100006315
1084 Ga0070698_100118659
1085 Ga0070698_100331196
1086 Ga0070698_100570296
1087 Ga0070698_100654502
1088 Ga0070699_100002516
1089 Ga0070699_100019945
1090 Ga0070699_100037281
1091 Ga0070699_100051010
1092 Ga0070699_100081806
1093 Ga0070699_100091875
1094 Ga0070699_100185087
1095 Ga0070699_100294785
1096 Ga0070699_100319775
1097 Ga0070699_100350177
1098 Ga0070699_100445390
1099 Ga0070699_100489209
1100 Ga0070699_100917110
1101 Ga0070679_100001113
1102 Ga0070679_100034545
1103 Ga0070679_100036717
1104 Ga0070679_100234132
1105 Ga0070679_100309895
1106 Ga0070684_100241528
1107 Ga0070697_100000676
1108 Ga0070697_100002183
1109 Ga0070697_100025430
1110 Ga0070697_100048316
1111 Ga0070697_100182974
1112 Ga0070697_100188915
1113 Ga0070697_100189402
1114 Ga0070697_100225229
1115 Ga0070697_100261986
1116 Ga0070697_100359912
1117 Ga0070697_100874309
1118 Ga0068853_100008227
1119 Ga0070672_100024688
1120 Ga0070672_100164052
1121 Ga0070672_100448181
1122 Ga0070686_100310061
1123 Ga0070686_101247849
1124 Ga0070695_100001443
1125 Ga0070695_100005056
1126 Ga0070695_100096571
1127 Ga0070695_100134677
1128 Ga0070696_100001369
1129 Ga0070696_100017182
1130 Ga0070696_100025044
1131 Ga0070696_100079526
1132 Ga0070696_100085349
1133 Ga0070696_100330285
1134 Ga0070696_101718551
1135 Ga0070693_100000104
1136 Ga0070693_100356053
1137 Ga0070665_101162564
1138 Ga0070704_100014114
1139 Ga0070704_100018081
1140 Ga0070704_100033390
1141 Ga0070704_100066200
1142 Ga0070704_100266623
1143 Ga0070704_100720848
1144 Ga0070704_100881208
1145 Ga0070704_100952440
1146 Ga0070704_101587799
1147 Ga0068855_100016998
1148 Ga0068855_100518680
1149 Ga0068855_100577014
1150 Ga0068855_100611731
1151 Ga0068857_100094550
1152 Ga0068857_100175503
1153 Ga0068857_100214239
1154 Ga0068854_100004651
1155 Ga0068856_100012614
1156 Ga0068856_100071511
1157 Ga0068856_100298801
1158 Ga0070702_100024931
1159 Ga0070702_101046941
1160 Ga0068852_100389912
1161 Ga0068859_100001562
1162 Ga0068859_100127803
1163 Ga0068859_100268466
1164 Ga0068859_100338727
1165 Ga0068859_100446312
1166 Ga0068859_100501533
1167 Ga0068859_100641229
1168 Ga0068864_100000991
1169 Ga0068864_100047381
1170 Ga0068864_101256791
1171 Ga0068866_10073428
1172 Ga0068866_10618098
1173 Ga0068861_100018444
1174 Ga0068861_100154005
1175 Ga0068861_100237858
1176 Ga0068851_10198680
1177 Ga0068870_10002820
1178 Ga0068863_100010104
1179 Ga0068863_100708195
1180 Ga0068863_101154134
1181 Ga0068863_101522666
1182 Ga0068863_101948999
1183 Ga0068858_100033406
1184 Ga0068858_100157079
1185 Ga0068860_100022117
1186 Ga0068860_100336400
1187 Ga0068860_100878726
1188 Ga0068860_100882234
1189 Ga0068862_100007685
1190 Ga0068862_100013048
1191 Ga0068862_100023027
1192 Ga0068862_100043608
1193 Ga0068862_100098268
1194 Ga0068862_100212790
1195 Ga0068862_100468936
1196 Ga0068862_100591516
1197 Ga0068862_101279850
1198 Ga0081540_1001963
1199 Ga0081539_10000590
1200 Ga0075432_10080745
1201 Ga0070715_10267494
1202 Ga0070715_11017775
1203 Ga0070716_100007870
1204 Ga0075427_10021528
1205 Ga0097621_101244755
1206 Ga0068871_100762236
1207 Ga0075428_100000730
1208 Ga0075428_100008047
1209 Ga0075428_100017939
1210 Ga0075428_100030783
1211 Ga0075428_100063364
1212 Ga0075428_100161255
1213 Ga0075428_100175668
1214 Ga0075428_100188259
1215 Ga0075428_100304698
1216 Ga0075428_100466585
1217 Ga0075428_100563045
1218 Ga0075428_100842283
1219 Ga0075428_101009790
1220 Ga0075430_100002036
1221 Ga0075430_100006370
1222 Ga0075430_100018856
1223 Ga0075430_100111721
1224 Ga0075430_100176534
1225 Ga0075430_100198464
1226 Ga0075430_100309158
1227 Ga0075430_100350342
1228 Ga0075430_100395150
1229 Ga0075430_100490427
1230 Ga0075431_100007203
1231 Ga0075431_100008661
1232 Ga0075431_100010364
1233 Ga0075431_100019710
1234 Ga0075431_100035297
1235 Ga0075431_100070228
1236 Ga0075431_100089673
1237 Ga0075431_100093074
1238 Ga0075431_100110736
1239 Ga0075431_100219357
1240 Ga0075431_100270914
1241 Ga0075431_100307066
1242 Ga0075431_100471721
1243 Ga0075431_100781618
1244 Ga0075431_101567585
1245 Ga0075433_10001209
1246 Ga0075433_10002879
1247 Ga0075433_10005890
1248 Ga0075433_10018092
1249 Ga0075433_10022899
1250 Ga0075433_10025739
1251 Ga0075433_10040876
1252 Ga0075433_10080500
1253 Ga0075433_10085717
1254 Ga0075433_10086269
1255 Ga0075433_10088588
1256 Ga0075433_10161430
1257 Ga0075433_10444063
1258 Ga0075433_10536391
1259 Ga0075433_10819915
1260 Ga0075434_100000039
1261 Ga0075434_100004221
1262 Ga0075434_100011543
1263 Ga0075434_100061715
1264 Ga0075434_100071242
1265 Ga0075434_100092860
1266 Ga0075434_100118891
1267 Ga0075434_100120734
1268 Ga0075434_100149544
1269 Ga0075434_100185820
1270 Ga0075434_100235777
1271 Ga0075434_100436959
1272 Ga0075434_100597562
1273 Ga0075434_100911680
1274 Ga0075434_101756525
1275 Ga0075429_100002010
1276 Ga0075429_100010977
1277 Ga0075429_100011741
1278 Ga0075429_100013899
1279 Ga0075429_100014322
1280 Ga0075429_100023491
1281 Ga0075429_100095349
1282 Ga0075429_100102898
1283 Ga0075429_100175753
1284 Ga0075429_100178014
1285 Ga0075429_100183632
1286 Ga0075429_100230963
1287 Ga0075429_100312326
1288 Ga0068865_100078896
1289 Ga0068865_100080105
1290 Ga0075436_100044437
1291 Ga0075436_100084670
1292 Ga0075436_100086429
1293 Ga0075436_100127043
1294 Ga0075436_100383659
1295 Ga0075436_100466309
1296 Ga0075436_100625026
1297 Ga0097620_100001562
1298 Ga0097620_100127803
1299 Ga0097620_100268459
1300 Ga0097620_100338733
1301 Ga0097620_100446301
1302 Ga0097620_100501536
1303 Ga0097620_100641246
1304 Ga0075435_100008582
1305 Ga0075435_100017075
1306 Ga0075435_100028763
1307 Ga0075435_100041954
1308 Ga0075435_100065361
1309 Ga0075435_100128630
1310 Ga0075435_100142348
1311 Ga0075435_100222577
1312 Ga0075435_100711065
1313 Ga0075435_100750633
1314 Ga0099794_10003785
1315 Ga0099794_10007317
1316 Ga0099794_10053082
1317 Ga0099794_10399742
1318 Ga0099794_10455910
1319 Ga0111539_10000715
1320 Ga0111539_10000819
1321 Ga0111539_10001430
1322 Ga0111539_10047551
1323 Ga0111539_10076175
1324 Ga0105245_10800644
1325 Ga0114129_10000409
1326 Ga0114129_10003438
1327 Ga0114129_10005405
1328 Ga0114129_10008975
1329 Ga0114129_10059492
1330 Ga0114129_10077976
1331 Ga0114129_10082816
1332 Ga0114129_10083036
1333 Ga0114129_10097283
1334 Ga0114129_10138195
1335 Ga0114129_10143481
1336 Ga0114129_10199854
1337 Ga0114129_10224251
1338 Ga0114129_10335894
1339 Ga0114129_10542462
1340 Ga0114129_10990084
1341 Ga0114129_11239651
1342 Ga0114129_11562390
1343 Ga0105243_10161636
1344 Ga0105243_10338732
1345 Ga0105243_10613718
1346 Ga0105241_10001344
1347 Ga0105241_10615983
1348 Ga0105242_10021975
1349 Ga0105242_10190262
1350 Ga0105248_10186725
1351 Ga0105248_10189571
1352 Ga0105248_11738923
1353 Ga0105237_10058839
1354 Ga0105238_10389887
1355 Ga0105249_10061301
1356 Ga0105249_10096471
1357 Ga0105249_10099318
1358 Ga0105249_10147254
1359 Ga0105249_10333816
1360 Ga0105249_10575338
1361 Ga0105249_11114596
1362 Ga0105249_11652903
1363 Ga0105246_10012663
1364 Ga0157373_10000101
1365 Ga0157371_10437079
1366 Ga0157370_10275494
1367 Ga0157369_10012134
1368 Ga0157374_10446432
1369 Ga0157374_11080543
1370 Ga0157378_10058823
1371 Ga0157378_12506964
1372 Ga0163162_10489108
1373 Ga0163162_10884082
1374 Ga0157372_10000703
1375 Ga0157372_11118195
1376 Ga0157375_10048022
1377 Ga0157375_10524051
1378 Ga0157375_10711959
1379 Ga0157375_12641858
1380 Ga0163163_10152202
1381 Ga0163163_10159045
1382 Ga0163163_10736290
1383 Ga0157380_10056424
1384 Ga0157380_10162064
1385 Ga0157380_10496505
1386 Ga0182008_10397785
1387 Ga0157377_10303813
1388 Ga0157379_10166896
1389 Ga0157379_10902559
1390 Ga0163161_10224342
1391 Ga0163161_11869771
1392 Ga0206356_11442960
1393 Ga0206354_10938711
1394 Ga0207656_10067904
1395 Ga0207653_10019640
1396 Ga0207653_10071663
1397 Ga0207653_10229018
1398 Ga0207692_10397937
1399 Ga0207642_10292696
1400 Ga0207642_10805140
1401 Ga0207680_10158576
1402 Ga0207647_10049061
1403 Ga0207645_10000852
1404 Ga0207645_10013648
1405 Ga0207643_10000150
1406 Ga0207684_10000996
1407 Ga0207684_10001569
1408 Ga0207684_10002411
1409 Ga0207684_10008157
1410 Ga0207684_10028553
1411 Ga0207684_10052166
1412 Ga0207684_10182336
1413 Ga0207684_10239761
1414 Ga0207684_10284387
1415 Ga0207684_10313165
1416 Ga0207684_10387267
1417 Ga0207684_10462277
1418 Ga0207684_10506424
1419 Ga0207684_10521690
1420 Ga0207654_10029377
1421 Ga0207654_10119642
1422 Ga0207707_10000076
1423 Ga0207707_10031856
1424 Ga0207707_10102064
1425 Ga0207707_10140157
1426 Ga0207707_10336183
1427 Ga0207663_10698262
1428 Ga0207660_10000022
1429 Ga0207660_10048361
1430 Ga0207662_10023135
1431 Ga0207657_10000005
1432 Ga0207649_10003591
1433 Ga0207652_10000060
1434 Ga0207652_10023677
1435 Ga0207652_10069077
1436 Ga0207652_10078641
1437 Ga0207652_10349596
1438 Ga0207646_10001766
1439 Ga0207646_10006356
1440 Ga0207646_10008955
1441 Ga0207646_10016669
1442 Ga0207646_10040356
1443 Ga0207646_10114641
1444 Ga0207646_10141204
1445 Ga0207646_10159756
1446 Ga0207646_10424425
1447 Ga0207646_10487366
1448 Ga0207646_10601260
1449 Ga0207646_11349769
1450 Ga0207681_10007091
1451 Ga0207681_10211310
1452 Ga0207681_10459040
1453 Ga0207681_10605141
1454 Ga0207681_10681995
1455 Ga0207694_11095009
1456 Ga0207694_11661090
1457 Ga0207650_10072410
1458 Ga0207659_10248049
1459 Ga0207659_10916707
1460 Ga0207644_10458373
1461 Ga0207690_10006358
1462 Ga0207706_10027460
1463 Ga0207706_10063115
1464 Ga0207686_10322557
1465 Ga0207709_10017341
1466 Ga0207709_10380646
1467 Ga0207709_10697026
1468 Ga0207709_10725893
1469 Ga0207670_10008129
1470 Ga0207704_10233523
1471 Ga0207704_10308151
1472 Ga0207704_10502297
1473 Ga0207665_10005354
1474 Ga0207691_10037324
1475 Ga0207691_10216845
1476 Ga0207711_10279211
1477 Ga0207711_11332540
1478 Ga0207689_10000050
1479 Ga0207689_10004262
1480 Ga0207689_10198354
1481 Ga0207661_10109543
1482 Ga0207661_10436733
1483 Ga0207661_10651228
1484 Ga0207679_10002376
1485 Ga0207667_10000587
1486 Ga0207667_10343624
1487 Ga0207651_10011721
1488 Ga0207712_10050600
1489 Ga0207712_10306567
1490 Ga0207712_10670257
1491 Ga0207712_10768261
1492 Ga0207712_11199756
1493 Ga0207668_10401152
1494 Ga0207668_10630763
1495 Ga0207640_10049758
1496 Ga0207640_10211929
1497 Ga0207640_11060467
1498 Ga0207677_10436860
1499 Ga0207677_10836824
1500 Ga0207703_10060648
1501 Ga0207639_10049105
1502 Ga0207639_11404783
1503 Ga0207678_10001742
1504 Ga0207678_10318709
1505 Ga0207708_10124948
1506 Ga0207708_10542310
1507 Ga0207702_10098091
1508 Ga0207702_10691902
1509 Ga0207702_10928924
1510 Ga0207641_10022956
1511 Ga0207641_10335830
1512 Ga0207641_10520199
1513 Ga0207641_11021133
1514 Ga0207648_10005797
1515 Ga0207648_10038731
1516 Ga0207648_10067171
1517 Ga0207648_10131629
1518 Ga0207648_10146922
1519 Ga0207676_10061331
1520 Ga0207676_10197607
1521 Ga0207676_11038288
1522 Ga0207674_10000075
1523 Ga0207674_10036958
1524 Ga0207674_10067327
1525 Ga0207674_10084664
1526 Ga0207675_100012152
1527 Ga0207675_100229606
1528 Ga0210000_1009137
1529 Ga0209983_1022072
1530 Ga0209588_1002125
1531 Ga0209588_1077971
1532 Ga0209998_10141696
1533 Ga0209974_10046506
1534 Ga0207428_10000009
1535 Ga0207428_10000631
1536 Ga0207428_10109497
1537 Ga0207428_10560977
1538 Ga0207428_10970037
1539 Ga0268266_10873953
1540 Ga0268265_10007375
1541 Ga0268265_10067642
1542 Ga0268265_10090858
1543 Ga0268265_10177003
1544 Ga0268265_10467559
1545 Ga0268265_10945312
1546 Ga0268264_10020679
1547 Ga0268264_10030980
1548 Ga0268264_10092992
1549 Ga0268264_10260110
1550 Ga0268264_10657248
1551 Ga0268264_10710385
1552 Ga0268264_11928651
1553 Ga0265325_10005355
1554 Ga0307509_10067942
1555 Ga0307408_100029740
1556 Ga0307408_100044097
1557 Ga0307408_100222053
1558 Ga0307405_10111668
1559 Ga0307405_10273264
1560 Ga0307410_11763437
1561 Ga0307406_10078084
1562 Ga0307407_10585805
1563 Ga0307412_10923570
1564 Ga0307416_100001116
1565 Ga0307416_100521610
1566 Ga0307416_102064962
1567 Ga0307411_10100729
1568 Ga0307411_10491308
1569 Ga0307411_10961862
1570 Ga0307415_100263008
1571 Ga0307415_101943541
1572 Ga0373930_0045200
1573 Ga0373948_0022860
1574 Ga0373958_0038403
1575 Ga0373959_0011123
1576 Ga0373934_0263500
1577 Ga0373940_0002057
1578 Ga0373940_0022837
1579 Ga0373949_0001137
1580 Ga0373949_0154028
1581 Ga0373951_0021372
1582 Ga0373952_0051068
1583 Ga0373952_0066762
1584 Ga0373932_0114584
1585 Ga0373939_0390273
1586 Ga0373941_0124486
1587 Ga0373945_0460582
1588 Ga0373960_0032851
1589 Ga0373960_0246812
1590 Ga0373943_0011173
1591 Ga0373942_0057071
1592 Ga0373942_0080498
1593 Ga0373961_0003927
1594 Ga0373961_0076866
1595 Ga0373962_0006756
1596 Ga0373962_0011889
1597 Ga0373931_0005358
1598 Ga0373931_0009773
1599 Ga0373931_0104028
1600 Ga0373931_0315703
1601 Ga0373933_0329719
1602 Ga0395899_0005710
1603 Ga0395900_0005301
1604 Ga0395900_0254312
1605 Ga0395898_0007244
1606 Ga0395898_1322176
1607 Ga0395905_0048060
1608 Ga0395901_0137841
1609 Ga0395901_0718524
1610 Ga0395901_0915858
1611 Ga0436361_0067535
1612 Ga0436363_0822832
1613 Ga0436363_1398976
1614 Ga0439448_0020856
1615 Ga0439455_0025065
1616 Ga0439455_0049398
1617 Ga0450889_013854
1618 Ga0439458_0008415
1619 Ga0439459_0024084
1620 Ga0439459_0046145
1621 Ga0439460_0077985
1622 Ga0451577_0003313
1623 Ga0451577_0054622
1624 Ga0451577_0100573
1625 Ga0451577_0182142
1626 Ga0451577_0510865
1627 Ga0466972_0207976
1628 Ga0453683_0008769
1629 Ga0453683_0107187
1630 Ga0453683_0137695
1631 Ga0466961_0608984
1632 Ga0453684_0023688
1633 Ga0453684_0030957
1634 Ga0453684_0082959
1635 Ga0451576_0006637
1636 Ga0451576_0022946
1637 Ga0451576_0024715
1638 Ga0451576_0029219
1639 Ga0451576_0051221
1640 Ga0451576_0678385
1641 Ga0466967_0536850
1642 Ga0466967_1580040
1643 Ga0466967_2054182
1644 Ga0495603_0538655
1645 Ga0495651_0537884
1646 Ga0495580_0001861
1647 Ga0495580_0472434
1648 Ga0495584_0669906
1649 Ga0495584_0674244
1650 Ga0495594_0091689
1651 Ga0495607_0335206
1652 Ga0495628_0289371
1653 Ga0495642_0098964
1654 Ga0495642_0402460
1655 Ga0495642_0528914
1656 Ga0495652_0554207
1657 Ga0495656_0350537
1658 Ga0495599_0178882
1659 Ga0495623_0102012
1660 Ga0495646_0522226
1661 Ga0495669_0099714
1662 Ga0495669_0637634
1663 Ga0495613_0474799
1664 Ga0495636_0592228
1665 Ga0495674_1209400
1666 Ga0495602_0056861
1667 Ga0495602_0190760
1668 Ga0496102_0030748
1669 Ga0496102_0100319
1670 Ga0496104_0307557
1671 Ga0496106_0066708
1672 Ga0496106_0165429
1673 Ga0496107_0155165
1674 Ga0496109_0350859
1675 Ga0496109_0833305
1676 Ga0496110_0166215
1677 Ga0496111_0188069
1678 Ga0496112_0037103
1679 Ga0496112_0812371
1680 Ga0496113_0344742
1681 Ga0501298_043407
1682 Ga0501033_0060859
1683 Ga0501034_0430056
1684 Ga0501036_0497695
1685 Ga0501036_0949161
1686 Ga0501036_1038556
1687 Ga0501037_0167325
1688 Ga0501037_0970061
1689 Ga0501038_0372246
1690 Ga0501038_0394070
1691 Ga0501039_0073727
1692 Ga0501040_0005074
1693 Ga0501040_0033093
1694 Ga0501040_0050315
1695 Ga0501040_0169625
1696 Ga0501040_1098407
1697 Ga0501041_0059321
1698 Ga0501041_0200888
1699 Ga0501041_0318678
1700 Ga0501041_0712555
1701 Ga0501042_0135706
1702 Ga0501042_0531805
1703 Ga0501042_1023688
1704 Ga0501043_0361466
1705 Ga0501043_0548862
1706 Ga0501043_0738110
1707 Ga0501043_0814236
1708 Ga0501043_0940766
1709 Ga0501046_0090245
1710 Ga0501046_0486811
1711 Ga0501048_0078831
1712 Ga0501048_0556054
1713 Ga0501067_0018104
1714 Ga0501067_0065519
1715 Ga0501068_0029632
1716 Ga0501068_0077246
1717 Ga0501068_0195644
1718 Ga0501068_0442146
1719 Ga0501069_0030340
1720 Ga0501069_0129532
1721 Ga0501069_0475263
1722 Ga0501071_0074452
1723 Ga0501071_0128859
1724 Ga0501071_0302888
1725 Ga0501072_0136345
1726 Ga0501072_0181917
1727 Ga0501072_0206515
1728 Ga0501072_0935520
1729 Ga0501072_1383178
1730 Ga0501074_0219130
1731 Ga0501074_0381183
1732 Ga0501074_0439368
1733 Ga0501074_0921760
1734 Ga0501075_0039504
1735 Ga0501075_0050064
1736 Ga0501075_0103517
1737 Ga0501075_0108776
1738 Ga0501075_0120193
1739 Ga0501075_0143600
1740 Ga0501075_0178358
1741 Ga0501075_0181089
1742 Ga0501075_0324184
1743 Ga0501075_0427783
1744 Ga0501075_0595065
1745 Ga0501075_0630076
1746 Ga0501076_0016029
1747 Ga0501076_0019510
1748 Ga0501076_0178291
1749 Ga0501076_0986157
1750 Ga0501077_0020298
1751 Ga0501077_0023045
1752 Ga0501077_0057806
1753 Ga0501077_0526450
1754 Ga0501077_0585850
1755 Ga0501077_0800068
1756 Ga0501235_180068
1757 Ga0501236_032159
1758 Ga0501239_072033
1759 Ga0501079_0002847
1760 Ga0501079_0035747
1761 Ga0501079_0083660
1762 Ga0501079_0186289
1763 Ga0501079_0256263
1764 Ga0501079_0344740
1765 Ga0501079_0404663
1766 Ga0501079_1232217
1767 Ga0501080_0074798
1768 Ga0501080_0364878
1769 Ga0501080_0660533
1770 Ga0501080_0957166
1771 Ga0501081_0003659
1772 Ga0501081_0054040
1773 Ga0501081_0056281
1774 Ga0501081_0094403
1775 Ga0501081_0173265
1776 Ga0501081_0296014
1777 Ga0501081_0644455
1778 Ga0501081_1271718
1779 Ga0501081_1351810
1780 Ga0501083_0506763
1781 Ga0501035_0503081
1782 Ga0501045_0075038
1783 Ga0501045_0182607
1784 Ga0501045_0279710
1785 Ga0501045_0408178
1786 Ga0501045_0536946
1787 Ga0501045_0622047
1788 Ga0501045_0762198
1789 Ga0501045_1002928
1790 nmdc:mga05p37_100067_c1
1791 nmdc:mga05p37_109212_c1
1792 nmdc:mga05p37_110969_c2
1793 nmdc:mga05p37_11843_c1
1794 nmdc:mga05p37_168904_c1
1795 nmdc:mga05p37_17944_c1
1796 nmdc:mga05p37_219498_c1
1797 nmdc:mga05p37_251625_c1
1798 nmdc:mga05p37_358580_c1
1799 nmdc:mga05p37_3637_c1
1800 nmdc:mga05p37_43265_c1
1801 nmdc:mga05p37_434265_c1
1802 nmdc:mga05p37_449532_c1
1803 nmdc:mga05p37_56510_c1
1804 nmdc:mga05p37_634435_c1
1805 nmdc:mga05p37_72141_c1
1806 nmdc:mga05p37_8064_c1
1807 nmdc:mga05p37_8089_c1
1808 nmdc:mga09592_108170_c1
1809 nmdc:mga09592_1470980_c1
1810 nmdc:mga09592_153742_c1
1811 nmdc:mga09592_254165_c1
1812 nmdc:mga09592_26657_c1
1813 nmdc:mga09592_302111_c1
1814 nmdc:mga09592_313007_c1
1815 nmdc:mga09592_333651_c1
1816 nmdc:mga09592_417946_c1
1817 nmdc:mga09592_4377_c1
1818 nmdc:mga09592_7564_c1
1819 nmdc:mga09592_780320_c1
1820 nmdc:mga09592_818_c1
1821 nmdc:mga09592_82381_c1
1822 nmdc:mga09592_95033_c1
1823 nmdc:mga0qj67_18174_c1
1824 nmdc:mga0qj67_247092_c1
1825 nmdc:mga0qj67_316281_c1
1826 nmdc:mga0qj67_392533_c1
1827 nmdc:mga0qj67_39748_c1
1828 nmdc:mga0qj67_638740_c1
1829 nmdc:mga0qj67_67554_c1
1830 nmdc:mga0qj67_68714_c1
1831 nmdc:mga0qj67_730_c1
1832 nmdc:mga0qj67_93875_c1
1833 nmdc:mga0qj67_9771_c1
1834 nmdc:mga06r32_1170494_c1
1835 nmdc:mga06r32_117512_c1
1836 nmdc:mga06r32_128690_c1
1837 nmdc:mga06r32_12991_c1
1838 nmdc:mga06r32_14279_c1
1839 nmdc:mga06r32_2111_c1
1840 nmdc:mga06r32_237426_c1
1841 nmdc:mga06r32_326076_c1
1842 nmdc:mga06r32_399277_c1
1843 nmdc:mga06r32_41550_c1
1844 nmdc:mga06r32_454447_c1
1845 nmdc:mga06r32_4632_c1
1846 nmdc:mga06r32_484863_c1
1847 nmdc:mga06r32_786815_c1
1848 nmdc:mga06r32_828564_c1
1849 nmdc:mga08y16_1317_c1
1850 nmdc:mga08y16_162187_c1
1851 nmdc:mga08y16_171_c1
1852 nmdc:mga08y16_1739795_c1
1853 nmdc:mga08y16_428483_c1
1854 nmdc:mga08y16_64546_c1
1855 nmdc:mga08y16_7918_c1
1856 nmdc:mga0n895_10084_c1
1857 nmdc:mga0n895_152601_c1
1858 nmdc:mga0n895_17404_c1
1859 nmdc:mga0n895_19948_c1
1860 nmdc:mga0n895_334791_c1
1861 nmdc:mga0n895_43883_c2
1862 nmdc:mga0n895_4527_c1
1863 nmdc:mga0n895_47458_c1
1864 nmdc:mga0n895_51094_c1
1865 nmdc:mga0n895_544513_c1
1866 nmdc:mga0n895_709893_c1
1867 nmdc:mga0n895_75696_c1
1868 nmdc:mga0n895_861910_c1
1869 nmdc:mga0rr50_1027680_c1
1870 nmdc:mga0rr50_1280_c1
1871 nmdc:mga0rr50_139984_c1
1872 nmdc:mga0rr50_1590746_c1
1873 nmdc:mga0rr50_1684107_c1
1874 nmdc:mga0rr50_26347_c1
1875 nmdc:mga0rr50_32838_c1
1876 nmdc:mga0rr50_5599_c1
1877 nmdc:mga0rr50_91452_c1
1878 nmdc:mga08x19_361052_c1
1879 nmdc:mga08x19_45966_c1
1880 nmdc:mga08x19_5649_c1
1881 nmdc:mga08x19_601847_c1
1882 nmdc:mga08x19_76845_c1
1883 nmdc:mga08x19_9252_c1
1884 nmdc:mga0a205_111571_c1
1885 nmdc:mga0a205_120630_c1
1886 nmdc:mga0a205_144582_c1
1887 nmdc:mga0a205_178729_c1
1888 nmdc:mga0a205_189823_c1
1889 nmdc:mga0a205_19596_c1
1890 nmdc:mga0a205_24698_c1
1891 nmdc:mga0a205_4101_c1
1892 nmdc:mga0a205_480572_c1
1893 nmdc:mga0a205_49683_c1
1894 nmdc:mga0a205_502462_c1
1895 nmdc:mga0a205_64423_c1
1896 nmdc:mga0a205_72713_c1
1897 nmdc:mga0a205_7301_c1
1898 nmdc:mga0a205_747144_c1
1899 nmdc:mga0a205_796_c1
1900 nmdc:mga0a205_9201_c1
1901 Ga0495619_0430549
1902 Ga0501084_0007316
1903 Ga0501084_0019852
1904 Ga0501084_0039408
1905 Ga0501084_0111022
1906 Ga0501084_0117599
1907 Ga0501084_0139932
1908 Ga0501084_0522945
1909 Ga0501084_0843721
1910 Ga0501084_1442183
1911 Ga0590075_016660
1912 Ga0590075_024665
1913 Ga0501082_0070725
1914 Ga0501082_0083559
1915 Ga0501082_0090616
1916 Ga0501082_0168589
1917 Ga0501082_0222579
1918 Ga0501082_0483426
1919 Ga0501082_0536677
1920 Ga0501082_0566207
1921 Ga0501082_1090843
1922 Ga0530510_0029602
1923 Ga0530510_0047462
1924 Ga0530510_0064878
1925 Ga0530510_0091456
1926 Ga0530510_0312353
1927 Ga0530510_0529217
1928 Ga0530510_0572390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

4

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7984 1 150
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7891 1 150
7pds-assembly1.cif.gz_D the structure of prirep1 with dsdna 0.5298 118 150
5imq-assembly1.cif.gz_S structure of ribosome bound to cofactor at 3.8 angstrom resolution 0.4929 27 113
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4926 3 90
ID Description Score Start End Superfamily
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9341 4 94 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9212 4 94 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9041 1 94 1.10.1510.10
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8987 5 94 1.10.1510.10
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.8956 4 94 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A7V2IAW8-F1-model_v4 GatB/YqeY domain-containing protein 0.964 2 152 GO:0016884
AF-A0A7S1UDL8-F1-model_v4 Asn/Gln amidotransferase domain-containing protein 0.955 1 150 GO:0016884
AF-A0A7V2IAW8-F1-model_v4 GatB/YqeY domain-containing protein 0.9517 2 152 GO:0016884
AF-A0A7V4G0Y2-F1-model_v4 GatB/YqeY domain-containing protein 0.9469 1 151 GO:0016884
AF-A0A7T9G411-F1-model_v4 deleted 0.9469 3 151

Map