F486929

General Info

Members Datasets Scaffolds Average Seq Length
964 452 932 205

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100224342|Ga0070668_1002243421
Length 236
Sequence MAHNSTHLERGVIDRCRRPFQARLSRVSLNGMPVRRKTRKSDTNGYLDGQFLVAMPAMTDKRFARSVIYMCAHSVQGAMGLIVNQRAPHITFPELLGQLSIPGGDNDGEGFEPDLIDLDVHVGGPVETGRGFVLHSSDYFAADSTLPIDDGVSLTATVDILKAIASGKGPDRAILALGYAGWRPGQLESEIQANGWLHCPPDVDLLFDRDLDQKYGRAMSKIGIDPSHLVSEAGHA

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
3 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
4 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
5 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
6 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
7 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
8 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
9 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
10 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
11 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
12 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
13 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
14 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
15 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
16 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
17 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
18 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
19 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
20 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
21 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
22 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
23 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
24 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
25 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
26 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
27 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
28 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
29 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
30 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
37 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
38 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
39 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
40 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
87 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
117 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
123 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
137 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
138 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
139 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
174 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
246 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
247 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
248 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
249 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
256 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
257 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
258 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
259 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
260 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
261 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
262 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
263 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
266 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
267 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
268 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
269 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
270 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
271 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
272 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
273 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
274 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
275 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
276 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
277 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
278 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
279 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
280 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
281 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
282 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
285 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
286 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
287 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
288 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
289 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
302 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
303 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
304 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
305 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
306 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
307 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
308 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
309 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
310 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
311 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
319 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
320 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
348 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
373 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
374 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
375 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
376 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
377 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
378 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
379 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
380 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
397 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
398 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
399 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
400 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
401 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
402 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
403 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
404 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
405 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
406 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
409 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
410 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
415 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
418 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
422 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
423 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
424 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
425 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
426 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
427 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
428 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
429 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
430 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
431 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
432 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
433 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
434 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
435 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
436 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
437 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
438 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
439 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
440 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
441 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
442 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
443 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
444 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
445 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
446 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
447 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
448 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
449 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
450 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
451 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
452 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0.52
Isolates 3.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 1.45
Rhizoplane 7.26
Rhizosphere 81.95
Stem 0
Stem Tuber 0.1
Unclassified 5.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1030462 3300001915 Bacteria 809
2 JGI24746J21847_1019977 3300001977 Bacteria 942
3 JGI24740J21852_10002543 3300001979 Bacteria 8224
4 JGI24739J22299_10014798 3300001989 Bacteria 2837
5 JGI24737J22298_10024313 3300001990 Bacteria 1919
6 JGI24743J22301_10048055 3300001991 Bacteria 866
7 JGI24735J21928_10042004 3300002067 Bacteria 1332
8 JGI24738J21930_10031365 3300002075 Bacteria 1084
9 JGI24749J21850_1027232 3300002076 Bacteria 816
10 JGI24744J21845_10016801 3300002077 Bacteria 1456
11 JGI24034J26672_10037342 3300002239 Bacteria 808
12 JGI24751J29686_10048208 3300002459 Bacteria 879
13 JGI25406J46586_10038370 3300003203 Bacteria 1717
14 JGI25153J46596_10019231 3300003215 Bacteria 2623
15 rootH1_10040793 3300003323 Bacteria 5038
16 Ga0055539_1022387 3300003752 Bacteria 746
17 Ga0055530_10018980 3300003791 Bacteria 2098
18 Ga0055531_10004299 3300003794 Bacteria 8731
19 Ga0065165_1002916 3300005262 Bacteria 13077
20 Ga0065712_10297111 3300005290 Bacteria 864
21 Ga0070676_10106354 3300005328 Bacteria 1741
22 Ga0070690_100000132 3300005330 Bacteria 38694
23 Ga0070670_100019173 3300005331 Bacteria 5866
24 Ga0070666_10005308 3300005335 Bacteria 7895
25 Ga0070666_10606610 3300005335 Bacteria 799
26 Ga0070680_100009699 3300005336 Bacteria 7408
27 Ga0070682_100012548 3300005337 Bacteria 4860
28 Ga0070682_100109989 3300005337 Bacteria 1835
29 Ga0068868_100003681 3300005338 Bacteria 10710
30 Ga0070660_100000566 3300005339 Bacteria 24792
31 Ga0070689_100010934 3300005340 Bacteria 6486
32 Ga0070689_100366989 3300005340 Bacteria 1211
33 Ga0070691_10002290 3300005341 Bacteria 8480
34 Ga0070691_10047138 3300005341 Bacteria 2049
35 Ga0070687_100245736 3300005343 Bacteria 1109
36 Ga0070661_100001081 3300005344 Bacteria 19286
37 Ga0070692_10000077 3300005345 Bacteria 20285
38 Ga0070668_100007631 3300005347 Bacteria 8028
39 Ga0070668_100224342 3300005347 Bacteria 1551
40 Ga0070668_100514555 3300005347 Bacteria 1038
41 Ga0070669_100001786 3300005353 Bacteria 15475
42 Ga0070675_100001964 3300005354 Bacteria 15219
43 Ga0070671_100008228 3300005355 Bacteria 8346
44 Ga0070671_100281621 3300005355 Bacteria 1414
45 Ga0070674_100001960 3300005356 Bacteria 11248
46 Ga0070674_100560326 3300005356 Bacteria 960
47 Ga0070674_100988936 3300005356 Bacteria 738
48 Ga0070673_100001024 3300005364 Bacteria 15818
49 Ga0070673_100418324 3300005364 Bacteria 1201
50 Ga0070688_100000125 3300005365 Bacteria 40976
51 Ga0070688_100422402 3300005365 Bacteria 991
52 Ga0070659_100003247 3300005366 Bacteria 11571
53 Ga0070667_100001803 3300005367 Bacteria 19053
54 Ga0070667_100415388 3300005367 Bacteria 1226
55 Ga0070709_10000375 3300005434 Bacteria 27523
56 Ga0070709_10001030 3300005434 Bacteria 15418
57 Ga0070714_100011184 3300005435 Bacteria 7115
58 Ga0070714_100321708 3300005435 Bacteria 1447
59 Ga0070714_100644657 3300005435 Bacteria 1019
60 Ga0070714_100751108 3300005435 Bacteria 943
61 Ga0070713_100026017 3300005436 Bacteria 4587
62 Ga0070713_100045651 3300005436 Bacteria 3592
63 Ga0070710_10014142 3300005437 Bacteria 4011
64 Ga0070710_10027576 3300005437 Bacteria 3031
65 Ga0070701_10000761 3300005438 Bacteria 11491
66 Ga0070711_100000898 3300005439 Bacteria 15668
67 Ga0070711_100438539 3300005439 Bacteria 1067
68 Ga0070711_100550372 3300005439 Bacteria 957
69 Ga0070705_100001091 3300005440 Bacteria 15071
70 Ga0070700_100026631 3300005441 Bacteria 3418
71 Ga0070694_100002073 3300005444 Bacteria 11899
72 Ga0070663_100093492 3300005455 Bacteria 2231
73 Ga0070663_100104498 3300005455 Bacteria 2119
74 Ga0070663_100644734 3300005455 Unclassified 895
75 Ga0070678_100000369 3300005456 Bacteria 21044
76 Ga0070662_100028337 3300005457 Bacteria 3896
77 Ga0070662_100728955 3300005457 Bacteria 840
78 Ga0070681_10055923 3300005458 Bacteria 3928
79 Ga0068867_100212339 3300005459 Bacteria 1555
80 Ga0070685_10639340 3300005466 Bacteria 770
81 Ga0070706_100142204 3300005467 Bacteria 2239
82 Ga0070707_100545279 3300005468 Bacteria 1122
83 Ga0070699_100424239 3300005518 Bacteria 1204
84 Ga0070679_100142265 3300005530 Bacteria 2377
85 Ga0070684_100001508 3300005535 Bacteria 16819
86 Ga0070684_100517204 3300005535 Bacteria 1106
87 Ga0070684_100619092 3300005535 Bacteria 1007
88 Ga0070697_100005000 3300005536 Bacteria 10181
89 Ga0070697_100867908 3300005536 Bacteria 800
90 Ga0068853_100000997 3300005539 Bacteria 19938
91 Ga0068853_100003336 3300005539 Bacteria 12288
92 Ga0068853_100239292 3300005539 Bacteria 1663
93 Ga0068853_100353668 3300005539 Bacteria 1367
94 Ga0070672_100020079 3300005543 Bacteria 4867
95 Ga0070686_100001627 3300005544 Bacteria 12561
96 Ga0070695_100000694 3300005545 Bacteria 17997
97 Ga0070696_100006259 3300005546 Bacteria 7968
98 Ga0070696_100204330 3300005546 Bacteria 1476
99 Ga0070696_100209924 3300005546 Bacteria 1457
100 Ga0070696_100478701 3300005546 Bacteria 987
101 Ga0070693_100000962 3300005547 Bacteria 12774
102 Ga0070693_100470622 3300005547 Bacteria 886
103 Ga0070665_100023123 3300005548 Bacteria 6262
104 Ga0070665_100134094 3300005548 Bacteria 2478
105 Ga0070665_100453837 3300005548 Bacteria 1291
106 Ga0070704_100000146 3300005549 Bacteria 26878
107 Ga0070704_100157354 3300005549 Bacteria 1793
108 Ga0070704_100203321 3300005549 Bacteria 1600
109 Ga0070704_100678602 3300005549 Bacteria 912
110 Ga0068855_100290295 3300005563 Bacteria 1813
111 Ga0068855_100837575 3300005563 Bacteria 975
112 Ga0070664_100000194 3300005564 Bacteria 43008
113 Ga0068857_100000347 3300005577 Bacteria 31990
114 Ga0068857_100014557 3300005577 Bacteria 6861
115 Ga0068854_100002339 3300005578 Bacteria 11682
116 Ga0068856_100003776 3300005614 Bacteria 15173
117 Ga0068856_100005030 3300005614 Bacteria 13091
118 Ga0068856_100860372 3300005614 Bacteria 926
119 Ga0070702_100002264 3300005615 Bacteria 8229
120 Ga0070702_100066164 3300005615 Bacteria 2119
121 Ga0068852_100030567 3300005616 Bacteria 4436
122 Ga0068852_100158800 3300005616 Bacteria 2109
123 Ga0068859_100009233 3300005617 Bacteria 9963
124 Ga0068859_100285657 3300005617 Bacteria 1743
125 Ga0068859_100300339 3300005617 Bacteria 1699
126 Ga0068859_100442615 3300005617 Bacteria 1396
127 Ga0068864_100008194 3300005618 Bacteria 8617
128 Ga0068864_100450929 3300005618 Bacteria 1230
129 Ga0068866_10001158 3300005718 Bacteria 11595
130 Ga0068866_10052173 3300005718 Bacteria 2086
131 Ga0068866_10292869 3300005718 Bacteria 1013
132 Ga0068861_100003098 3300005719 Bacteria 10989
133 Ga0068861_100036198 3300005719 Bacteria 3662
134 Ga0068861_100209304 3300005719 Bacteria 1642
135 Ga0068861_100373801 3300005719 Bacteria 1257
136 Ga0068851_10001831 3300005834 Bacteria 9313
137 Ga0068851_10012565 3300005834 Bacteria 3994
138 Ga0068863_100009936 3300005841 Bacteria 9265
139 Ga0068863_100843405 3300005841 Bacteria 915
140 Ga0068858_100005670 3300005842 Bacteria 12203
141 Ga0068858_100031377 3300005842 Bacteria 4935
142 Ga0068858_100090802 3300005842 Bacteria 2843
143 Ga0068858_100380904 3300005842 Bacteria 1354
144 Ga0068858_101184832 3300005842 Bacteria 751
145 Ga0068860_100000411 3300005843 Bacteria 55810
146 Ga0068860_100007100 3300005843 Bacteria 11206
147 Ga0068860_100221871 3300005843 Bacteria 1836
148 Ga0068860_100391229 3300005843 Bacteria 1374
149 Ga0068862_100000967 3300005844 Bacteria 27645
150 Ga0081455_10002674 3300005937 Bacteria 21063
151 Ga0081455_10009824 3300005937 Bacteria 9800
152 Ga0081540_1133943 3300005983 Bacteria 1006
153 Ga0081539_10001094 3300005985 Bacteria 49286
154 Ga0081539_10032156 3300005985 Bacteria 3218
155 Ga0070717_10026943 3300006028 Bacteria 4590
156 Ga0075368_10104777 3300006042 Bacteria 1163
157 Ga0075432_10041098 3300006058 Bacteria 1614
158 Ga0070715_10000091 3300006163 Bacteria 22194
159 Ga0070715_10165602 3300006163 Bacteria 1096
160 Ga0070716_100011336 3300006173 Bacteria 4488
161 Ga0070716_100175226 3300006173 Bacteria 1403
162 Ga0070712_100001007 3300006175 Bacteria 16978
163 Ga0070712_100011722 3300006175 Bacteria 5569
164 Ga0070712_100142395 3300006175 Bacteria 1831
165 Ga0075367_10008319 3300006178 Bacteria 5372
166 Ga0068871_100129675 3300006358 Bacteria 2137
167 Ga0075428_100003217 3300006844 Bacteria 17869
168 Ga0075428_100049289 3300006844 Bacteria 4620
169 Ga0075428_100272294 3300006844 Bacteria 1822
170 Ga0075428_100360956 3300006844 Bacteria 1558
171 Ga0075430_100046367 3300006846 Bacteria 3671
172 Ga0075430_100376934 3300006846 Bacteria 1171
173 Ga0075430_100389731 3300006846 Bacteria 1150
174 Ga0075431_100003293 3300006847 Bacteria 15635
175 Ga0075431_100016100 3300006847 Bacteria 7586
176 Ga0075431_100111480 3300006847 Bacteria 2823
177 Ga0075431_100152635 3300006847 Unclassified 2378
178 Ga0075431_100248756 3300006847 Bacteria 1807
179 Ga0075431_100466138 3300006847 Bacteria 1257
180 Ga0075433_10110340 3300006852 Bacteria 2440
181 Ga0075433_10112477 3300006852 Bacteria 2415
182 Ga0075433_10344997 3300006852 Bacteria 1316
183 Ga0075433_10618869 3300006852 Bacteria 950
184 Ga0075434_100000437 3300006871 Bacteria 30944
185 Ga0075434_100018921 3300006871 Bacteria 6657
186 Ga0075434_100187972 3300006871 Bacteria 2086
187 Ga0075434_100590849 3300006871 Bacteria 1129
188 Ga0075434_100696917 3300006871 Bacteria 1033
189 Ga0075429_100031335 3300006880 Bacteria 4621
190 Ga0068865_100031517 3300006881 Bacteria 3535
191 Ga0068865_100157725 3300006881 Bacteria 1728
192 Ga0068865_100226447 3300006881 Bacteria 1464
193 Ga0075436_100002170 3300006914 Bacteria 13524
194 Ga0097620_100009234 3300006931 Bacteria 9963
195 Ga0097620_100285675 3300006931 Bacteria 1743
196 Ga0097620_100300341 3300006931 Bacteria 1699
197 Ga0097620_100442602 3300006931 Bacteria 1396
198 Ga0099825_1019570 3300006941 Bacteria 5017
199 Ga0099823_1026161 3300006944 Bacteria 5175
200 Ga0079104_1000010 3300006946 Bacteria 366021
201 Ga0075435_100009318 3300007076 Bacteria 7100
202 Ga0075435_100015409 3300007076 Bacteria 5747
203 Ga0075435_100044849 3300007076 Bacteria 3543
204 Ga0075435_100133732 3300007076 Bacteria 2076
205 Ga0105250_10006562 3300009092 Bacteria 5070
206 Ga0105240_10006744 3300009093 Bacteria 16809
207 Ga0105240_10024137 3300009093 Bacteria 8025
208 Ga0105240_10145276 3300009093 Bacteria 2831
209 Ga0105240_10760180 3300009093 Bacteria 1053
210 Ga0105240_10983235 3300009093 Bacteria 903
211 Ga0111539_10007284 3300009094 Bacteria 14165
212 Ga0111539_10010676 3300009094 Bacteria 11565
213 Ga0111539_10096054 3300009094 Bacteria 3481
214 Ga0111539_10797157 3300009094 Bacteria 1099
215 Ga0111539_10972591 3300009094 Bacteria 987
216 Ga0105245_10002335 3300009098 Bacteria 17159
217 Ga0105245_10183784 3300009098 Bacteria 1999
218 Ga0105247_10001750 3300009101 Bacteria 15298
219 Ga0105247_10017506 3300009101 Bacteria 4298
220 Ga0105247_10060649 3300009101 Bacteria 2344
221 Ga0105247_10545903 3300009101 Bacteria 851
222 Ga0114129_10086909 3300009147 Bacteria 4336
223 Ga0114129_10127955 3300009147 Bacteria 3491
224 Ga0114129_10161059 3300009147 Bacteria 3065
225 Ga0114129_10392048 3300009147 Bacteria 1831
226 Ga0114129_11320514 3300009147 Bacteria 893
227 Ga0105243_10005199 3300009148 Bacteria 10186
228 Ga0105243_10048819 3300009148 Bacteria 3338
229 Ga0105243_10762445 3300009148 Unclassified 950
230 Ga0105241_10001223 3300009174 Bacteria 19645
231 Ga0105241_10002644 3300009174 Bacteria 13413
232 Ga0105241_10307619 3300009174 Bacteria 1362
233 Ga0105242_10001958 3300009176 Bacteria 16205
234 Ga0105242_10158609 3300009176 Bacteria 1978
235 Ga0105242_10435239 3300009176 Bacteria 1232
236 Ga0105248_10004605 3300009177 Bacteria 15262
237 Ga0105248_10102427 3300009177 Bacteria 3227
238 Ga0105237_10000852 3300009545 Bacteria 41478
239 Ga0105237_10112552 3300009545 Bacteria 2714
240 Ga0105237_10124000 3300009545 Bacteria 2578
241 Ga0105237_10357565 3300009545 Bacteria 1464
242 Ga0105237_10368819 3300009545 Bacteria 1440
243 Ga0105238_10000517 3300009551 Bacteria 40562
244 Ga0105238_10086951 3300009551 Bacteria 3113
245 Ga0105238_10444815 3300009551 Bacteria 1292
246 Ga0105249_10001834 3300009553 Bacteria 18468
247 Ga0105249_10012163 3300009553 Bacteria 7578
248 Ga0105249_10315285 3300009553 Bacteria 1573
249 Ga0105249_11188251 3300009553 Bacteria 834
250 Ga0105239_10002648 3300010375 Bacteria 22602
251 Ga0105239_10004780 3300010375 Bacteria 16073
252 Ga0105239_10136885 3300010375 Bacteria 2727
253 Ga0105239_11635832 3300010375 Bacteria 745
254 Ga0105246_10000433 3300011119 Bacteria 22347
255 Ga0105246_10761418 3300011119 Bacteria 855
256 Ga0157342_1002313 3300012507 Bacteria 1535
257 Ga0157373_10011762 3300013100 Bacteria 6429
258 Ga0157371_10006258 3300013102 Bacteria 9860
259 Ga0157370_10101893 3300013104 Bacteria 2689
260 Ga0157370_10212000 3300013104 Bacteria 1795
261 Ga0157369_10001745 3300013105 Bacteria 26370
262 Ga0157369_10034677 3300013105 Bacteria 5535
263 Ga0157369_10096092 3300013105 Bacteria 3161
264 Ga0157374_10059981 3300013296 Bacteria 3559
265 Ga0157378_10001283 3300013297 Bacteria 22595
266 Ga0157378_10015568 3300013297 Bacteria 6660
267 Ga0157378_10038277 3300013297 Bacteria 4250
268 Ga0157378_10368422 3300013297 Bacteria 1408
269 Ga0163162_10002987 3300013306 Bacteria 16152
270 Ga0163162_10027188 3300013306 Bacteria 5657
271 Ga0157372_10001332 3300013307 Bacteria 26676
272 Ga0157372_10145389 3300013307 Bacteria 2734
273 Ga0157375_10003129 3300013308 Bacteria 14370
274 Ga0157375_10021721 3300013308 Bacteria 5892
275 Ga0157375_10114079 3300013308 Bacteria 2804
276 Ga0157375_10187567 3300013308 Bacteria 2222
277 Ga0157375_10564642 3300013308 Bacteria 1299
278 Ga0163163_10004852 3300014325 Bacteria 11559
279 Ga0163163_10145567 3300014325 Bacteria 2413
280 Ga0163163_10176903 3300014325 Bacteria 2180
281 Ga0157380_10004603 3300014326 Bacteria 9580
282 Ga0157380_10094327 3300014326 Bacteria 2477
283 Ga0157380_10804673 3300014326 Bacteria 957
284 Ga0157377_10010256 3300014745 Bacteria 4627
285 Ga0157379_10002584 3300014968 Bacteria 15210
286 Ga0157379_10043870 3300014968 Bacteria 3992
287 Ga0157379_10056547 3300014968 Bacteria 3505
288 Ga0157379_10157016 3300014968 Bacteria 2052
289 Ga0157379_10414404 3300014968 Bacteria 1240
290 Ga0157376_10000538 3300014969 Bacteria 24411
291 Ga0157376_10024288 3300014969 Bacteria 4756
292 Ga0157376_10036787 3300014969 Bacteria 3968
293 Ga0163161_10000490 3300017792 Bacteria 32523
294 Ga0206350_11192583 3300020080 Bacteria 923
295 Ga0206354_10816019 3300020081 Bacteria 911
296 Ga0206354_11350350 3300020081 Bacteria 1698
297 Ga0213876_10225003 3300021384 Bacteria 997
298 Ga0224712_10035877 3300022467 Bacteria 1834
299 Ga0224712_10150869 3300022467 Bacteria 1030
300 Ga0209677_101450 3300025253 Bacteria 10255
301 Ga0209233_1005932 3300025261 Bacteria 3999
302 Ga0209455_1001576 3300025272 Bacteria 10047
303 Ga0209455_1003672 3300025272 Bacteria 5321
304 Ga0209676_1009741 3300025292 Bacteria 4104
305 Ga0209758_1004272 3300025297 Bacteria 12068
306 Ga0209758_1038102 3300025297 Bacteria 1849
307 Ga0209051_1003930 3300025303 Bacteria 9469
308 Ga0209257_1006738 3300025304 Bacteria 7251
309 Ga0207656_10003508 3300025321 Bacteria 5395
310 Ga0207653_10006535 3300025885 Bacteria 3641
311 Ga0207692_10005648 3300025898 Bacteria 5022
312 Ga0207692_10007364 3300025898 Bacteria 4512
313 Ga0207642_10061365 3300025899 Bacteria 1748
314 Ga0207642_10187493 3300025899 Bacteria 1132
315 Ga0207710_10006549 3300025900 Bacteria 4963
316 Ga0207710_10064626 3300025900 Bacteria 1667
317 Ga0207710_10084680 3300025900 Bacteria 1476
318 Ga0207688_10001250 3300025901 Bacteria 13206
319 Ga0207680_10028076 3300025903 Bacteria 3144
320 Ga0207680_10255972 3300025903 Bacteria 1210
321 Ga0207647_10003291 3300025904 Bacteria 12131
322 Ga0207685_10002881 3300025905 Bacteria 4055
323 Ga0207699_10008987 3300025906 Bacteria 4952
324 Ga0207645_10075195 3300025907 Bacteria 2162
325 Ga0207645_10117787 3300025907 Bacteria 1723
326 Ga0207684_10138260 3300025910 Bacteria 2093
327 Ga0207654_10000248 3300025911 Bacteria 32761
328 Ga0207654_10029250 3300025911 Bacteria 3014
329 Ga0207707_10027159 3300025912 Bacteria 5005
330 Ga0207695_10000343 3300025913 Bacteria 107739
331 Ga0207695_10049026 3300025913 Bacteria 4455
332 Ga0207695_10213787 3300025913 Bacteria 1838
333 Ga0207671_10011331 3300025914 Bacteria 7263
334 Ga0207671_10234084 3300025914 Bacteria 1442
335 Ga0207671_10239771 3300025914 Bacteria 1424
336 Ga0207671_10387416 3300025914 Bacteria 1111
337 Ga0207693_10000412 3300025915 Bacteria 38871
338 Ga0207693_10047106 3300025915 Bacteria 3388
339 Ga0207693_10078258 3300025915 Bacteria 2588
340 Ga0207693_10780288 3300025915 Bacteria 737
341 Ga0207663_10000871 3300025916 Bacteria 13709
342 Ga0207663_10068191 3300025916 Bacteria 2284
343 Ga0207660_10006910 3300025917 Bacteria 7346
344 Ga0207662_10011701 3300025918 Bacteria 4874
345 Ga0207657_10000047 3300025919 Bacteria 111686
346 Ga0207657_10421461 3300025919 Bacteria 1049
347 Ga0207649_10004715 3300025920 Bacteria 7380
348 Ga0207652_10439393 3300025921 Bacteria 1176
349 Ga0207681_10017352 3300025923 Bacteria 4519
350 Ga0207694_10000136 3300025924 Bacteria 74908
351 Ga0207650_10038148 3300025925 Bacteria 3506
352 Ga0207659_10043668 3300025926 Bacteria 3150
353 Ga0207687_10015831 3300025927 Bacteria 4949
354 Ga0207687_10250573 3300025927 Bacteria 1408
355 Ga0207700_10089733 3300025928 Bacteria 2424
356 Ga0207700_10288808 3300025928 Bacteria 1413
357 Ga0207700_10313751 3300025928 Bacteria 1357
358 Ga0207700_10341238 3300025928 Bacteria 1302
359 Ga0207664_10047350 3300025929 Bacteria 3377
360 Ga0207664_10456874 3300025929 Bacteria 1140
361 Ga0207644_10005779 3300025931 Bacteria 8050
362 Ga0207690_10001352 3300025932 Bacteria 15387
363 Ga0207706_10000079 3300025933 Bacteria 100592
364 Ga0207686_10016453 3300025934 Bacteria 4153
365 Ga0207686_10421171 3300025934 Bacteria 1021
366 Ga0207709_10702857 3300025935 Bacteria 809
367 Ga0207670_10120631 3300025936 Bacteria 1905
368 Ga0207670_10232883 3300025936 Bacteria 1415
369 Ga0207669_10004194 3300025937 Bacteria 6319
370 Ga0207704_10001638 3300025938 Bacteria 10043
371 Ga0207704_10378610 3300025938 Bacteria 1110
372 Ga0207665_10000268 3300025939 Bacteria 35929
373 Ga0207665_10059641 3300025939 Bacteria 2583
374 Ga0207691_10024140 3300025940 Bacteria 5718
375 Ga0207691_10494572 3300025940 Bacteria 1039
376 Ga0207711_10150173 3300025941 Bacteria 2102
377 Ga0207711_10180935 3300025941 Bacteria 1917
378 Ga0207689_10119881 3300025942 Bacteria 2164
379 Ga0207689_10553071 3300025942 Bacteria 967
380 Ga0207689_10752738 3300025942 Bacteria 822
381 Ga0207661_10000613 3300025944 Bacteria 22875
382 Ga0207661_10438663 3300025944 Bacteria 1188
383 Ga0207679_10015477 3300025945 Bacteria 5042
384 Ga0207667_10016518 3300025949 Bacteria 8337
385 Ga0207667_10144695 3300025949 Bacteria 2447
386 Ga0207667_10324472 3300025949 Bacteria 1572
387 Ga0207667_11050626 3300025949 Bacteria 800
388 Ga0207651_10204300 3300025960 Bacteria 1585
389 Ga0207651_10369507 3300025960 Bacteria 1213
390 Ga0207712_10003528 3300025961 Bacteria 9865
391 Ga0207712_10044532 3300025961 Bacteria 3067
392 Ga0207668_10005573 3300025972 Bacteria 7422
393 Ga0207668_10385290 3300025972 Bacteria 1181
394 Ga0207668_10783147 3300025972 Bacteria 843
395 Ga0207640_10080850 3300025981 Bacteria 2220
396 Ga0207658_10050845 3300025986 Bacteria 3051
397 Ga0207658_10372810 3300025986 Bacteria 1248
398 Ga0207677_10446490 3300026023 Bacteria 1107
399 Ga0207703_10010804 3300026035 Bacteria 7123
400 Ga0207703_10030237 3300026035 Bacteria 4279
401 Ga0207703_10316506 3300026035 Bacteria 1428
402 Ga0207703_10466547 3300026035 Bacteria 1181
403 Ga0207639_10100681 3300026041 Bacteria 2335
404 Ga0207639_10216336 3300026041 Bacteria 1652
405 Ga0207639_10547664 3300026041 Bacteria 1062
406 Ga0207639_10769344 3300026041 Bacteria 896
407 Ga0207678_10000392 3300026067 Bacteria 39947
408 Ga0207678_10355197 3300026067 Bacteria 1264
409 Ga0207708_10002311 3300026075 Bacteria 14019
410 Ga0207702_10000006 3300026078 Bacteria 346370
411 Ga0207702_10025691 3300026078 Bacteria 4889
412 Ga0207702_10169114 3300026078 Bacteria 2003
413 Ga0207702_10228686 3300026078 Bacteria 1737
414 Ga0207641_10004680 3300026088 Bacteria 11806
415 Ga0207641_10187007 3300026088 Bacteria 1901
416 Ga0207641_10692234 3300026088 Bacteria 1003
417 Ga0207648_10130384 3300026089 Bacteria 2213
418 Ga0207648_10285393 3300026089 Bacteria 1477
419 Ga0207676_10036926 3300026095 Bacteria 3719
420 Ga0207676_10394568 3300026095 Bacteria 1292
421 Ga0207674_10000403 3300026116 Bacteria 56087
422 Ga0207674_10003449 3300026116 Bacteria 19336
423 Ga0207675_100000204 3300026118 Bacteria 54999
424 Ga0207675_100018399 3300026118 Bacteria 6515
425 Ga0207675_100059117 3300026118 Bacteria 3577
426 Ga0207675_100085253 3300026118 Bacteria 2964
427 Ga0207683_10000026 3300026121 Bacteria 111890
428 Ga0207698_10007715 3300026142 Bacteria 6752
429 Ga0207698_10022080 3300026142 Bacteria 4414
430 Ga0209281_1000078 3300027111 Bacteria 261622
431 Ga0209389_1000039 3300027296 Bacteria 124545
432 Ga0209489_100087 3300027361 Bacteria 124545
433 Ga0209700_100090 3300027363 Bacteria 124545
434 Ga0209983_1047621 3300027665 Bacteria 934
435 Ga0209813_10004386 3300027866 Bacteria 3369
436 Ga0209813_10094422 3300027866 Bacteria 1009
437 Ga0207428_10009013 3300027907 Bacteria 8985
438 Ga0207428_10058824 3300027907 Bacteria 3049
439 Ga0207428_10385060 3300027907 Bacteria 1028
440 Ga0268266_10091186 3300028379 Bacteria 2672
441 Ga0268266_10198746 3300028379 Bacteria 1834
442 Ga0268265_10662317 3300028380 Bacteria 1004
443 Ga0268264_10000194 3300028381 Bacteria 125395
444 Ga0268264_10014684 3300028381 Bacteria 6436
445 Ga0268264_10019377 3300028381 Bacteria 5561
446 Ga0268264_10799317 3300028381 Bacteria 942
447 Ga0268264_11033036 3300028381 Unclassified 829
448 Ga0265337_1006579 3300028556 Bacteria 4459
449 Ga0265326_10011532 3300028558 Bacteria 2602
450 Ga0265319_1009499 3300028563 Bacteria 4138
451 Ga0265334_10001587 3300028573 Bacteria 10922
452 Ga0265323_10001598 3300028653 Bacteria 10926
453 Ga0265336_10000238 3300028666 Bacteria 39366
454 Ga0307515_10441348 3300028794 Bacteria 918
455 Ga0265338_10000278 3300028800 Bacteria 93010
456 Ga0265324_10001755 3300029957 Bacteria 11922
457 Ga0265330_10211006 3300031235 Bacteria 820
458 Ga0265328_10032026 3300031239 Bacteria 1953
459 Ga0265325_10021108 3300031241 Bacteria 3582
460 Ga0265325_10068951 3300031241 Bacteria 1779
461 Ga0265325_10086138 3300031241 Bacteria 1555
462 Ga0265325_10157284 3300031241 Bacteria 1071
463 Ga0265325_10184735 3300031241 Bacteria 969
464 Ga0265340_10000397 3300031247 Bacteria 23270
465 Ga0265340_10013221 3300031247 Bacteria 4343
466 Ga0265340_10014208 3300031247 Bacteria 4166
467 Ga0265340_10073276 3300031247 Bacteria 1621
468 Ga0265339_10000016 3300031249 Bacteria 185313
469 Ga0265339_10013893 3300031249 Bacteria 4871
470 Ga0265339_10020578 3300031249 Bacteria 3852
471 Ga0265339_10032991 3300031249 Bacteria 2919
472 Ga0265316_10037176 3300031344 Bacteria 3932
473 Ga0265316_10166769 3300031344 Bacteria 1645
474 Ga0307513_10006480 3300031456 Bacteria 15285
475 Ga0265313_10000060 3300031595 Bacteria 107224
476 Ga0265313_10001332 3300031595 Bacteria 23248
477 Ga0265313_10039946 3300031595 Bacteria 2324
478 Ga0265313_10091458 3300031595 Bacteria 1365
479 Ga0265314_10082713 3300031711 Bacteria 2112
480 Ga0265342_10006501 3300031712 Bacteria 8699
481 Ga0265342_10118122 3300031712 Bacteria 1495
482 Ga0307516_10018505 3300031730 Bacteria 7237
483 Ga0307416_100995733 3300032002 Bacteria 941
484 Ga0373938_0006926 3300034957 Bacteria 1978
485 Ga0373928_0033382 3300035084 Bacteria 1151
486 Ga0373929_0048702 3300035085 Bacteria 963
487 Ga0373949_0014064 3300035090 Bacteria 1780
488 Ga0373951_0054044 3300035091 Bacteria 993
489 Ga0373952_0012012 3300035092 Bacteria 1697
490 Ga0373952_0013064 3300035092 Bacteria 1642
491 Ga0373952_0086003 3300035092 Bacteria 810
492 Ga0373932_0005443 3300035112 Bacteria 2995
493 Ga0373932_0008895 3300035112 Bacteria 2405
494 Ga0373936_0046310 3300035113 Bacteria 1753
495 Ga0373939_0002625 3300035114 Bacteria 4222
496 Ga0373939_0004663 3300035114 Bacteria 3249
497 Ga0373960_0055393 3300035121 Unclassified 1188
498 Ga0373960_0128930 3300035121 Bacteria 846
499 Ga0373943_0249927 3300035170 Bacteria 995
500 Ga0373942_0003455 3300035207 Bacteria 3710
501 Ga0373942_0028908 3300035207 Bacteria 1451
502 Ga0373961_0008667 3300035241 Bacteria 2477
503 Ga0373961_0060423 3300035241 Bacteria 1148
504 Ga0373962_0011595 3300035242 Bacteria 2211
505 Ga0373962_0045265 3300035242 Bacteria 1253
506 Ga0373962_0099235 3300035242 Bacteria 906
507 Ga0373931_0000272 3300035691 Bacteria 21907
508 Ga0373931_0005753 3300035691 Bacteria 5759
509 Ga0373931_0031452 3300035691 Bacteria 2740
510 Ga0373935_0533301 3300035692 Bacteria 854
511 Ga0373927_0006712 3300035695 Bacteria 7830
512 Ga0373947_0000790 3300035725 Bacteria 19015
513 Ga0373947_0127839 3300035725 Bacteria 1620
514 Ga0373937_0130019 3300036401 Bacteria 2351
515 Ga0373925_0001714 3300037068 Bacteria 18478
516 Ga0373925_0068711 3300037068 Bacteria 2675
517 Ga0395900_0004457 3300037418 Bacteria 14827
518 Ga0395900_0026747 3300037418 Bacteria 5906
519 Ga0395900_0240515 3300037418 Bacteria 1816
520 Ga0395898_0014586 3300037466 Bacteria 8069
521 Ga0395898_0237216 3300037466 Bacteria 1739
522 Ga0395898_0755816 3300037466 Bacteria 913
523 Ga0395905_0000463 3300037471 Bacteria 56433
524 Ga0395905_0001025 3300037471 Bacteria 35622
525 Ga0395905_0001846 3300037471 Bacteria 24436
526 Ga0395905_0707115 3300037471 Bacteria 910
527 Ga0395905_1419738 3300037471 Bacteria 598
528 Ga0436364_1035385 3300037853 Bacteria 947
529 Ga0436364_1124912 3300037853 Bacteria 3542
530 Ga0395901_0019998 3300038443 Bacteria 6849
531 Ga0395901_0048529 3300038443 Bacteria 4409
532 Ga0395901_0176955 3300038443 Bacteria 2238
533 Ga0400487_27525 3300039110 Unclassified 1164
534 Ga0436365_0096215 3300039437 Bacteria 1062
535 Ga0436365_0502292 3300039437 Bacteria 2576
536 Ga0436365_1937907 3300039437 Bacteria 2252
537 Ga0436360_0019834 3300039438 Bacteria 1149
538 Ga0436361_1111580 3300039447 Bacteria 766
539 Ga0451833_1324743 3300041491 Bacteria 541
540 Ga0439433_0111100 3300041999 Bacteria 686
541 Ga0439446_0242404 3300042156 Bacteria 620
542 Ga0439435_0009720 3300042436 Bacteria 2263
543 Ga0439460_0197788 3300042461 Unclassified 684
544 Ga0466971_0058904 3300044719 Bacteria 1734
545 Ga0466970_0075322 3300044765 Bacteria 1818
546 Ga0466970_0217095 3300044765 Bacteria 1067
547 Ga0466957_0199958 3300044842 Bacteria 1312
548 Ga0466957_0386895 3300044842 Bacteria 955
549 Ga0466959_0136527 3300045049 Bacteria 1736
550 Ga0466959_0271653 3300045049 Bacteria 1165
551 Ga0495603_0000441 3300046455 Bacteria 22761
552 Ga0495603_0183854 3300046455 Bacteria 1209
553 Ga0495603_0598482 3300046455 Bacteria 631
554 Ga0495590_0047837 3300046457 Bacteria 1492
555 Ga0495590_0080154 3300046457 Bacteria 1150
556 Ga0495629_0000840 3300046459 Bacteria 24948
557 Ga0495638_0206581 3300046460 Bacteria 1105
558 Ga0495641_0026421 3300046461 Bacteria 2832
559 Ga0495580_0001605 3300046472 Bacteria 19867
560 Ga0495582_0000619 3300046473 Bacteria 19530
561 Ga0495639_0002230 3300046475 Bacteria 8518
562 Ga0495662_0116855 3300046476 Bacteria 1308
563 Ga0495664_0222203 3300046477 Bacteria 1143
564 Ga0495584_0057774 3300046491 Bacteria 1952
565 Ga0495584_0317218 3300046491 Bacteria 791
566 Ga0495594_0000067 3300046499 Bacteria 45132
567 Ga0495607_0115355 3300046501 Bacteria 1418
568 Ga0495643_0022103 3300046522 Bacteria 3635
569 Ga0495643_0284857 3300046522 Unclassified 759
570 Ga0495644_0041488 3300046523 Bacteria 1733
571 Ga0495663_0123939 3300046525 Bacteria 867
572 Ga0495666_0077405 3300046526 Bacteria 1576
573 Ga0495654_0000043 3300046530 Bacteria 161913
574 Ga0495654_0086487 3300046530 Bacteria 1461
575 Ga0495665_0001878 3300046531 Bacteria 11359
576 Ga0495665_0205416 3300046531 Bacteria 1020
577 Ga0495665_0510239 3300046531 Bacteria 605
578 Ga0495645_0001839 3300046543 Bacteria 14422
579 Ga0495622_0004063 3300046557 Bacteria 6832
580 Ga0495633_0150039 3300046558 Bacteria 1077
581 Ga0495667_0694892 3300046559 Bacteria 630
582 Ga0495656_0053711 3300046615 Bacteria 1732
583 Ga0495668_0053826 3300046616 Bacteria 2225
584 Ga0495634_0004589 3300046642 Bacteria 10790
585 Ga0495635_0451326 3300046663 Bacteria 850
586 Ga0495635_0630261 3300046663 Bacteria 698
587 Ga0495588_0006117 3300046674 Bacteria 5403
588 Ga0495599_0029202 3300046678 Bacteria 3456
589 Ga0495647_0004660 3300046681 Bacteria 4470
590 Ga0495658_0000623 3300046683 Bacteria 19287
591 Ga0495658_0402655 3300046683 Bacteria 872
592 Ga0495669_0083069 3300046684 Bacteria 1472
593 Ga0495613_0000306 3300046689 Bacteria 44259
594 Ga0495613_0254956 3300046689 Bacteria 1223
595 Ga0495671_0312627 3300046692 Bacteria 755
596 Ga0495589_0116586 3300046794 Bacteria 1287
597 Ga0495581_0000520 3300047315 Bacteria 19707
598 Ga0495674_0120135 3300047319 Bacteria 2221
599 Ga0495674_0795907 3300047319 Bacteria 736
600 Ga0495676_0035027 3300047321 Bacteria 4204
601 Ga0495676_0068038 3300047321 Bacteria 2753
602 Ga0495676_0264924 3300047321 Bacteria 1168
603 Ga0495680_0039696 3300047322 Bacteria 3753
604 Ga0495677_0145604 3300047445 Bacteria 911
605 Ga0495593_0000741 3300047673 Bacteria 18972
606 Ga0495614_0002751 3300048089 Bacteria 7817
607 Ga0496100_0012548 3300048903 Bacteria 4860
608 Ga0496100_0039173 3300048903 Bacteria 3008
609 Ga0496100_0095627 3300048903 Bacteria 2037
610 Ga0496101_0002433 3300048904 Bacteria 11442
611 Ga0496101_0010447 3300048904 Bacteria 6132
612 Ga0496101_0275290 3300048904 Bacteria 1314
613 Ga0496102_0011741 3300048905 Bacteria 7559
614 Ga0496102_0015978 3300048905 Bacteria 6551
615 Ga0496102_0129946 3300048905 Bacteria 2356
616 Ga0496102_0365165 3300048905 Bacteria 1359
617 Ga0496103_0009787 3300048906 Bacteria 5676
618 Ga0496103_0092179 3300048906 Bacteria 1912
619 Ga0496103_0187751 3300048906 Bacteria 1329
620 Ga0496104_0001121 3300048907 Bacteria 22928
621 Ga0496104_0005122 3300048907 Bacteria 11440
622 Ga0496104_0042435 3300048907 Bacteria 4268
623 Ga0496104_0116132 3300048907 Bacteria 2568
624 Ga0496104_0217548 3300048907 Bacteria 1822
625 Ga0496105_0003149 3300048908 Bacteria 12142
626 Ga0496105_0030430 3300048908 Bacteria 4423
627 Ga0496105_0048741 3300048908 Bacteria 3496
628 Ga0496105_0203661 3300048908 Bacteria 1615
629 Ga0496105_0337087 3300048908 Bacteria 1206
630 Ga0496106_0003556 3300048909 Bacteria 11604
631 Ga0496106_0032831 3300048909 Bacteria 3871
632 Ga0496106_0077262 3300048909 Bacteria 2553
633 Ga0496106_0197754 3300048909 Bacteria 1599
634 Ga0496106_0537201 3300048909 Bacteria 938
635 Ga0496106_0664808 3300048909 Bacteria 832
636 Ga0496107_0039274 3300048910 Bacteria 3394
637 Ga0496107_0057973 3300048910 Bacteria 2799
638 Ga0496107_0095358 3300048910 Bacteria 2177
639 Ga0496107_0235549 3300048910 Unclassified 1362
640 Ga0496108_0013407 3300048911 Bacteria 6684
641 Ga0496108_0191370 3300048911 Bacteria 1773
642 Ga0496108_0196962 3300048911 Bacteria 1747
643 Ga0496108_0467005 3300048911 Bacteria 1103
644 Ga0496108_0587744 3300048911 Bacteria 970
645 Ga0496109_0016963 3300048912 Bacteria 6374
646 Ga0496109_0021712 3300048912 Bacteria 5681
647 Ga0496109_0031736 3300048912 Bacteria 4743
648 Ga0496109_0040221 3300048912 Bacteria 4234
649 Ga0496109_0272109 3300048912 Bacteria 1596
650 Ga0496109_0422059 3300048912 Bacteria 1260
651 Ga0496109_1025531 3300048912 Bacteria 762
652 Ga0496110_0050169 3300048913 Bacteria 3663
653 Ga0496110_0055452 3300048913 Bacteria 3487
654 Ga0496110_0114339 3300048913 Bacteria 2428
655 Ga0496110_0601499 3300048913 Bacteria 997
656 Ga0496111_0006155 3300048914 Bacteria 7767
657 Ga0496111_0008506 3300048914 Bacteria 6797
658 Ga0496111_0011375 3300048914 Bacteria 5992
659 Ga0496111_0030040 3300048914 Bacteria 3863
660 Ga0496111_0182962 3300048914 Bacteria 1558
661 Ga0496112_0003566 3300048915 Bacteria 12935
662 Ga0496112_0004157 3300048915 Bacteria 12189
663 Ga0496112_0005950 3300048915 Bacteria 10642
664 Ga0496112_0048867 3300048915 Bacteria 4145
665 Ga0496112_0069837 3300048915 Bacteria 3470
666 Ga0496113_0034904 3300048916 Bacteria 3673
667 Ga0496113_0235411 3300048916 Bacteria 1461
668 Ga0496114_0005084 3300048917 Bacteria 10252
669 Ga0496114_0016968 3300048917 Bacteria 5872
670 Ga0496114_0018129 3300048917 Bacteria 5687
671 Ga0496114_0963582 3300048917 Bacteria 736
672 Ga0496115_0058298 3300048918 Bacteria 3107
673 Ga0496115_0150053 3300048918 Bacteria 1924
674 Ga0496115_0208438 3300048918 Bacteria 1614
675 Ga0496117_0047746 3300048920 Bacteria 3066
676 Ga0496117_0262694 3300048920 Bacteria 935
677 Ga0496118_0063903 3300048921 Bacteria 2705
678 Ga0496118_0069619 3300048921 Bacteria 2547
679 Ga0496121_0008329 3300048924 Bacteria 12248
680 Ga0496121_0089977 3300048924 Bacteria 2401
681 Ga0496121_0097751 3300048924 Bacteria 2274
682 Ga0496121_0170675 3300048924 Bacteria 1580
683 Ga0496122_0023503 3300048925 Bacteria 5431
684 Ga0496122_0025339 3300048925 Bacteria 5154
685 Ga0496123_0029566 3300048926 Bacteria 4029
686 Ga0496124_0018333 3300048927 Bacteria 6556
687 Ga0496124_0075943 3300048927 Bacteria 2775
688 Ga0496124_0079267 3300048927 Bacteria 2705
689 Ga0496124_0221903 3300048927 Bacteria 1421
690 Ga0496125_0065863 3300048928 Bacteria 2866
691 Ga0496125_0165870 3300048928 Bacteria 1492
692 Ga0496126_0033948 3300048929 Bacteria 4798
693 Ga0496126_0728268 3300048929 Bacteria 768
694 Ga0501031_0018247 3300049568 Bacteria 4566
695 Ga0501031_0019059 3300049568 Bacteria 4467
696 Ga0501031_0064762 3300049568 Bacteria 2381
697 Ga0501031_0154659 3300049568 Bacteria 1499
698 Ga0501032_0102264 3300049569 Bacteria 1899
699 Ga0501032_0154271 3300049569 Bacteria 1509
700 Ga0501033_0000165 3300049570 Bacteria 63213
701 Ga0501033_0061294 3300049570 Bacteria 2773
702 Ga0501033_0206627 3300049570 Bacteria 1401
703 Ga0501033_0334362 3300049570 Bacteria 1063
704 Ga0501034_0362793 3300049571 Bacteria 1376
705 Ga0501034_0388152 3300049571 Bacteria 1320
706 Ga0501036_0010396 3300049572 Bacteria 7683
707 Ga0501036_0050046 3300049572 Bacteria 3539
708 Ga0501036_0062494 3300049572 Bacteria 3154
709 Ga0501036_0203101 3300049572 Bacteria 1667
710 Ga0501036_1401005 3300049572 Bacteria 567
711 Ga0501037_0046690 3300049573 Bacteria 3176
712 Ga0501037_0094802 3300049573 Bacteria 2158
713 Ga0501037_0110673 3300049573 Bacteria 1979
714 Ga0501037_0436858 3300049573 Bacteria 894
715 Ga0501038_0027908 3300049574 Bacteria 5016
716 Ga0501038_0164994 3300049574 Bacteria 1797
717 Ga0501038_0235436 3300049574 Bacteria 1455
718 Ga0501038_0492907 3300049574 Bacteria 938
719 Ga0501039_0012810 3300049575 Bacteria 6410
720 Ga0501039_0024150 3300049575 Bacteria 4669
721 Ga0501039_0055460 3300049575 Bacteria 3069
722 Ga0501039_0092905 3300049575 Bacteria 2351
723 Ga0501039_0112275 3300049575 Bacteria 2131
724 Ga0501039_0272602 3300049575 Bacteria 1330
725 Ga0501039_0393157 3300049575 Bacteria 1089
726 Ga0501040_0011102 3300049576 Bacteria 5888
727 Ga0501040_0034372 3300049576 Bacteria 3434
728 Ga0501040_0110567 3300049576 Bacteria 1921
729 Ga0501040_0160241 3300049576 Bacteria 1590
730 Ga0501040_0214608 3300049576 Bacteria 1368
731 Ga0501040_0274269 3300049576 Bacteria 1204
732 Ga0501041_0005900 3300049577 Bacteria 7158
733 Ga0501041_0012868 3300049577 Bacteria 4957
734 Ga0501041_0104099 3300049577 Bacteria 1758
735 Ga0501041_0111852 3300049577 Bacteria 1694
736 Ga0501041_0115119 3300049577 Bacteria 1669
737 Ga0501041_0127842 3300049577 Bacteria 1582
738 Ga0501041_0385164 3300049577 Bacteria 887
739 Ga0501041_0433083 3300049577 Bacteria 834
740 Ga0501042_0004334 3300049578 Bacteria 9047
741 Ga0501042_0041700 3300049578 Bacteria 3265
742 Ga0501042_0072925 3300049578 Bacteria 2456
743 Ga0501042_0087311 3300049578 Bacteria 2237
744 Ga0501043_0039464 3300049579 Bacteria 3710
745 Ga0501043_0052089 3300049579 Bacteria 3216
746 Ga0501043_0338439 3300049579 Bacteria 1145
747 Ga0501046_0037603 3300049580 Bacteria 3889
748 Ga0501046_0049030 3300049580 Bacteria 3342
749 Ga0501046_0494222 3300049580 Bacteria 877
750 Ga0501047_0180925 3300049581 Bacteria 1975
751 Ga0501048_0009618 3300049582 Bacteria 7254
752 Ga0501048_0110136 3300049582 Bacteria 1944
753 Ga0501048_0118483 3300049582 Bacteria 1870
754 Ga0501048_0210620 3300049582 Bacteria 1378
755 Ga0501048_0305458 3300049582 Bacteria 1132
756 Ga0501048_0443650 3300049582 Bacteria 929
757 Ga0501067_0001414 3300049583 Bacteria 13016
758 Ga0501067_0118441 3300049583 Bacteria 1473
759 Ga0501067_0151364 3300049583 Bacteria 1293
760 Ga0501068_0073805 3300049584 Bacteria 2084
761 Ga0501068_0108673 3300049584 Bacteria 1723
762 Ga0501069_0236220 3300049585 Bacteria 1065
763 Ga0501069_0430967 3300049585 Bacteria 782
764 Ga0501069_0512408 3300049585 Bacteria 716
765 Ga0501070_0043242 3300049586 Bacteria 3750
766 Ga0501070_0132022 3300049586 Bacteria 2063
767 Ga0501070_0266119 3300049586 Bacteria 1401
768 Ga0501070_0323089 3300049586 Bacteria 1255
769 Ga0501071_0019681 3300049587 Bacteria 4686
770 Ga0501071_0021438 3300049587 Bacteria 4500
771 Ga0501071_0055362 3300049587 Bacteria 2863
772 Ga0501071_0072077 3300049587 Bacteria 2519
773 Ga0501071_0087454 3300049587 Bacteria 2286
774 Ga0501071_0107854 3300049587 Bacteria 2057
775 Ga0501072_0012631 3300049588 Bacteria 6456
776 Ga0501072_0033814 3300049588 Bacteria 4006
777 Ga0501072_0130696 3300049588 Bacteria 2001
778 Ga0501072_0178836 3300049588 Bacteria 1692
779 Ga0501073_0129775 3300049589 Bacteria 1747
780 Ga0501073_0543303 3300049589 Bacteria 803
781 Ga0501074_0028541 3300049590 Bacteria 4044
782 Ga0501074_0071912 3300049590 Bacteria 2486
783 Ga0501074_0185281 3300049590 Bacteria 1484
784 Ga0501074_0610854 3300049590 Bacteria 771
785 Ga0501074_0620765 3300049590 Bacteria 764
786 Ga0501075_0002322 3300049591 Bacteria 12625
787 Ga0501075_0006118 3300049591 Bacteria 8269
788 Ga0501075_0012671 3300049591 Bacteria 5997
789 Ga0501075_0015132 3300049591 Bacteria 5534
790 Ga0501075_0070921 3300049591 Bacteria 2633
791 Ga0501075_0098624 3300049591 Bacteria 2218
792 Ga0501075_0155348 3300049591 Bacteria 1744
793 Ga0501075_0281474 3300049591 Bacteria 1267
794 Ga0501076_0009092 3300049592 Bacteria 7315
795 Ga0501076_0011036 3300049592 Bacteria 6717
796 Ga0501076_0049110 3300049592 Bacteria 3336
797 Ga0501076_0084603 3300049592 Bacteria 2548
798 Ga0501076_0331027 3300049592 Bacteria 1249
799 Ga0501076_0465161 3300049592 Bacteria 1041
800 Ga0501076_0524191 3300049592 Bacteria 977
801 Ga0501076_0656056 3300049592 Bacteria 866
802 Ga0501077_0007577 3300049593 Bacteria 6698
803 Ga0501077_0009692 3300049593 Bacteria 5987
804 Ga0501077_0032091 3300049593 Bacteria 3342
805 Ga0501077_0059327 3300049593 Bacteria 2429
806 Ga0501077_0092901 3300049593 Bacteria 1912
807 Ga0501077_0131485 3300049593 Bacteria 1586
808 Ga0501077_0160611 3300049593 Bacteria 1427
809 Ga0501077_0430334 3300049593 Bacteria 844
810 Ga0501079_0006052 3300049741 Bacteria 9069
811 Ga0501079_0017035 3300049741 Bacteria 5549
812 Ga0501079_0082619 3300049741 Bacteria 2484
813 Ga0501079_0204266 3300049741 Bacteria 1543
814 Ga0501079_0254203 3300049741 Bacteria 1373
815 Ga0501079_0562156 3300049741 Bacteria 897
816 Ga0501080_0018226 3300049742 Bacteria 6498
817 Ga0501080_0160984 3300049742 Bacteria 2073
818 Ga0501080_0236155 3300049742 Bacteria 1670
819 Ga0501080_0243634 3300049742 Bacteria 1640
820 Ga0501080_0269689 3300049742 Bacteria 1549
821 Ga0501080_0351603 3300049742 Bacteria 1331
822 Ga0501081_0008837 3300049743 Bacteria 6549
823 Ga0501081_0009707 3300049743 Bacteria 6276
824 Ga0501081_0048832 3300049743 Bacteria 2913
825 Ga0501081_0057804 3300049743 Bacteria 2682
826 Ga0501081_0587723 3300049743 Bacteria 833
827 Ga0501083_0001062 3300049744 Bacteria 18344
828 Ga0501083_0027140 3300049744 Bacteria 3952
829 Ga0501083_0047990 3300049744 Bacteria 2883
830 Ga0501083_0054706 3300049744 Bacteria 2678
831 Ga0501083_0059019 3300049744 Bacteria 2566
832 Ga0501083_0124668 3300049744 Bacteria 1689
833 Ga0501083_0233358 3300049744 Bacteria 1198
834 Ga0501035_0001055 3300049822 Bacteria 28892
835 Ga0501035_0055153 3300049822 Bacteria 3549
836 Ga0501035_0132542 3300049822 Bacteria 2172
837 Ga0501035_0395611 3300049822 Bacteria 1150
838 Ga0501044_0936403 3300049823 Bacteria 740
839 Ga0501045_0013203 3300049824 Bacteria 5826
840 Ga0501045_0135424 3300049824 Bacteria 1831
841 Ga0501045_0143113 3300049824 Bacteria 1778
842 Ga0501045_0145614 3300049824 Bacteria 1762
843 Ga0501045_0187221 3300049824 Bacteria 1542
844 Ga0501045_0295393 3300049824 Bacteria 1206
845 Ga0501045_0656700 3300049824 Bacteria 775
846 nmdc:mga0yw44_276743_c1 3300050492 Bacteria 1121
847 nmdc:mga0k408_324982_c1 3300050493 Bacteria 918
848 nmdc:mga06z11_27251_c1 3300050494 Bacteria 2731
849 nmdc:mga06z11_4683_c1 3300050494 Bacteria 5402
850 nmdc:mga05p37_197320_c1 3300050507 Bacteria 2440
851 nmdc:mga05p37_277802_c1 3300050507 Bacteria 1999
852 nmdc:mga05p37_304832_c1 3300050507 Bacteria 1891
853 nmdc:mga09592_171162_c1 3300050508 Bacteria 1878
854 nmdc:mga09592_1766_c1 3300050508 Bacteria 17366
855 nmdc:mga09592_285705_c1 3300050508 Bacteria 1430
856 nmdc:mga0qj67_116450_c1 3300050509 Bacteria 2159
857 nmdc:mga0qj67_5071_c1 3300050509 Bacteria 9583
858 nmdc:mga0qj67_739369_c1 3300050509 Bacteria 781
859 nmdc:mga06r32_131161_c1 3300050510 Bacteria 2478
860 nmdc:mga06r32_2699_c1 3300050510 Bacteria 15873
861 nmdc:mga06r32_407392_c1 3300050510 Bacteria 1342
862 nmdc:mga06r32_577844_c1 3300050510 Bacteria 1096
863 nmdc:mga06r32_61975_c1 3300050510 Bacteria 3602
864 nmdc:mga08y16_10691_c1 3300050511 Bacteria 9631
865 nmdc:mga08y16_197590_c1 3300050511 Bacteria 2085
866 nmdc:mga08y16_29502_c1 3300050511 Bacteria 5780
867 nmdc:mga08y16_37547_c1 3300050511 Bacteria 5086
868 nmdc:mga0n895_1273_c1 3300050512 Bacteria 18618
869 nmdc:mga0n895_16404_c1 3300050512 Bacteria 6795
870 nmdc:mga0n895_184516_c1 3300050512 Bacteria 2117
871 nmdc:mga0n895_197375_c1 3300050512 Bacteria 2044
872 nmdc:mga0n895_668722_c1 3300050512 Bacteria 1036
873 nmdc:mga0rr50_12331_c1 3300050513 Bacteria 5520
874 nmdc:mga0rr50_70440_c1 3300050513 Bacteria 2664
875 nmdc:mga0rr50_818250_c1 3300050513 Bacteria 795
876 nmdc:mga08x19_31143_c1 3300050514 Bacteria 3354
877 nmdc:mga0a205_298671_c1 3300050515 Bacteria 1484
878 nmdc:mga0a205_54545_c1 3300050515 Bacteria 3860
879 nmdc:mga0a205_57553_c1 3300050515 Bacteria 3753
880 nmdc:mga0sz30_287710_c1 3300050516 Bacteria 732
881 Ga0495601_0025917 3300053077 Bacteria 3617
882 Ga0495601_0051547 3300053077 Bacteria 2597
883 Ga0500635_0156183 3300053080 Bacteria 873
884 Ga0495655_0000614 3300053083 Bacteria 5816
885 Ga0495595_0026853 3300053084 Bacteria 2561
886 Ga0495619_0014629 3300053085 Bacteria 4956
887 Ga0495619_0019133 3300053085 Bacteria 4351
888 Ga0500643_064813 3300053087 Bacteria 1021
889 Ga0500644_0003039 3300053088 Bacteria 4161
890 Ga0500572_001422 3300053111 Bacteria 6578
891 Ga0500618_000007 3300053125 Bacteria 226268
892 Ga0500618_001066 3300053125 Bacteria 13544
893 Ga0500559_0000750 3300053136 Bacteria 21301
894 Ga0500577_0000750 3300053142 Bacteria 8336
895 Ga0500590_022856 3300053148 Bacteria 3248
896 Ga0500603_023087 3300053150 Bacteria 1546
897 Ga0500616_0000758 3300053153 Bacteria 37186
898 Ga0500622_0002839 3300053156 Bacteria 12151
899 Ga0500636_0000562 3300053177 Bacteria 20257
900 Ga0500636_0016824 3300053177 Bacteria 4312
901 Ga0500637_0009578 3300053178 Bacteria 4937
902 Ga0500576_097625 3300053725 Bacteria 1206
903 Ga0500601_003129 3300053737 Bacteria 1787
904 Ga0501084_0001874 3300054114 Bacteria 16763
905 Ga0501084_0010094 3300054114 Bacteria 7802
906 Ga0501084_0015357 3300054114 Bacteria 6348
907 Ga0501084_0031135 3300054114 Bacteria 4463
908 Ga0501084_0035892 3300054114 Bacteria 4144
909 Ga0501084_0081161 3300054114 Bacteria 2720
910 Ga0501084_0087331 3300054114 Bacteria 2618
911 Ga0501084_0117137 3300054114 Bacteria 2240
912 Ga0501084_0126400 3300054114 Bacteria 2151
913 Ga0501084_0243763 3300054114 Bacteria 1517
914 Ga0501084_0290570 3300054114 Bacteria 1381
915 Ga0501084_0590777 3300054114 Bacteria 938
916 Ga0501084_0752287 3300054114 Bacteria 821
917 Ga0501082_0008485 3300060353 Bacteria 8860
918 Ga0501082_0027615 3300060353 Bacteria 4885
919 Ga0501082_0039628 3300060353 Bacteria 4063
920 Ga0501082_0108400 3300060353 Bacteria 2403
921 Ga0501082_0111536 3300060353 Bacteria 2368
922 Ga0501082_0241771 3300060353 Bacteria 1571
923 Ga0501082_0288996 3300060353 Bacteria 1427
924 Ga0501082_0684825 3300060353 Bacteria 897
925 Ga0501082_0834195 3300060353 Bacteria 806
926 Ga0466962_0142212 3300061719 Bacteria 1162
927 Ga0530510_0019403 3300061734 Bacteria 4826
928 Ga0530510_0020859 3300061734 Bacteria 4660
929 Ga0530510_0091899 3300061734 Bacteria 2214
930 Ga0530510_0106649 3300061734 Bacteria 2050
931 Ga0530510_0119654 3300061734 Bacteria 1932
932 Ga0530510_0412678 3300061734 Bacteria 1019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041491 Ga0451833_1324743 Ga0451833_1324743_31_531 166
2 3300049572 Ga0501036_1401005 Ga0501036_1401005_12_521 169
3 3300046531 Ga0495665_0510239 Ga0495665_0510239_55_591 178
4 3300005577 Ga0068857_100014557 Ga0068857_1000145575 181
5 3300005614 Ga0068856_100003776 Ga0068856_10000377614 181
6 3300005616 Ga0068852_100030567 Ga0068852_1000305674 181
7 3300005834 Ga0068851_10001831 Ga0068851_100018312 181
8 3300025321 Ga0207656_10003508 Ga0207656_100035085 181
9 3300025911 Ga0207654_10000248 Ga0207654_1000024822 181
10 3300025913 Ga0207695_10000343 Ga0207695_1000034367 181
11 3300025924 Ga0207694_10000136 Ga0207694_1000013614 181
12 3300026078 Ga0207702_10000006 Ga0207702_10000006218 181
13 3300026116 Ga0207674_10003449 Ga0207674_100034498 181
14 3300026142 Ga0207698_10022080 Ga0207698_100220801 181
15 3300037471 Ga0395905_1419738 Ga0395905_1419738_33_578 181
16 3300042156 Ga0439446_0242404 Ga0439446_0242404_17_562 181
17 3300046683 Ga0495658_0402655 Ga0495658_0402655_317_862 181
18 3300006175 Ga0070712_100011722 Ga0070712_1000117225 185
19 3300025915 Ga0207693_10780288 Ga0207693_107802881 185
20 3300031241 Ga0265325_10021108 Ga0265325_100211081 185
21 3300031249 Ga0265339_10000016 Ga0265339_1000001652 185
22 3300031595 Ga0265313_10000060 Ga0265313_1000006087 185
23 3300035692 Ga0373935_0533301 Ga0373935_0533301_269_826 185
24 3300037068 Ga0373925_0001714 Ga0373925_0001714_68_625 185
25 3300046455 Ga0495603_0598482 Ga0495603_0598482_41_598 185
26 3300046476 Ga0495662_0116855 Ga0495662_0116855_707_1264 185
27 3300046531 Ga0495665_0205416 Ga0495665_0205416_384_941 185
28 3300046559 Ga0495667_0694892 Ga0495667_0694892_59_616 185
29 3300046663 Ga0495635_0451326 Ga0495635_0451326_26_583 185
30 3300046689 Ga0495613_0254956 Ga0495613_0254956_53_610 185
31 iso_pu_bacteria 2855020534 2855021462 185
32 3300053153 Ga0500616_0000758 Ga0500616_0000758_17931_18536 186
33 3300006881 Ga0068865_100157725 Ga0068865_1001577252 187
34 iso_pu_bacteria 2713897090 2715501660 190
35 iso_pu_bacteria 2824600985 2824603715 193
36 iso_pu_bacteria 2824609381 2824610679 193
37 iso_pu_bacteria 2824653114 2824657901 193
38 iso_pu_bacteria 2888419890 2888421265 193
39 3300048921 Ga0496118_0069619 Ga0496118_0069619_1334_1921 194
40 iso_pu_bacteria 2995392953 2995395135 194
41 iso_pu_bacteria 8056875544 8056879320 194
42 3300005719 Ga0068861_100373801 Ga0068861_1003738012 195
43 3300009093 Ga0105240_10983235 Ga0105240_109832352 195
44 3300047319 Ga0495674_0795907 Ga0495674_0795907_14_634 195
45 3300047321 Ga0495676_0035027 Ga0495676_0035027_1579_2226 195
46 3300048905 Ga0496102_0365165 Ga0496102_0365165_346_933 195
47 3300048909 Ga0496106_0664808 Ga0496106_0664808_148_735 195
48 3300048924 Ga0496121_0097751 Ga0496121_0097751_1178_1801 195
49 3300053080 Ga0500635_0156183 Ga0500635_0156183_240_860 195
50 iso_pu_bacteria 2891048133 2891050732 195
51 3300005546 Ga0070696_100204330 Ga0070696_1002043302 196
52 3300005549 Ga0070704_100203321 Ga0070704_1002033212 196
53 3300006844 Ga0075428_100003217 Ga0075428_10000321720 196
54 3300006846 Ga0075430_100046367 Ga0075430_1000463674 196
55 3300006847 Ga0075431_100016100 Ga0075431_1000161004 196
56 3300031239 Ga0265328_10032026 Ga0265328_100320263 196
57 3300031241 Ga0265325_10157284 Ga0265325_101572842 196
58 3300031247 Ga0265340_10000397 Ga0265340_1000039712 196
59 3300031249 Ga0265339_10013893 Ga0265339_100138933 196
60 3300031344 Ga0265316_10037176 Ga0265316_100371763 196
61 3300031595 Ga0265313_10001332 Ga0265313_1000133214 196
62 3300031711 Ga0265314_10082713 Ga0265314_100827132 196
63 3300032002 Ga0307416_100995733 Ga0307416_1009957332 196
64 3300049570 Ga0501033_0206627 Ga0501033_0206627_329_928 196
65 3300049572 Ga0501036_0050046 Ga0501036_0050046_542_1141 196
66 3300049576 Ga0501040_0034372 Ga0501040_0034372_2179_2778 196
67 3300049577 Ga0501041_0012868 Ga0501041_0012868_3577_4176 196
68 3300049578 Ga0501042_0072925 Ga0501042_0072925_1273_1872 196
69 3300049583 Ga0501067_0118441 Ga0501067_0118441_62_661 196
70 3300049586 Ga0501070_0323089 Ga0501070_0323089_226_825 196
71 3300049587 Ga0501071_0021438 Ga0501071_0021438_3442_4041 196
72 3300049591 Ga0501075_0002322 Ga0501075_0002322_9960_10559 196
73 3300049592 Ga0501076_0331027 Ga0501076_0331027_302_901 196
74 3300049593 Ga0501077_0092901 Ga0501077_0092901_857_1456 196
75 3300049741 Ga0501079_0006052 Ga0501079_0006052_6953_7552 196
76 3300049743 Ga0501081_0009707 Ga0501081_0009707_5444_6043 196
77 3300049824 Ga0501045_0013203 Ga0501045_0013203_2137_2736 196
78 3300050508 nmdc:mga09592_285705_c1 nmdc:mga09592_285705_c1_420_1019 196
79 3300050509 nmdc:mga0qj67_739369_c1 nmdc:mga0qj67_739369_c1_43_642 196
80 3300050510 nmdc:mga06r32_61975_c1 nmdc:mga06r32_61975_c1_702_1301 196
81 3300054114 Ga0501084_0001874 Ga0501084_0001874_8414_9013 196
82 3300060353 Ga0501082_0008485 Ga0501082_0008485_7787_8386 196
83 3300060353 Ga0501082_0111536 Ga0501082_0111536_925_1524 196
84 3300060353 Ga0501082_0241771 Ga0501082_0241771_732_1331 196
85 3300061734 Ga0530510_0020859 Ga0530510_0020859_1488_2087 196
86 iso_pu_bacteria 2510917026 2511173867 196
87 iso_pu_bacteria 2558860983 2561467230 196
88 iso_pu_bacteria 2585427633 2585994721 196
89 iso_pu_bacteria 2585427634 2585999204 196
90 iso_pu_bacteria 2599185236 2599719343 196
91 iso_pu_bacteria 2821123053 2821123854 196
92 iso_pu_bacteria 2838736955 2838739117 196
93 iso_pu_bacteria 2841840854 2841843015 196
94 iso_pu_bacteria 2842140634 2842142797 196
95 iso_pu_bacteria 2854916844 2854917729 196
96 iso_pu_bacteria 2857531043 2857531416 196
97 iso_pu_bacteria 2919171160 2919171832 196
98 iso_pu_bacteria 8018150411 8018151871 196
99 iso_pu_bacteria 8054460903 8054461485 196
100 3300005347 Ga0070668_100514555 Ga0070668_1005145552 197
101 3300005719 Ga0068861_100209304 Ga0068861_1002093042 197
102 3300006028 Ga0070717_10026943 Ga0070717_100269434 197
103 3300006042 Ga0075368_10104777 Ga0075368_101047771 197
104 3300006178 Ga0075367_10008319 Ga0075367_100083194 197
105 3300009093 Ga0105240_10760180 Ga0105240_107601801 197
106 3300009094 Ga0111539_10972591 Ga0111539_109725912 197
107 3300013104 Ga0157370_10101893 Ga0157370_101018932 197
108 3300013105 Ga0157369_10034677 Ga0157369_100346775 197
109 3300014968 Ga0157379_10157016 Ga0157379_101570162 197
110 3300020081 Ga0206354_11350350 Ga0206354_113503502 197
111 3300022467 Ga0224712_10035877 Ga0224712_100358772 197
112 3300025928 Ga0207700_10313751 Ga0207700_103137512 197
113 3300026041 Ga0207639_10100681 Ga0207639_101006812 197
114 3300026118 Ga0207675_100018399 Ga0207675_1000183992 197
115 3300027866 Ga0209813_10004386 Ga0209813_100043862 197
116 3300039437 Ga0436365_1937907 Ga0436365_1937907_442_1095 197
117 3300048907 Ga0496104_0001121 Ga0496104_0001121_17436_18038 197
118 3300048908 Ga0496105_0030430 Ga0496105_0030430_1276_1878 197
119 3300048912 Ga0496109_0021712 Ga0496109_0021712_3017_3619 197
120 3300048913 Ga0496110_0050169 Ga0496110_0050169_1766_2368 197
121 3300048914 Ga0496111_0006155 Ga0496111_0006155_1319_1921 197
122 3300048915 Ga0496112_0069837 Ga0496112_0069837_633_1235 197
123 3300049574 Ga0501038_0492907 Ga0501038_0492907_114_722 197
124 3300049581 Ga0501047_0180925 Ga0501047_0180925_193_801 197
125 3300049583 Ga0501067_0001414 Ga0501067_0001414_1631_2242 197
126 3300049589 Ga0501073_0543303 Ga0501073_0543303_28_636 197
127 3300049744 Ga0501083_0027140 Ga0501083_0027140_806_1417 197
128 3300049744 Ga0501083_0059019 Ga0501083_0059019_470_1081 197
129 3300050494 nmdc:mga06z11_4683_c1 nmdc:mga06z11_4683_c1_3311_3910 197
130 3300054114 Ga0501084_0126400 Ga0501084_0126400_633_1244 197
131 iso_pu_bacteria 2854896431 2854898495 197
132 3300031247 Ga0265340_10013221 Ga0265340_100132216 198
133 3300042436 Ga0439435_0009720 Ga0439435_0009720_1540_2139 198
134 3300042461 Ga0439460_0197788 Ga0439460_0197788_25_624 198
135 3300048912 Ga0496109_0272109 Ga0496109_0272109_324_929 198
136 3300049571 Ga0501034_0388152 Ga0501034_0388152_202_891 198
137 3300049592 Ga0501076_0524191 Ga0501076_0524191_173_784 198
138 3300049744 Ga0501083_0054706 Ga0501083_0054706_1867_2478 198
139 3300054114 Ga0501084_0290570 Ga0501084_0290570_390_992 198
140 3300060353 Ga0501082_0834195 Ga0501082_0834195_140_745 198
141 3300001979 JGI24740J21852_10002543 JGI24740J21852_100025438 199
142 3300005365 Ga0070688_100422402 Ga0070688_1004224022 199
143 3300005435 Ga0070714_100644657 Ga0070714_1006446571 199
144 3300005439 Ga0070711_100550372 Ga0070711_1005503721 199
145 3300005455 Ga0070663_100644734 Ga0070663_1006447342 199
146 3300005518 Ga0070699_100424239 Ga0070699_1004242391 199
147 3300005539 Ga0068853_100000997 Ga0068853_10000099711 199
148 3300005549 Ga0070704_100157354 Ga0070704_1001573542 199
149 3300005549 Ga0070704_100678602 Ga0070704_1006786021 199
150 3300005563 Ga0068855_100837575 Ga0068855_1008375751 199
151 3300005617 Ga0068859_100300339 Ga0068859_1003003391 199
152 3300005842 Ga0068858_101184832 Ga0068858_1011848321 199
153 3300005843 Ga0068860_100391229 Ga0068860_1003912292 199
154 3300005937 Ga0081455_10009824 Ga0081455_100098249 199
155 3300006844 Ga0075428_100049289 Ga0075428_1000492892 199
156 3300006844 Ga0075428_100272294 Ga0075428_1002722942 199
157 3300006847 Ga0075431_100466138 Ga0075431_1004661382 199
158 3300006852 Ga0075433_10618869 Ga0075433_106188692 199
159 3300006871 Ga0075434_100018921 Ga0075434_1000189214 199
160 3300006871 Ga0075434_100187972 Ga0075434_1001879722 199
161 3300006871 Ga0075434_100696917 Ga0075434_1006969171 199
162 3300006931 Ga0097620_100300341 Ga0097620_1003003411 199
163 3300007076 Ga0075435_100015409 Ga0075435_1000154092 199
164 3300009093 Ga0105240_10006744 Ga0105240_1000674411 199
165 3300009094 Ga0111539_10010676 Ga0111539_100106767 199
166 3300009094 Ga0111539_10096054 Ga0111539_100960542 199
167 3300009147 Ga0114129_10127955 Ga0114129_101279552 199
168 3300009147 Ga0114129_11320514 Ga0114129_113205142 199
169 3300009148 Ga0105243_10762445 Ga0105243_107624452 199
170 3300009174 Ga0105241_10002644 Ga0105241_100026448 199
171 3300009176 Ga0105242_10435239 Ga0105242_104352392 199
172 3300009545 Ga0105237_10112552 Ga0105237_101125523 199
173 3300009551 Ga0105238_10000517 Ga0105238_1000051727 199
174 3300010375 Ga0105239_10002648 Ga0105239_1000264811 199
175 3300010375 Ga0105239_11635832 Ga0105239_116358321 199
176 3300013297 Ga0157378_10368422 Ga0157378_103684222 199
177 3300013308 Ga0157375_10187567 Ga0157375_101875673 199
178 3300014325 Ga0163163_10145567 Ga0163163_101455672 199
179 3300014968 Ga0157379_10414404 Ga0157379_104144041 199
180 3300025914 Ga0207671_10234084 Ga0207671_102340842 199
181 3300025935 Ga0207709_10702857 Ga0207709_107028572 199
182 3300025936 Ga0207670_10232883 Ga0207670_102328832 199
183 3300025944 Ga0207661_10438663 Ga0207661_104386632 199
184 3300025949 Ga0207667_10324472 Ga0207667_103244722 199
185 3300025972 Ga0207668_10783147 Ga0207668_107831472 199
186 3300026035 Ga0207703_10316506 Ga0207703_103165062 199
187 3300026041 Ga0207639_10216336 Ga0207639_102163362 199
188 3300027907 Ga0207428_10009013 Ga0207428_100090135 199
189 3300027907 Ga0207428_10385060 Ga0207428_103850602 199
190 3300028381 Ga0268264_11033036 Ga0268264_110330362 199
191 3300048903 Ga0496100_0095627 Ga0496100_0095627_402_1010 199
192 3300048907 Ga0496104_0005122 Ga0496104_0005122_6546_7154 199
193 3300048908 Ga0496105_0203661 Ga0496105_0203661_284_892 199
194 3300048909 Ga0496106_0077262 Ga0496106_0077262_1052_1660 199
195 3300048910 Ga0496107_0235549 Ga0496107_0235549_564_1172 199
196 3300048911 Ga0496108_0013407 Ga0496108_0013407_5276_5884 199
197 3300048912 Ga0496109_0040221 Ga0496109_0040221_1198_1806 199
198 3300048913 Ga0496110_0114339 Ga0496110_0114339_218_826 199
199 3300048913 Ga0496110_0601499 Ga0496110_0601499_273_881 199
200 3300048914 Ga0496111_0030040 Ga0496111_0030040_911_1519 199
201 3300048915 Ga0496112_0048867 Ga0496112_0048867_2458_3066 199
202 3300048916 Ga0496113_0235411 Ga0496113_0235411_501_1109 199
203 3300048918 Ga0496115_0150053 Ga0496115_0150053_1197_1805 199
204 3300049592 Ga0501076_0656056 Ga0501076_0656056_90_698 199
205 3300050507 nmdc:mga05p37_277802_c1 nmdc:mga05p37_277802_c1_214_822 199
206 3300050509 nmdc:mga0qj67_5071_c1 nmdc:mga0qj67_5071_c1_6073_6681 199
207 3300050511 nmdc:mga08y16_29502_c1 nmdc:mga08y16_29502_c1_2440_3048 199
208 3300050511 nmdc:mga08y16_37547_c1 nmdc:mga08y16_37547_c1_228_836 199
209 3300050512 nmdc:mga0n895_16404_c1 nmdc:mga0n895_16404_c1_2969_3577 199
210 3300050512 nmdc:mga0n895_184516_c1 nmdc:mga0n895_184516_c1_645_1253 199
211 3300050512 nmdc:mga0n895_668722_c1 nmdc:mga0n895_668722_c1_22_630 199
212 3300050513 nmdc:mga0rr50_12331_c1 nmdc:mga0rr50_12331_c1_4766_5374 199
213 3300050515 nmdc:mga0a205_298671_c1 nmdc:mga0a205_298671_c1_66_674 199
214 3300054114 Ga0501084_0752287 Ga0501084_0752287_177_785 199
215 3300003215 JGI25153J46596_10019231 JGI25153J46596_100192312 200
216 3300003323 rootH1_10040793 rootH1_100407933 200
217 3300003791 Ga0055530_10018980 Ga0055530_100189802 200
218 3300003794 Ga0055531_10004299 Ga0055531_1000429910 200
219 3300005262 Ga0065165_1002916 Ga0065165_10029162 200
220 3300005548 Ga0070665_100134094 Ga0070665_1001340943 200
221 3300006852 Ga0075433_10110340 Ga0075433_101103402 200
222 3300006871 Ga0075434_100000437 Ga0075434_10000043727 200
223 3300006946 Ga0079104_1000010 Ga0079104_1000010377 200
224 3300007076 Ga0075435_100009318 Ga0075435_1000093187 200
225 3300009094 Ga0111539_10007284 Ga0111539_100072845 200
226 3300025292 Ga0209676_1009741 Ga0209676_10097414 200
227 3300025297 Ga0209758_1004272 Ga0209758_10042727 200
228 3300025303 Ga0209051_1003930 Ga0209051_100393011 200
229 3300025304 Ga0209257_1006738 Ga0209257_10067386 200
230 3300025942 Ga0207689_10119881 Ga0207689_101198813 200
231 3300027111 Ga0209281_1000078 Ga0209281_1000078254 200
232 3300028379 Ga0268266_10198746 Ga0268266_101987462 200
233 3300028794 Ga0307515_10441348 Ga0307515_104413482 200
234 3300031235 Ga0265330_10211006 Ga0265330_102110061 200
235 3300031241 Ga0265325_10068951 Ga0265325_100689513 200
236 3300031241 Ga0265325_10086138 Ga0265325_100861382 200
237 3300031241 Ga0265325_10184735 Ga0265325_101847352 200
238 3300031247 Ga0265340_10014208 Ga0265340_100142082 200
239 3300031247 Ga0265340_10073276 Ga0265340_100732762 200
240 3300031249 Ga0265339_10020578 Ga0265339_100205784 200
241 3300031249 Ga0265339_10032991 Ga0265339_100329915 200
242 3300031344 Ga0265316_10166769 Ga0265316_101667692 200
243 3300031595 Ga0265313_10039946 Ga0265313_100399461 200
244 3300031595 Ga0265313_10091458 Ga0265313_100914582 200
245 3300031712 Ga0265342_10006501 Ga0265342_100065017 200
246 3300031712 Ga0265342_10118122 Ga0265342_101181222 200
247 3300035090 Ga0373949_0014064 Ga0373949_0014064_239_850 200
248 3300035092 Ga0373952_0012012 Ga0373952_0012012_47_658 200
249 3300035112 Ga0373932_0008895 Ga0373932_0008895_367_978 200
250 3300035114 Ga0373939_0004663 Ga0373939_0004663_1744_2355 200
251 3300035121 Ga0373960_0055393 Ga0373960_0055393_145_756 200
252 3300035207 Ga0373942_0003455 Ga0373942_0003455_471_1082 200
253 3300035241 Ga0373961_0008667 Ga0373961_0008667_1694_2305 200
254 3300035242 Ga0373962_0011595 Ga0373962_0011595_934_1545 200
255 3300035691 Ga0373931_0000272 Ga0373931_0000272_19453_20064 200
256 3300037471 Ga0395905_0000463 Ga0395905_0000463_32410_33018 200
257 3300037471 Ga0395905_0001846 Ga0395905_0001846_5830_6438 200
258 3300046455 Ga0495603_0183854 Ga0495603_0183854_68_682 200
259 3300046460 Ga0495638_0206581 Ga0495638_0206581_464_1072 200
260 3300046501 Ga0495607_0115355 Ga0495607_0115355_796_1401 200
261 3300046522 Ga0495643_0022103 Ga0495643_0022103_35_640 200
262 3300046522 Ga0495643_0284857 Ga0495643_0284857_73_678 200
263 3300046530 Ga0495654_0000043 Ga0495654_0000043_101457_102062 200
264 3300046530 Ga0495654_0086487 Ga0495654_0086487_788_1393 200
265 3300048911 Ga0496108_0467005 Ga0496108_0467005_460_1071 200
266 3300048914 Ga0496111_0008506 Ga0496111_0008506_715_1386 200
267 3300048917 Ga0496114_0963582 Ga0496114_0963582_110_721 200
268 3300048924 Ga0496121_0008329 Ga0496121_0008329_9512_10117 200
269 3300048925 Ga0496122_0023503 Ga0496122_0023503_829_1500 200
270 3300048925 Ga0496122_0025339 Ga0496122_0025339_581_1243 200
271 3300048926 Ga0496123_0029566 Ga0496123_0029566_522_1193 200
272 3300048927 Ga0496124_0018333 Ga0496124_0018333_3600_4205 200
273 3300048927 Ga0496124_0079267 Ga0496124_0079267_1395_2066 200
274 3300048928 Ga0496125_0065863 Ga0496125_0065863_1448_2188 200
275 3300048929 Ga0496126_0033948 Ga0496126_0033948_2328_2981 200
276 3300049568 Ga0501031_0064762 Ga0501031_0064762_216_824 200
277 3300049569 Ga0501032_0154271 Ga0501032_0154271_673_1281 200
278 3300049570 Ga0501033_0000165 Ga0501033_0000165_44216_44824 200
279 3300049585 Ga0501069_0430967 Ga0501069_0430967_85_693 200
280 3300049593 Ga0501077_0131485 Ga0501077_0131485_840_1460 200
281 3300049742 Ga0501080_0243634 Ga0501080_0243634_143_763 200
282 3300049744 Ga0501083_0001062 Ga0501083_0001062_4950_5639 200
283 3300049822 Ga0501035_0001055 Ga0501035_0001055_15007_15615 200
284 3300050493 nmdc:mga0k408_324982_c1 nmdc:mga0k408_324982_c1_139_747 200
285 3300050511 nmdc:mga08y16_10691_c1 nmdc:mga08y16_10691_c1_6345_6956 200
286 3300050512 nmdc:mga0n895_1273_c1 nmdc:mga0n895_1273_c1_11940_12551 200
287 3300050515 nmdc:mga0a205_54545_c1 nmdc:mga0a205_54545_c1_2887_3498 200
288 3300050516 nmdc:mga0sz30_287710_c1 nmdc:mga0sz30_287710_c1_36_641 200
289 3300053087 Ga0500643_064813 Ga0500643_064813_22_627 200
290 3300053088 Ga0500644_0003039 Ga0500644_0003039_312_920 200
291 3300053111 Ga0500572_001422 Ga0500572_001422_116_769 200
292 3300053125 Ga0500618_000007 Ga0500618_000007_215369_215974 200
293 3300053125 Ga0500618_001066 Ga0500618_001066_5604_6212 200
294 3300053156 Ga0500622_0002839 Ga0500622_0002839_11371_11979 200
295 3300053177 Ga0500636_0000562 Ga0500636_0000562_12183_12836 200
296 3300054114 Ga0501084_0117137 Ga0501084_0117137_106_726 200
297 iso_pu_bacteria 2844315083 2844316345 200
298 iso_pu_bacteria 2847930680 2847939351 200
299 iso_pu_bacteria 2857509624 2857513425 200
300 iso_pu_bacteria 2879083081 2879087024 200
301 iso_pu_bacteria 2903727486 2903728321 200
302 iso_pu_bacteria 2906602504 2906606461 200
303 iso_pu_bacteria 2906626472 2906631350 200
304 iso_pu_bacteria 8016583857 8016585318 200
305 3300007076 Ga0075435_100044849 Ga0075435_1000448492 201
306 3300046558 Ga0495633_0150039 Ga0495633_0150039_79_744 201
307 3300049570 Ga0501033_0061294 Ga0501033_0061294_1350_1961 201
308 3300049575 Ga0501039_0272602 Ga0501039_0272602_536_1147 201
309 3300049577 Ga0501041_0385164 Ga0501041_0385164_196_807 201
310 3300049579 Ga0501043_0338439 Ga0501043_0338439_66_677 201
311 3300049580 Ga0501046_0494222 Ga0501046_0494222_145_756 201
312 3300049588 Ga0501072_0178836 Ga0501072_0178836_145_756 201
313 3300049590 Ga0501074_0610854 Ga0501074_0610854_143_754 201
314 3300049591 Ga0501075_0098624 Ga0501075_0098624_1110_1721 201
315 3300049593 Ga0501077_0059327 Ga0501077_0059327_1116_1727 201
316 3300049743 Ga0501081_0048832 Ga0501081_0048832_116_727 201
317 3300049824 Ga0501045_0145614 Ga0501045_0145614_236_847 201
318 3300050513 nmdc:mga0rr50_70440_c1 nmdc:mga0rr50_70440_c1_997_1698 201
319 3300054114 Ga0501084_0081161 Ga0501084_0081161_475_1086 201
320 3300061734 Ga0530510_0019403 Ga0530510_0019403_3781_4392 201
321 3300005347 Ga0070668_100224342 Ga0070668_1002243421 202
322 3300005467 Ga0070706_100142204 Ga0070706_1001422042 202
323 3300005536 Ga0070697_100867908 Ga0070697_1008679081 202
324 3300006847 Ga0075431_100003293 Ga0075431_10000329312 202
325 3300006847 Ga0075431_100152635 Ga0075431_1001526352 202
326 3300006880 Ga0075429_100031335 Ga0075429_1000313352 202
327 3300009147 Ga0114129_10392048 Ga0114129_103920482 202
328 3300014326 Ga0157380_10094327 Ga0157380_100943272 202
329 3300025910 Ga0207684_10138260 Ga0207684_101382602 202
330 3300025972 Ga0207668_10385290 Ga0207668_103852901 202
331 3300027866 Ga0209813_10094422 Ga0209813_100944221 202
332 3300031456 Ga0307513_10006480 Ga0307513_1000648010 202
333 3300031730 Ga0307516_10018505 Ga0307516_100185052 202
334 3300039110 Ga0400487_27525 Ga0400487_27525_90_707 202
335 3300041999 Ga0439433_0111100 Ga0439433_0111100_51_668 202
336 3300049568 Ga0501031_0018247 Ga0501031_0018247_2615_3223 202
337 3300049569 Ga0501032_0102264 Ga0501032_0102264_1164_1772 202
338 3300049571 Ga0501034_0362793 Ga0501034_0362793_614_1222 202
339 3300049572 Ga0501036_0010396 Ga0501036_0010396_4602_5210 202
340 3300049572 Ga0501036_0203101 Ga0501036_0203101_169_786 202
341 3300049573 Ga0501037_0046690 Ga0501037_0046690_456_1064 202
342 3300049574 Ga0501038_0027908 Ga0501038_0027908_1021_1629 202
343 3300049575 Ga0501039_0012810 Ga0501039_0012810_1186_1794 202
344 3300049575 Ga0501039_0024150 Ga0501039_0024150_2146_2763 202
345 3300049575 Ga0501039_0393157 Ga0501039_0393157_312_929 202
346 3300049576 Ga0501040_0110567 Ga0501040_0110567_165_773 202
347 3300049577 Ga0501041_0127842 Ga0501041_0127842_873_1481 202
348 3300049578 Ga0501042_0004334 Ga0501042_0004334_7244_7852 202
349 3300049579 Ga0501043_0039464 Ga0501043_0039464_2927_3535 202
350 3300049582 Ga0501048_0118483 Ga0501048_0118483_950_1558 202
351 3300049582 Ga0501048_0443650 Ga0501048_0443650_64_681 202
352 3300049584 Ga0501068_0108673 Ga0501068_0108673_736_1344 202
353 3300049585 Ga0501069_0512408 Ga0501069_0512408_32_640 202
354 3300049586 Ga0501070_0043242 Ga0501070_0043242_198_806 202
355 3300049587 Ga0501071_0055362 Ga0501071_0055362_2005_2613 202
356 3300049588 Ga0501072_0130696 Ga0501072_0130696_1360_1977 202
357 3300049590 Ga0501074_0028541 Ga0501074_0028541_2632_3240 202
358 3300049591 Ga0501075_0012671 Ga0501075_0012671_4112_4720 202
359 3300049591 Ga0501075_0015132 Ga0501075_0015132_1440_2057 202
360 3300049592 Ga0501076_0011036 Ga0501076_0011036_5252_5860 202
361 3300049592 Ga0501076_0049110 Ga0501076_0049110_224_841 202
362 3300049593 Ga0501077_0009692 Ga0501077_0009692_4651_5259 202
363 3300049741 Ga0501079_0082619 Ga0501079_0082619_1670_2278 202
364 3300049742 Ga0501080_0018226 Ga0501080_0018226_4826_5434 202
365 3300049743 Ga0501081_0057804 Ga0501081_0057804_797_1405 202
366 3300049744 Ga0501083_0124668 Ga0501083_0124668_228_845 202
367 3300049744 Ga0501083_0233358 Ga0501083_0233358_360_968 202
368 3300049822 Ga0501035_0055153 Ga0501035_0055153_2615_3223 202
369 3300049824 Ga0501045_0187221 Ga0501045_0187221_381_989 202
370 3300050494 nmdc:mga06z11_27251_c1 nmdc:mga06z11_27251_c1_600_1217 202
371 3300050508 nmdc:mga09592_1766_c1 nmdc:mga09592_1766_c1_11228_11845 202
372 3300050510 nmdc:mga06r32_131161_c1 nmdc:mga06r32_131161_c1_326_943 202
373 3300050510 nmdc:mga06r32_2699_c1 nmdc:mga06r32_2699_c1_4172_4789 202
374 3300054114 Ga0501084_0015357 Ga0501084_0015357_1072_1680 202
375 3300054114 Ga0501084_0031135 Ga0501084_0031135_66_683 202
376 3300060353 Ga0501082_0039628 Ga0501082_0039628_3408_4016 202
377 3300061734 Ga0530510_0119654 Ga0530510_0119654_47_655 202
378 3300005341 Ga0070691_10047138 Ga0070691_100471383 203
379 3300005356 Ga0070674_100988936 Ga0070674_1009889361 203
380 3300005367 Ga0070667_100415388 Ga0070667_1004153881 203
381 3300005457 Ga0070662_100728955 Ga0070662_1007289552 203
382 3300005535 Ga0070684_100619092 Ga0070684_1006190922 203
383 3300005546 Ga0070696_100209924 Ga0070696_1002099242 203
384 3300005547 Ga0070693_100470622 Ga0070693_1004706221 203
385 3300005614 Ga0068856_100860372 Ga0068856_1008603721 203
386 3300005617 Ga0068859_100442615 Ga0068859_1004426152 203
387 3300005718 Ga0068866_10052173 Ga0068866_100521731 203
388 3300005842 Ga0068858_100031377 Ga0068858_1000313771 203
389 3300005842 Ga0068858_100090802 Ga0068858_1000908022 203
390 3300006847 Ga0075431_100248756 Ga0075431_1002487562 203
391 3300006852 Ga0075433_10344997 Ga0075433_103449972 203
392 3300006931 Ga0097620_100442602 Ga0097620_1004426022 203
393 3300009094 Ga0111539_10797157 Ga0111539_107971572 203
394 3300009098 Ga0105245_10183784 Ga0105245_101837842 203
395 3300009101 Ga0105247_10017506 Ga0105247_100175066 203
396 3300009147 Ga0114129_10086909 Ga0114129_100869092 203
397 3300009545 Ga0105237_10368819 Ga0105237_103688191 203
398 3300009553 Ga0105249_10315285 Ga0105249_103152852 203
399 3300009553 Ga0105249_11188251 Ga0105249_111882511 203
400 3300010375 Ga0105239_10136885 Ga0105239_101368852 203
401 3300012507 Ga0157342_1002313 Ga0157342_10023132 203
402 3300013308 Ga0157375_10114079 Ga0157375_101140792 203
403 3300013308 Ga0157375_10564642 Ga0157375_105646422 203
404 3300014968 Ga0157379_10056547 Ga0157379_100565471 203
405 3300025885 Ga0207653_10006535 Ga0207653_100065351 203
406 3300025900 Ga0207710_10064626 Ga0207710_100646262 203
407 3300025907 Ga0207645_10075195 Ga0207645_100751952 203
408 3300025919 Ga0207657_10421461 Ga0207657_104214611 203
409 3300025927 Ga0207687_10250573 Ga0207687_102505732 203
410 3300025942 Ga0207689_10752738 Ga0207689_107527381 203
411 3300025949 Ga0207667_11050626 Ga0207667_110506262 203
412 3300025961 Ga0207712_10044532 Ga0207712_100445322 203
413 3300025986 Ga0207658_10372810 Ga0207658_103728101 203
414 3300026035 Ga0207703_10010804 Ga0207703_100108046 203
415 3300026078 Ga0207702_10228686 Ga0207702_102286862 203
416 3300026089 Ga0207648_10130384 Ga0207648_101303842 203
417 3300026118 Ga0207675_100059117 Ga0207675_1000591175 203
418 3300027665 Ga0209983_1047621 Ga0209983_10476211 203
419 3300028381 Ga0268264_10014684 Ga0268264_100146844 203
420 3300035085 Ga0373929_0048702 Ga0373929_0048702_172_783 203
421 3300035092 Ga0373952_0086003 Ga0373952_0086003_92_703 203
422 3300035121 Ga0373960_0128930 Ga0373960_0128930_73_684 203
423 3300035170 Ga0373943_0249927 Ga0373943_0249927_24_635 203
424 3300035241 Ga0373961_0060423 Ga0373961_0060423_374_985 203
425 3300035242 Ga0373962_0099235 Ga0373962_0099235_259_870 203
426 3300035691 Ga0373931_0031452 Ga0373931_0031452_245_856 203
427 3300035695 Ga0373927_0006712 Ga0373927_0006712_4509_5120 203
428 3300035725 Ga0373947_0000790 Ga0373947_0000790_5250_5861 203
429 3300036401 Ga0373937_0130019 Ga0373937_0130019_891_1502 203
430 3300037068 Ga0373925_0068711 Ga0373925_0068711_2027_2638 203
431 3300046455 Ga0495603_0000441 Ga0495603_0000441_18485_19096 203
432 3300046459 Ga0495629_0000840 Ga0495629_0000840_16730_17341 203
433 3300046461 Ga0495641_0026421 Ga0495641_0026421_50_661 203
434 3300046472 Ga0495580_0001605 Ga0495580_0001605_6156_6767 203
435 3300046473 Ga0495582_0000619 Ga0495582_0000619_12464_13075 203
436 3300046475 Ga0495639_0002230 Ga0495639_0002230_6425_7036 203
437 3300046491 Ga0495584_0317218 Ga0495584_0317218_126_737 203
438 3300046499 Ga0495594_0000067 Ga0495594_0000067_10877_11488 203
439 3300046523 Ga0495644_0041488 Ga0495644_0041488_90_701 203
440 3300046526 Ga0495666_0077405 Ga0495666_0077405_718_1329 203
441 3300046531 Ga0495665_0001878 Ga0495665_0001878_113_724 203
442 3300046557 Ga0495622_0004063 Ga0495622_0004063_4779_5390 203
443 3300046615 Ga0495656_0053711 Ga0495656_0053711_264_875 203
444 3300046642 Ga0495634_0004589 Ga0495634_0004589_7063_7674 203
445 3300046663 Ga0495635_0630261 Ga0495635_0630261_71_682 203
446 3300046674 Ga0495588_0006117 Ga0495588_0006117_1547_2158 203
447 3300046681 Ga0495647_0004660 Ga0495647_0004660_502_1113 203
448 3300046683 Ga0495658_0000623 Ga0495658_0000623_7309_7920 203
449 3300046689 Ga0495613_0000306 Ga0495613_0000306_33562_34173 203
450 3300047315 Ga0495581_0000520 Ga0495581_0000520_7658_8269 203
451 3300047319 Ga0495674_0120135 Ga0495674_0120135_140_751 203
452 3300047321 Ga0495676_0068038 Ga0495676_0068038_1938_2549 203
453 3300047322 Ga0495680_0039696 Ga0495680_0039696_1021_1632 203
454 3300047445 Ga0495677_0145604 Ga0495677_0145604_272_883 203
455 3300047673 Ga0495593_0000741 Ga0495593_0000741_2346_2957 203
456 3300048089 Ga0495614_0002751 Ga0495614_0002751_3963_4574 203
457 3300048905 Ga0496102_0015978 Ga0496102_0015978_5660_6271 203
458 3300048906 Ga0496103_0009787 Ga0496103_0009787_1771_2382 203
459 3300048909 Ga0496106_0197754 Ga0496106_0197754_733_1344 203
460 3300048910 Ga0496107_0095358 Ga0496107_0095358_717_1328 203
461 3300048912 Ga0496109_0422059 Ga0496109_0422059_602_1213 203
462 3300048914 Ga0496111_0182962 Ga0496111_0182962_823_1434 203
463 3300048927 Ga0496124_0221903 Ga0496124_0221903_683_1297 203
464 3300049568 Ga0501031_0154659 Ga0501031_0154659_304_915 203
465 3300049570 Ga0501033_0334362 Ga0501033_0334362_339_950 203
466 3300049572 Ga0501036_0062494 Ga0501036_0062494_584_1195 203
467 3300049573 Ga0501037_0094802 Ga0501037_0094802_1090_1701 203
468 3300049573 Ga0501037_0436858 Ga0501037_0436858_146_757 203
469 3300049574 Ga0501038_0235436 Ga0501038_0235436_826_1437 203
470 3300049575 Ga0501039_0092905 Ga0501039_0092905_1090_1701 203
471 3300049576 Ga0501040_0160241 Ga0501040_0160241_345_956 203
472 3300049576 Ga0501040_0214608 Ga0501040_0214608_725_1336 203
473 3300049577 Ga0501041_0104099 Ga0501041_0104099_894_1505 203
474 3300049577 Ga0501041_0111852 Ga0501041_0111852_755_1366 203
475 3300049578 Ga0501042_0087311 Ga0501042_0087311_94_705 203
476 3300049579 Ga0501043_0052089 Ga0501043_0052089_101_712 203
477 3300049580 Ga0501046_0037603 Ga0501046_0037603_1321_1932 203
478 3300049582 Ga0501048_0210620 Ga0501048_0210620_613_1224 203
479 3300049584 Ga0501068_0073805 Ga0501068_0073805_492_1103 203
480 3300049587 Ga0501071_0019681 Ga0501071_0019681_3625_4236 203
481 3300049588 Ga0501072_0012631 Ga0501072_0012631_4133_4744 203
482 3300049588 Ga0501072_0033814 Ga0501072_0033814_2576_3187 203
483 3300049589 Ga0501073_0129775 Ga0501073_0129775_985_1596 203
484 3300049590 Ga0501074_0071912 Ga0501074_0071912_1747_2358 203
485 3300049591 Ga0501075_0155348 Ga0501075_0155348_631_1242 203
486 3300049592 Ga0501076_0084603 Ga0501076_0084603_346_957 203
487 3300049593 Ga0501077_0007577 Ga0501077_0007577_5344_5955 203
488 3300049593 Ga0501077_0032091 Ga0501077_0032091_2693_3304 203
489 3300049741 Ga0501079_0017035 Ga0501079_0017035_440_1051 203
490 3300049742 Ga0501080_0160984 Ga0501080_0160984_814_1425 203
491 3300049742 Ga0501080_0236155 Ga0501080_0236155_447_1058 203
492 3300049744 Ga0501083_0047990 Ga0501083_0047990_1151_1762 203
493 3300049822 Ga0501035_0132542 Ga0501035_0132542_824_1435 203
494 3300049823 Ga0501044_0936403 Ga0501044_0936403_80_691 203
495 3300049824 Ga0501045_0135424 Ga0501045_0135424_408_1019 203
496 3300049824 Ga0501045_0143113 Ga0501045_0143113_131_742 203
497 3300050507 nmdc:mga05p37_197320_c1 nmdc:mga05p37_197320_c1_352_963 203
498 3300050510 nmdc:mga06r32_577844_c1 nmdc:mga06r32_577844_c1_213_824 203
499 3300050515 nmdc:mga0a205_57553_c1 nmdc:mga0a205_57553_c1_2526_3137 203
500 3300053077 Ga0495601_0051547 Ga0495601_0051547_528_1139 203
501 3300053084 Ga0495595_0026853 Ga0495595_0026853_357_968 203
502 3300053085 Ga0495619_0014629 Ga0495619_0014629_3949_4560 203
503 3300053085 Ga0495619_0019133 Ga0495619_0019133_3211_3822 203
504 3300054114 Ga0501084_0087331 Ga0501084_0087331_1626_2237 203
505 3300054114 Ga0501084_0243763 Ga0501084_0243763_866_1477 203
506 3300060353 Ga0501082_0108400 Ga0501082_0108400_862_1473 203
507 3300060353 Ga0501082_0288996 Ga0501082_0288996_631_1242 203
508 3300061734 Ga0530510_0091899 Ga0530510_0091899_1451_2062 203
509 3300061734 Ga0530510_0412678 Ga0530510_0412678_184_828 203
510 3300001915 JGI24741J21665_1030462 JGI24741J21665_10304621 204
511 3300001977 JGI24746J21847_1019977 JGI24746J21847_10199771 204
512 3300001989 JGI24739J22299_10014798 JGI24739J22299_100147982 204
513 3300001990 JGI24737J22298_10024313 JGI24737J22298_100243132 204
514 3300001991 JGI24743J22301_10048055 JGI24743J22301_100480552 204
515 3300002067 JGI24735J21928_10042004 JGI24735J21928_100420042 204
516 3300002075 JGI24738J21930_10031365 JGI24738J21930_100313652 204
517 3300002076 JGI24749J21850_1027232 JGI24749J21850_10272321 204
518 3300002077 JGI24744J21845_10016801 JGI24744J21845_100168011 204
519 3300002239 JGI24034J26672_10037342 JGI24034J26672_100373421 204
520 3300002459 JGI24751J29686_10048208 JGI24751J29686_100482081 204
521 3300003203 JGI25406J46586_10038370 JGI25406J46586_100383702 204
522 3300003752 Ga0055539_1022387 Ga0055539_10223871 204
523 3300005290 Ga0065712_10297111 Ga0065712_102971111 204
524 3300005328 Ga0070676_10106354 Ga0070676_101063541 204
525 3300005330 Ga0070690_100000132 Ga0070690_10000013216 204
526 3300005331 Ga0070670_100019173 Ga0070670_1000191731 204
527 3300005335 Ga0070666_10005308 Ga0070666_100053082 204
528 3300005335 Ga0070666_10606610 Ga0070666_106066101 204
529 3300005336 Ga0070680_100009699 Ga0070680_1000096995 204
530 3300005337 Ga0070682_100012548 Ga0070682_1000125481 204
531 3300005337 Ga0070682_100109989 Ga0070682_1001099892 204
532 3300005338 Ga0068868_100003681 Ga0068868_1000036812 204
533 3300005339 Ga0070660_100000566 Ga0070660_10000056612 204
534 3300005340 Ga0070689_100010934 Ga0070689_1000109349 204
535 3300005340 Ga0070689_100366989 Ga0070689_1003669891 204
536 3300005341 Ga0070691_10002290 Ga0070691_100022907 204
537 3300005343 Ga0070687_100245736 Ga0070687_1002457362 204
538 3300005344 Ga0070661_100001081 Ga0070661_1000010814 204
539 3300005345 Ga0070692_10000077 Ga0070692_1000007716 204
540 3300005347 Ga0070668_100007631 Ga0070668_1000076316 204
541 3300005353 Ga0070669_100001786 Ga0070669_10000178613 204
542 3300005354 Ga0070675_100001964 Ga0070675_10000196417 204
543 3300005355 Ga0070671_100008228 Ga0070671_1000082282 204
544 3300005355 Ga0070671_100281621 Ga0070671_1002816212 204
545 3300005356 Ga0070674_100001960 Ga0070674_1000019606 204
546 3300005356 Ga0070674_100560326 Ga0070674_1005603261 204
547 3300005364 Ga0070673_100001024 Ga0070673_10000102413 204
548 3300005364 Ga0070673_100418324 Ga0070673_1004183242 204
549 3300005365 Ga0070688_100000125 Ga0070688_10000012528 204
550 3300005366 Ga0070659_100003247 Ga0070659_1000032479 204
551 3300005367 Ga0070667_100001803 Ga0070667_10000180314 204
552 3300005434 Ga0070709_10000375 Ga0070709_100003753 204
553 3300005434 Ga0070709_10001030 Ga0070709_100010305 204
554 3300005435 Ga0070714_100011184 Ga0070714_1000111842 204
555 3300005435 Ga0070714_100321708 Ga0070714_1003217081 204
556 3300005435 Ga0070714_100751108 Ga0070714_1007511081 204
557 3300005436 Ga0070713_100026017 Ga0070713_1000260175 204
558 3300005436 Ga0070713_100045651 Ga0070713_1000456512 204
559 3300005437 Ga0070710_10014142 Ga0070710_100141426 204
560 3300005437 Ga0070710_10027576 Ga0070710_100275763 204
561 3300005438 Ga0070701_10000761 Ga0070701_100007613 204
562 3300005439 Ga0070711_100000898 Ga0070711_10000089813 204
563 3300005439 Ga0070711_100438539 Ga0070711_1004385391 204
564 3300005440 Ga0070705_100001091 Ga0070705_10000109113 204
565 3300005441 Ga0070700_100026631 Ga0070700_1000266312 204
566 3300005444 Ga0070694_100002073 Ga0070694_1000020731 204
567 3300005455 Ga0070663_100093492 Ga0070663_1000934921 204
568 3300005455 Ga0070663_100104498 Ga0070663_1001044982 204
569 3300005456 Ga0070678_100000369 Ga0070678_1000003699 204
570 3300005457 Ga0070662_100028337 Ga0070662_1000283372 204
571 3300005458 Ga0070681_10055923 Ga0070681_100559232 204
572 3300005459 Ga0068867_100212339 Ga0068867_1002123392 204
573 3300005466 Ga0070685_10639340 Ga0070685_106393401 204
574 3300005468 Ga0070707_100545279 Ga0070707_1005452791 204
575 3300005530 Ga0070679_100142265 Ga0070679_1001422652 204
576 3300005535 Ga0070684_100001508 Ga0070684_10000150819 204
577 3300005535 Ga0070684_100517204 Ga0070684_1005172042 204
578 3300005536 Ga0070697_100005000 Ga0070697_1000050005 204
579 3300005539 Ga0068853_100003336 Ga0068853_1000033362 204
580 3300005539 Ga0068853_100239292 Ga0068853_1002392922 204
581 3300005539 Ga0068853_100353668 Ga0068853_1003536682 204
582 3300005543 Ga0070672_100020079 Ga0070672_1000200794 204
583 3300005544 Ga0070686_100001627 Ga0070686_1000016271 204
584 3300005545 Ga0070695_100000694 Ga0070695_10000069413 204
585 3300005546 Ga0070696_100006259 Ga0070696_1000062595 204
586 3300005546 Ga0070696_100478701 Ga0070696_1004787011 204
587 3300005547 Ga0070693_100000962 Ga0070693_1000009626 204
588 3300005548 Ga0070665_100023123 Ga0070665_1000231232 204
589 3300005548 Ga0070665_100453837 Ga0070665_1004538372 204
590 3300005549 Ga0070704_100000146 Ga0070704_10000014620 204
591 3300005563 Ga0068855_100290295 Ga0068855_1002902951 204
592 3300005564 Ga0070664_100000194 Ga0070664_10000019417 204
593 3300005577 Ga0068857_100000347 Ga0068857_10000034713 204
594 3300005578 Ga0068854_100002339 Ga0068854_1000023392 204
595 3300005614 Ga0068856_100005030 Ga0068856_10000503011 204
596 3300005615 Ga0070702_100002264 Ga0070702_10000226411 204
597 3300005615 Ga0070702_100066164 Ga0070702_1000661642 204
598 3300005616 Ga0068852_100158800 Ga0068852_1001588002 204
599 3300005617 Ga0068859_100009233 Ga0068859_10000923314 204
600 3300005617 Ga0068859_100285657 Ga0068859_1002856572 204
601 3300005618 Ga0068864_100008194 Ga0068864_1000081946 204
602 3300005618 Ga0068864_100450929 Ga0068864_1004509291 204
603 3300005718 Ga0068866_10001158 Ga0068866_100011584 204
604 3300005718 Ga0068866_10292869 Ga0068866_102928691 204
605 3300005719 Ga0068861_100003098 Ga0068861_10000309811 204
606 3300005719 Ga0068861_100036198 Ga0068861_1000361982 204
607 3300005834 Ga0068851_10012565 Ga0068851_100125652 204
608 3300005841 Ga0068863_100009936 Ga0068863_1000099366 204
609 3300005841 Ga0068863_100843405 Ga0068863_1008434051 204
610 3300005842 Ga0068858_100005670 Ga0068858_1000056702 204
611 3300005842 Ga0068858_100380904 Ga0068858_1003809042 204
612 3300005843 Ga0068860_100000411 Ga0068860_10000041129 204
613 3300005843 Ga0068860_100007100 Ga0068860_10000710016 204
614 3300005843 Ga0068860_100221871 Ga0068860_1002218712 204
615 3300005844 Ga0068862_100000967 Ga0068862_10000096714 204
616 3300005937 Ga0081455_10002674 Ga0081455_1000267412 204
617 3300005983 Ga0081540_1133943 Ga0081540_11339431 204
618 3300005985 Ga0081539_10001094 Ga0081539_1000109433 204
619 3300005985 Ga0081539_10032156 Ga0081539_100321563 204
620 3300006058 Ga0075432_10041098 Ga0075432_100410982 204
621 3300006163 Ga0070715_10000091 Ga0070715_1000009113 204
622 3300006163 Ga0070715_10165602 Ga0070715_101656022 204
623 3300006173 Ga0070716_100011336 Ga0070716_1000113363 204
624 3300006173 Ga0070716_100175226 Ga0070716_1001752262 204
625 3300006175 Ga0070712_100001007 Ga0070712_1000010076 204
626 3300006175 Ga0070712_100142395 Ga0070712_1001423952 204
627 3300006358 Ga0068871_100129675 Ga0068871_1001296752 204
628 3300006844 Ga0075428_100360956 Ga0075428_1003609562 204
629 3300006846 Ga0075430_100376934 Ga0075430_1003769342 204
630 3300006846 Ga0075430_100389731 Ga0075430_1003897312 204
631 3300006847 Ga0075431_100111480 Ga0075431_1001114802 204
632 3300006852 Ga0075433_10112477 Ga0075433_101124773 204
633 3300006871 Ga0075434_100590849 Ga0075434_1005908491 204
634 3300006881 Ga0068865_100031517 Ga0068865_1000315172 204
635 3300006881 Ga0068865_100226447 Ga0068865_1002264472 204
636 3300006914 Ga0075436_100002170 Ga0075436_10000217013 204
637 3300006931 Ga0097620_100009234 Ga0097620_10000923414 204
638 3300006931 Ga0097620_100285675 Ga0097620_1002856751 204
639 3300006941 Ga0099825_1019570 Ga0099825_10195703 204
640 3300006944 Ga0099823_1026161 Ga0099823_10261613 204
641 3300007076 Ga0075435_100133732 Ga0075435_1001337322 204
642 3300009092 Ga0105250_10006562 Ga0105250_100065627 204
643 3300009093 Ga0105240_10024137 Ga0105240_100241379 204
644 3300009093 Ga0105240_10145276 Ga0105240_101452762 204
645 3300009098 Ga0105245_10002335 Ga0105245_100023355 204
646 3300009101 Ga0105247_10001750 Ga0105247_100017503 204
647 3300009101 Ga0105247_10060649 Ga0105247_100606492 204
648 3300009101 Ga0105247_10545903 Ga0105247_105459031 204
649 3300009147 Ga0114129_10161059 Ga0114129_101610592 204
650 3300009148 Ga0105243_10005199 Ga0105243_100051991 204
651 3300009148 Ga0105243_10048819 Ga0105243_100488192 204
652 3300009174 Ga0105241_10001223 Ga0105241_100012232 204
653 3300009174 Ga0105241_10307619 Ga0105241_103076192 204
654 3300009176 Ga0105242_10001958 Ga0105242_1000195812 204
655 3300009176 Ga0105242_10158609 Ga0105242_101586091 204
656 3300009177 Ga0105248_10004605 Ga0105248_1000460517 204
657 3300009177 Ga0105248_10102427 Ga0105248_101024272 204
658 3300009545 Ga0105237_10000852 Ga0105237_1000085213 204
659 3300009545 Ga0105237_10124000 Ga0105237_101240001 204
660 3300009545 Ga0105237_10357565 Ga0105237_103575652 204
661 3300009551 Ga0105238_10086951 Ga0105238_100869512 204
662 3300009551 Ga0105238_10444815 Ga0105238_104448151 204
663 3300009553 Ga0105249_10001834 Ga0105249_1000183416 204
664 3300009553 Ga0105249_10012163 Ga0105249_100121639 204
665 3300010375 Ga0105239_10004780 Ga0105239_1000478014 204
666 3300011119 Ga0105246_10000433 Ga0105246_1000043319 204
667 3300011119 Ga0105246_10761418 Ga0105246_107614181 204
668 3300013100 Ga0157373_10011762 Ga0157373_100117625 204
669 3300013102 Ga0157371_10006258 Ga0157371_1000625811 204
670 3300013104 Ga0157370_10212000 Ga0157370_102120002 204
671 3300013105 Ga0157369_10001745 Ga0157369_100017457 204
672 3300013105 Ga0157369_10096092 Ga0157369_100960923 204
673 3300013296 Ga0157374_10059981 Ga0157374_100599814 204
674 3300013297 Ga0157378_10001283 Ga0157378_1000128313 204
675 3300013297 Ga0157378_10015568 Ga0157378_100155687 204
676 3300013297 Ga0157378_10038277 Ga0157378_100382772 204
677 3300013306 Ga0163162_10002987 Ga0163162_100029876 204
678 3300013306 Ga0163162_10027188 Ga0163162_100271882 204
679 3300013307 Ga0157372_10001332 Ga0157372_1000133217 204
680 3300013307 Ga0157372_10145389 Ga0157372_101453891 204
681 3300013308 Ga0157375_10003129 Ga0157375_100031298 204
682 3300013308 Ga0157375_10021721 Ga0157375_100217216 204
683 3300014325 Ga0163163_10004852 Ga0163163_100048524 204
684 3300014325 Ga0163163_10176903 Ga0163163_101769032 204
685 3300014326 Ga0157380_10004603 Ga0157380_100046032 204
686 3300014326 Ga0157380_10804673 Ga0157380_108046732 204
687 3300014745 Ga0157377_10010256 Ga0157377_100102562 204
688 3300014968 Ga0157379_10002584 Ga0157379_1000258413 204
689 3300014968 Ga0157379_10043870 Ga0157379_100438702 204
690 3300014969 Ga0157376_10000538 Ga0157376_100005382 204
691 3300014969 Ga0157376_10024288 Ga0157376_100242882 204
692 3300014969 Ga0157376_10036787 Ga0157376_100367872 204
693 3300017792 Ga0163161_10000490 Ga0163161_1000049026 204
694 3300020080 Ga0206350_11192583 Ga0206350_111925831 204
695 3300020081 Ga0206354_10816019 Ga0206354_108160191 204
696 3300021384 Ga0213876_10225003 Ga0213876_102250031 204
697 3300022467 Ga0224712_10150869 Ga0224712_101508691 204
698 3300025253 Ga0209677_101450 Ga0209677_1014506 204
699 3300025261 Ga0209233_1005932 Ga0209233_10059323 204
700 3300025272 Ga0209455_1001576 Ga0209455_10015768 204
701 3300025272 Ga0209455_1003672 Ga0209455_10036725 204
702 3300025297 Ga0209758_1038102 Ga0209758_10381022 204
703 3300025898 Ga0207692_10005648 Ga0207692_100056485 204
704 3300025898 Ga0207692_10007364 Ga0207692_100073642 204
705 3300025899 Ga0207642_10061365 Ga0207642_100613651 204
706 3300025899 Ga0207642_10187493 Ga0207642_101874931 204
707 3300025900 Ga0207710_10006549 Ga0207710_100065492 204
708 3300025900 Ga0207710_10084680 Ga0207710_100846801 204
709 3300025901 Ga0207688_10001250 Ga0207688_100012509 204
710 3300025903 Ga0207680_10028076 Ga0207680_100280762 204
711 3300025903 Ga0207680_10255972 Ga0207680_102559721 204
712 3300025904 Ga0207647_10003291 Ga0207647_100032912 204
713 3300025905 Ga0207685_10002881 Ga0207685_100028815 204
714 3300025906 Ga0207699_10008987 Ga0207699_100089874 204
715 3300025907 Ga0207645_10117787 Ga0207645_101177871 204
716 3300025911 Ga0207654_10029250 Ga0207654_100292502 204
717 3300025912 Ga0207707_10027159 Ga0207707_100271596 204
718 3300025913 Ga0207695_10049026 Ga0207695_100490264 204
719 3300025913 Ga0207695_10213787 Ga0207695_102137872 204
720 3300025914 Ga0207671_10011331 Ga0207671_100113311 204
721 3300025914 Ga0207671_10239771 Ga0207671_102397712 204
722 3300025914 Ga0207671_10387416 Ga0207671_103874162 204
723 3300025915 Ga0207693_10000412 Ga0207693_100004129 204
724 3300025915 Ga0207693_10047106 Ga0207693_100471064 204
725 3300025915 Ga0207693_10078258 Ga0207693_100782582 204
726 3300025916 Ga0207663_10000871 Ga0207663_100008718 204
727 3300025916 Ga0207663_10068191 Ga0207663_100681911 204
728 3300025917 Ga0207660_10006910 Ga0207660_100069105 204
729 3300025918 Ga0207662_10011701 Ga0207662_100117012 204
730 3300025919 Ga0207657_10000047 Ga0207657_1000004776 204
731 3300025920 Ga0207649_10004715 Ga0207649_100047151 204
732 3300025921 Ga0207652_10439393 Ga0207652_104393932 204
733 3300025923 Ga0207681_10017352 Ga0207681_100173521 204
734 3300025925 Ga0207650_10038148 Ga0207650_100381481 204
735 3300025926 Ga0207659_10043668 Ga0207659_100436682 204
736 3300025927 Ga0207687_10015831 Ga0207687_100158312 204
737 3300025928 Ga0207700_10089733 Ga0207700_100897333 204
738 3300025928 Ga0207700_10288808 Ga0207700_102888082 204
739 3300025928 Ga0207700_10341238 Ga0207700_103412382 204
740 3300025929 Ga0207664_10047350 Ga0207664_100473502 204
741 3300025929 Ga0207664_10456874 Ga0207664_104568741 204
742 3300025931 Ga0207644_10005779 Ga0207644_100057798 204
743 3300025932 Ga0207690_10001352 Ga0207690_1000135213 204
744 3300025933 Ga0207706_10000079 Ga0207706_1000007925 204
745 3300025934 Ga0207686_10016453 Ga0207686_100164532 204
746 3300025934 Ga0207686_10421171 Ga0207686_104211712 204
747 3300025936 Ga0207670_10120631 Ga0207670_101206312 204
748 3300025937 Ga0207669_10004194 Ga0207669_100041942 204
749 3300025938 Ga0207704_10001638 Ga0207704_100016389 204
750 3300025938 Ga0207704_10378610 Ga0207704_103786101 204
751 3300025939 Ga0207665_10000268 Ga0207665_1000026828 204
752 3300025939 Ga0207665_10059641 Ga0207665_100596413 204
753 3300025940 Ga0207691_10024140 Ga0207691_100241404 204
754 3300025940 Ga0207691_10494572 Ga0207691_104945722 204
755 3300025941 Ga0207711_10150173 Ga0207711_101501732 204
756 3300025941 Ga0207711_10180935 Ga0207711_101809352 204
757 3300025942 Ga0207689_10553071 Ga0207689_105530712 204
758 3300025944 Ga0207661_10000613 Ga0207661_100006134 204
759 3300025945 Ga0207679_10015477 Ga0207679_100154774 204
760 3300025949 Ga0207667_10016518 Ga0207667_100165185 204
761 3300025949 Ga0207667_10144695 Ga0207667_101446951 204
762 3300025960 Ga0207651_10204300 Ga0207651_102043002 204
763 3300025960 Ga0207651_10369507 Ga0207651_103695071 204
764 3300025961 Ga0207712_10003528 Ga0207712_100035282 204
765 3300025972 Ga0207668_10005573 Ga0207668_100055735 204
766 3300025981 Ga0207640_10080850 Ga0207640_100808503 204
767 3300025986 Ga0207658_10050845 Ga0207658_100508456 204
768 3300026023 Ga0207677_10446490 Ga0207677_104464902 204
769 3300026035 Ga0207703_10030237 Ga0207703_100302373 204
770 3300026035 Ga0207703_10466547 Ga0207703_104665472 204
771 3300026041 Ga0207639_10547664 Ga0207639_105476642 204
772 3300026041 Ga0207639_10769344 Ga0207639_107693441 204
773 3300026067 Ga0207678_10000392 Ga0207678_1000039232 204
774 3300026067 Ga0207678_10355197 Ga0207678_103551972 204
775 3300026075 Ga0207708_10002311 Ga0207708_1000231113 204
776 3300026078 Ga0207702_10025691 Ga0207702_100256911 204
777 3300026078 Ga0207702_10169114 Ga0207702_101691141 204
778 3300026088 Ga0207641_10004680 Ga0207641_100046807 204
779 3300026088 Ga0207641_10187007 Ga0207641_101870072 204
780 3300026088 Ga0207641_10692234 Ga0207641_106922341 204
781 3300026089 Ga0207648_10285393 Ga0207648_102853932 204
782 3300026095 Ga0207676_10036926 Ga0207676_100369262 204
783 3300026095 Ga0207676_10394568 Ga0207676_103945682 204
784 3300026116 Ga0207674_10000403 Ga0207674_1000040313 204
785 3300026118 Ga0207675_100000204 Ga0207675_1000002048 204
786 3300026118 Ga0207675_100085253 Ga0207675_1000852532 204
787 3300026121 Ga0207683_10000026 Ga0207683_1000002633 204
788 3300026142 Ga0207698_10007715 Ga0207698_100077152 204
789 3300027296 Ga0209389_1000039 Ga0209389_100003941 204
790 3300027361 Ga0209489_100087 Ga0209489_10008741 204
791 3300027363 Ga0209700_100090 Ga0209700_10009076 204
792 3300027907 Ga0207428_10058824 Ga0207428_100588241 204
793 3300028379 Ga0268266_10091186 Ga0268266_100911863 204
794 3300028380 Ga0268265_10662317 Ga0268265_106623171 204
795 3300028381 Ga0268264_10000194 Ga0268264_1000019439 204
796 3300028381 Ga0268264_10019377 Ga0268264_100193773 204
797 3300028381 Ga0268264_10799317 Ga0268264_107993171 204
798 3300028556 Ga0265337_1006579 Ga0265337_10065795 204
799 3300028558 Ga0265326_10011532 Ga0265326_100115321 204
800 3300028563 Ga0265319_1009499 Ga0265319_10094993 204
801 3300028573 Ga0265334_10001587 Ga0265334_100015874 204
802 3300028653 Ga0265323_10001598 Ga0265323_100015988 204
803 3300028666 Ga0265336_10000238 Ga0265336_100002389 204
804 3300028800 Ga0265338_10000278 Ga0265338_1000027830 204
805 3300029957 Ga0265324_10001755 Ga0265324_1000175512 204
806 3300034957 Ga0373938_0006926 Ga0373938_0006926_77_691 204
807 3300035084 Ga0373928_0033382 Ga0373928_0033382_407_1072 204
808 3300035091 Ga0373951_0054044 Ga0373951_0054044_107_721 204
809 3300035092 Ga0373952_0013064 Ga0373952_0013064_959_1573 204
810 3300035112 Ga0373932_0005443 Ga0373932_0005443_1242_1856 204
811 3300035113 Ga0373936_0046310 Ga0373936_0046310_413_1066 204
812 3300035114 Ga0373939_0002625 Ga0373939_0002625_2902_3516 204
813 3300035207 Ga0373942_0028908 Ga0373942_0028908_572_1186 204
814 3300035242 Ga0373962_0045265 Ga0373962_0045265_102_716 204
815 3300035691 Ga0373931_0005753 Ga0373931_0005753_78_692 204
816 3300035725 Ga0373947_0127839 Ga0373947_0127839_720_1334 204
817 3300037418 Ga0395900_0004457 Ga0395900_0004457_3676_4320 204
818 3300037418 Ga0395900_0026747 Ga0395900_0026747_3659_4333 204
819 3300037418 Ga0395900_0240515 Ga0395900_0240515_467_1081 204
820 3300037466 Ga0395898_0014586 Ga0395898_0014586_3772_4416 204
821 3300037466 Ga0395898_0237216 Ga0395898_0237216_449_1063 204
822 3300037466 Ga0395898_0755816 Ga0395898_0755816_180_854 204
823 3300037471 Ga0395905_0001025 Ga0395905_0001025_13562_14176 204
824 3300037471 Ga0395905_0707115 Ga0395905_0707115_209_853 204
825 3300037853 Ga0436364_1035385 Ga0436364_1035385_37_711 204
826 3300037853 Ga0436364_1124912 Ga0436364_1124912_166_831 204
827 3300038443 Ga0395901_0019998 Ga0395901_0019998_852_1466 204
828 3300038443 Ga0395901_0048529 Ga0395901_0048529_2653_3297 204
829 3300038443 Ga0395901_0176955 Ga0395901_0176955_213_887 204
830 3300039437 Ga0436365_0096215 Ga0436365_0096215_47_757 204
831 3300039437 Ga0436365_0502292 Ga0436365_0502292_1719_2384 204
832 3300039438 Ga0436360_0019834 Ga0436360_0019834_114_806 204
833 3300039447 Ga0436361_1111580 Ga0436361_1111580_46_702 204
834 3300044719 Ga0466971_0058904 Ga0466971_0058904_246_899 204
835 3300044765 Ga0466970_0075322 Ga0466970_0075322_1014_1664 204
836 3300044765 Ga0466970_0217095 Ga0466970_0217095_367_1038 204
837 3300044842 Ga0466957_0199958 Ga0466957_0199958_367_1038 204
838 3300044842 Ga0466957_0386895 Ga0466957_0386895_55_705 204
839 3300045049 Ga0466959_0136527 Ga0466959_0136527_552_1202 204
840 3300045049 Ga0466959_0271653 Ga0466959_0271653_404_1075 204
841 3300046457 Ga0495590_0047837 Ga0495590_0047837_151_765 204
842 3300046457 Ga0495590_0080154 Ga0495590_0080154_115_780 204
843 3300046477 Ga0495664_0222203 Ga0495664_0222203_440_1090 204
844 3300046491 Ga0495584_0057774 Ga0495584_0057774_144_758 204
845 3300046525 Ga0495663_0123939 Ga0495663_0123939_49_663 204
846 3300046543 Ga0495645_0001839 Ga0495645_0001839_7408_8130 204
847 3300046616 Ga0495668_0053826 Ga0495668_0053826_842_1489 204
848 3300046678 Ga0495599_0029202 Ga0495599_0029202_442_1164 204
849 3300046684 Ga0495669_0083069 Ga0495669_0083069_672_1286 204
850 3300046692 Ga0495671_0312627 Ga0495671_0312627_70_684 204
851 3300046794 Ga0495589_0116586 Ga0495589_0116586_422_1036 204
852 3300047321 Ga0495676_0264924 Ga0495676_0264924_186_800 204
853 3300048903 Ga0496100_0012548 Ga0496100_0012548_1309_1923 204
854 3300048903 Ga0496100_0039173 Ga0496100_0039173_2302_2916 204
855 3300048904 Ga0496101_0002433 Ga0496101_0002433_1344_1958 204
856 3300048904 Ga0496101_0010447 Ga0496101_0010447_193_807 204
857 3300048904 Ga0496101_0275290 Ga0496101_0275290_165_779 204
858 3300048905 Ga0496102_0011741 Ga0496102_0011741_6621_7235 204
859 3300048905 Ga0496102_0129946 Ga0496102_0129946_219_833 204
860 3300048906 Ga0496103_0092179 Ga0496103_0092179_93_707 204
861 3300048906 Ga0496103_0187751 Ga0496103_0187751_278_892 204
862 3300048907 Ga0496104_0042435 Ga0496104_0042435_242_856 204
863 3300048907 Ga0496104_0116132 Ga0496104_0116132_692_1306 204
864 3300048907 Ga0496104_0217548 Ga0496104_0217548_52_666 204
865 3300048908 Ga0496105_0003149 Ga0496105_0003149_908_1522 204
866 3300048908 Ga0496105_0048741 Ga0496105_0048741_725_1339 204
867 3300048908 Ga0496105_0337087 Ga0496105_0337087_150_764 204
868 3300048909 Ga0496106_0003556 Ga0496106_0003556_7900_8514 204
869 3300048909 Ga0496106_0032831 Ga0496106_0032831_2332_2946 204
870 3300048909 Ga0496106_0537201 Ga0496106_0537201_214_828 204
871 3300048910 Ga0496107_0039274 Ga0496107_0039274_936_1550 204
872 3300048910 Ga0496107_0057973 Ga0496107_0057973_536_1150 204
873 3300048911 Ga0496108_0191370 Ga0496108_0191370_824_1438 204
874 3300048911 Ga0496108_0196962 Ga0496108_0196962_408_1022 204
875 3300048911 Ga0496108_0587744 Ga0496108_0587744_266_880 204
876 3300048912 Ga0496109_0016963 Ga0496109_0016963_5331_5945 204
877 3300048912 Ga0496109_0031736 Ga0496109_0031736_3462_4076 204
878 3300048912 Ga0496109_1025531 Ga0496109_1025531_56_670 204
879 3300048913 Ga0496110_0055452 Ga0496110_0055452_2818_3432 204
880 3300048914 Ga0496111_0011375 Ga0496111_0011375_5160_5774 204
881 3300048915 Ga0496112_0003566 Ga0496112_0003566_4274_4888 204
882 3300048915 Ga0496112_0004157 Ga0496112_0004157_4968_5582 204
883 3300048915 Ga0496112_0005950 Ga0496112_0005950_8972_9586 204
884 3300048916 Ga0496113_0034904 Ga0496113_0034904_2652_3266 204
885 3300048917 Ga0496114_0005084 Ga0496114_0005084_42_656 204
886 3300048917 Ga0496114_0016968 Ga0496114_0016968_4084_4698 204
887 3300048917 Ga0496114_0018129 Ga0496114_0018129_917_1531 204
888 3300048918 Ga0496115_0058298 Ga0496115_0058298_889_1503 204
889 3300048918 Ga0496115_0208438 Ga0496115_0208438_593_1207 204
890 3300048920 Ga0496117_0047746 Ga0496117_0047746_816_1481 204
891 3300048920 Ga0496117_0262694 Ga0496117_0262694_204_854 204
892 3300048921 Ga0496118_0063903 Ga0496118_0063903_517_1182 204
893 3300048924 Ga0496121_0089977 Ga0496121_0089977_1269_1934 204
894 3300048924 Ga0496121_0170675 Ga0496121_0170675_713_1378 204
895 3300048927 Ga0496124_0075943 Ga0496124_0075943_138_788 204
896 3300048928 Ga0496125_0165870 Ga0496125_0165870_381_1031 204
897 3300048929 Ga0496126_0728268 Ga0496126_0728268_24_689 204
898 3300049568 Ga0501031_0019059 Ga0501031_0019059_3379_3996 204
899 3300049573 Ga0501037_0110673 Ga0501037_0110673_975_1589 204
900 3300049574 Ga0501038_0164994 Ga0501038_0164994_304_918 204
901 3300049575 Ga0501039_0055460 Ga0501039_0055460_1534_2148 204
902 3300049575 Ga0501039_0112275 Ga0501039_0112275_601_1215 204
903 3300049576 Ga0501040_0011102 Ga0501040_0011102_4220_4834 204
904 3300049576 Ga0501040_0274269 Ga0501040_0274269_168_782 204
905 3300049577 Ga0501041_0005900 Ga0501041_0005900_3813_4427 204
906 3300049577 Ga0501041_0115119 Ga0501041_0115119_479_1093 204
907 3300049577 Ga0501041_0433083 Ga0501041_0433083_130_747 204
908 3300049578 Ga0501042_0041700 Ga0501042_0041700_722_1336 204
909 3300049580 Ga0501046_0049030 Ga0501046_0049030_920_1534 204
910 3300049582 Ga0501048_0009618 Ga0501048_0009618_5793_6407 204
911 3300049582 Ga0501048_0110136 Ga0501048_0110136_998_1612 204
912 3300049582 Ga0501048_0305458 Ga0501048_0305458_231_845 204
913 3300049583 Ga0501067_0151364 Ga0501067_0151364_23_637 204
914 3300049585 Ga0501069_0236220 Ga0501069_0236220_165_779 204
915 3300049586 Ga0501070_0132022 Ga0501070_0132022_1013_1627 204
916 3300049586 Ga0501070_0266119 Ga0501070_0266119_514_1128 204
917 3300049587 Ga0501071_0072077 Ga0501071_0072077_940_1554 204
918 3300049587 Ga0501071_0087454 Ga0501071_0087454_1141_1755 204
919 3300049587 Ga0501071_0107854 Ga0501071_0107854_256_870 204
920 3300049590 Ga0501074_0185281 Ga0501074_0185281_57_671 204
921 3300049590 Ga0501074_0620765 Ga0501074_0620765_97_714 204
922 3300049591 Ga0501075_0006118 Ga0501075_0006118_6643_7257 204
923 3300049591 Ga0501075_0070921 Ga0501075_0070921_1146_1760 204
924 3300049591 Ga0501075_0281474 Ga0501075_0281474_129_743 204
925 3300049592 Ga0501076_0009092 Ga0501076_0009092_5791_6405 204
926 3300049592 Ga0501076_0465161 Ga0501076_0465161_412_1026 204
927 3300049593 Ga0501077_0160611 Ga0501077_0160611_381_995 204
928 3300049593 Ga0501077_0430334 Ga0501077_0430334_11_625 204
929 3300049741 Ga0501079_0204266 Ga0501079_0204266_133_747 204
930 3300049741 Ga0501079_0254203 Ga0501079_0254203_708_1322 204
931 3300049741 Ga0501079_0562156 Ga0501079_0562156_43_657 204
932 3300049742 Ga0501080_0269689 Ga0501080_0269689_260_874 204
933 3300049742 Ga0501080_0351603 Ga0501080_0351603_108_722 204
934 3300049743 Ga0501081_0008837 Ga0501081_0008837_1272_1886 204
935 3300049743 Ga0501081_0587723 Ga0501081_0587723_144_758 204
936 3300049822 Ga0501035_0395611 Ga0501035_0395611_76_690 204
937 3300049824 Ga0501045_0295393 Ga0501045_0295393_81_695 204
938 3300049824 Ga0501045_0656700 Ga0501045_0656700_14_628 204
939 3300050492 nmdc:mga0yw44_276743_c1 nmdc:mga0yw44_276743_c1_236_850 204
940 3300050507 nmdc:mga05p37_304832_c1 nmdc:mga05p37_304832_c1_1047_1661 204
941 3300050508 nmdc:mga09592_171162_c1 nmdc:mga09592_171162_c1_913_1527 204
942 3300050509 nmdc:mga0qj67_116450_c1 nmdc:mga0qj67_116450_c1_1408_2022 204
943 3300050510 nmdc:mga06r32_407392_c1 nmdc:mga06r32_407392_c1_263_877 204
944 3300050511 nmdc:mga08y16_197590_c1 nmdc:mga08y16_197590_c1_1060_1674 204
945 3300050512 nmdc:mga0n895_197375_c1 nmdc:mga0n895_197375_c1_231_845 204
946 3300050513 nmdc:mga0rr50_818250_c1 nmdc:mga0rr50_818250_c1_110_724 204
947 3300050514 nmdc:mga08x19_31143_c1 nmdc:mga08x19_31143_c1_282_896 204
948 3300053077 Ga0495601_0025917 Ga0495601_0025917_815_1537 204
949 3300053083 Ga0495655_0000614 Ga0495655_0000614_2824_3438 204
950 3300053136 Ga0500559_0000750 Ga0500559_0000750_16192_16842 204
951 3300053142 Ga0500577_0000750 Ga0500577_0000750_5916_6566 204
952 3300053148 Ga0500590_022856 Ga0500590_022856_617_1270 204
953 3300053150 Ga0500603_023087 Ga0500603_023087_603_1268 204
954 3300053177 Ga0500636_0016824 Ga0500636_0016824_2210_2875 204
955 3300053178 Ga0500637_0009578 Ga0500637_0009578_854_1507 204
956 3300053725 Ga0500576_097625 Ga0500576_097625_49_699 204
957 3300053737 Ga0500601_003129 Ga0500601_003129_941_1606 204
958 3300054114 Ga0501084_0010094 Ga0501084_0010094_1218_1832 204
959 3300054114 Ga0501084_0035892 Ga0501084_0035892_2120_2734 204
960 3300054114 Ga0501084_0590777 Ga0501084_0590777_188_802 204
961 3300060353 Ga0501082_0027615 Ga0501082_0027615_2860_3474 204
962 3300060353 Ga0501082_0684825 Ga0501082_0684825_87_809 204
963 3300061719 Ga0466962_0142212 Ga0466962_0142212_297_968 204
964 3300061734 Ga0530510_0106649 Ga0530510_0106649_261_875 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

56

223

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.9221 16 194
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.915 15 200
2ew0-assembly1.cif.gz_A x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1. 0.9099 15 200
2haf-assembly1.cif.gz_A crystal structure of a putative translation repressor from vibrio cholerae 0.8693 16 194
2hrx-assembly1.cif.gz_A x-ray crystal structure of protein dip2367 from corynebacterium diphtheriae. northeast structural genomics consortium target cdr13. 0.8108 16 189
ID Description Score Start End Superfamily
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9217 18 186 3.40.50.1000
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.9121 15 200 3.40.1740.10
2aj2A01 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.9096 15 194 3.40.1740.10
2ew0A00 Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like 0.907 15 200 3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9006 18 186 3.40.50.1000
ID Description Score Start End GO Terms
AF-M9Z348-F1-model_v4 Transcriptional regulator 0.9868 92 194 GO:0005829
AF-M4W589-F1-model_v4 Transcriptional regulator 0.9843 59 188 GO:0005829
AF-V9PH53-F1-model_v4 YqgE/AlgH family protein 0.9787 37 160 GO:0005829
AF-M9Z348-F1-model_v4 Transcriptional regulator 0.9775 92 194 GO:0005829
AF-V9PHC8-F1-model_v4 YqgE/AlgH family protein 0.9769 37 160 GO:0005829

Feature Viewer

pLDDT pTM Quality
82.63 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map