F486927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 351 | 952 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10001613|rootH2_1000161317 |
| Length | 267 |
| Sequence | LARRAIISRFGQKGYFYSNPFGLQDAETSWPEPIMSSKISILLVEDEENLHEALKLNLELEGYEITSAFEGTQALKAIQSEYFDLIILDVMLPGVDGISVTETIRVQNNDVPILILSAKNASADRVLGLKKGADDYLTKPFNLEELLLRIQKLIEKNKKMQEKESFGDVYSFGKNIIDFKAQEATTKDGDRIQLSKKEAMLLKLLIENRNEVVTREKILQAVWGYNVYPTTRTIDNFVLNFRKYFEEDSRHPKYFHSVRGVGYKYTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 5 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 6 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 7 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 8 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 9 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 10 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 11 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 12 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 13 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 14 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 15 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 16 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 17 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 23 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 24 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 30 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 31 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 219 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 233 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 250 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 251 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 252 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 253 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 254 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 255 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 256 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 313 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 314 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 321 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 327 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 328 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 329 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 330 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 332 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 333 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 334 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 340 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 343 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 344 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 347 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 351 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.44 |
| Metatranscriptomes | 0 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.2 |
| Nodule | 0 |
| Rhizoplane | 0.62 |
| Rhizosphere | 85.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_981202 | 2162886006 | Bacteria | 1020 |
| 2 | MRS1b_contig_3268472 | 2162886011 | Bacteria | 1165 |
| 3 | MBSR1b_contig_11128225 | 2162886012 | Bacteria | 1147 |
| 4 | MBSR1b_contig_5448556 | 2162886012 | Bacteria | 1163 |
| 5 | JGI24740J21852_10007294 | 3300001979 | Bacteria | 4504 |
| 6 | JGI24739J22299_10000030 | 3300001989 | Bacteria | 39896 |
| 7 | JGI24737J22298_10056043 | 3300001990 | Bacteria | 1191 |
| 8 | JGI25154J39366_1000023 | 3300002738 | Bacteria | 219569 |
| 9 | JGI25158J39367_1022306 | 3300002739 | Bacteria | 763 |
| 10 | JGI25157J39369_1001946 | 3300002741 | Bacteria | 6161 |
| 11 | JGI25406J46586_10001649 | 3300003203 | Bacteria | 10542 |
| 12 | JGI25153J46596_10000551 | 3300003215 | Bacteria | 23390 |
| 13 | rootH1_10084469 | 3300003316 | Bacteria | 3964 |
| 14 | rootH1_10108546 | 3300003316 | Bacteria | 7212 |
| 15 | rootH1_10108546 | 3300003323 | Unclassified | 2346 |
| 16 | rootH1_10119675 | 3300003316 | Bacteria | 1337 |
| 17 | rootH1_10189687 | 3300003316 | Bacteria | 1349 |
| 18 | rootH2_10001613 | 3300003320 | Bacteria | 20111 |
| 19 | rootH2_10001614 | 3300003320 | Bacteria | 29985 |
| 20 | rootH2_10006434 | 3300003320 | Bacteria | 3616 |
| 21 | rootH2_10023604 | 3300003320 | Bacteria | 13207 |
| 22 | rootH2_10035434 | 3300003320 | Bacteria | 17210 |
| 23 | rootL2_10003209 | 3300003322 | Bacteria | 1865 |
| 24 | rootL2_10026021 | 3300003322 | Bacteria | 20401 |
| 25 | rootL2_10109532 | 3300003322 | Bacteria | 2760 |
| 26 | rootH1_10005885 | 3300003316 | Bacteria | 2871 |
| 27 | rootH1_10005885 | 3300003323 | Bacteria | 12245 |
| 28 | rootH1_10007189 | 3300003323 | Bacteria | 65578 |
| 29 | rootH1_10069904 | 3300003323 | Bacteria | 4252 |
| 30 | rootH1_10148649 | 3300003316 | Bacteria | 2170 |
| 31 | rootH1_10148649 | 3300003323 | Bacteria | 2343 |
| 32 | rootH1_10162497 | 3300003323 | Bacteria | 1777 |
| 33 | rootH1_10174566 | 3300003323 | Bacteria | 10046 |
| 34 | rootH1_10300162 | 3300003323 | Unclassified | 2070 |
| 35 | JGI25160J50197_1000262 | 3300003354 | Bacteria | 39642 |
| 36 | JGI25160J50197_1003292 | 3300003354 | Bacteria | 7275 |
| 37 | JGI25160J50197_1005474 | 3300003354 | Bacteria | 5281 |
| 38 | JGI25160J50197_1011378 | 3300003354 | Bacteria | 3161 |
| 39 | Ga0055542_1004489 | 3300003762 | Bacteria | 3377 |
| 40 | Ga0055526_1014933 | 3300003771 | Bacteria | 3154 |
| 41 | Ga0055528_1005109 | 3300003790 | Bacteria | 6183 |
| 42 | Ga0055530_10000185 | 3300003791 | Bacteria | 55895 |
| 43 | Ga0055531_10000080 | 3300003794 | Bacteria | 103922 |
| 44 | Ga0055531_10015829 | 3300003794 | Bacteria | 3295 |
| 45 | Ga0065165_1000658 | 3300005262 | Bacteria | 49852 |
| 46 | Ga0065165_1015870 | 3300005262 | Bacteria | 2851 |
| 47 | Ga0065165_1016647 | 3300005262 | Bacteria | 2744 |
| 48 | Ga0065714_10169900 | 3300005288 | Bacteria | 1009 |
| 49 | Ga0065704_10083111 | 3300005289 | Bacteria | 3507 |
| 50 | Ga0065712_10001811 | 3300005290 | Bacteria | 7619 |
| 51 | Ga0065712_10131490 | 3300005290 | Bacteria | 1521 |
| 52 | Ga0065715_10107465 | 3300005293 | Bacteria | 2768 |
| 53 | Ga0070658_10141172 | 3300005327 | Bacteria | 2012 |
| 54 | Ga0070658_10146069 | 3300005327 | Bacteria | 1978 |
| 55 | Ga0070658_10148731 | 3300005327 | Unclassified | 1960 |
| 56 | Ga0070658_10370041 | 3300005327 | Bacteria | 1228 |
| 57 | Ga0070676_10026974 | 3300005328 | Bacteria | 3254 |
| 58 | Ga0070683_100002723 | 3300005329 | Bacteria | 14112 |
| 59 | Ga0070683_100010919 | 3300005329 | Bacteria | 7822 |
| 60 | Ga0070683_100016236 | 3300005329 | Bacteria | 6560 |
| 61 | Ga0070683_100021184 | 3300005329 | Bacteria | 5796 |
| 62 | Ga0070683_100057092 | 3300005329 | Bacteria | 3626 |
| 63 | Ga0070690_100008208 | 3300005330 | Bacteria | 6006 |
| 64 | Ga0070690_100042207 | 3300005330 | Bacteria | 2889 |
| 65 | Ga0070690_100047194 | 3300005330 | Bacteria | 2740 |
| 66 | Ga0070690_100091596 | 3300005330 | Bacteria | 2003 |
| 67 | Ga0070670_100042974 | 3300005331 | Unclassified | 3886 |
| 68 | Ga0070670_100080557 | 3300005331 | Bacteria | 2798 |
| 69 | Ga0070670_100381812 | 3300005331 | Bacteria | 1241 |
| 70 | Ga0070677_10185787 | 3300005333 | Bacteria | 993 |
| 71 | Ga0068869_100010867 | 3300005334 | Bacteria | 5954 |
| 72 | Ga0068869_100023482 | 3300005334 | Bacteria | 4260 |
| 73 | Ga0068869_100023826 | 3300005334 | Bacteria | 4234 |
| 74 | Ga0068869_100025876 | 3300005334 | Bacteria | 4079 |
| 75 | Ga0068869_100545350 | 3300005334 | Bacteria | 973 |
| 76 | Ga0070666_10018584 | 3300005335 | Bacteria | 4473 |
| 77 | Ga0070666_10019589 | 3300005335 | Bacteria | 4370 |
| 78 | Ga0070666_10022880 | 3300005335 | Bacteria | 4063 |
| 79 | Ga0070666_10071360 | 3300005335 | Bacteria | 2363 |
| 80 | Ga0070666_10094173 | 3300005335 | Bacteria | 2060 |
| 81 | Ga0070680_100009821 | 3300005336 | Bacteria | 7368 |
| 82 | Ga0070680_100034885 | 3300005336 | Bacteria | 4059 |
| 83 | Ga0070680_100062884 | 3300005336 | Bacteria | 3040 |
| 84 | Ga0070680_100230985 | 3300005336 | Bacteria | 1563 |
| 85 | Ga0070682_100002989 | 3300005337 | Bacteria | 9381 |
| 86 | Ga0070682_100008284 | 3300005337 | Bacteria | 5861 |
| 87 | Ga0070682_100070789 | 3300005337 | Bacteria | 2231 |
| 88 | Ga0068868_100008122 | 3300005338 | Bacteria | 7508 |
| 89 | Ga0068868_100030461 | 3300005338 | Bacteria | 4138 |
| 90 | Ga0068868_100050988 | 3300005338 | Bacteria | 3252 |
| 91 | Ga0068868_100148964 | 3300005338 | Bacteria | 1926 |
| 92 | Ga0068868_100163007 | 3300005338 | Bacteria | 1842 |
| 93 | Ga0070660_100001701 | 3300005339 | Bacteria | 15090 |
| 94 | Ga0070660_100020297 | 3300005339 | Bacteria | 4882 |
| 95 | Ga0070660_100153020 | 3300005339 | Bacteria | 1855 |
| 96 | Ga0070660_100162679 | 3300005339 | Bacteria | 1799 |
| 97 | Ga0070660_100222651 | 3300005339 | Bacteria | 1534 |
| 98 | Ga0070660_100364986 | 3300005339 | Bacteria | 1190 |
| 99 | Ga0070689_100083354 | 3300005340 | Bacteria | 2512 |
| 100 | Ga0070689_100092162 | 3300005340 | Bacteria | 2390 |
| 101 | Ga0070689_100166838 | 3300005340 | Bacteria | 1782 |
| 102 | Ga0070689_100215216 | 3300005340 | Bacteria | 1574 |
| 103 | Ga0070691_10014940 | 3300005341 | Bacteria | 3565 |
| 104 | Ga0070687_100002175 | 3300005343 | Bacteria | 7248 |
| 105 | Ga0070661_100010396 | 3300005344 | Bacteria | 6469 |
| 106 | Ga0070661_100036849 | 3300005344 | Bacteria | 3555 |
| 107 | Ga0070661_100169976 | 3300005344 | Bacteria | 1655 |
| 108 | Ga0070661_100196607 | 3300005344 | Unclassified | 1539 |
| 109 | Ga0070692_10141671 | 3300005345 | Unclassified | 1361 |
| 110 | Ga0070668_100038898 | 3300005347 | Bacteria | 3638 |
| 111 | Ga0070668_100084352 | 3300005347 | Bacteria | 2495 |
| 112 | Ga0070668_100445560 | 3300005347 | Bacteria | 1112 |
| 113 | Ga0070669_100001473 | 3300005353 | Bacteria | 17021 |
| 114 | Ga0070669_100002379 | 3300005353 | Bacteria | 13607 |
| 115 | Ga0070669_100232571 | 3300005353 | Bacteria | 1461 |
| 116 | Ga0070669_100330819 | 3300005353 | Bacteria | 1232 |
| 117 | Ga0070669_100365431 | 3300005353 | Bacteria | 1174 |
| 118 | Ga0070675_100002848 | 3300005354 | Bacteria | 13041 |
| 119 | Ga0070675_100031505 | 3300005354 | Bacteria | 4287 |
| 120 | Ga0070675_100073774 | 3300005354 | Bacteria | 2833 |
| 121 | Ga0070675_100147193 | 3300005354 | Bacteria | 2017 |
| 122 | Ga0070675_100170583 | 3300005354 | Bacteria | 1876 |
| 123 | Ga0070675_100174451 | 3300005354 | Bacteria | 1856 |
| 124 | Ga0070671_100139769 | 3300005355 | Unclassified | 2043 |
| 125 | Ga0070674_100028730 | 3300005356 | Bacteria | 3654 |
| 126 | Ga0070674_100111383 | 3300005356 | Bacteria | 2010 |
| 127 | Ga0070673_100016516 | 3300005364 | Bacteria | 5222 |
| 128 | Ga0070673_100032649 | 3300005364 | Bacteria | 3923 |
| 129 | Ga0070673_100056711 | 3300005364 | Bacteria | 3092 |
| 130 | Ga0070673_100188037 | 3300005364 | Bacteria | 1772 |
| 131 | Ga0070673_100206890 | 3300005364 | Bacteria | 1692 |
| 132 | Ga0070673_100231519 | 3300005364 | Bacteria | 1603 |
| 133 | Ga0070688_100014189 | 3300005365 | Bacteria | 4511 |
| 134 | Ga0070688_100032799 | 3300005365 | Bacteria | 3135 |
| 135 | Ga0070659_100020079 | 3300005366 | Bacteria | 5073 |
| 136 | Ga0070659_100039015 | 3300005366 | Bacteria | 3706 |
| 137 | Ga0070659_100069244 | 3300005366 | Bacteria | 2800 |
| 138 | Ga0070667_100021229 | 3300005367 | Bacteria | 5395 |
| 139 | Ga0070667_100105559 | 3300005367 | Bacteria | 2438 |
| 140 | Ga0070667_100124634 | 3300005367 | Bacteria | 2244 |
| 141 | Ga0070667_100175646 | 3300005367 | Bacteria | 1893 |
| 142 | Ga0070667_100197785 | 3300005367 | Bacteria | 1783 |
| 143 | Ga0070667_100531129 | 3300005367 | Bacteria | 1080 |
| 144 | Ga0070667_100620507 | 3300005367 | Bacteria | 997 |
| 145 | Ga0070714_100097141 | 3300005435 | Bacteria | 2589 |
| 146 | Ga0070713_100115595 | 3300005436 | Bacteria | 2345 |
| 147 | Ga0070701_10010862 | 3300005438 | Bacteria | 4044 |
| 148 | Ga0070700_100017034 | 3300005441 | Bacteria | 4150 |
| 149 | Ga0070663_100023838 | 3300005455 | Bacteria | 4108 |
| 150 | Ga0070663_100650154 | 3300005455 | Bacteria | 892 |
| 151 | Ga0070678_100012152 | 3300005456 | Bacteria | 5340 |
| 152 | Ga0070678_100027845 | 3300005456 | Bacteria | 3843 |
| 153 | Ga0070678_100113898 | 3300005456 | Bacteria | 2121 |
| 154 | Ga0070662_100003337 | 3300005457 | Bacteria | 10011 |
| 155 | Ga0070662_100004529 | 3300005457 | Bacteria | 8803 |
| 156 | Ga0070662_100007311 | 3300005457 | Bacteria | 7156 |
| 157 | Ga0070662_100043670 | 3300005457 | Bacteria | 3208 |
| 158 | Ga0070662_100225848 | 3300005457 | Bacteria | 1496 |
| 159 | Ga0070662_100644692 | 3300005457 | Bacteria | 893 |
| 160 | Ga0070681_10018659 | 3300005458 | Bacteria | 6937 |
| 161 | Ga0070681_10029652 | 3300005458 | Bacteria | 5494 |
| 162 | Ga0070681_10047183 | 3300005458 | Bacteria | 4306 |
| 163 | Ga0070681_10409182 | 3300005458 | Bacteria | 1268 |
| 164 | Ga0070681_10502991 | 3300005458 | Bacteria | 1125 |
| 165 | Ga0068867_100003149 | 3300005459 | Bacteria | 11633 |
| 166 | Ga0068867_100011145 | 3300005459 | Bacteria | 6342 |
| 167 | Ga0068867_100034427 | 3300005459 | Bacteria | 3671 |
| 168 | Ga0068867_100039464 | 3300005459 | Bacteria | 3442 |
| 169 | Ga0068867_100069965 | 3300005459 | Bacteria | 2622 |
| 170 | Ga0068867_100128318 | 3300005459 | Bacteria | 1968 |
| 171 | Ga0068867_100247171 | 3300005459 | Unclassified | 1449 |
| 172 | Ga0068867_100684361 | 3300005459 | Bacteria | 903 |
| 173 | Ga0070685_10005889 | 3300005466 | Bacteria | 6238 |
| 174 | Ga0070685_10057717 | 3300005466 | Bacteria | 2260 |
| 175 | Ga0070706_100160349 | 3300005467 | Bacteria | 2100 |
| 176 | Ga0070698_100072788 | 3300005471 | Bacteria | 3444 |
| 177 | Ga0070699_100744618 | 3300005518 | Bacteria | 896 |
| 178 | Ga0070679_100006985 | 3300005530 | Bacteria | 10536 |
| 179 | Ga0070679_100057085 | 3300005530 | Bacteria | 3890 |
| 180 | Ga0070679_100084362 | 3300005530 | Bacteria | 3165 |
| 181 | Ga0070679_100177700 | 3300005530 | Bacteria | 2101 |
| 182 | Ga0070684_100002319 | 3300005535 | Bacteria | 14029 |
| 183 | Ga0070684_100018469 | 3300005535 | Bacteria | 5744 |
| 184 | Ga0070684_100045790 | 3300005535 | Unclassified | 3789 |
| 185 | Ga0068853_100001650 | 3300005539 | Bacteria | 16317 |
| 186 | Ga0068853_100009686 | 3300005539 | Bacteria | 7769 |
| 187 | Ga0068853_100011889 | 3300005539 | Bacteria | 7078 |
| 188 | Ga0068853_100012660 | 3300005539 | Bacteria | 6868 |
| 189 | Ga0068853_100026641 | 3300005539 | Bacteria | 4856 |
| 190 | Ga0068853_100031274 | 3300005539 | Bacteria | 4502 |
| 191 | Ga0068853_100112140 | 3300005539 | Bacteria | 2424 |
| 192 | Ga0068853_100126287 | 3300005539 | Bacteria | 2285 |
| 193 | Ga0068853_100158738 | 3300005539 | Bacteria | 2039 |
| 194 | Ga0070672_100264670 | 3300005543 | Bacteria | 1451 |
| 195 | Ga0070672_100270528 | 3300005543 | Bacteria | 1435 |
| 196 | Ga0070686_100002348 | 3300005544 | Bacteria | 10422 |
| 197 | Ga0070693_100155375 | 3300005547 | Bacteria | 1452 |
| 198 | Ga0070693_100367100 | 3300005547 | Bacteria | 989 |
| 199 | Ga0070693_100429698 | 3300005547 | Unclassified | 922 |
| 200 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 201 | Ga0070665_100010501 | 3300005548 | Bacteria | 9368 |
| 202 | Ga0070704_100651303 | 3300005549 | Bacteria | 930 |
| 203 | Ga0068855_100001027 | 3300005563 | Bacteria | 34809 |
| 204 | Ga0068855_100010998 | 3300005563 | Bacteria | 10920 |
| 205 | Ga0068855_100022282 | 3300005563 | Bacteria | 7591 |
| 206 | Ga0068855_100044640 | 3300005563 | Bacteria | 5245 |
| 207 | Ga0068855_100066276 | 3300005563 | Bacteria | 4210 |
| 208 | Ga0068855_100087504 | 3300005563 | Bacteria | 3600 |
| 209 | Ga0068855_100090034 | 3300005563 | Bacteria | 3542 |
| 210 | Ga0068855_100115699 | 3300005563 | Bacteria | 3074 |
| 211 | Ga0068855_100128374 | 3300005563 | Bacteria | 2897 |
| 212 | Ga0068855_100133349 | 3300005563 | Bacteria | 2835 |
| 213 | Ga0068855_100553509 | 3300005563 | Unclassified | 1245 |
| 214 | Ga0070664_100005866 | 3300005564 | Bacteria | 9910 |
| 215 | Ga0070664_100020090 | 3300005564 | Bacteria | 5499 |
| 216 | Ga0070664_100154183 | 3300005564 | Bacteria | 2029 |
| 217 | Ga0070664_100211093 | 3300005564 | Bacteria | 1735 |
| 218 | Ga0070664_100304484 | 3300005564 | Bacteria | 1441 |
| 219 | Ga0068857_100009364 | 3300005577 | Bacteria | 8503 |
| 220 | Ga0068857_100025602 | 3300005577 | Bacteria | 5195 |
| 221 | Ga0068857_100043224 | 3300005577 | Bacteria | 3997 |
| 222 | Ga0068857_100140488 | 3300005577 | Bacteria | 2183 |
| 223 | Ga0068857_100215361 | 3300005577 | Bacteria | 1753 |
| 224 | Ga0068857_100224835 | 3300005577 | Bacteria | 1715 |
| 225 | Ga0068857_100627451 | 3300005577 | Unclassified | 1017 |
| 226 | Ga0068854_100005213 | 3300005578 | Bacteria | 8197 |
| 227 | Ga0068854_100023108 | 3300005578 | Bacteria | 4243 |
| 228 | Ga0068854_100024925 | 3300005578 | Bacteria | 4102 |
| 229 | Ga0068854_100202862 | 3300005578 | Bacteria | 1560 |
| 230 | Ga0068854_100295385 | 3300005578 | Bacteria | 1309 |
| 231 | Ga0068856_100029521 | 3300005614 | Bacteria | 5356 |
| 232 | Ga0068856_100195408 | 3300005614 | Bacteria | 2037 |
| 233 | Ga0068856_100394467 | 3300005614 | Bacteria | 1404 |
| 234 | Ga0070702_100012795 | 3300005615 | Bacteria | 4220 |
| 235 | Ga0068852_100001786 | 3300005616 | Bacteria | 14607 |
| 236 | Ga0068852_100013163 | 3300005616 | Bacteria | 6323 |
| 237 | Ga0068852_100027749 | 3300005616 | Bacteria | 4619 |
| 238 | Ga0068852_100032243 | 3300005616 | Bacteria | 4336 |
| 239 | Ga0068852_100039363 | 3300005616 | Unclassified | 3980 |
| 240 | Ga0068852_100053083 | 3300005616 | Bacteria | 3487 |
| 241 | Ga0068852_100183721 | 3300005616 | Bacteria | 1968 |
| 242 | Ga0068852_100331546 | 3300005616 | Bacteria | 1481 |
| 243 | Ga0068852_100464625 | 3300005616 | Bacteria | 1255 |
| 244 | Ga0068859_100001537 | 3300005617 | Bacteria | 23548 |
| 245 | Ga0068859_100052034 | 3300005617 | Bacteria | 4118 |
| 246 | Ga0068859_100057535 | 3300005617 | Bacteria | 3916 |
| 247 | Ga0068859_100065234 | 3300005617 | Bacteria | 3675 |
| 248 | Ga0068859_100206749 | 3300005617 | Bacteria | 2048 |
| 249 | Ga0068859_100402314 | 3300005617 | Unclassified | 1465 |
| 250 | Ga0068864_100327593 | 3300005618 | Unclassified | 1440 |
| 251 | Ga0068864_100554786 | 3300005618 | Bacteria | 1111 |
| 252 | Ga0068866_10089167 | 3300005718 | Bacteria | 1675 |
| 253 | Ga0068866_10205294 | 3300005718 | Bacteria | 1180 |
| 254 | Ga0068861_100005965 | 3300005719 | Bacteria | 8274 |
| 255 | Ga0068861_100142260 | 3300005719 | Bacteria | 1959 |
| 256 | Ga0068870_10015841 | 3300005840 | Bacteria | 3587 |
| 257 | Ga0068870_10238647 | 3300005840 | Bacteria | 1121 |
| 258 | Ga0068863_100030065 | 3300005841 | Bacteria | 5189 |
| 259 | Ga0068863_100249545 | 3300005841 | Bacteria | 1714 |
| 260 | Ga0068863_100327402 | 3300005841 | Bacteria | 1489 |
| 261 | Ga0068863_100363016 | 3300005841 | Bacteria | 1412 |
| 262 | Ga0068863_100424242 | 3300005841 | Unclassified | 1303 |
| 263 | Ga0068858_100043642 | 3300005842 | Bacteria | 4158 |
| 264 | Ga0068858_100069589 | 3300005842 | Bacteria | 3262 |
| 265 | Ga0068858_100081884 | 3300005842 | Bacteria | 3000 |
| 266 | Ga0068858_100184815 | 3300005842 | Bacteria | 1969 |
| 267 | Ga0068858_100478197 | 3300005842 | Bacteria | 1202 |
| 268 | Ga0068860_100000061 | 3300005843 | Bacteria | 192548 |
| 269 | Ga0068860_100012083 | 3300005843 | Bacteria | 8504 |
| 270 | Ga0068860_100020912 | 3300005843 | Bacteria | 6340 |
| 271 | Ga0068860_100061044 | 3300005843 | Bacteria | 3581 |
| 272 | Ga0068860_100096462 | 3300005843 | Bacteria | 2819 |
| 273 | Ga0068860_100103769 | 3300005843 | Bacteria | 2714 |
| 274 | Ga0068860_100122333 | 3300005843 | Bacteria | 2493 |
| 275 | Ga0068860_100142112 | 3300005843 | Bacteria | 2307 |
| 276 | Ga0068860_100165733 | 3300005843 | Bacteria | 2133 |
| 277 | Ga0068862_100003320 | 3300005844 | Bacteria | 13899 |
| 278 | Ga0068862_100127044 | 3300005844 | Bacteria | 2252 |
| 279 | Ga0068862_100185882 | 3300005844 | Bacteria | 1867 |
| 280 | Ga0068862_100207999 | 3300005844 | Bacteria | 1767 |
| 281 | Ga0068862_100238029 | 3300005844 | Bacteria | 1654 |
| 282 | Ga0068862_100693688 | 3300005844 | Bacteria | 986 |
| 283 | Ga0081540_1016808 | 3300005983 | Bacteria | 4560 |
| 284 | Ga0081539_10001169 | 3300005985 | Bacteria | 47510 |
| 285 | Ga0070712_100201394 | 3300006175 | Bacteria | 1564 |
| 286 | Ga0075366_10008445 | 3300006195 | Bacteria | 5728 |
| 287 | Ga0075366_10013810 | 3300006195 | Bacteria | 4605 |
| 288 | Ga0075366_10016298 | 3300006195 | Bacteria | 4270 |
| 289 | Ga0075366_10020526 | 3300006195 | Bacteria | 3834 |
| 290 | Ga0097621_100008140 | 3300006237 | Bacteria | 7539 |
| 291 | Ga0097621_100034071 | 3300006237 | Bacteria | 4059 |
| 292 | Ga0097621_100213347 | 3300006237 | Bacteria | 1680 |
| 293 | Ga0097621_100483174 | 3300006237 | Unclassified | 1120 |
| 294 | Ga0068871_100005800 | 3300006358 | Bacteria | 8678 |
| 295 | Ga0068871_100011294 | 3300006358 | Bacteria | 6549 |
| 296 | Ga0068871_100025524 | 3300006358 | Bacteria | 4599 |
| 297 | Ga0068871_100156605 | 3300006358 | Bacteria | 1946 |
| 298 | Ga0068871_100236567 | 3300006358 | Bacteria | 1587 |
| 299 | Ga0068871_100258495 | 3300006358 | Unclassified | 1518 |
| 300 | Ga0068871_100311914 | 3300006358 | Bacteria | 1383 |
| 301 | Ga0068871_100359685 | 3300006358 | Bacteria | 1289 |
| 302 | Ga0075430_100478339 | 3300006846 | Bacteria | 1028 |
| 303 | Ga0075429_100415624 | 3300006880 | Bacteria | 1178 |
| 304 | Ga0068865_100014376 | 3300006881 | Bacteria | 5028 |
| 305 | Ga0068865_100054058 | 3300006881 | Unclassified | 2788 |
| 306 | Ga0068865_100174859 | 3300006881 | Bacteria | 1649 |
| 307 | Ga0097620_100001537 | 3300006931 | Bacteria | 23548 |
| 308 | Ga0097620_100052035 | 3300006931 | Bacteria | 4118 |
| 309 | Ga0097620_100057538 | 3300006931 | Bacteria | 3916 |
| 310 | Ga0097620_100065241 | 3300006931 | Bacteria | 3675 |
| 311 | Ga0097620_100206762 | 3300006931 | Bacteria | 2048 |
| 312 | Ga0097620_100312077 | 3300006931 | Bacteria | 1666 |
| 313 | Ga0097620_100402270 | 3300006931 | Unclassified | 1465 |
| 314 | Ga0105240_10000800 | 3300009093 | Bacteria | 56989 |
| 315 | Ga0105240_10001787 | 3300009093 | Bacteria | 36277 |
| 316 | Ga0105240_10001808 | 3300009093 | Bacteria | 36002 |
| 317 | Ga0105240_10004358 | 3300009093 | Bacteria | 21601 |
| 318 | Ga0105240_10029970 | 3300009093 | Bacteria | 7078 |
| 319 | Ga0105240_10067649 | 3300009093 | Bacteria | 4428 |
| 320 | Ga0105240_10300854 | 3300009093 | Bacteria | 1835 |
| 321 | Ga0105240_10705280 | 3300009093 | Bacteria | 1101 |
| 322 | Ga0105240_10817748 | 3300009093 | Bacteria | 1008 |
| 323 | Ga0105240_11022734 | 3300009093 | Bacteria | 883 |
| 324 | Ga0111539_10005159 | 3300009094 | Bacteria | 16933 |
| 325 | Ga0111539_10011279 | 3300009094 | Bacteria | 11226 |
| 326 | Ga0111539_10103371 | 3300009094 | Bacteria | 3344 |
| 327 | Ga0105247_10000312 | 3300009101 | Bacteria | 43730 |
| 328 | Ga0105247_10047668 | 3300009101 | Bacteria | 2632 |
| 329 | Ga0105243_10082441 | 3300009148 | Bacteria | 2628 |
| 330 | Ga0105241_10000608 | 3300009174 | Bacteria | 26997 |
| 331 | Ga0105241_10007179 | 3300009174 | Bacteria | 8200 |
| 332 | Ga0105241_10040180 | 3300009174 | Bacteria | 3531 |
| 333 | Ga0105241_10143104 | 3300009174 | Bacteria | 1949 |
| 334 | Ga0105241_10343175 | 3300009174 | Bacteria | 1294 |
| 335 | Ga0105241_10576960 | 3300009174 | Bacteria | 1013 |
| 336 | Ga0105241_10981968 | 3300009174 | Bacteria | 789 |
| 337 | Ga0105241_11033057 | 3300009174 | Bacteria | 770 |
| 338 | Ga0105242_10023950 | 3300009176 | Bacteria | 4817 |
| 339 | Ga0105242_10027545 | 3300009176 | Bacteria | 4514 |
| 340 | Ga0105242_10135198 | 3300009176 | Bacteria | 2133 |
| 341 | Ga0105242_10173117 | 3300009176 | Unclassified | 1899 |
| 342 | Ga0105242_10268998 | 3300009176 | Bacteria | 1543 |
| 343 | Ga0105242_10297728 | 3300009176 | Bacteria | 1471 |
| 344 | Ga0105242_10444777 | 3300009176 | Bacteria | 1220 |
| 345 | Ga0105248_10192276 | 3300009177 | Bacteria | 2299 |
| 346 | Ga0105248_11468427 | 3300009177 | Bacteria | 772 |
| 347 | Ga0105237_10001055 | 3300009545 | Bacteria | 37018 |
| 348 | Ga0105237_10005526 | 3300009545 | Bacteria | 14250 |
| 349 | Ga0105237_10006018 | 3300009545 | Bacteria | 13573 |
| 350 | Ga0105237_10006998 | 3300009545 | Bacteria | 12429 |
| 351 | Ga0105237_10007301 | 3300009545 | Bacteria | 12120 |
| 352 | Ga0105237_10011542 | 3300009545 | Bacteria | 9343 |
| 353 | Ga0105237_10017111 | 3300009545 | Bacteria | 7521 |
| 354 | Ga0105237_10207088 | 3300009545 | Bacteria | 1962 |
| 355 | Ga0105237_10446460 | 3300009545 | Bacteria | 1299 |
| 356 | Ga0105237_10665885 | 3300009545 | Bacteria | 1048 |
| 357 | Ga0105238_10000592 | 3300009551 | Bacteria | 38095 |
| 358 | Ga0105238_10092053 | 3300009551 | Bacteria | 3019 |
| 359 | Ga0105238_10159963 | 3300009551 | Bacteria | 2227 |
| 360 | Ga0105238_10651836 | 3300009551 | Bacteria | 1063 |
| 361 | Ga0105249_10010102 | 3300009553 | Bacteria | 8286 |
| 362 | Ga0105249_10013950 | 3300009553 | Bacteria | 7102 |
| 363 | Ga0105249_10017890 | 3300009553 | Bacteria | 6298 |
| 364 | Ga0105249_10044259 | 3300009553 | Bacteria | 4048 |
| 365 | Ga0105249_10351052 | 3300009553 | Bacteria | 1494 |
| 366 | Ga0105249_10820063 | 3300009553 | Bacteria | 995 |
| 367 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 368 | Ga0105239_10001405 | 3300010375 | Bacteria | 32195 |
| 369 | Ga0105239_10004672 | 3300010375 | Bacteria | 16278 |
| 370 | Ga0105239_10013173 | 3300010375 | Bacteria | 9189 |
| 371 | Ga0105239_10027401 | 3300010375 | Bacteria | 6272 |
| 372 | Ga0105239_10131992 | 3300010375 | Bacteria | 2779 |
| 373 | Ga0105239_10234930 | 3300010375 | Bacteria | 2057 |
| 374 | Ga0105239_10248630 | 3300010375 | Bacteria | 1997 |
| 375 | Ga0105239_10346502 | 3300010375 | Bacteria | 1677 |
| 376 | Ga0105239_10398219 | 3300010375 | Bacteria | 1558 |
| 377 | Ga0105239_10435887 | 3300010375 | Bacteria | 1485 |
| 378 | Ga0105246_10123991 | 3300011119 | Bacteria | 1919 |
| 379 | Ga0105246_10162933 | 3300011119 | Bacteria | 1700 |
| 380 | Ga0157373_10000927 | 3300013100 | Bacteria | 22674 |
| 381 | Ga0157373_10003672 | 3300013100 | Bacteria | 11604 |
| 382 | Ga0157373_10008630 | 3300013100 | Bacteria | 7563 |
| 383 | Ga0157373_10031894 | 3300013100 | Bacteria | 3795 |
| 384 | Ga0157373_10145917 | 3300013100 | Bacteria | 1664 |
| 385 | Ga0157373_10187209 | 3300013100 | Bacteria | 1458 |
| 386 | Ga0157371_10000218 | 3300013102 | Bacteria | 83919 |
| 387 | Ga0157371_10005551 | 3300013102 | Bacteria | 10609 |
| 388 | Ga0157371_10005559 | 3300013102 | Bacteria | 10598 |
| 389 | Ga0157371_10009581 | 3300013102 | Bacteria | 7618 |
| 390 | Ga0157371_10010719 | 3300013102 | Bacteria | 7118 |
| 391 | Ga0157371_10014278 | 3300013102 | Bacteria | 6000 |
| 392 | Ga0157371_10040978 | 3300013102 | Bacteria | 3306 |
| 393 | Ga0157371_10081734 | 3300013102 | Bacteria | 2287 |
| 394 | Ga0157371_10096881 | 3300013102 | Bacteria | 2091 |
| 395 | Ga0157371_10112231 | 3300013102 | Bacteria | 1935 |
| 396 | Ga0157371_10176975 | 3300013102 | Bacteria | 1525 |
| 397 | Ga0157370_10001029 | 3300013104 | Bacteria | 35080 |
| 398 | Ga0157370_10003402 | 3300013104 | Bacteria | 18690 |
| 399 | Ga0157370_10018211 | 3300013104 | Bacteria | 7067 |
| 400 | Ga0157370_10060865 | 3300013104 | Bacteria | 3584 |
| 401 | Ga0157370_10465930 | 3300013104 | Bacteria | 1161 |
| 402 | Ga0157369_10009590 | 3300013105 | Bacteria | 11070 |
| 403 | Ga0157369_10010400 | 3300013105 | Bacteria | 10605 |
| 404 | Ga0157369_10025346 | 3300013105 | Bacteria | 6584 |
| 405 | Ga0157369_10034211 | 3300013105 | Bacteria | 5579 |
| 406 | Ga0157369_10059094 | 3300013105 | Bacteria | 4135 |
| 407 | Ga0157369_10101397 | 3300013105 | Bacteria | 3067 |
| 408 | Ga0157369_10188622 | 3300013105 | Bacteria | 2167 |
| 409 | Ga0157369_10216187 | 3300013105 | Bacteria | 2008 |
| 410 | Ga0157369_10473626 | 3300013105 | Bacteria | 1296 |
| 411 | Ga0157369_10868613 | 3300013105 | Bacteria | 926 |
| 412 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 413 | Ga0157374_10025078 | 3300013296 | Bacteria | 5350 |
| 414 | Ga0157374_10033168 | 3300013296 | Bacteria | 4710 |
| 415 | Ga0157374_10038891 | 3300013296 | Bacteria | 4375 |
| 416 | Ga0157374_10042729 | 3300013296 | Bacteria | 4182 |
| 417 | Ga0157374_10107601 | 3300013296 | Bacteria | 2680 |
| 418 | Ga0157374_10152419 | 3300013296 | Bacteria | 2248 |
| 419 | Ga0157374_10165790 | 3300013296 | Unclassified | 2153 |
| 420 | Ga0157374_10221176 | 3300013296 | Bacteria | 1858 |
| 421 | Ga0157378_10005523 | 3300013297 | Bacteria | 11078 |
| 422 | Ga0157378_10027293 | 3300013297 | Bacteria | 5039 |
| 423 | Ga0157378_10037242 | 3300013297 | Bacteria | 4308 |
| 424 | Ga0157378_10062778 | 3300013297 | Bacteria | 3318 |
| 425 | Ga0157378_10142475 | 3300013297 | Unclassified | 2227 |
| 426 | Ga0157378_10159054 | 3300013297 | Bacteria | 2111 |
| 427 | Ga0157378_10268770 | 3300013297 | Bacteria | 1639 |
| 428 | Ga0157378_10398812 | 3300013297 | Bacteria | 1355 |
| 429 | Ga0157378_11105649 | 3300013297 | Bacteria | 830 |
| 430 | Ga0163162_10000131 | 3300013306 | Bacteria | 67924 |
| 431 | Ga0163162_10004708 | 3300013306 | Bacteria | 13154 |
| 432 | Ga0163162_10005290 | 3300013306 | Bacteria | 12454 |
| 433 | Ga0163162_10038605 | 3300013306 | Bacteria | 4766 |
| 434 | Ga0163162_10039779 | 3300013306 | Bacteria | 4699 |
| 435 | Ga0163162_10061753 | 3300013306 | Bacteria | 3785 |
| 436 | Ga0163162_10073172 | 3300013306 | Bacteria | 3483 |
| 437 | Ga0163162_10104996 | 3300013306 | Bacteria | 2920 |
| 438 | Ga0163162_10131408 | 3300013306 | Bacteria | 2612 |
| 439 | Ga0163162_10137584 | 3300013306 | Bacteria | 2554 |
| 440 | Ga0163162_10151565 | 3300013306 | Bacteria | 2437 |
| 441 | Ga0163162_10213432 | 3300013306 | Bacteria | 2060 |
| 442 | Ga0163162_10616528 | 3300013306 | Bacteria | 1210 |
| 443 | Ga0157372_10002419 | 3300013307 | Bacteria | 20209 |
| 444 | Ga0157372_10003581 | 3300013307 | Bacteria | 16712 |
| 445 | Ga0157372_10007454 | 3300013307 | Bacteria | 11637 |
| 446 | Ga0157372_10010103 | 3300013307 | Bacteria | 10026 |
| 447 | Ga0157372_10012118 | 3300013307 | Bacteria | 9184 |
| 448 | Ga0157372_10028193 | 3300013307 | Bacteria | 6127 |
| 449 | Ga0157372_10031379 | 3300013307 | Bacteria | 5818 |
| 450 | Ga0157372_10047349 | 3300013307 | Bacteria | 4778 |
| 451 | Ga0157372_10104492 | 3300013307 | Bacteria | 3238 |
| 452 | Ga0157372_10121312 | 3300013307 | Bacteria | 3003 |
| 453 | Ga0157372_10142033 | 3300013307 | Bacteria | 2767 |
| 454 | Ga0157372_10213475 | 3300013307 | Bacteria | 2236 |
| 455 | Ga0157372_10351612 | 3300013307 | Unclassified | 1717 |
| 456 | Ga0157372_10417051 | 3300013307 | Bacteria | 1564 |
| 457 | Ga0157372_10489888 | 3300013307 | Bacteria | 1433 |
| 458 | Ga0157372_10617596 | 3300013307 | Bacteria | 1263 |
| 459 | Ga0157372_10728386 | 3300013307 | Bacteria | 1153 |
| 460 | Ga0157372_10747771 | 3300013307 | Bacteria | 1137 |
| 461 | Ga0157375_10017033 | 3300013308 | Bacteria | 6547 |
| 462 | Ga0157375_10020278 | 3300013308 | Bacteria | 6068 |
| 463 | Ga0157375_10022629 | 3300013308 | Bacteria | 5786 |
| 464 | Ga0157375_10041404 | 3300013308 | Bacteria | 4448 |
| 465 | Ga0157375_10067495 | 3300013308 | Bacteria | 3574 |
| 466 | Ga0157375_10104801 | 3300013308 | Bacteria | 2917 |
| 467 | Ga0157375_10546896 | 3300013308 | Bacteria | 1320 |
| 468 | Ga0157375_10700957 | 3300013308 | Bacteria | 1166 |
| 469 | Ga0157375_11090716 | 3300013308 | Bacteria | 934 |
| 470 | Ga0163163_10000368 | 3300014325 | Bacteria | 43257 |
| 471 | Ga0163163_10000591 | 3300014325 | Bacteria | 31919 |
| 472 | Ga0163163_10002613 | 3300014325 | Bacteria | 15252 |
| 473 | Ga0163163_10035392 | 3300014325 | Bacteria | 4843 |
| 474 | Ga0163163_10520060 | 3300014325 | Bacteria | 1252 |
| 475 | Ga0163163_10993533 | 3300014325 | Bacteria | 902 |
| 476 | Ga0157380_10001169 | 3300014326 | Bacteria | 17017 |
| 477 | Ga0157380_10013173 | 3300014326 | Bacteria | 6022 |
| 478 | Ga0157380_10172186 | 3300014326 | Bacteria | 1893 |
| 479 | Ga0157380_10245907 | 3300014326 | Bacteria | 1616 |
| 480 | Ga0157380_10346062 | 3300014326 | Bacteria | 1389 |
| 481 | Ga0157377_10000583 | 3300014745 | Bacteria | 15210 |
| 482 | Ga0157377_10010639 | 3300014745 | Bacteria | 4559 |
| 483 | Ga0157377_10042633 | 3300014745 | Bacteria | 2521 |
| 484 | Ga0157377_10068561 | 3300014745 | Bacteria | 2044 |
| 485 | Ga0157377_10104123 | 3300014745 | Bacteria | 1696 |
| 486 | Ga0157377_10279978 | 3300014745 | Bacteria | 1093 |
| 487 | Ga0157379_10065726 | 3300014968 | Bacteria | 3242 |
| 488 | Ga0157379_10115111 | 3300014968 | Unclassified | 2418 |
| 489 | Ga0157379_10178514 | 3300014968 | Bacteria | 1918 |
| 490 | Ga0157379_10301294 | 3300014968 | Bacteria | 1461 |
| 491 | Ga0157379_10319530 | 3300014968 | Bacteria | 1417 |
| 492 | Ga0157379_10352364 | 3300014968 | Bacteria | 1348 |
| 493 | Ga0157376_10007481 | 3300014969 | Bacteria | 7803 |
| 494 | Ga0157376_10071819 | 3300014969 | Bacteria | 2943 |
| 495 | Ga0157376_10144156 | 3300014969 | Bacteria | 2140 |
| 496 | Ga0157376_10212351 | 3300014969 | Unclassified | 1787 |
| 497 | Ga0182005_1000347 | 3300015265 | Bacteria | 26332 |
| 498 | Ga0163161_10014248 | 3300017792 | Bacteria | 5536 |
| 499 | Ga0163161_10061547 | 3300017792 | Bacteria | 2733 |
| 500 | Ga0163161_10210465 | 3300017792 | Bacteria | 1502 |
| 501 | Ga0163161_10832109 | 3300017792 | Bacteria | 778 |
| 502 | Ga0209436_100381 | 3300025208 | Bacteria | 20022 |
| 503 | Ga0209436_105597 | 3300025208 | Bacteria | 2862 |
| 504 | Ga0209258_100116 | 3300025242 | Bacteria | 190317 |
| 505 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 506 | Ga0209026_1000136 | 3300025250 | Bacteria | 116507 |
| 507 | Ga0209148_1000175 | 3300025254 | Bacteria | 129536 |
| 508 | Ga0209129_1013267 | 3300025258 | Bacteria | 1825 |
| 509 | Ga0209673_1000203 | 3300025273 | Bacteria | 119623 |
| 510 | Ga0209130_1001665 | 3300025284 | Bacteria | 13575 |
| 511 | Ga0209564_1029275 | 3300025295 | Bacteria | 1737 |
| 512 | Ga0209758_1003355 | 3300025297 | Bacteria | 14686 |
| 513 | Ga0209758_1035284 | 3300025297 | Bacteria | 1973 |
| 514 | Ga0209050_1000276 | 3300025298 | Bacteria | 109997 |
| 515 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 516 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 517 | Ga0207426_1000957 | 3300025302 | Bacteria | 28456 |
| 518 | Ga0207426_1001807 | 3300025302 | Bacteria | 15872 |
| 519 | Ga0207426_1004921 | 3300025302 | Bacteria | 6304 |
| 520 | Ga0209051_1028556 | 3300025303 | Bacteria | 2201 |
| 521 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 522 | Ga0209257_1000736 | 3300025304 | Bacteria | 49668 |
| 523 | Ga0207697_10014327 | 3300025315 | Bacteria | 3289 |
| 524 | Ga0207642_10066117 | 3300025899 | Bacteria | 1701 |
| 525 | Ga0207642_10128593 | 3300025899 | Bacteria | 1318 |
| 526 | Ga0207710_10003454 | 3300025900 | Bacteria | 7040 |
| 527 | Ga0207688_10014553 | 3300025901 | Bacteria | 4274 |
| 528 | Ga0207680_10059167 | 3300025903 | Bacteria | 2326 |
| 529 | Ga0207680_10065274 | 3300025903 | Bacteria | 2234 |
| 530 | Ga0207680_10078434 | 3300025903 | Unclassified | 2068 |
| 531 | Ga0207680_10087851 | 3300025903 | Bacteria | 1969 |
| 532 | Ga0207647_10012067 | 3300025904 | Bacteria | 6031 |
| 533 | Ga0207647_10015325 | 3300025904 | Bacteria | 5259 |
| 534 | Ga0207647_10067803 | 3300025904 | Bacteria | 2161 |
| 535 | Ga0207647_10133698 | 3300025904 | Bacteria | 1456 |
| 536 | Ga0207647_10174232 | 3300025904 | Bacteria | 1252 |
| 537 | Ga0207685_10046005 | 3300025905 | Bacteria | 1658 |
| 538 | Ga0207685_10070455 | 3300025905 | Bacteria | 1415 |
| 539 | Ga0207645_10002259 | 3300025907 | Bacteria | 15319 |
| 540 | Ga0207645_10045080 | 3300025907 | Bacteria | 2819 |
| 541 | Ga0207645_10233734 | 3300025907 | Bacteria | 1214 |
| 542 | Ga0207643_10001726 | 3300025908 | Bacteria | 12257 |
| 543 | Ga0207643_10002959 | 3300025908 | Bacteria | 9169 |
| 544 | Ga0207705_10016061 | 3300025909 | Bacteria | 5374 |
| 545 | Ga0207705_10048638 | 3300025909 | Bacteria | 3050 |
| 546 | Ga0207705_10603120 | 3300025909 | Bacteria | 854 |
| 547 | Ga0207654_10006600 | 3300025911 | Bacteria | 5833 |
| 548 | Ga0207654_10011213 | 3300025911 | Bacteria | 4567 |
| 549 | Ga0207654_10178152 | 3300025911 | Bacteria | 1385 |
| 550 | Ga0207707_10021785 | 3300025912 | Bacteria | 5601 |
| 551 | Ga0207707_10031463 | 3300025912 | Bacteria | 4643 |
| 552 | Ga0207707_10064134 | 3300025912 | Bacteria | 3198 |
| 553 | Ga0207707_10477892 | 3300025912 | Bacteria | 1065 |
| 554 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 555 | Ga0207695_10000863 | 3300025913 | Bacteria | 55452 |
| 556 | Ga0207695_10001230 | 3300025913 | Bacteria | 43841 |
| 557 | Ga0207695_10001645 | 3300025913 | Bacteria | 35984 |
| 558 | Ga0207695_10016157 | 3300025913 | Bacteria | 8752 |
| 559 | Ga0207695_10016635 | 3300025913 | Bacteria | 8597 |
| 560 | Ga0207695_10044762 | 3300025913 | Bacteria | 4704 |
| 561 | Ga0207695_10052763 | 3300025913 | Bacteria | 4257 |
| 562 | Ga0207695_10092647 | 3300025913 | Bacteria | 3032 |
| 563 | Ga0207671_10000311 | 3300025914 | Bacteria | 71753 |
| 564 | Ga0207671_10000931 | 3300025914 | Bacteria | 36651 |
| 565 | Ga0207671_10004520 | 3300025914 | Bacteria | 13223 |
| 566 | Ga0207671_10071468 | 3300025914 | Bacteria | 2588 |
| 567 | Ga0207671_10128850 | 3300025914 | Bacteria | 1941 |
| 568 | Ga0207671_10194419 | 3300025914 | Bacteria | 1582 |
| 569 | Ga0207671_10282927 | 3300025914 | Bacteria | 1308 |
| 570 | Ga0207671_10285284 | 3300025914 | Bacteria | 1303 |
| 571 | Ga0207660_10011620 | 3300025917 | Bacteria | 5740 |
| 572 | Ga0207660_10147988 | 3300025917 | Bacteria | 1802 |
| 573 | Ga0207660_10159791 | 3300025917 | Bacteria | 1738 |
| 574 | Ga0207662_10150672 | 3300025918 | Bacteria | 1479 |
| 575 | Ga0207657_10004301 | 3300025919 | Bacteria | 15090 |
| 576 | Ga0207657_10004450 | 3300025919 | Bacteria | 14828 |
| 577 | Ga0207657_10013194 | 3300025919 | Bacteria | 8113 |
| 578 | Ga0207657_10055721 | 3300025919 | Bacteria | 3413 |
| 579 | Ga0207657_10062275 | 3300025919 | Bacteria | 3195 |
| 580 | Ga0207657_10195260 | 3300025919 | Bacteria | 1631 |
| 581 | Ga0207657_10218906 | 3300025919 | Bacteria | 1526 |
| 582 | Ga0207649_10009764 | 3300025920 | Bacteria | 5257 |
| 583 | Ga0207649_10024760 | 3300025920 | Bacteria | 3492 |
| 584 | Ga0207652_10015279 | 3300025921 | Bacteria | 6232 |
| 585 | Ga0207652_10024919 | 3300025921 | Bacteria | 4967 |
| 586 | Ga0207652_10050800 | 3300025921 | Bacteria | 3553 |
| 587 | Ga0207652_10098398 | 3300025921 | Bacteria | 2580 |
| 588 | Ga0207681_10005188 | 3300025923 | Bacteria | 8000 |
| 589 | Ga0207681_10151369 | 3300025923 | Bacteria | 1739 |
| 590 | Ga0207681_10220221 | 3300025923 | Bacteria | 1468 |
| 591 | Ga0207681_10305519 | 3300025923 | Bacteria | 1260 |
| 592 | Ga0207681_10390928 | 3300025923 | Bacteria | 1121 |
| 593 | Ga0207681_10570078 | 3300025923 | Bacteria | 933 |
| 594 | Ga0207694_10031984 | 3300025924 | Bacteria | 4023 |
| 595 | Ga0207694_10048275 | 3300025924 | Bacteria | 3294 |
| 596 | Ga0207694_10048733 | 3300025924 | Bacteria | 3278 |
| 597 | Ga0207694_10141674 | 3300025924 | Bacteria | 1934 |
| 598 | Ga0207650_10008659 | 3300025925 | Bacteria | 6950 |
| 599 | Ga0207650_10355213 | 3300025925 | Bacteria | 1206 |
| 600 | Ga0207650_10601117 | 3300025925 | Unclassified | 925 |
| 601 | Ga0207650_10692301 | 3300025925 | Bacteria | 861 |
| 602 | Ga0207659_10035016 | 3300025926 | Bacteria | 3467 |
| 603 | Ga0207659_10073350 | 3300025926 | Bacteria | 2506 |
| 604 | Ga0207659_10080311 | 3300025926 | Unclassified | 2409 |
| 605 | Ga0207700_10683205 | 3300025928 | Bacteria | 916 |
| 606 | Ga0207664_10259690 | 3300025929 | Bacteria | 1519 |
| 607 | Ga0207644_10215706 | 3300025931 | Unclassified | 1519 |
| 608 | Ga0207690_10037538 | 3300025932 | Bacteria | 3146 |
| 609 | Ga0207690_10042491 | 3300025932 | Bacteria | 2986 |
| 610 | Ga0207690_10152754 | 3300025932 | Bacteria | 1713 |
| 611 | Ga0207706_10010112 | 3300025933 | Bacteria | 8639 |
| 612 | Ga0207706_10012685 | 3300025933 | Bacteria | 7670 |
| 613 | Ga0207706_10014218 | 3300025933 | Bacteria | 7215 |
| 614 | Ga0207706_10027202 | 3300025933 | Bacteria | 5115 |
| 615 | Ga0207706_10047628 | 3300025933 | Bacteria | 3792 |
| 616 | Ga0207706_10061401 | 3300025933 | Bacteria | 3309 |
| 617 | Ga0207706_10110337 | 3300025933 | Bacteria | 2420 |
| 618 | Ga0207706_10135341 | 3300025933 | Bacteria | 2168 |
| 619 | Ga0207686_10079691 | 3300025934 | Bacteria | 2133 |
| 620 | Ga0207686_10160542 | 3300025934 | Bacteria | 1575 |
| 621 | Ga0207670_10004555 | 3300025936 | Bacteria | 7485 |
| 622 | Ga0207670_10017672 | 3300025936 | Bacteria | 4314 |
| 623 | Ga0207670_10067853 | 3300025936 | Bacteria | 2455 |
| 624 | Ga0207669_10049990 | 3300025937 | Bacteria | 2496 |
| 625 | Ga0207669_10087744 | 3300025937 | Bacteria | 2016 |
| 626 | Ga0207669_10202361 | 3300025937 | Bacteria | 1442 |
| 627 | Ga0207704_10068555 | 3300025938 | Unclassified | 2237 |
| 628 | Ga0207704_10291008 | 3300025938 | Bacteria | 1246 |
| 629 | Ga0207691_10021958 | 3300025940 | Bacteria | 6023 |
| 630 | Ga0207691_10041817 | 3300025940 | Bacteria | 4228 |
| 631 | Ga0207691_10085172 | 3300025940 | Bacteria | 2837 |
| 632 | Ga0207691_10146521 | 3300025940 | Bacteria | 2078 |
| 633 | Ga0207689_10002915 | 3300025942 | Bacteria | 15788 |
| 634 | Ga0207689_10007600 | 3300025942 | Bacteria | 9495 |
| 635 | Ga0207689_10031405 | 3300025942 | Bacteria | 4422 |
| 636 | Ga0207689_10074508 | 3300025942 | Bacteria | 2789 |
| 637 | Ga0207689_10133923 | 3300025942 | Bacteria | 2040 |
| 638 | Ga0207661_10002997 | 3300025944 | Bacteria | 11677 |
| 639 | Ga0207661_10023607 | 3300025944 | Bacteria | 4649 |
| 640 | Ga0207661_10129311 | 3300025944 | Bacteria | 2161 |
| 641 | Ga0207661_10132054 | 3300025944 | Bacteria | 2140 |
| 642 | Ga0207661_10152979 | 3300025944 | Bacteria | 1995 |
| 643 | Ga0207679_10002990 | 3300025945 | Bacteria | 10485 |
| 644 | Ga0207679_10051676 | 3300025945 | Bacteria | 3010 |
| 645 | Ga0207679_10090875 | 3300025945 | Bacteria | 2361 |
| 646 | Ga0207679_10137024 | 3300025945 | Bacteria | 1972 |
| 647 | Ga0207679_10281133 | 3300025945 | Bacteria | 1427 |
| 648 | Ga0207667_10000098 | 3300025949 | Bacteria | 140051 |
| 649 | Ga0207667_10000279 | 3300025949 | Bacteria | 70460 |
| 650 | Ga0207667_10004113 | 3300025949 | Bacteria | 17874 |
| 651 | Ga0207667_10015607 | 3300025949 | Bacteria | 8616 |
| 652 | Ga0207667_10036738 | 3300025949 | Bacteria | 5246 |
| 653 | Ga0207667_10067886 | 3300025949 | Bacteria | 3714 |
| 654 | Ga0207667_10092444 | 3300025949 | Bacteria | 3124 |
| 655 | Ga0207667_10153360 | 3300025949 | Bacteria | 2370 |
| 656 | Ga0207667_10304291 | 3300025949 | Bacteria | 1629 |
| 657 | Ga0207667_10308841 | 3300025949 | Unclassified | 1615 |
| 658 | Ga0207667_10411371 | 3300025949 | Unclassified | 1377 |
| 659 | Ga0207667_10446595 | 3300025949 | Bacteria | 1314 |
| 660 | Ga0207651_10055766 | 3300025960 | Bacteria | 2716 |
| 661 | Ga0207651_10068694 | 3300025960 | Bacteria | 2499 |
| 662 | Ga0207651_10406754 | 3300025960 | Bacteria | 1159 |
| 663 | Ga0207651_10568262 | 3300025960 | Bacteria | 988 |
| 664 | Ga0207651_10703119 | 3300025960 | Bacteria | 891 |
| 665 | Ga0207712_10048361 | 3300025961 | Bacteria | 2958 |
| 666 | Ga0207712_10113716 | 3300025961 | Bacteria | 2035 |
| 667 | Ga0207712_10115514 | 3300025961 | Bacteria | 2021 |
| 668 | Ga0207640_10054839 | 3300025981 | Bacteria | 2608 |
| 669 | Ga0207640_10116265 | 3300025981 | Bacteria | 1906 |
| 670 | Ga0207640_10168360 | 3300025981 | Bacteria | 1630 |
| 671 | Ga0207658_10014921 | 3300025986 | Bacteria | 5325 |
| 672 | Ga0207658_10287708 | 3300025986 | Bacteria | 1411 |
| 673 | Ga0207658_10343050 | 3300025986 | Bacteria | 1299 |
| 674 | Ga0207658_10747588 | 3300025986 | Unclassified | 885 |
| 675 | Ga0207677_10061412 | 3300026023 | Bacteria | 2602 |
| 676 | Ga0207677_10218413 | 3300026023 | Bacteria | 1527 |
| 677 | Ga0207703_10667275 | 3300026035 | Bacteria | 987 |
| 678 | Ga0207639_10009288 | 3300026041 | Bacteria | 6780 |
| 679 | Ga0207639_10028028 | 3300026041 | Bacteria | 4108 |
| 680 | Ga0207639_10041905 | 3300026041 | Bacteria | 3429 |
| 681 | Ga0207639_10100693 | 3300026041 | Bacteria | 2334 |
| 682 | Ga0207639_10111554 | 3300026041 | Bacteria | 2230 |
| 683 | Ga0207639_10138452 | 3300026041 | Bacteria | 2025 |
| 684 | Ga0207639_10140722 | 3300026041 | Bacteria | 2010 |
| 685 | Ga0207678_10028489 | 3300026067 | Bacteria | 4876 |
| 686 | Ga0207678_10136670 | 3300026067 | Bacteria | 2091 |
| 687 | Ga0207708_10024439 | 3300026075 | Bacteria | 4570 |
| 688 | Ga0207708_10415485 | 3300026075 | Bacteria | 1115 |
| 689 | Ga0207702_10039691 | 3300026078 | Bacteria | 3946 |
| 690 | Ga0207702_10100345 | 3300026078 | Bacteria | 2554 |
| 691 | Ga0207702_10245666 | 3300026078 | Bacteria | 1679 |
| 692 | Ga0207641_10256895 | 3300026088 | Bacteria | 1634 |
| 693 | Ga0207641_10283722 | 3300026088 | Bacteria | 1559 |
| 694 | Ga0207641_10420365 | 3300026088 | Unclassified | 1287 |
| 695 | Ga0207648_10002473 | 3300026089 | Bacteria | 19851 |
| 696 | Ga0207648_10003197 | 3300026089 | Bacteria | 17252 |
| 697 | Ga0207648_10007616 | 3300026089 | Bacteria | 10615 |
| 698 | Ga0207648_10054782 | 3300026089 | Bacteria | 3483 |
| 699 | Ga0207648_10086149 | 3300026089 | Bacteria | 2741 |
| 700 | Ga0207648_10126118 | 3300026089 | Bacteria | 2252 |
| 701 | Ga0207648_10487329 | 3300026089 | Bacteria | 1127 |
| 702 | Ga0207648_10535812 | 3300026089 | Bacteria | 1074 |
| 703 | Ga0207676_10099230 | 3300026095 | Bacteria | 2410 |
| 704 | Ga0207676_10294458 | 3300026095 | Unclassified | 1479 |
| 705 | Ga0207676_10408837 | 3300026095 | Bacteria | 1270 |
| 706 | Ga0207676_10469819 | 3300026095 | Unclassified | 1189 |
| 707 | Ga0207674_10000969 | 3300026116 | Bacteria | 37567 |
| 708 | Ga0207674_10009448 | 3300026116 | Bacteria | 11142 |
| 709 | Ga0207674_10047506 | 3300026116 | Bacteria | 4399 |
| 710 | Ga0207674_10051915 | 3300026116 | Bacteria | 4183 |
| 711 | Ga0207674_10123610 | 3300026116 | Bacteria | 2554 |
| 712 | Ga0207674_10377589 | 3300026116 | Bacteria | 1370 |
| 713 | Ga0207674_10461027 | 3300026116 | Unclassified | 1228 |
| 714 | Ga0207674_10633061 | 3300026116 | Bacteria | 1033 |
| 715 | Ga0207675_100000654 | 3300026118 | Bacteria | 34117 |
| 716 | Ga0207675_100003600 | 3300026118 | Bacteria | 15104 |
| 717 | Ga0207675_100067678 | 3300026118 | Bacteria | 3338 |
| 718 | Ga0207675_100104872 | 3300026118 | Bacteria | 2664 |
| 719 | Ga0207675_100153648 | 3300026118 | Bacteria | 2192 |
| 720 | Ga0207675_100645481 | 3300026118 | Bacteria | 1064 |
| 721 | Ga0207683_10001428 | 3300026121 | Bacteria | 21608 |
| 722 | Ga0207683_10009987 | 3300026121 | Bacteria | 8101 |
| 723 | Ga0207683_10030224 | 3300026121 | Bacteria | 4694 |
| 724 | Ga0207683_10159291 | 3300026121 | Unclassified | 2040 |
| 725 | Ga0207698_10000937 | 3300026142 | Bacteria | 16993 |
| 726 | Ga0207698_10030751 | 3300026142 | Bacteria | 3866 |
| 727 | Ga0207698_10047300 | 3300026142 | Bacteria | 3258 |
| 728 | Ga0207698_10069896 | 3300026142 | Bacteria | 2779 |
| 729 | Ga0207698_10090694 | 3300026142 | Unclassified | 2500 |
| 730 | Ga0207698_10132943 | 3300026142 | Bacteria | 2130 |
| 731 | Ga0207698_10154573 | 3300026142 | Bacteria | 1996 |
| 732 | Ga0207698_10575339 | 3300026142 | Unclassified | 1107 |
| 733 | Ga0207698_10701506 | 3300026142 | Bacteria | 1007 |
| 734 | Ga0207698_10908417 | 3300026142 | Bacteria | 888 |
| 735 | Ga0209974_10178453 | 3300027876 | Bacteria | 777 |
| 736 | Ga0207428_10009020 | 3300027907 | Bacteria | 8978 |
| 737 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 738 | Ga0268266_10177309 | 3300028379 | Bacteria | 1938 |
| 739 | Ga0268266_10230016 | 3300028379 | Bacteria | 1707 |
| 740 | Ga0268266_10515390 | 3300028379 | Bacteria | 1143 |
| 741 | Ga0268265_10054849 | 3300028380 | Bacteria | 3026 |
| 742 | Ga0268265_10756567 | 3300028380 | Bacteria | 943 |
| 743 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 744 | Ga0268264_10002043 | 3300028381 | Bacteria | 18025 |
| 745 | Ga0268264_10004073 | 3300028381 | Bacteria | 12513 |
| 746 | Ga0268264_10008382 | 3300028381 | Bacteria | 8592 |
| 747 | Ga0268264_10024643 | 3300028381 | Bacteria | 4913 |
| 748 | Ga0268264_10119283 | 3300028381 | Bacteria | 2323 |
| 749 | Ga0268264_10123800 | 3300028381 | Bacteria | 2282 |
| 750 | Ga0268264_10440654 | 3300028381 | Bacteria | 1260 |
| 751 | Ga0268264_10478570 | 3300028381 | Unclassified | 1211 |
| 752 | Ga0307517_10001481 | 3300028786 | Bacteria | 39285 |
| 753 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 754 | Ga0307515_10407697 | 3300028794 | Unclassified | 983 |
| 755 | Ga0307511_10000201 | 3300030521 | Bacteria | 60079 |
| 756 | Ga0316177_1143555 | 3300030731 | Bacteria | 1344 |
| 757 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 758 | Ga0265327_10015178 | 3300031251 | Bacteria | 4990 |
| 759 | Ga0265327_10105431 | 3300031251 | Bacteria | 1354 |
| 760 | Ga0307513_10089008 | 3300031456 | Bacteria | 3153 |
| 761 | Ga0307513_10143808 | 3300031456 | Bacteria | 2307 |
| 762 | Ga0307513_10168021 | 3300031456 | Bacteria | 2075 |
| 763 | Ga0307509_10075949 | 3300031507 | Bacteria | 3488 |
| 764 | Ga0307509_10136092 | 3300031507 | Bacteria | 2402 |
| 765 | Ga0307508_10001083 | 3300031616 | Bacteria | 31499 |
| 766 | Ga0307516_10003458 | 3300031730 | Bacteria | 20249 |
| 767 | Ga0307405_10448635 | 3300031731 | Unclassified | 1022 |
| 768 | Ga0307413_10014902 | 3300031824 | Bacteria | 3966 |
| 769 | Ga0307410_10036382 | 3300031852 | Bacteria | 3206 |
| 770 | Ga0307407_10275716 | 3300031903 | Bacteria | 1163 |
| 771 | Ga0307412_10367335 | 3300031911 | Bacteria | 1161 |
| 772 | Ga0307416_100703478 | 3300032002 | Bacteria | 1100 |
| 773 | Ga0307414_10121535 | 3300032004 | Bacteria | 2009 |
| 774 | Ga0307414_10223667 | 3300032004 | Bacteria | 1547 |
| 775 | Ga0307411_10372226 | 3300032005 | Unclassified | 1172 |
| 776 | Ga0307415_100356310 | 3300032126 | Bacteria | 1234 |
| 777 | Ga0307507_10171810 | 3300033179 | Bacteria | 1573 |
| 778 | Ga0307510_10008700 | 3300033180 | Bacteria | 12090 |
| 779 | Ga0373934_0054546 | 3300035086 | Bacteria | 1587 |
| 780 | Ga0373935_0731115 | 3300035692 | Bacteria | 729 |
| 781 | Ga0373933_0040109 | 3300035724 | Bacteria | 2757 |
| 782 | Ga0373937_0041388 | 3300036401 | Bacteria | 4202 |
| 783 | Ga0373937_0116024 | 3300036401 | Bacteria | 2494 |
| 784 | Ga0395899_0009123 | 3300037312 | Bacteria | 7619 |
| 785 | Ga0395899_0026127 | 3300037312 | Bacteria | 4407 |
| 786 | Ga0395899_0039218 | 3300037312 | Bacteria | 3546 |
| 787 | Ga0395899_0066712 | 3300037312 | Bacteria | 2642 |
| 788 | Ga0395900_0086961 | 3300037418 | Bacteria | 3212 |
| 789 | Ga0395900_0167250 | 3300037418 | Bacteria | 2240 |
| 790 | Ga0395900_0269218 | 3300037418 | Bacteria | 1699 |
| 791 | Ga0395898_0022627 | 3300037466 | Bacteria | 6364 |
| 792 | Ga0395898_0098120 | 3300037466 | Bacteria | 2813 |
| 793 | Ga0395898_0475765 | 3300037466 | Bacteria | 1188 |
| 794 | Ga0395905_0060068 | 3300037471 | Bacteria | 3555 |
| 795 | Ga0395905_0249181 | 3300037471 | Bacteria | 1659 |
| 796 | Ga0395901_0007671 | 3300038443 | Bacteria | 10885 |
| 797 | Ga0395901_0028563 | 3300038443 | Bacteria | 5737 |
| 798 | Ga0395901_0055582 | 3300038443 | Bacteria | 4117 |
| 799 | Ga0395901_0122950 | 3300038443 | Bacteria | 2727 |
| 800 | Ga0436365_1831652 | 3300039437 | Bacteria | 3666 |
| 801 | Ga0439439_0011631 | 3300041406 | Unclassified | 2121 |
| 802 | Ga0451793_0181996 | 3300041452 | Bacteria | 1575 |
| 803 | Ga0451804_1111977 | 3300041463 | Bacteria | 795 |
| 804 | Ga0451807_0395518 | 3300041486 | Bacteria | 1110 |
| 805 | Ga0451841_0356308 | 3300041498 | Bacteria | 1528 |
| 806 | Ga0451849_0545289 | 3300041505 | Unclassified | 783 |
| 807 | Ga0451851_1127070 | 3300041507 | Bacteria | 1088 |
| 808 | Ga0439431_0013852 | 3300041997 | Unclassified | 1864 |
| 809 | Ga0439445_0031519 | 3300042004 | Bacteria | 1378 |
| 810 | Ga0439449_0082707 | 3300042007 | Bacteria | 1184 |
| 811 | Ga0439446_0082229 | 3300042156 | Bacteria | 999 |
| 812 | Ga0439434_0001630 | 3300042435 | Bacteria | 6486 |
| 813 | Ga0451577_0280639 | 3300042876 | Bacteria | 1509 |
| 814 | Ga0451577_0281363 | 3300042876 | Bacteria | 1507 |
| 815 | Ga0466972_0000021 | 3300044658 | Bacteria | 196266 |
| 816 | Ga0466972_0008143 | 3300044658 | Bacteria | 5257 |
| 817 | Ga0466965_0005791 | 3300044683 | Bacteria | 5577 |
| 818 | Ga0466961_0153839 | 3300044693 | Bacteria | 1435 |
| 819 | Ga0466964_0066241 | 3300044706 | Bacteria | 1515 |
| 820 | Ga0466968_0055589 | 3300044735 | Bacteria | 1699 |
| 821 | Ga0466970_0001020 | 3300044765 | Bacteria | 13511 |
| 822 | Ga0466957_0050124 | 3300044842 | Bacteria | 2540 |
| 823 | Ga0466958_0048247 | 3300045836 | Bacteria | 2573 |
| 824 | Ga0495627_029697 | 3300046453 | Bacteria | 1737 |
| 825 | Ga0495629_0223363 | 3300046459 | Bacteria | 1299 |
| 826 | Ga0495638_0084489 | 3300046460 | Bacteria | 1921 |
| 827 | Ga0495638_0241846 | 3300046460 | Bacteria | 999 |
| 828 | Ga0495650_0016596 | 3300046471 | Bacteria | 3724 |
| 829 | Ga0495580_0046645 | 3300046472 | Bacteria | 3074 |
| 830 | Ga0495606_0064736 | 3300046507 | Bacteria | 2325 |
| 831 | Ga0495608_0027308 | 3300046511 | Bacteria | 3884 |
| 832 | Ga0495628_0164769 | 3300046516 | Bacteria | 1683 |
| 833 | Ga0495648_0086382 | 3300046524 | Bacteria | 1769 |
| 834 | Ga0495652_0292846 | 3300046529 | Bacteria | 1187 |
| 835 | Ga0495640_0148898 | 3300046533 | Bacteria | 1505 |
| 836 | Ga0495587_0106078 | 3300046536 | Unclassified | 1616 |
| 837 | Ga0495633_0000116 | 3300046558 | Bacteria | 108667 |
| 838 | Ga0495668_0000235 | 3300046616 | Bacteria | 78964 |
| 839 | Ga0495668_0002655 | 3300046616 | Bacteria | 14375 |
| 840 | Ga0495611_0000026 | 3300046648 | Bacteria | 118428 |
| 841 | Ga0495611_0030385 | 3300046648 | Unclassified | 2375 |
| 842 | Ga0495625_0043643 | 3300046660 | Bacteria | 3251 |
| 843 | Ga0495635_0225787 | 3300046663 | Bacteria | 1266 |
| 844 | Ga0495599_0185059 | 3300046678 | Bacteria | 1283 |
| 845 | Ga0495623_0156881 | 3300046679 | Bacteria | 1341 |
| 846 | Ga0495646_0232112 | 3300046680 | Bacteria | 994 |
| 847 | Ga0495670_0033326 | 3300046691 | Unclassified | 2563 |
| 848 | Ga0495600_0221809 | 3300046809 | Bacteria | 1209 |
| 849 | Ga0495672_0115229 | 3300047320 | Bacteria | 1437 |
| 850 | Ga0495680_0159270 | 3300047322 | Bacteria | 1640 |
| 851 | Ga0495687_001838 | 3300047443 | Bacteria | 18636 |
| 852 | Ga0495684_0222379 | 3300047471 | Bacteria | 1384 |
| 853 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 854 | Ga0495686_0001217 | 3300047472 | Bacteria | 29546 |
| 855 | Ga0496109_0481980 | 3300048912 | Bacteria | 1171 |
| 856 | Ga0496110_0009618 | 3300048913 | Bacteria | 7828 |
| 857 | Ga0496111_0513055 | 3300048914 | Bacteria | 882 |
| 858 | Ga0496126_0015380 | 3300048929 | Bacteria | 7698 |
| 859 | Ga0501031_0013457 | 3300049568 | Bacteria | 5334 |
| 860 | Ga0501031_0076966 | 3300049568 | Bacteria | 2173 |
| 861 | Ga0501032_0014560 | 3300049569 | Bacteria | 5570 |
| 862 | Ga0501032_0255073 | 3300049569 | Bacteria | 1138 |
| 863 | Ga0501033_0044589 | 3300049570 | Bacteria | 3301 |
| 864 | Ga0501033_0385727 | 3300049570 | Bacteria | 978 |
| 865 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 866 | Ga0501034_0005186 | 3300049571 | Bacteria | 14296 |
| 867 | Ga0501034_0028416 | 3300049571 | Bacteria | 5691 |
| 868 | Ga0501034_0053717 | 3300049571 | Bacteria | 4056 |
| 869 | Ga0501034_0712444 | 3300049571 | Bacteria | 901 |
| 870 | Ga0501036_0005238 | 3300049572 | Bacteria | 10492 |
| 871 | Ga0501036_0055566 | 3300049572 | Bacteria | 3354 |
| 872 | Ga0501037_0004139 | 3300049573 | Bacteria | 10526 |
| 873 | Ga0501037_0005433 | 3300049573 | Bacteria | 9280 |
| 874 | Ga0501038_0020656 | 3300049574 | Bacteria | 5919 |
| 875 | Ga0501038_0032811 | 3300049574 | Bacteria | 4577 |
| 876 | Ga0501039_0078832 | 3300049575 | Bacteria | 2562 |
| 877 | Ga0501043_0007747 | 3300049579 | Bacteria | 8498 |
| 878 | Ga0501043_0034982 | 3300049579 | Bacteria | 3951 |
| 879 | Ga0501043_0051202 | 3300049579 | Bacteria | 3245 |
| 880 | Ga0501043_0249742 | 3300049579 | Bacteria | 1367 |
| 881 | Ga0501046_0237520 | 3300049580 | Bacteria | 1345 |
| 882 | Ga0501047_0016908 | 3300049581 | Bacteria | 6973 |
| 883 | Ga0501047_0071717 | 3300049581 | Bacteria | 3334 |
| 884 | Ga0501047_0149418 | 3300049581 | Bacteria | 2213 |
| 885 | Ga0501047_0406186 | 3300049581 | Bacteria | 1195 |
| 886 | Ga0501047_0575056 | 3300049581 | Bacteria | 950 |
| 887 | Ga0501048_0436981 | 3300049582 | Bacteria | 937 |
| 888 | Ga0501067_0031005 | 3300049583 | Unclassified | 2967 |
| 889 | Ga0501070_0088403 | 3300049586 | Bacteria | 2564 |
| 890 | Ga0501072_0384824 | 3300049588 | Bacteria | 1113 |
| 891 | Ga0501217_082276 | 3300049661 | Unclassified | 893 |
| 892 | Ga0501257_005682 | 3300049686 | Bacteria | 2755 |
| 893 | Ga0501219_000704 | 3300049703 | Bacteria | 4619 |
| 894 | Ga0501079_0659548 | 3300049741 | Bacteria | 824 |
| 895 | Ga0501083_0022214 | 3300049744 | Bacteria | 4402 |
| 896 | Ga0501269_003839 | 3300049766 | Bacteria | 1806 |
| 897 | Ga0501035_0114753 | 3300049822 | Bacteria | 2358 |
| 898 | Ga0501035_0319559 | 3300049822 | Bacteria | 1304 |
| 899 | Ga0501044_0001506 | 3300049823 | Bacteria | 27312 |
| 900 | Ga0501044_0006596 | 3300049823 | Bacteria | 12806 |
| 901 | Ga0501044_0067425 | 3300049823 | Bacteria | 3646 |
| 902 | Ga0501044_0070719 | 3300049823 | Bacteria | 3549 |
| 903 | Ga0501044_0123794 | 3300049823 | Bacteria | 2584 |
| 904 | Ga0501044_0188050 | 3300049823 | Bacteria | 2029 |
| 905 | Ga0501284_00036 | 3300050005 | Bacteria | 57905 |
| 906 | Ga0501284_04967 | 3300050005 | Bacteria | 755 |
| 907 | nmdc:mga0k408_12581_c1 | 3300050493 | Bacteria | 4626 |
| 908 | nmdc:mga0k408_214014_c1 | 3300050493 | Bacteria | 1151 |
| 909 | nmdc:mga0k408_2243_c2 | 3300050493 | Bacteria | 5931 |
| 910 | nmdc:mga0k408_257387_c1 | 3300050493 | Bacteria | 1042 |
| 911 | nmdc:mga09592_198000_c1 | 3300050508 | Bacteria | 1739 |
| 912 | nmdc:mga0qj67_359562_c1 | 3300050509 | Bacteria | 1176 |
| 913 | nmdc:mga06r32_868945_c1 | 3300050510 | Bacteria | 860 |
| 914 | Ga0500644_0000260 | 3300053088 | Bacteria | 30005 |
| 915 | Ga0500644_0014085 | 3300053088 | Bacteria | 2249 |
| 916 | Ga0500646_0001629 | 3300053090 | Bacteria | 5935 |
| 917 | Ga0500646_0002227 | 3300053090 | Bacteria | 5047 |
| 918 | Ga0500646_0033314 | 3300053090 | Bacteria | 1425 |
| 919 | Ga0500583_0000076 | 3300053092 | Bacteria | 59162 |
| 920 | Ga0500583_0000557 | 3300053092 | Bacteria | 11283 |
| 921 | Ga0500583_0000662 | 3300053092 | Bacteria | 10175 |
| 922 | Ga0500583_0050409 | 3300053092 | Bacteria | 1930 |
| 923 | Ga0500651_0031174 | 3300053093 | Bacteria | 3358 |
| 924 | Ga0500641_0022545 | 3300053096 | Bacteria | 2413 |
| 925 | Ga0500641_0105659 | 3300053096 | Bacteria | 1210 |
| 926 | Ga0500562_000038 | 3300053108 | Bacteria | 72186 |
| 927 | Ga0500569_000126 | 3300053109 | Bacteria | 11996 |
| 928 | Ga0500607_084876 | 3300053121 | Bacteria | 1607 |
| 929 | Ga0500655_016844 | 3300053133 | Bacteria | 1348 |
| 930 | Ga0500658_0003845 | 3300053134 | Bacteria | 5648 |
| 931 | Ga0500559_0064467 | 3300053136 | Bacteria | 1639 |
| 932 | Ga0500568_0001023 | 3300053139 | Bacteria | 19133 |
| 933 | Ga0500568_0019739 | 3300053139 | Bacteria | 2924 |
| 934 | Ga0500577_0010546 | 3300053142 | Bacteria | 2725 |
| 935 | Ga0500577_0113138 | 3300053142 | Bacteria | 1122 |
| 936 | Ga0500588_0020852 | 3300053146 | Bacteria | 1762 |
| 937 | Ga0500588_0037377 | 3300053146 | Bacteria | 1441 |
| 938 | Ga0500589_011678 | 3300053147 | Bacteria | 3814 |
| 939 | Ga0500590_125891 | 3300053148 | Bacteria | 1193 |
| 940 | Ga0500616_0001355 | 3300053153 | Bacteria | 23862 |
| 941 | Ga0500616_0116780 | 3300053153 | Bacteria | 1280 |
| 942 | Ga0500622_0000212 | 3300053156 | Bacteria | 61612 |
| 943 | Ga0500622_0000340 | 3300053156 | Bacteria | 45986 |
| 944 | Ga0500622_0001733 | 3300053156 | Bacteria | 16854 |
| 945 | Ga0500633_0019517 | 3300053160 | Bacteria | 2028 |
| 946 | Ga0500639_038750 | 3300053163 | Bacteria | 2510 |
| 947 | Ga0500636_0002821 | 3300053177 | Bacteria | 9699 |
| 948 | Ga0500637_0142145 | 3300053178 | Bacteria | 1389 |
| 949 | Ga0500611_000101 | 3300053727 | Bacteria | 21697 |
| 950 | Ga0500645_049652 | 3300053730 | Bacteria | 1227 |
| 951 | Ga0501084_0276631 | 3300054114 | Bacteria | 1417 |
| 952 | Ga0466962_0018303 | 3300061719 | Bacteria | 3370 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10007189 | rootH1_1000718912 | 214 |
| 2 | 3300005327 | Ga0070658_10146069 | Ga0070658_101460692 | 221 |
| 3 | 3300005329 | Ga0070683_100021184 | Ga0070683_1000211843 | 221 |
| 4 | 3300005335 | Ga0070666_10022880 | Ga0070666_100228802 | 221 |
| 5 | 3300005337 | Ga0070682_100008284 | Ga0070682_1000082843 | 221 |
| 6 | 3300005338 | Ga0068868_100030461 | Ga0068868_1000304612 | 221 |
| 7 | 3300005339 | Ga0070660_100153020 | Ga0070660_1001530202 | 221 |
| 8 | 3300005344 | Ga0070661_100036849 | Ga0070661_1000368492 | 221 |
| 9 | 3300005345 | Ga0070692_10141671 | Ga0070692_101416712 | 221 |
| 10 | 3300005354 | Ga0070675_100073774 | Ga0070675_1000737742 | 221 |
| 11 | 3300005364 | Ga0070673_100032649 | Ga0070673_1000326492 | 221 |
| 12 | 3300005366 | Ga0070659_100039015 | Ga0070659_1000390152 | 221 |
| 13 | 3300005457 | Ga0070662_100004529 | Ga0070662_1000045298 | 221 |
| 14 | 3300005459 | Ga0068867_100247171 | Ga0068867_1002471712 | 221 |
| 15 | 3300005530 | Ga0070679_100177700 | Ga0070679_1001777002 | 221 |
| 16 | 3300005539 | Ga0068853_100031274 | Ga0068853_1000312743 | 221 |
| 17 | 3300005563 | Ga0068855_100087504 | Ga0068855_1000875043 | 221 |
| 18 | 3300005564 | Ga0070664_100005866 | Ga0070664_10000586610 | 221 |
| 19 | 3300005578 | Ga0068854_100024925 | Ga0068854_1000249252 | 221 |
| 20 | 3300006237 | Ga0097621_100008140 | Ga0097621_1000081403 | 221 |
| 21 | 3300006358 | Ga0068871_100025524 | Ga0068871_1000255242 | 221 |
| 22 | 3300013100 | Ga0157373_10008630 | Ga0157373_100086303 | 221 |
| 23 | 3300013102 | Ga0157371_10040978 | Ga0157371_100409782 | 221 |
| 24 | 3300013105 | Ga0157369_10009590 | Ga0157369_100095903 | 221 |
| 25 | 3300013296 | Ga0157374_10033168 | Ga0157374_100331682 | 221 |
| 26 | 3300013297 | Ga0157378_10027293 | Ga0157378_100272932 | 221 |
| 27 | 3300014745 | Ga0157377_10042633 | Ga0157377_100426332 | 221 |
| 28 | 3300025903 | Ga0207680_10065274 | Ga0207680_100652742 | 221 |
| 29 | 3300025909 | Ga0207705_10603120 | Ga0207705_106031201 | 221 |
| 30 | 3300025912 | Ga0207707_10477892 | Ga0207707_104778922 | 221 |
| 31 | 3300025919 | Ga0207657_10004450 | Ga0207657_100044506 | 221 |
| 32 | 3300025920 | Ga0207649_10024760 | Ga0207649_100247602 | 221 |
| 33 | 3300025926 | Ga0207659_10080311 | Ga0207659_100803112 | 221 |
| 34 | 3300025932 | Ga0207690_10037538 | Ga0207690_100375383 | 221 |
| 35 | 3300025933 | Ga0207706_10010112 | Ga0207706_100101122 | 221 |
| 36 | 3300025945 | Ga0207679_10281133 | Ga0207679_102811332 | 221 |
| 37 | 3300025949 | Ga0207667_10308841 | Ga0207667_103088412 | 221 |
| 38 | 3300025960 | Ga0207651_10068694 | Ga0207651_100686942 | 221 |
| 39 | 3300005577 | Ga0068857_100140488 | Ga0068857_1001404882 | 222 |
| 40 | 3300025944 | Ga0207661_10152979 | Ga0207661_101529792 | 222 |
| 41 | 3300025934 | Ga0207686_10160542 | Ga0207686_101605422 | 224 |
| 42 | 3300031251 | Ga0265327_10105431 | Ga0265327_101054311 | 224 |
| 43 | 3300035692 | Ga0373935_0731115 | Ga0373935_0731115_12_686 | 224 |
| 44 | 3300049570 | Ga0501033_0385727 | Ga0501033_0385727_282_956 | 224 |
| 45 | 3300005564 | Ga0070664_100211093 | Ga0070664_1002110932 | 225 |
| 46 | 3300005616 | Ga0068852_100331546 | Ga0068852_1003315462 | 225 |
| 47 | 3300005841 | Ga0068863_100249545 | Ga0068863_1002495452 | 225 |
| 48 | 3300005843 | Ga0068860_100103769 | Ga0068860_1001037694 | 225 |
| 49 | 3300006358 | Ga0068871_100236567 | Ga0068871_1002365672 | 225 |
| 50 | 3300025933 | Ga0207706_10135341 | Ga0207706_101353413 | 225 |
| 51 | 3300025937 | Ga0207669_10087744 | Ga0207669_100877442 | 225 |
| 52 | 3300025940 | Ga0207691_10041817 | Ga0207691_100418172 | 225 |
| 53 | 3300026121 | Ga0207683_10030224 | Ga0207683_100302242 | 225 |
| 54 | 3300046616 | Ga0495668_0000235 | Ga0495668_0000235_30488_31198 | 225 |
| 55 | 3300049569 | Ga0501032_0255073 | Ga0501032_0255073_443_1126 | 225 |
| 56 | 3300049766 | Ga0501269_003839 | Ga0501269_003839_1010_1720 | 225 |
| 57 | 3300053096 | Ga0500641_0105659 | Ga0500641_0105659_159_869 | 225 |
| 58 | 3300053142 | Ga0500577_0113138 | Ga0500577_0113138_141_851 | 225 |
| 59 | 3300053153 | Ga0500616_0001355 | Ga0500616_0001355_3305_4015 | 225 |
| 60 | 3300025940 | Ga0207691_10021958 | Ga0207691_100219583 | 226 |
| 61 | 3300026035 | Ga0207703_10667275 | Ga0207703_106672752 | 226 |
| 62 | 3300026041 | Ga0207639_10100693 | Ga0207639_101006932 | 227 |
| 63 | iso_pu_bacteria | 2738541278 | 2738725630 | 229 |
| 64 | 3300047320 | Ga0495672_0115229 | Ga0495672_0115229_326_1048 | 230 |
| 65 | 3300026089 | Ga0207648_10487329 | Ga0207648_104873292 | 231 |
| 66 | 3300041505 | Ga0451849_0545289 | Ga0451849_0545289_40_735 | 231 |
| 67 | iso_pu_bacteria | 2818991442 | 2819575020 | 231 |
| 68 | iso_pu_bacteria | 2818991444 | 2819585514 | 231 |
| 69 | iso_pu_bacteria | 2818991460 | 2819676981 | 231 |
| 70 | iso_pu_bacteria | 2821136567 | 2821141116 | 231 |
| 71 | iso_pu_bacteria | 2881955468 | 2881958350 | 231 |
| 72 | iso_pu_bacteria | 2884791551 | 2884796820 | 231 |
| 73 | iso_pu_bacteria | 2904467357 | 2904471617 | 231 |
| 74 | iso_pu_bacteria | 2929154850 | 2929159830 | 231 |
| 75 | iso_pu_bacteria | 2929177148 | 2929177663 | 231 |
| 76 | iso_pu_bacteria | 2929239360 | 2929240030 | 231 |
| 77 | iso_pu_bacteria | 2929921140 | 2929921737 | 231 |
| 78 | iso_pu_bacteria | 2945977869 | 2945980012 | 231 |
| 79 | iso_pu_bacteria | 2946013367 | 2946014127 | 231 |
| 80 | iso_pu_bacteria | 8003151029 | 8003154284 | 231 |
| 81 | 3300005614 | Ga0068856_100394467 | Ga0068856_1003944672 | 232 |
| 82 | 3300009174 | Ga0105241_10343175 | Ga0105241_103431752 | 232 |
| 83 | 3300009545 | Ga0105237_10446460 | Ga0105237_104464602 | 232 |
| 84 | 3300010375 | Ga0105239_10435887 | Ga0105239_104358872 | 232 |
| 85 | 3300025914 | Ga0207671_10282927 | Ga0207671_102829272 | 232 |
| 86 | 3300031456 | Ga0307513_10089008 | Ga0307513_100890082 | 232 |
| 87 | 3300031507 | Ga0307509_10075949 | Ga0307509_100759492 | 232 |
| 88 | 3300031507 | Ga0307509_10136092 | Ga0307509_101360923 | 232 |
| 89 | 3300031616 | Ga0307508_10001083 | Ga0307508_1000108320 | 232 |
| 90 | 3300039437 | Ga0436365_1831652 | Ga0436365_1831652_1821_2525 | 232 |
| 91 | 3300046660 | Ga0495625_0043643 | Ga0495625_0043643_2498_3199 | 232 |
| 92 | 3300053090 | Ga0500646_0001629 | Ga0500646_0001629_3208_3909 | 232 |
| 93 | 3300053146 | Ga0500588_0020852 | Ga0500588_0020852_869_1570 | 232 |
| 94 | 3300003316 | rootH1_10084469 | rootH1_100844693 | 233 |
| 95 | 3300003320 | rootH2_10001613 | rootH2_1000161317 | 233 |
| 96 | 3300003320 | rootH2_10001614 | rootH2_1000161417 | 233 |
| 97 | 3300003320 | rootH2_10023604 | rootH2_100236046 | 233 |
| 98 | 3300003323 | rootH1_10300162 | rootH1_103001622 | 233 |
| 99 | 3300005327 | Ga0070658_10141172 | Ga0070658_101411722 | 233 |
| 100 | 3300005329 | Ga0070683_100002723 | Ga0070683_10000272313 | 233 |
| 101 | 3300005329 | Ga0070683_100057092 | Ga0070683_1000570921 | 233 |
| 102 | 3300005330 | Ga0070690_100091596 | Ga0070690_1000915962 | 233 |
| 103 | 3300005335 | Ga0070666_10018584 | Ga0070666_100185844 | 233 |
| 104 | 3300005336 | Ga0070680_100009821 | Ga0070680_1000098212 | 233 |
| 105 | 3300005336 | Ga0070680_100034885 | Ga0070680_1000348852 | 233 |
| 106 | 3300005337 | Ga0070682_100002989 | Ga0070682_10000298910 | 233 |
| 107 | 3300005337 | Ga0070682_100070789 | Ga0070682_1000707893 | 233 |
| 108 | 3300005339 | Ga0070660_100020297 | Ga0070660_1000202976 | 233 |
| 109 | 3300005354 | Ga0070675_100031505 | Ga0070675_1000315052 | 233 |
| 110 | 3300005436 | Ga0070713_100115595 | Ga0070713_1001155952 | 233 |
| 111 | 3300005458 | Ga0070681_10047183 | Ga0070681_100471832 | 233 |
| 112 | 3300005458 | Ga0070681_10502991 | Ga0070681_105029911 | 233 |
| 113 | 3300005471 | Ga0070698_100072788 | Ga0070698_1000727884 | 233 |
| 114 | 3300005530 | Ga0070679_100006985 | Ga0070679_1000069853 | 233 |
| 115 | 3300005530 | Ga0070679_100057085 | Ga0070679_1000570852 | 233 |
| 116 | 3300005539 | Ga0068853_100001650 | Ga0068853_10000165014 | 233 |
| 117 | 3300005539 | Ga0068853_100009686 | Ga0068853_1000096867 | 233 |
| 118 | 3300005539 | Ga0068853_100011889 | Ga0068853_1000118892 | 233 |
| 119 | 3300005548 | Ga0070665_100000014 | Ga0070665_100000014222 | 233 |
| 120 | 3300005563 | Ga0068855_100010998 | Ga0068855_1000109984 | 233 |
| 121 | 3300005563 | Ga0068855_100044640 | Ga0068855_1000446404 | 233 |
| 122 | 3300005563 | Ga0068855_100066276 | Ga0068855_1000662762 | 233 |
| 123 | 3300005563 | Ga0068855_100090034 | Ga0068855_1000900342 | 233 |
| 124 | 3300005563 | Ga0068855_100115699 | Ga0068855_1001156992 | 233 |
| 125 | 3300005563 | Ga0068855_100128374 | Ga0068855_1001283741 | 233 |
| 126 | 3300005563 | Ga0068855_100133349 | Ga0068855_1001333492 | 233 |
| 127 | 3300005577 | Ga0068857_100025602 | Ga0068857_1000256022 | 233 |
| 128 | 3300005577 | Ga0068857_100224835 | Ga0068857_1002248351 | 233 |
| 129 | 3300005578 | Ga0068854_100005213 | Ga0068854_1000052137 | 233 |
| 130 | 3300005578 | Ga0068854_100202862 | Ga0068854_1002028622 | 233 |
| 131 | 3300005614 | Ga0068856_100195408 | Ga0068856_1001954082 | 233 |
| 132 | 3300005616 | Ga0068852_100001786 | Ga0068852_10000178612 | 233 |
| 133 | 3300005616 | Ga0068852_100013163 | Ga0068852_1000131636 | 233 |
| 134 | 3300005616 | Ga0068852_100032243 | Ga0068852_1000322433 | 233 |
| 135 | 3300005616 | Ga0068852_100039363 | Ga0068852_1000393634 | 233 |
| 136 | 3300005617 | Ga0068859_100001537 | Ga0068859_10000153726 | 233 |
| 137 | 3300005843 | Ga0068860_100000061 | Ga0068860_10000006125 | 233 |
| 138 | 3300005843 | Ga0068860_100012083 | Ga0068860_1000120837 | 233 |
| 139 | 3300005983 | Ga0081540_1016808 | Ga0081540_10168082 | 233 |
| 140 | 3300006175 | Ga0070712_100201394 | Ga0070712_1002013942 | 233 |
| 141 | 3300006195 | Ga0075366_10016298 | Ga0075366_100162983 | 233 |
| 142 | 3300006358 | Ga0068871_100359685 | Ga0068871_1003596852 | 233 |
| 143 | 3300006846 | Ga0075430_100478339 | Ga0075430_1004783392 | 233 |
| 144 | 3300006931 | Ga0097620_100001537 | Ga0097620_10000153726 | 233 |
| 145 | 3300009093 | Ga0105240_10000800 | Ga0105240_1000080043 | 233 |
| 146 | 3300009093 | Ga0105240_10001787 | Ga0105240_1000178735 | 233 |
| 147 | 3300009093 | Ga0105240_10001808 | Ga0105240_1000180835 | 233 |
| 148 | 3300009093 | Ga0105240_10004358 | Ga0105240_1000435812 | 233 |
| 149 | 3300009093 | Ga0105240_10029970 | Ga0105240_100299707 | 233 |
| 150 | 3300009093 | Ga0105240_10067649 | Ga0105240_100676494 | 233 |
| 151 | 3300009093 | Ga0105240_10817748 | Ga0105240_108177482 | 233 |
| 152 | 3300009093 | Ga0105240_11022734 | Ga0105240_110227342 | 233 |
| 153 | 3300009094 | Ga0111539_10011279 | Ga0111539_100112793 | 233 |
| 154 | 3300009174 | Ga0105241_10000608 | Ga0105241_1000060823 | 233 |
| 155 | 3300009174 | Ga0105241_10007179 | Ga0105241_100071794 | 233 |
| 156 | 3300009174 | Ga0105241_10143104 | Ga0105241_101431042 | 233 |
| 157 | 3300009174 | Ga0105241_10576960 | Ga0105241_105769602 | 233 |
| 158 | 3300009174 | Ga0105241_10981968 | Ga0105241_109819681 | 233 |
| 159 | 3300009174 | Ga0105241_11033057 | Ga0105241_110330571 | 233 |
| 160 | 3300009545 | Ga0105237_10005526 | Ga0105237_1000552610 | 233 |
| 161 | 3300009545 | Ga0105237_10006018 | Ga0105237_100060185 | 233 |
| 162 | 3300009545 | Ga0105237_10006998 | Ga0105237_100069985 | 233 |
| 163 | 3300009545 | Ga0105237_10007301 | Ga0105237_1000730114 | 233 |
| 164 | 3300009545 | Ga0105237_10011542 | Ga0105237_100115429 | 233 |
| 165 | 3300009545 | Ga0105237_10017111 | Ga0105237_100171113 | 233 |
| 166 | 3300009545 | Ga0105237_10207088 | Ga0105237_102070882 | 233 |
| 167 | 3300009545 | Ga0105237_10665885 | Ga0105237_106658852 | 233 |
| 168 | 3300009551 | Ga0105238_10000592 | Ga0105238_100005922 | 233 |
| 169 | 3300009551 | Ga0105238_10092053 | Ga0105238_100920533 | 233 |
| 170 | 3300009551 | Ga0105238_10159963 | Ga0105238_101599632 | 233 |
| 171 | 3300009551 | Ga0105238_10651836 | Ga0105238_106518362 | 233 |
| 172 | 3300009553 | Ga0105249_10351052 | Ga0105249_103510522 | 233 |
| 173 | 3300010375 | Ga0105239_10000019 | Ga0105239_1000001979 | 233 |
| 174 | 3300010375 | Ga0105239_10001405 | Ga0105239_1000140531 | 233 |
| 175 | 3300010375 | Ga0105239_10004672 | Ga0105239_100046729 | 233 |
| 176 | 3300010375 | Ga0105239_10027401 | Ga0105239_100274017 | 233 |
| 177 | 3300010375 | Ga0105239_10248630 | Ga0105239_102486302 | 233 |
| 178 | 3300010375 | Ga0105239_10346502 | Ga0105239_103465022 | 233 |
| 179 | 3300013100 | Ga0157373_10000927 | Ga0157373_1000092710 | 233 |
| 180 | 3300013100 | Ga0157373_10187209 | Ga0157373_101872092 | 233 |
| 181 | 3300013102 | Ga0157371_10112231 | Ga0157371_101122312 | 233 |
| 182 | 3300013104 | Ga0157370_10018211 | Ga0157370_100182117 | 233 |
| 183 | 3300013105 | Ga0157369_10010400 | Ga0157369_100104007 | 233 |
| 184 | 3300013105 | Ga0157369_10034211 | Ga0157369_100342115 | 233 |
| 185 | 3300013105 | Ga0157369_10059094 | Ga0157369_100590942 | 233 |
| 186 | 3300013105 | Ga0157369_10188622 | Ga0157369_101886222 | 233 |
| 187 | 3300013296 | Ga0157374_10000011 | Ga0157374_10000011329 | 233 |
| 188 | 3300013296 | Ga0157374_10107601 | Ga0157374_101076012 | 233 |
| 189 | 3300013297 | Ga0157378_10268770 | Ga0157378_102687702 | 233 |
| 190 | 3300013306 | Ga0163162_10004708 | Ga0163162_100047089 | 233 |
| 191 | 3300013307 | Ga0157372_10003581 | Ga0157372_1000358116 | 233 |
| 192 | 3300013307 | Ga0157372_10012118 | Ga0157372_100121182 | 233 |
| 193 | 3300013307 | Ga0157372_10031379 | Ga0157372_100313793 | 233 |
| 194 | 3300013307 | Ga0157372_10121312 | Ga0157372_101213124 | 233 |
| 195 | 3300014745 | Ga0157377_10279978 | Ga0157377_102799782 | 233 |
| 196 | 3300014969 | Ga0157376_10007481 | Ga0157376_100074812 | 233 |
| 197 | 3300025904 | Ga0207647_10067803 | Ga0207647_100678032 | 233 |
| 198 | 3300025904 | Ga0207647_10174232 | Ga0207647_101742322 | 233 |
| 199 | 3300025909 | Ga0207705_10048638 | Ga0207705_100486382 | 233 |
| 200 | 3300025911 | Ga0207654_10006600 | Ga0207654_100066005 | 233 |
| 201 | 3300025911 | Ga0207654_10011213 | Ga0207654_100112134 | 233 |
| 202 | 3300025911 | Ga0207654_10178152 | Ga0207654_101781522 | 233 |
| 203 | 3300025912 | Ga0207707_10064134 | Ga0207707_100641344 | 233 |
| 204 | 3300025913 | Ga0207695_10000087 | Ga0207695_1000008752 | 233 |
| 205 | 3300025913 | Ga0207695_10000863 | Ga0207695_1000086336 | 233 |
| 206 | 3300025913 | Ga0207695_10001230 | Ga0207695_1000123025 | 233 |
| 207 | 3300025913 | Ga0207695_10001645 | Ga0207695_1000164535 | 233 |
| 208 | 3300025913 | Ga0207695_10016157 | Ga0207695_100161572 | 233 |
| 209 | 3300025913 | Ga0207695_10016635 | Ga0207695_100166359 | 233 |
| 210 | 3300025913 | Ga0207695_10044762 | Ga0207695_100447625 | 233 |
| 211 | 3300025913 | Ga0207695_10052763 | Ga0207695_100527634 | 233 |
| 212 | 3300025913 | Ga0207695_10092647 | Ga0207695_100926473 | 233 |
| 213 | 3300025914 | Ga0207671_10000311 | Ga0207671_100003115 | 233 |
| 214 | 3300025914 | Ga0207671_10000931 | Ga0207671_1000093112 | 233 |
| 215 | 3300025914 | Ga0207671_10004520 | Ga0207671_1000452013 | 233 |
| 216 | 3300025914 | Ga0207671_10071468 | Ga0207671_100714682 | 233 |
| 217 | 3300025914 | Ga0207671_10128850 | Ga0207671_101288502 | 233 |
| 218 | 3300025914 | Ga0207671_10194419 | Ga0207671_101944191 | 233 |
| 219 | 3300025917 | Ga0207660_10147988 | Ga0207660_101479882 | 233 |
| 220 | 3300025919 | Ga0207657_10013194 | Ga0207657_100131942 | 233 |
| 221 | 3300025921 | Ga0207652_10024919 | Ga0207652_100249192 | 233 |
| 222 | 3300025921 | Ga0207652_10050800 | Ga0207652_100508002 | 233 |
| 223 | 3300025924 | Ga0207694_10031984 | Ga0207694_100319844 | 233 |
| 224 | 3300025924 | Ga0207694_10048275 | Ga0207694_100482753 | 233 |
| 225 | 3300025924 | Ga0207694_10048733 | Ga0207694_100487332 | 233 |
| 226 | 3300025924 | Ga0207694_10141674 | Ga0207694_101416742 | 233 |
| 227 | 3300025925 | Ga0207650_10692301 | Ga0207650_106923012 | 233 |
| 228 | 3300025928 | Ga0207700_10683205 | Ga0207700_106832052 | 233 |
| 229 | 3300025944 | Ga0207661_10002997 | Ga0207661_100029972 | 233 |
| 230 | 3300025944 | Ga0207661_10129311 | Ga0207661_101293111 | 233 |
| 231 | 3300025949 | Ga0207667_10000098 | Ga0207667_1000009888 | 233 |
| 232 | 3300025949 | Ga0207667_10000279 | Ga0207667_1000027952 | 233 |
| 233 | 3300025949 | Ga0207667_10036738 | Ga0207667_100367384 | 233 |
| 234 | 3300025949 | Ga0207667_10067886 | Ga0207667_100678863 | 233 |
| 235 | 3300025949 | Ga0207667_10092444 | Ga0207667_100924441 | 233 |
| 236 | 3300025949 | Ga0207667_10304291 | Ga0207667_103042912 | 233 |
| 237 | 3300025981 | Ga0207640_10054839 | Ga0207640_100548393 | 233 |
| 238 | 3300025981 | Ga0207640_10116265 | Ga0207640_101162652 | 233 |
| 239 | 3300025981 | Ga0207640_10168360 | Ga0207640_101683602 | 233 |
| 240 | 3300025986 | Ga0207658_10343050 | Ga0207658_103430502 | 233 |
| 241 | 3300026041 | Ga0207639_10009288 | Ga0207639_100092881 | 233 |
| 242 | 3300026041 | Ga0207639_10041905 | Ga0207639_100419053 | 233 |
| 243 | 3300026041 | Ga0207639_10138452 | Ga0207639_101384522 | 233 |
| 244 | 3300026078 | Ga0207702_10039691 | Ga0207702_100396912 | 233 |
| 245 | 3300026078 | Ga0207702_10245666 | Ga0207702_102456662 | 233 |
| 246 | 3300026116 | Ga0207674_10000969 | Ga0207674_1000096921 | 233 |
| 247 | 3300026118 | Ga0207675_100104872 | Ga0207675_1001048722 | 233 |
| 248 | 3300026142 | Ga0207698_10000937 | Ga0207698_1000093715 | 233 |
| 249 | 3300026142 | Ga0207698_10047300 | Ga0207698_100473002 | 233 |
| 250 | 3300026142 | Ga0207698_10069896 | Ga0207698_100698962 | 233 |
| 251 | 3300026142 | Ga0207698_10090694 | Ga0207698_100906942 | 233 |
| 252 | 3300026142 | Ga0207698_10908417 | Ga0207698_109084172 | 233 |
| 253 | 3300027876 | Ga0209974_10178453 | Ga0209974_101784531 | 233 |
| 254 | 3300028379 | Ga0268266_10000068 | Ga0268266_10000068211 | 233 |
| 255 | 3300028381 | Ga0268264_10000079 | Ga0268264_10000079158 | 233 |
| 256 | 3300028381 | Ga0268264_10002043 | Ga0268264_1000204319 | 233 |
| 257 | 3300028786 | Ga0307517_10001481 | Ga0307517_1000148140 | 233 |
| 258 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012280 | 233 |
| 259 | 3300028794 | Ga0307515_10407697 | Ga0307515_104076972 | 233 |
| 260 | 3300030521 | Ga0307511_10000201 | Ga0307511_1000020146 | 233 |
| 261 | 3300031456 | Ga0307513_10143808 | Ga0307513_101438082 | 233 |
| 262 | 3300031730 | Ga0307516_10003458 | Ga0307516_1000345823 | 233 |
| 263 | 3300032126 | Ga0307415_100356310 | Ga0307415_1003563102 | 233 |
| 264 | 3300033179 | Ga0307507_10171810 | Ga0307507_101718102 | 233 |
| 265 | 3300033180 | Ga0307510_10008700 | Ga0307510_1000870013 | 233 |
| 266 | 3300041498 | Ga0451841_0356308 | Ga0451841_0356308_263_964 | 233 |
| 267 | 3300041507 | Ga0451851_1127070 | Ga0451851_1127070_37_738 | 233 |
| 268 | 3300044658 | Ga0466972_0008143 | Ga0466972_0008143_4104_4805 | 233 |
| 269 | 3300044693 | Ga0466961_0153839 | Ga0466961_0153839_533_1234 | 233 |
| 270 | 3300044706 | Ga0466964_0066241 | Ga0466964_0066241_468_1169 | 233 |
| 271 | 3300044735 | Ga0466968_0055589 | Ga0466968_0055589_160_861 | 233 |
| 272 | 3300044842 | Ga0466957_0050124 | Ga0466957_0050124_1301_2002 | 233 |
| 273 | 3300045836 | Ga0466958_0048247 | Ga0466958_0048247_833_1534 | 233 |
| 274 | 3300046460 | Ga0495638_0084489 | Ga0495638_0084489_1063_1764 | 233 |
| 275 | 3300046507 | Ga0495606_0064736 | Ga0495606_0064736_1517_2218 | 233 |
| 276 | 3300046524 | Ga0495648_0086382 | Ga0495648_0086382_319_1020 | 233 |
| 277 | 3300046616 | Ga0495668_0002655 | Ga0495668_0002655_6950_7651 | 233 |
| 278 | 3300046648 | Ga0495611_0000026 | Ga0495611_0000026_3537_4238 | 233 |
| 279 | 3300047443 | Ga0495687_001838 | Ga0495687_001838_620_1321 | 233 |
| 280 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_519551_520252 | 233 |
| 281 | 3300049568 | Ga0501031_0076966 | Ga0501031_0076966_514_1218 | 233 |
| 282 | 3300049569 | Ga0501032_0014560 | Ga0501032_0014560_1623_2327 | 233 |
| 283 | 3300049571 | Ga0501034_0005186 | Ga0501034_0005186_8607_9311 | 233 |
| 284 | 3300049572 | Ga0501036_0005238 | Ga0501036_0005238_1158_1862 | 233 |
| 285 | 3300049573 | Ga0501037_0004139 | Ga0501037_0004139_1815_2519 | 233 |
| 286 | 3300049574 | Ga0501038_0020656 | Ga0501038_0020656_3810_4514 | 233 |
| 287 | 3300049579 | Ga0501043_0034982 | Ga0501043_0034982_638_1342 | 233 |
| 288 | 3300049579 | Ga0501043_0051202 | Ga0501043_0051202_2128_2832 | 233 |
| 289 | 3300049579 | Ga0501043_0249742 | Ga0501043_0249742_598_1299 | 233 |
| 290 | 3300049581 | Ga0501047_0016908 | Ga0501047_0016908_1822_2526 | 233 |
| 291 | 3300049581 | Ga0501047_0071717 | Ga0501047_0071717_2123_2824 | 233 |
| 292 | 3300049581 | Ga0501047_0406186 | Ga0501047_0406186_32_733 | 233 |
| 293 | 3300049686 | Ga0501257_005682 | Ga0501257_005682_252_953 | 233 |
| 294 | 3300049703 | Ga0501219_000704 | Ga0501219_000704_2132_2833 | 233 |
| 295 | 3300049823 | Ga0501044_0001506 | Ga0501044_0001506_1360_2061 | 233 |
| 296 | 3300049823 | Ga0501044_0006596 | Ga0501044_0006596_7814_8518 | 233 |
| 297 | 3300049823 | Ga0501044_0188050 | Ga0501044_0188050_452_1159 | 233 |
| 298 | 3300050005 | Ga0501284_00036 | Ga0501284_00036_38796_39497 | 233 |
| 299 | 3300050005 | Ga0501284_04967 | Ga0501284_04967_24_725 | 233 |
| 300 | 3300050493 | nmdc:mga0k408_12581_c1 | nmdc:mga0k408_12581_c1_1825_2526 | 233 |
| 301 | 3300050509 | nmdc:mga0qj67_359562_c1 | nmdc:mga0qj67_359562_c1_349_1053 | 233 |
| 302 | 3300050510 | nmdc:mga06r32_868945_c1 | nmdc:mga06r32_868945_c1_45_749 | 233 |
| 303 | 3300053090 | Ga0500646_0033314 | Ga0500646_0033314_387_1088 | 233 |
| 304 | 3300053092 | Ga0500583_0000076 | Ga0500583_0000076_36024_36731 | 233 |
| 305 | 3300053092 | Ga0500583_0000557 | Ga0500583_0000557_9979_10680 | 233 |
| 306 | 3300053092 | Ga0500583_0000662 | Ga0500583_0000662_5206_5907 | 233 |
| 307 | 3300053133 | Ga0500655_016844 | Ga0500655_016844_388_1089 | 233 |
| 308 | 3300053139 | Ga0500568_0019739 | Ga0500568_0019739_1289_1990 | 233 |
| 309 | 3300053146 | Ga0500588_0037377 | Ga0500588_0037377_673_1374 | 233 |
| 310 | 3300053147 | Ga0500589_011678 | Ga0500589_011678_716_1417 | 233 |
| 311 | 3300053156 | Ga0500622_0001733 | Ga0500622_0001733_3980_4681 | 233 |
| 312 | 3300053163 | Ga0500639_038750 | Ga0500639_038750_1266_1967 | 233 |
| 313 | 3300053178 | Ga0500637_0142145 | Ga0500637_0142145_649_1350 | 233 |
| 314 | 3300061719 | Ga0466962_0018303 | Ga0466962_0018303_1454_2155 | 233 |
| 315 | 3300001979 | JGI24740J21852_10007294 | JGI24740J21852_100072945 | 234 |
| 316 | 3300001989 | JGI24739J22299_10000030 | JGI24739J22299_1000003019 | 234 |
| 317 | 3300001990 | JGI24737J22298_10056043 | JGI24737J22298_100560431 | 234 |
| 318 | 3300002738 | JGI25154J39366_1000023 | JGI25154J39366_10000239 | 234 |
| 319 | 3300002739 | JGI25158J39367_1022306 | JGI25158J39367_10223061 | 234 |
| 320 | 3300002741 | JGI25157J39369_1001946 | JGI25157J39369_10019463 | 234 |
| 321 | 3300003215 | JGI25153J46596_10000551 | JGI25153J46596_1000055123 | 234 |
| 322 | 3300003316 | rootH1_10108546 | rootH1_101085467 | 234 |
| 323 | 3300003320 | rootH2_10006434 | rootH2_100064342 | 234 |
| 324 | 3300003320 | rootH2_10035434 | rootH2_1003543411 | 234 |
| 325 | 3300003322 | rootL2_10003209 | rootL2_100032091 | 234 |
| 326 | 3300003322 | rootL2_10026021 | rootL2_100260218 | 234 |
| 327 | 3300003323 | rootH1_10005885 | rootH1_100058855 | 234 |
| 328 | 3300003323 | rootH1_10069904 | rootH1_100699046 | 234 |
| 329 | 3300003323 | rootH1_10148649 | rootH1_101486492 | 234 |
| 330 | 3300003323 | rootH1_10162497 | rootH1_101624972 | 234 |
| 331 | 3300003354 | JGI25160J50197_1000262 | JGI25160J50197_100026227 | 234 |
| 332 | 3300003354 | JGI25160J50197_1003292 | JGI25160J50197_10032926 | 234 |
| 333 | 3300003354 | JGI25160J50197_1005474 | JGI25160J50197_10054745 | 234 |
| 334 | 3300003354 | JGI25160J50197_1011378 | JGI25160J50197_10113782 | 234 |
| 335 | 3300003762 | Ga0055542_1004489 | Ga0055542_10044892 | 234 |
| 336 | 3300003771 | Ga0055526_1014933 | Ga0055526_10149332 | 234 |
| 337 | 3300003790 | Ga0055528_1005109 | Ga0055528_10051094 | 234 |
| 338 | 3300003791 | Ga0055530_10000185 | Ga0055530_1000018524 | 234 |
| 339 | 3300003794 | Ga0055531_10000080 | Ga0055531_1000008077 | 234 |
| 340 | 3300003794 | Ga0055531_10015829 | Ga0055531_100158292 | 234 |
| 341 | 3300005262 | Ga0065165_1000658 | Ga0065165_100065843 | 234 |
| 342 | 3300005262 | Ga0065165_1015870 | Ga0065165_10158703 | 234 |
| 343 | 3300005262 | Ga0065165_1016647 | Ga0065165_10166473 | 234 |
| 344 | 3300005327 | Ga0070658_10148731 | Ga0070658_101487312 | 234 |
| 345 | 3300005327 | Ga0070658_10370041 | Ga0070658_103700412 | 234 |
| 346 | 3300005334 | Ga0068869_100023826 | Ga0068869_1000238262 | 234 |
| 347 | 3300005336 | Ga0070680_100062884 | Ga0070680_1000628841 | 234 |
| 348 | 3300005339 | Ga0070660_100001701 | Ga0070660_10000170114 | 234 |
| 349 | 3300005339 | Ga0070660_100162679 | Ga0070660_1001626792 | 234 |
| 350 | 3300005339 | Ga0070660_100364986 | Ga0070660_1003649861 | 234 |
| 351 | 3300005343 | Ga0070687_100002175 | Ga0070687_1000021755 | 234 |
| 352 | 3300005354 | Ga0070675_100170583 | Ga0070675_1001705831 | 234 |
| 353 | 3300005356 | Ga0070674_100028730 | Ga0070674_1000287303 | 234 |
| 354 | 3300005366 | Ga0070659_100020079 | Ga0070659_1000200792 | 234 |
| 355 | 3300005367 | Ga0070667_100175646 | Ga0070667_1001756462 | 234 |
| 356 | 3300005435 | Ga0070714_100097141 | Ga0070714_1000971412 | 234 |
| 357 | 3300005455 | Ga0070663_100023838 | Ga0070663_1000238383 | 234 |
| 358 | 3300005455 | Ga0070663_100650154 | Ga0070663_1006501541 | 234 |
| 359 | 3300005456 | Ga0070678_100012152 | Ga0070678_1000121522 | 234 |
| 360 | 3300005457 | Ga0070662_100225848 | Ga0070662_1002258482 | 234 |
| 361 | 3300005458 | Ga0070681_10018659 | Ga0070681_100186593 | 234 |
| 362 | 3300005458 | Ga0070681_10029652 | Ga0070681_100296524 | 234 |
| 363 | 3300005459 | Ga0068867_100128318 | Ga0068867_1001283182 | 234 |
| 364 | 3300005530 | Ga0070679_100084362 | Ga0070679_1000843622 | 234 |
| 365 | 3300005539 | Ga0068853_100126287 | Ga0068853_1001262872 | 234 |
| 366 | 3300005549 | Ga0070704_100651303 | Ga0070704_1006513031 | 234 |
| 367 | 3300005563 | Ga0068855_100001027 | Ga0068855_10000102715 | 234 |
| 368 | 3300005563 | Ga0068855_100022282 | Ga0068855_1000222826 | 234 |
| 369 | 3300005563 | Ga0068855_100553509 | Ga0068855_1005535092 | 234 |
| 370 | 3300005577 | Ga0068857_100043224 | Ga0068857_1000432244 | 234 |
| 371 | 3300005614 | Ga0068856_100029521 | Ga0068856_1000295212 | 234 |
| 372 | 3300005615 | Ga0070702_100012795 | Ga0070702_1000127954 | 234 |
| 373 | 3300005616 | Ga0068852_100053083 | Ga0068852_1000530833 | 234 |
| 374 | 3300005841 | Ga0068863_100030065 | Ga0068863_1000300656 | 234 |
| 375 | 3300005842 | Ga0068858_100043642 | Ga0068858_1000436424 | 234 |
| 376 | 3300005843 | Ga0068860_100020912 | Ga0068860_1000209125 | 234 |
| 377 | 3300006195 | Ga0075366_10020526 | Ga0075366_100205264 | 234 |
| 378 | 3300006880 | Ga0075429_100415624 | Ga0075429_1004156242 | 234 |
| 379 | 3300006931 | Ga0097620_100312077 | Ga0097620_1003120772 | 234 |
| 380 | 3300009094 | Ga0111539_10103371 | Ga0111539_101033711 | 234 |
| 381 | 3300009176 | Ga0105242_10444777 | Ga0105242_104447771 | 234 |
| 382 | 3300009177 | Ga0105248_11468427 | Ga0105248_114684271 | 234 |
| 383 | 3300009545 | Ga0105237_10001055 | Ga0105237_1000105515 | 234 |
| 384 | 3300009553 | Ga0105249_10044259 | Ga0105249_100442596 | 234 |
| 385 | 3300010375 | Ga0105239_10013173 | Ga0105239_100131737 | 234 |
| 386 | 3300010375 | Ga0105239_10234930 | Ga0105239_102349302 | 234 |
| 387 | 3300013100 | Ga0157373_10003672 | Ga0157373_100036722 | 234 |
| 388 | 3300013102 | Ga0157371_10000218 | Ga0157371_1000021875 | 234 |
| 389 | 3300013102 | Ga0157371_10005551 | Ga0157371_100055517 | 234 |
| 390 | 3300013102 | Ga0157371_10005559 | Ga0157371_100055595 | 234 |
| 391 | 3300013102 | Ga0157371_10009581 | Ga0157371_100095814 | 234 |
| 392 | 3300013102 | Ga0157371_10081734 | Ga0157371_100817342 | 234 |
| 393 | 3300013102 | Ga0157371_10096881 | Ga0157371_100968812 | 234 |
| 394 | 3300013104 | Ga0157370_10001029 | Ga0157370_1000102922 | 234 |
| 395 | 3300013104 | Ga0157370_10003402 | Ga0157370_100034026 | 234 |
| 396 | 3300013104 | Ga0157370_10060865 | Ga0157370_100608652 | 234 |
| 397 | 3300013105 | Ga0157369_10473626 | Ga0157369_104736262 | 234 |
| 398 | 3300013297 | Ga0157378_10005523 | Ga0157378_1000552311 | 234 |
| 399 | 3300013306 | Ga0163162_10005290 | Ga0163162_100052903 | 234 |
| 400 | 3300013306 | Ga0163162_10104996 | Ga0163162_101049964 | 234 |
| 401 | 3300013306 | Ga0163162_10213432 | Ga0163162_102134322 | 234 |
| 402 | 3300013307 | Ga0157372_10007454 | Ga0157372_1000745411 | 234 |
| 403 | 3300013307 | Ga0157372_10010103 | Ga0157372_1001010310 | 234 |
| 404 | 3300013307 | Ga0157372_10028193 | Ga0157372_100281932 | 234 |
| 405 | 3300013307 | Ga0157372_10047349 | Ga0157372_100473492 | 234 |
| 406 | 3300013307 | Ga0157372_10142033 | Ga0157372_101420332 | 234 |
| 407 | 3300013308 | Ga0157375_10104801 | Ga0157375_101048012 | 234 |
| 408 | 3300014325 | Ga0163163_10993533 | Ga0163163_109935332 | 234 |
| 409 | 3300014745 | Ga0157377_10068561 | Ga0157377_100685612 | 234 |
| 410 | 3300015265 | Ga0182005_1000347 | Ga0182005_100034714 | 234 |
| 411 | 3300025208 | Ga0209436_100381 | Ga0209436_1003816 | 234 |
| 412 | 3300025208 | Ga0209436_105597 | Ga0209436_1055973 | 234 |
| 413 | 3300025242 | Ga0209258_100116 | Ga0209258_10011691 | 234 |
| 414 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004586 | 234 |
| 415 | 3300025250 | Ga0209026_1000136 | Ga0209026_100013673 | 234 |
| 416 | 3300025254 | Ga0209148_1000175 | Ga0209148_100017522 | 234 |
| 417 | 3300025258 | Ga0209129_1013267 | Ga0209129_10132672 | 234 |
| 418 | 3300025273 | Ga0209673_1000203 | Ga0209673_1000203104 | 234 |
| 419 | 3300025284 | Ga0209130_1001665 | Ga0209130_10016657 | 234 |
| 420 | 3300025295 | Ga0209564_1029275 | Ga0209564_10292751 | 234 |
| 421 | 3300025297 | Ga0209758_1003355 | Ga0209758_10033555 | 234 |
| 422 | 3300025297 | Ga0209758_1035284 | Ga0209758_10352843 | 234 |
| 423 | 3300025298 | Ga0209050_1000276 | Ga0209050_100027645 | 234 |
| 424 | 3300025302 | Ga0207426_1000024 | Ga0207426_1000024114 | 234 |
| 425 | 3300025302 | Ga0207426_1000059 | Ga0207426_100005945 | 234 |
| 426 | 3300025302 | Ga0207426_1000957 | Ga0207426_100095724 | 234 |
| 427 | 3300025302 | Ga0207426_1001807 | Ga0207426_100180716 | 234 |
| 428 | 3300025302 | Ga0207426_1004921 | Ga0207426_10049212 | 234 |
| 429 | 3300025303 | Ga0209051_1028556 | Ga0209051_10285563 | 234 |
| 430 | 3300025304 | Ga0209257_1000004 | Ga0209257_100000477 | 234 |
| 431 | 3300025304 | Ga0209257_1000736 | Ga0209257_100073610 | 234 |
| 432 | 3300025904 | Ga0207647_10015325 | Ga0207647_100153252 | 234 |
| 433 | 3300025904 | Ga0207647_10133698 | Ga0207647_101336981 | 234 |
| 434 | 3300025909 | Ga0207705_10016061 | Ga0207705_100160615 | 234 |
| 435 | 3300025912 | Ga0207707_10021785 | Ga0207707_100217852 | 234 |
| 436 | 3300025912 | Ga0207707_10031463 | Ga0207707_100314632 | 234 |
| 437 | 3300025914 | Ga0207671_10285284 | Ga0207671_102852842 | 234 |
| 438 | 3300025917 | Ga0207660_10011620 | Ga0207660_100116203 | 234 |
| 439 | 3300025917 | Ga0207660_10159791 | Ga0207660_101597912 | 234 |
| 440 | 3300025919 | Ga0207657_10004301 | Ga0207657_1000430114 | 234 |
| 441 | 3300025919 | Ga0207657_10055721 | Ga0207657_100557212 | 234 |
| 442 | 3300025919 | Ga0207657_10062275 | Ga0207657_100622754 | 234 |
| 443 | 3300025921 | Ga0207652_10015279 | Ga0207652_100152794 | 234 |
| 444 | 3300025921 | Ga0207652_10098398 | Ga0207652_100983982 | 234 |
| 445 | 3300025929 | Ga0207664_10259690 | Ga0207664_102596902 | 234 |
| 446 | 3300025932 | Ga0207690_10152754 | Ga0207690_101527542 | 234 |
| 447 | 3300025937 | Ga0207669_10049990 | Ga0207669_100499902 | 234 |
| 448 | 3300025942 | Ga0207689_10074508 | Ga0207689_100745084 | 234 |
| 449 | 3300025945 | Ga0207679_10051676 | Ga0207679_100516763 | 234 |
| 450 | 3300025949 | Ga0207667_10004113 | Ga0207667_100041136 | 234 |
| 451 | 3300025949 | Ga0207667_10015607 | Ga0207667_100156074 | 234 |
| 452 | 3300025949 | Ga0207667_10153360 | Ga0207667_101533603 | 234 |
| 453 | 3300025949 | Ga0207667_10446595 | Ga0207667_104465952 | 234 |
| 454 | 3300026041 | Ga0207639_10111554 | Ga0207639_101115543 | 234 |
| 455 | 3300026067 | Ga0207678_10136670 | Ga0207678_101366703 | 234 |
| 456 | 3300026078 | Ga0207702_10100345 | Ga0207702_101003453 | 234 |
| 457 | 3300026118 | Ga0207675_100645481 | Ga0207675_1006454811 | 234 |
| 458 | 3300026142 | Ga0207698_10132943 | Ga0207698_101329432 | 234 |
| 459 | 3300026142 | Ga0207698_10575339 | Ga0207698_105753392 | 234 |
| 460 | 3300028381 | Ga0268264_10004073 | Ga0268264_100040734 | 234 |
| 461 | 3300032004 | Ga0307414_10121535 | Ga0307414_101215353 | 234 |
| 462 | 3300037312 | Ga0395899_0009123 | Ga0395899_0009123_332_1039 | 234 |
| 463 | 3300037312 | Ga0395899_0026127 | Ga0395899_0026127_1677_2384 | 234 |
| 464 | 3300037312 | Ga0395899_0039218 | Ga0395899_0039218_1753_2460 | 234 |
| 465 | 3300037418 | Ga0395900_0086961 | Ga0395900_0086961_337_1044 | 234 |
| 466 | 3300037418 | Ga0395900_0167250 | Ga0395900_0167250_1396_2103 | 234 |
| 467 | 3300037418 | Ga0395900_0269218 | Ga0395900_0269218_641_1348 | 234 |
| 468 | 3300037466 | Ga0395898_0098120 | Ga0395898_0098120_2087_2794 | 234 |
| 469 | 3300037466 | Ga0395898_0475765 | Ga0395898_0475765_376_1083 | 234 |
| 470 | 3300037471 | Ga0395905_0249181 | Ga0395905_0249181_528_1235 | 234 |
| 471 | 3300038443 | Ga0395901_0007671 | Ga0395901_0007671_9432_10139 | 234 |
| 472 | 3300038443 | Ga0395901_0028563 | Ga0395901_0028563_4626_5333 | 234 |
| 473 | 3300038443 | Ga0395901_0055582 | Ga0395901_0055582_292_999 | 234 |
| 474 | 3300038443 | Ga0395901_0122950 | Ga0395901_0122950_1157_1864 | 234 |
| 475 | 3300041452 | Ga0451793_0181996 | Ga0451793_0181996_18_725 | 234 |
| 476 | 3300041463 | Ga0451804_1111977 | Ga0451804_1111977_47_751 | 234 |
| 477 | 3300042004 | Ga0439445_0031519 | Ga0439445_0031519_11_721 | 234 |
| 478 | 3300042007 | Ga0439449_0082707 | Ga0439449_0082707_298_1005 | 234 |
| 479 | 3300042876 | Ga0451577_0280639 | Ga0451577_0280639_279_983 | 234 |
| 480 | 3300044683 | Ga0466965_0005791 | Ga0466965_0005791_4384_5091 | 234 |
| 481 | 3300046453 | Ga0495627_029697 | Ga0495627_029697_269_976 | 234 |
| 482 | 3300046558 | Ga0495633_0000116 | Ga0495633_0000116_55457_56164 | 234 |
| 483 | 3300048929 | Ga0496126_0015380 | Ga0496126_0015380_6384_7091 | 234 |
| 484 | 3300049570 | Ga0501033_0044589 | Ga0501033_0044589_1608_2318 | 234 |
| 485 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_338324_339031 | 234 |
| 486 | 3300049571 | Ga0501034_0028416 | Ga0501034_0028416_3634_4344 | 234 |
| 487 | 3300049571 | Ga0501034_0053717 | Ga0501034_0053717_1556_2266 | 234 |
| 488 | 3300049822 | Ga0501035_0319559 | Ga0501035_0319559_227_937 | 234 |
| 489 | 3300049823 | Ga0501044_0067425 | Ga0501044_0067425_2653_3363 | 234 |
| 490 | 3300050493 | nmdc:mga0k408_257387_c1 | nmdc:mga0k408_257387_c1_293_997 | 234 |
| 491 | 3300050508 | nmdc:mga09592_198000_c1 | nmdc:mga09592_198000_c1_235_939 | 234 |
| 492 | 3300053088 | Ga0500644_0000260 | Ga0500644_0000260_4649_5356 | 234 |
| 493 | 3300053090 | Ga0500646_0002227 | Ga0500646_0002227_2269_2976 | 234 |
| 494 | 3300053092 | Ga0500583_0050409 | Ga0500583_0050409_1001_1708 | 234 |
| 495 | 3300053093 | Ga0500651_0031174 | Ga0500651_0031174_1996_2703 | 234 |
| 496 | 3300053109 | Ga0500569_000126 | Ga0500569_000126_965_1672 | 234 |
| 497 | 3300053121 | Ga0500607_084876 | Ga0500607_084876_169_876 | 234 |
| 498 | 3300053134 | Ga0500658_0003845 | Ga0500658_0003845_4602_5309 | 234 |
| 499 | 3300053136 | Ga0500559_0064467 | Ga0500559_0064467_114_821 | 234 |
| 500 | 3300053142 | Ga0500577_0010546 | Ga0500577_0010546_1707_2414 | 234 |
| 501 | 3300053148 | Ga0500590_125891 | Ga0500590_125891_376_1083 | 234 |
| 502 | 3300053153 | Ga0500616_0116780 | Ga0500616_0116780_290_997 | 234 |
| 503 | 3300053156 | Ga0500622_0000212 | Ga0500622_0000212_4239_4946 | 234 |
| 504 | 3300053160 | Ga0500633_0019517 | Ga0500633_0019517_856_1563 | 234 |
| 505 | 3300053177 | Ga0500636_0002821 | Ga0500636_0002821_972_1679 | 234 |
| 506 | 2162886006 | SwRhRL3b_contig_981202 | SwRhRL3b_0159.00000260 | 235 |
| 507 | 2162886011 | MRS1b_contig_3268472 | MRS1b_0325.00000700 | 235 |
| 508 | 2162886012 | MBSR1b_contig_11128225 | MBSR1b_0076.00000370 | 235 |
| 509 | 2162886012 | MBSR1b_contig_5448556 | MBSR1b_0478.00005130 | 235 |
| 510 | 3300003203 | JGI25406J46586_10001649 | JGI25406J46586_100016497 | 235 |
| 511 | 3300003316 | rootH1_10119675 | rootH1_101196752 | 235 |
| 512 | 3300003316 | rootH1_10189687 | rootH1_101896872 | 235 |
| 513 | 3300003322 | rootL2_10109532 | rootL2_101095324 | 235 |
| 514 | 3300003323 | rootH1_10174566 | rootH1_101745664 | 235 |
| 515 | 3300005288 | Ga0065714_10169900 | Ga0065714_101699002 | 235 |
| 516 | 3300005289 | Ga0065704_10083111 | Ga0065704_100831114 | 235 |
| 517 | 3300005290 | Ga0065712_10001811 | Ga0065712_100018113 | 235 |
| 518 | 3300005290 | Ga0065712_10131490 | Ga0065712_101314902 | 235 |
| 519 | 3300005293 | Ga0065715_10107465 | Ga0065715_101074652 | 235 |
| 520 | 3300005328 | Ga0070676_10026974 | Ga0070676_100269743 | 235 |
| 521 | 3300005329 | Ga0070683_100010919 | Ga0070683_1000109195 | 235 |
| 522 | 3300005329 | Ga0070683_100016236 | Ga0070683_1000162364 | 235 |
| 523 | 3300005330 | Ga0070690_100008208 | Ga0070690_1000082082 | 235 |
| 524 | 3300005330 | Ga0070690_100042207 | Ga0070690_1000422072 | 235 |
| 525 | 3300005330 | Ga0070690_100047194 | Ga0070690_1000471942 | 235 |
| 526 | 3300005331 | Ga0070670_100042974 | Ga0070670_1000429742 | 235 |
| 527 | 3300005331 | Ga0070670_100080557 | Ga0070670_1000805572 | 235 |
| 528 | 3300005331 | Ga0070670_100381812 | Ga0070670_1003818122 | 235 |
| 529 | 3300005333 | Ga0070677_10185787 | Ga0070677_101857871 | 235 |
| 530 | 3300005334 | Ga0068869_100010867 | Ga0068869_1000108675 | 235 |
| 531 | 3300005334 | Ga0068869_100023482 | Ga0068869_1000234824 | 235 |
| 532 | 3300005334 | Ga0068869_100025876 | Ga0068869_1000258764 | 235 |
| 533 | 3300005334 | Ga0068869_100545350 | Ga0068869_1005453501 | 235 |
| 534 | 3300005335 | Ga0070666_10019589 | Ga0070666_100195894 | 235 |
| 535 | 3300005335 | Ga0070666_10071360 | Ga0070666_100713602 | 235 |
| 536 | 3300005335 | Ga0070666_10094173 | Ga0070666_100941732 | 235 |
| 537 | 3300005336 | Ga0070680_100230985 | Ga0070680_1002309852 | 235 |
| 538 | 3300005338 | Ga0068868_100008122 | Ga0068868_1000081222 | 235 |
| 539 | 3300005338 | Ga0068868_100050988 | Ga0068868_1000509882 | 235 |
| 540 | 3300005338 | Ga0068868_100148964 | Ga0068868_1001489641 | 235 |
| 541 | 3300005338 | Ga0068868_100163007 | Ga0068868_1001630072 | 235 |
| 542 | 3300005339 | Ga0070660_100222651 | Ga0070660_1002226512 | 235 |
| 543 | 3300005340 | Ga0070689_100083354 | Ga0070689_1000833543 | 235 |
| 544 | 3300005340 | Ga0070689_100092162 | Ga0070689_1000921622 | 235 |
| 545 | 3300005340 | Ga0070689_100166838 | Ga0070689_1001668382 | 235 |
| 546 | 3300005340 | Ga0070689_100215216 | Ga0070689_1002152162 | 235 |
| 547 | 3300005341 | Ga0070691_10014940 | Ga0070691_100149403 | 235 |
| 548 | 3300005344 | Ga0070661_100010396 | Ga0070661_1000103965 | 235 |
| 549 | 3300005344 | Ga0070661_100169976 | Ga0070661_1001699762 | 235 |
| 550 | 3300005344 | Ga0070661_100196607 | Ga0070661_1001966072 | 235 |
| 551 | 3300005347 | Ga0070668_100038898 | Ga0070668_1000388982 | 235 |
| 552 | 3300005347 | Ga0070668_100084352 | Ga0070668_1000843523 | 235 |
| 553 | 3300005347 | Ga0070668_100445560 | Ga0070668_1004455601 | 235 |
| 554 | 3300005353 | Ga0070669_100001473 | Ga0070669_1000014734 | 235 |
| 555 | 3300005353 | Ga0070669_100002379 | Ga0070669_1000023799 | 235 |
| 556 | 3300005353 | Ga0070669_100232571 | Ga0070669_1002325711 | 235 |
| 557 | 3300005353 | Ga0070669_100330819 | Ga0070669_1003308192 | 235 |
| 558 | 3300005353 | Ga0070669_100365431 | Ga0070669_1003654312 | 235 |
| 559 | 3300005354 | Ga0070675_100002848 | Ga0070675_1000028487 | 235 |
| 560 | 3300005354 | Ga0070675_100147193 | Ga0070675_1001471932 | 235 |
| 561 | 3300005354 | Ga0070675_100174451 | Ga0070675_1001744513 | 235 |
| 562 | 3300005355 | Ga0070671_100139769 | Ga0070671_1001397692 | 235 |
| 563 | 3300005356 | Ga0070674_100111383 | Ga0070674_1001113833 | 235 |
| 564 | 3300005364 | Ga0070673_100016516 | Ga0070673_1000165165 | 235 |
| 565 | 3300005364 | Ga0070673_100056711 | Ga0070673_1000567112 | 235 |
| 566 | 3300005364 | Ga0070673_100188037 | Ga0070673_1001880371 | 235 |
| 567 | 3300005364 | Ga0070673_100206890 | Ga0070673_1002068902 | 235 |
| 568 | 3300005364 | Ga0070673_100231519 | Ga0070673_1002315192 | 235 |
| 569 | 3300005365 | Ga0070688_100014189 | Ga0070688_1000141893 | 235 |
| 570 | 3300005365 | Ga0070688_100032799 | Ga0070688_1000327992 | 235 |
| 571 | 3300005366 | Ga0070659_100069244 | Ga0070659_1000692442 | 235 |
| 572 | 3300005367 | Ga0070667_100021229 | Ga0070667_1000212292 | 235 |
| 573 | 3300005367 | Ga0070667_100105559 | Ga0070667_1001055592 | 235 |
| 574 | 3300005367 | Ga0070667_100124634 | Ga0070667_1001246342 | 235 |
| 575 | 3300005367 | Ga0070667_100197785 | Ga0070667_1001977852 | 235 |
| 576 | 3300005367 | Ga0070667_100531129 | Ga0070667_1005311291 | 235 |
| 577 | 3300005367 | Ga0070667_100620507 | Ga0070667_1006205072 | 235 |
| 578 | 3300005438 | Ga0070701_10010862 | Ga0070701_100108622 | 235 |
| 579 | 3300005441 | Ga0070700_100017034 | Ga0070700_1000170344 | 235 |
| 580 | 3300005456 | Ga0070678_100027845 | Ga0070678_1000278452 | 235 |
| 581 | 3300005456 | Ga0070678_100113898 | Ga0070678_1001138983 | 235 |
| 582 | 3300005457 | Ga0070662_100003337 | Ga0070662_1000033377 | 235 |
| 583 | 3300005457 | Ga0070662_100007311 | Ga0070662_1000073118 | 235 |
| 584 | 3300005457 | Ga0070662_100043670 | Ga0070662_1000436704 | 235 |
| 585 | 3300005457 | Ga0070662_100644692 | Ga0070662_1006446922 | 235 |
| 586 | 3300005458 | Ga0070681_10409182 | Ga0070681_104091822 | 235 |
| 587 | 3300005459 | Ga0068867_100003149 | Ga0068867_1000031496 | 235 |
| 588 | 3300005459 | Ga0068867_100011145 | Ga0068867_1000111452 | 235 |
| 589 | 3300005459 | Ga0068867_100034427 | Ga0068867_1000344274 | 235 |
| 590 | 3300005459 | Ga0068867_100039464 | Ga0068867_1000394644 | 235 |
| 591 | 3300005459 | Ga0068867_100069965 | Ga0068867_1000699652 | 235 |
| 592 | 3300005459 | Ga0068867_100684361 | Ga0068867_1006843611 | 235 |
| 593 | 3300005466 | Ga0070685_10005889 | Ga0070685_100058892 | 235 |
| 594 | 3300005466 | Ga0070685_10057717 | Ga0070685_100577171 | 235 |
| 595 | 3300005467 | Ga0070706_100160349 | Ga0070706_1001603493 | 235 |
| 596 | 3300005518 | Ga0070699_100744618 | Ga0070699_1007446181 | 235 |
| 597 | 3300005535 | Ga0070684_100002319 | Ga0070684_1000023195 | 235 |
| 598 | 3300005535 | Ga0070684_100018469 | Ga0070684_1000184695 | 235 |
| 599 | 3300005535 | Ga0070684_100045790 | Ga0070684_1000457903 | 235 |
| 600 | 3300005539 | Ga0068853_100012660 | Ga0068853_1000126605 | 235 |
| 601 | 3300005539 | Ga0068853_100026641 | Ga0068853_1000266414 | 235 |
| 602 | 3300005539 | Ga0068853_100112140 | Ga0068853_1001121403 | 235 |
| 603 | 3300005539 | Ga0068853_100158738 | Ga0068853_1001587382 | 235 |
| 604 | 3300005543 | Ga0070672_100264670 | Ga0070672_1002646702 | 235 |
| 605 | 3300005543 | Ga0070672_100270528 | Ga0070672_1002705282 | 235 |
| 606 | 3300005544 | Ga0070686_100002348 | Ga0070686_1000023482 | 235 |
| 607 | 3300005547 | Ga0070693_100155375 | Ga0070693_1001553751 | 235 |
| 608 | 3300005547 | Ga0070693_100367100 | Ga0070693_1003671002 | 235 |
| 609 | 3300005547 | Ga0070693_100429698 | Ga0070693_1004296982 | 235 |
| 610 | 3300005548 | Ga0070665_100010501 | Ga0070665_1000105019 | 235 |
| 611 | 3300005564 | Ga0070664_100020090 | Ga0070664_1000200905 | 235 |
| 612 | 3300005564 | Ga0070664_100154183 | Ga0070664_1001541832 | 235 |
| 613 | 3300005564 | Ga0070664_100304484 | Ga0070664_1003044842 | 235 |
| 614 | 3300005577 | Ga0068857_100009364 | Ga0068857_1000093645 | 235 |
| 615 | 3300005577 | Ga0068857_100215361 | Ga0068857_1002153612 | 235 |
| 616 | 3300005577 | Ga0068857_100627451 | Ga0068857_1006274512 | 235 |
| 617 | 3300005578 | Ga0068854_100023108 | Ga0068854_1000231082 | 235 |
| 618 | 3300005578 | Ga0068854_100295385 | Ga0068854_1002953852 | 235 |
| 619 | 3300005616 | Ga0068852_100027749 | Ga0068852_1000277495 | 235 |
| 620 | 3300005616 | Ga0068852_100183721 | Ga0068852_1001837212 | 235 |
| 621 | 3300005616 | Ga0068852_100464625 | Ga0068852_1004646252 | 235 |
| 622 | 3300005617 | Ga0068859_100052034 | Ga0068859_1000520342 | 235 |
| 623 | 3300005617 | Ga0068859_100057535 | Ga0068859_1000575354 | 235 |
| 624 | 3300005617 | Ga0068859_100065234 | Ga0068859_1000652342 | 235 |
| 625 | 3300005617 | Ga0068859_100206749 | Ga0068859_1002067492 | 235 |
| 626 | 3300005617 | Ga0068859_100402314 | Ga0068859_1004023141 | 235 |
| 627 | 3300005618 | Ga0068864_100327593 | Ga0068864_1003275932 | 235 |
| 628 | 3300005618 | Ga0068864_100554786 | Ga0068864_1005547862 | 235 |
| 629 | 3300005718 | Ga0068866_10089167 | Ga0068866_100891672 | 235 |
| 630 | 3300005718 | Ga0068866_10205294 | Ga0068866_102052941 | 235 |
| 631 | 3300005719 | Ga0068861_100005965 | Ga0068861_1000059652 | 235 |
| 632 | 3300005719 | Ga0068861_100142260 | Ga0068861_1001422603 | 235 |
| 633 | 3300005840 | Ga0068870_10015841 | Ga0068870_100158412 | 235 |
| 634 | 3300005840 | Ga0068870_10238647 | Ga0068870_102386472 | 235 |
| 635 | 3300005841 | Ga0068863_100327402 | Ga0068863_1003274021 | 235 |
| 636 | 3300005841 | Ga0068863_100363016 | Ga0068863_1003630162 | 235 |
| 637 | 3300005841 | Ga0068863_100424242 | Ga0068863_1004242423 | 235 |
| 638 | 3300005842 | Ga0068858_100069589 | Ga0068858_1000695892 | 235 |
| 639 | 3300005842 | Ga0068858_100081884 | Ga0068858_1000818842 | 235 |
| 640 | 3300005842 | Ga0068858_100184815 | Ga0068858_1001848152 | 235 |
| 641 | 3300005842 | Ga0068858_100478197 | Ga0068858_1004781972 | 235 |
| 642 | 3300005843 | Ga0068860_100061044 | Ga0068860_1000610442 | 235 |
| 643 | 3300005843 | Ga0068860_100096462 | Ga0068860_1000964622 | 235 |
| 644 | 3300005843 | Ga0068860_100122333 | Ga0068860_1001223332 | 235 |
| 645 | 3300005843 | Ga0068860_100142112 | Ga0068860_1001421122 | 235 |
| 646 | 3300005843 | Ga0068860_100165733 | Ga0068860_1001657332 | 235 |
| 647 | 3300005844 | Ga0068862_100003320 | Ga0068862_1000033207 | 235 |
| 648 | 3300005844 | Ga0068862_100127044 | Ga0068862_1001270443 | 235 |
| 649 | 3300005844 | Ga0068862_100185882 | Ga0068862_1001858822 | 235 |
| 650 | 3300005844 | Ga0068862_100207999 | Ga0068862_1002079992 | 235 |
| 651 | 3300005844 | Ga0068862_100238029 | Ga0068862_1002380292 | 235 |
| 652 | 3300005844 | Ga0068862_100693688 | Ga0068862_1006936882 | 235 |
| 653 | 3300005985 | Ga0081539_10001169 | Ga0081539_1000116926 | 235 |
| 654 | 3300006195 | Ga0075366_10008445 | Ga0075366_100084457 | 235 |
| 655 | 3300006195 | Ga0075366_10013810 | Ga0075366_100138106 | 235 |
| 656 | 3300006237 | Ga0097621_100034071 | Ga0097621_1000340712 | 235 |
| 657 | 3300006237 | Ga0097621_100213347 | Ga0097621_1002133471 | 235 |
| 658 | 3300006237 | Ga0097621_100483174 | Ga0097621_1004831742 | 235 |
| 659 | 3300006358 | Ga0068871_100005800 | Ga0068871_1000058008 | 235 |
| 660 | 3300006358 | Ga0068871_100011294 | Ga0068871_1000112946 | 235 |
| 661 | 3300006358 | Ga0068871_100156605 | Ga0068871_1001566052 | 235 |
| 662 | 3300006358 | Ga0068871_100258495 | Ga0068871_1002584952 | 235 |
| 663 | 3300006358 | Ga0068871_100311914 | Ga0068871_1003119142 | 235 |
| 664 | 3300006881 | Ga0068865_100014376 | Ga0068865_1000143764 | 235 |
| 665 | 3300006881 | Ga0068865_100054058 | Ga0068865_1000540582 | 235 |
| 666 | 3300006881 | Ga0068865_100174859 | Ga0068865_1001748592 | 235 |
| 667 | 3300006931 | Ga0097620_100052035 | Ga0097620_1000520352 | 235 |
| 668 | 3300006931 | Ga0097620_100057538 | Ga0097620_1000575384 | 235 |
| 669 | 3300006931 | Ga0097620_100065241 | Ga0097620_1000652414 | 235 |
| 670 | 3300006931 | Ga0097620_100206762 | Ga0097620_1002067622 | 235 |
| 671 | 3300006931 | Ga0097620_100402270 | Ga0097620_1004022701 | 235 |
| 672 | 3300009093 | Ga0105240_10300854 | Ga0105240_103008542 | 235 |
| 673 | 3300009093 | Ga0105240_10705280 | Ga0105240_107052802 | 235 |
| 674 | 3300009094 | Ga0111539_10005159 | Ga0111539_1000515915 | 235 |
| 675 | 3300009101 | Ga0105247_10000312 | Ga0105247_1000031232 | 235 |
| 676 | 3300009101 | Ga0105247_10047668 | Ga0105247_100476682 | 235 |
| 677 | 3300009148 | Ga0105243_10082441 | Ga0105243_100824412 | 235 |
| 678 | 3300009174 | Ga0105241_10040180 | Ga0105241_100401802 | 235 |
| 679 | 3300009176 | Ga0105242_10023950 | Ga0105242_100239502 | 235 |
| 680 | 3300009176 | Ga0105242_10027545 | Ga0105242_100275452 | 235 |
| 681 | 3300009176 | Ga0105242_10135198 | Ga0105242_101351981 | 235 |
| 682 | 3300009176 | Ga0105242_10173117 | Ga0105242_101731172 | 235 |
| 683 | 3300009176 | Ga0105242_10268998 | Ga0105242_102689982 | 235 |
| 684 | 3300009176 | Ga0105242_10297728 | Ga0105242_102977282 | 235 |
| 685 | 3300009177 | Ga0105248_10192276 | Ga0105248_101922761 | 235 |
| 686 | 3300009553 | Ga0105249_10010102 | Ga0105249_100101023 | 235 |
| 687 | 3300009553 | Ga0105249_10013950 | Ga0105249_100139505 | 235 |
| 688 | 3300009553 | Ga0105249_10017890 | Ga0105249_100178902 | 235 |
| 689 | 3300009553 | Ga0105249_10820063 | Ga0105249_108200632 | 235 |
| 690 | 3300010375 | Ga0105239_10131992 | Ga0105239_101319922 | 235 |
| 691 | 3300010375 | Ga0105239_10398219 | Ga0105239_103982192 | 235 |
| 692 | 3300011119 | Ga0105246_10123991 | Ga0105246_101239911 | 235 |
| 693 | 3300011119 | Ga0105246_10162933 | Ga0105246_101629332 | 235 |
| 694 | 3300013100 | Ga0157373_10031894 | Ga0157373_100318942 | 235 |
| 695 | 3300013100 | Ga0157373_10145917 | Ga0157373_101459172 | 235 |
| 696 | 3300013102 | Ga0157371_10010719 | Ga0157371_100107191 | 235 |
| 697 | 3300013102 | Ga0157371_10014278 | Ga0157371_100142782 | 235 |
| 698 | 3300013102 | Ga0157371_10176975 | Ga0157371_101769752 | 235 |
| 699 | 3300013104 | Ga0157370_10465930 | Ga0157370_104659301 | 235 |
| 700 | 3300013105 | Ga0157369_10025346 | Ga0157369_100253466 | 235 |
| 701 | 3300013105 | Ga0157369_10101397 | Ga0157369_101013972 | 235 |
| 702 | 3300013105 | Ga0157369_10216187 | Ga0157369_102161872 | 235 |
| 703 | 3300013105 | Ga0157369_10868613 | Ga0157369_108686131 | 235 |
| 704 | 3300013296 | Ga0157374_10025078 | Ga0157374_100250782 | 235 |
| 705 | 3300013296 | Ga0157374_10038891 | Ga0157374_100388913 | 235 |
| 706 | 3300013296 | Ga0157374_10042729 | Ga0157374_100427294 | 235 |
| 707 | 3300013296 | Ga0157374_10152419 | Ga0157374_101524192 | 235 |
| 708 | 3300013296 | Ga0157374_10165790 | Ga0157374_101657902 | 235 |
| 709 | 3300013296 | Ga0157374_10221176 | Ga0157374_102211762 | 235 |
| 710 | 3300013297 | Ga0157378_10037242 | Ga0157378_100372422 | 235 |
| 711 | 3300013297 | Ga0157378_10062778 | Ga0157378_100627783 | 235 |
| 712 | 3300013297 | Ga0157378_10142475 | Ga0157378_101424752 | 235 |
| 713 | 3300013297 | Ga0157378_10159054 | Ga0157378_101590542 | 235 |
| 714 | 3300013297 | Ga0157378_10398812 | Ga0157378_103988122 | 235 |
| 715 | 3300013297 | Ga0157378_11105649 | Ga0157378_111056492 | 235 |
| 716 | 3300013306 | Ga0163162_10000131 | Ga0163162_1000013156 | 235 |
| 717 | 3300013306 | Ga0163162_10038605 | Ga0163162_100386054 | 235 |
| 718 | 3300013306 | Ga0163162_10039779 | Ga0163162_100397792 | 235 |
| 719 | 3300013306 | Ga0163162_10061753 | Ga0163162_100617533 | 235 |
| 720 | 3300013306 | Ga0163162_10073172 | Ga0163162_100731721 | 235 |
| 721 | 3300013306 | Ga0163162_10131408 | Ga0163162_101314082 | 235 |
| 722 | 3300013306 | Ga0163162_10137584 | Ga0163162_101375842 | 235 |
| 723 | 3300013306 | Ga0163162_10151565 | Ga0163162_101515651 | 235 |
| 724 | 3300013306 | Ga0163162_10616528 | Ga0163162_106165282 | 235 |
| 725 | 3300013307 | Ga0157372_10002419 | Ga0157372_100024198 | 235 |
| 726 | 3300013307 | Ga0157372_10104492 | Ga0157372_101044921 | 235 |
| 727 | 3300013307 | Ga0157372_10213475 | Ga0157372_102134753 | 235 |
| 728 | 3300013307 | Ga0157372_10351612 | Ga0157372_103516122 | 235 |
| 729 | 3300013307 | Ga0157372_10417051 | Ga0157372_104170512 | 235 |
| 730 | 3300013307 | Ga0157372_10489888 | Ga0157372_104898882 | 235 |
| 731 | 3300013307 | Ga0157372_10617596 | Ga0157372_106175961 | 235 |
| 732 | 3300013307 | Ga0157372_10728386 | Ga0157372_107283861 | 235 |
| 733 | 3300013307 | Ga0157372_10747771 | Ga0157372_107477712 | 235 |
| 734 | 3300013308 | Ga0157375_10017033 | Ga0157375_100170332 | 235 |
| 735 | 3300013308 | Ga0157375_10020278 | Ga0157375_100202784 | 235 |
| 736 | 3300013308 | Ga0157375_10022629 | Ga0157375_100226295 | 235 |
| 737 | 3300013308 | Ga0157375_10041404 | Ga0157375_100414042 | 235 |
| 738 | 3300013308 | Ga0157375_10067495 | Ga0157375_100674952 | 235 |
| 739 | 3300013308 | Ga0157375_10546896 | Ga0157375_105468962 | 235 |
| 740 | 3300013308 | Ga0157375_10700957 | Ga0157375_107009571 | 235 |
| 741 | 3300013308 | Ga0157375_11090716 | Ga0157375_110907161 | 235 |
| 742 | 3300014325 | Ga0163163_10000368 | Ga0163163_100003684 | 235 |
| 743 | 3300014325 | Ga0163163_10000591 | Ga0163163_1000059135 | 235 |
| 744 | 3300014325 | Ga0163163_10002613 | Ga0163163_100026135 | 235 |
| 745 | 3300014325 | Ga0163163_10035392 | Ga0163163_100353925 | 235 |
| 746 | 3300014325 | Ga0163163_10520060 | Ga0163163_105200602 | 235 |
| 747 | 3300014326 | Ga0157380_10001169 | Ga0157380_1000116915 | 235 |
| 748 | 3300014326 | Ga0157380_10013173 | Ga0157380_100131736 | 235 |
| 749 | 3300014326 | Ga0157380_10172186 | Ga0157380_101721862 | 235 |
| 750 | 3300014326 | Ga0157380_10245907 | Ga0157380_102459072 | 235 |
| 751 | 3300014326 | Ga0157380_10346062 | Ga0157380_103460622 | 235 |
| 752 | 3300014745 | Ga0157377_10000583 | Ga0157377_1000058311 | 235 |
| 753 | 3300014745 | Ga0157377_10010639 | Ga0157377_100106392 | 235 |
| 754 | 3300014745 | Ga0157377_10104123 | Ga0157377_101041232 | 235 |
| 755 | 3300014968 | Ga0157379_10065726 | Ga0157379_100657263 | 235 |
| 756 | 3300014968 | Ga0157379_10115111 | Ga0157379_101151113 | 235 |
| 757 | 3300014968 | Ga0157379_10178514 | Ga0157379_101785142 | 235 |
| 758 | 3300014968 | Ga0157379_10301294 | Ga0157379_103012942 | 235 |
| 759 | 3300014968 | Ga0157379_10319530 | Ga0157379_103195302 | 235 |
| 760 | 3300014968 | Ga0157379_10352364 | Ga0157379_103523642 | 235 |
| 761 | 3300014969 | Ga0157376_10071819 | Ga0157376_100718192 | 235 |
| 762 | 3300014969 | Ga0157376_10144156 | Ga0157376_101441562 | 235 |
| 763 | 3300014969 | Ga0157376_10212351 | Ga0157376_102123512 | 235 |
| 764 | 3300017792 | Ga0163161_10014248 | Ga0163161_100142486 | 235 |
| 765 | 3300017792 | Ga0163161_10061547 | Ga0163161_100615472 | 235 |
| 766 | 3300017792 | Ga0163161_10210465 | Ga0163161_102104652 | 235 |
| 767 | 3300017792 | Ga0163161_10832109 | Ga0163161_108321091 | 235 |
| 768 | 3300025315 | Ga0207697_10014327 | Ga0207697_100143273 | 235 |
| 769 | 3300025899 | Ga0207642_10066117 | Ga0207642_100661172 | 235 |
| 770 | 3300025899 | Ga0207642_10128593 | Ga0207642_101285931 | 235 |
| 771 | 3300025900 | Ga0207710_10003454 | Ga0207710_100034544 | 235 |
| 772 | 3300025901 | Ga0207688_10014553 | Ga0207688_100145534 | 235 |
| 773 | 3300025903 | Ga0207680_10059167 | Ga0207680_100591671 | 235 |
| 774 | 3300025903 | Ga0207680_10078434 | Ga0207680_100784342 | 235 |
| 775 | 3300025903 | Ga0207680_10087851 | Ga0207680_100878512 | 235 |
| 776 | 3300025904 | Ga0207647_10012067 | Ga0207647_100120674 | 235 |
| 777 | 3300025905 | Ga0207685_10046005 | Ga0207685_100460052 | 235 |
| 778 | 3300025905 | Ga0207685_10070455 | Ga0207685_100704552 | 235 |
| 779 | 3300025907 | Ga0207645_10002259 | Ga0207645_100022596 | 235 |
| 780 | 3300025907 | Ga0207645_10045080 | Ga0207645_100450802 | 235 |
| 781 | 3300025907 | Ga0207645_10233734 | Ga0207645_102337341 | 235 |
| 782 | 3300025908 | Ga0207643_10001726 | Ga0207643_100017265 | 235 |
| 783 | 3300025908 | Ga0207643_10002959 | Ga0207643_100029591 | 235 |
| 784 | 3300025918 | Ga0207662_10150672 | Ga0207662_101506722 | 235 |
| 785 | 3300025919 | Ga0207657_10195260 | Ga0207657_101952602 | 235 |
| 786 | 3300025919 | Ga0207657_10218906 | Ga0207657_102189062 | 235 |
| 787 | 3300025920 | Ga0207649_10009764 | Ga0207649_100097645 | 235 |
| 788 | 3300025923 | Ga0207681_10005188 | Ga0207681_100051885 | 235 |
| 789 | 3300025923 | Ga0207681_10151369 | Ga0207681_101513692 | 235 |
| 790 | 3300025923 | Ga0207681_10220221 | Ga0207681_102202211 | 235 |
| 791 | 3300025923 | Ga0207681_10305519 | Ga0207681_103055192 | 235 |
| 792 | 3300025923 | Ga0207681_10390928 | Ga0207681_103909282 | 235 |
| 793 | 3300025923 | Ga0207681_10570078 | Ga0207681_105700781 | 235 |
| 794 | 3300025925 | Ga0207650_10008659 | Ga0207650_100086593 | 235 |
| 795 | 3300025925 | Ga0207650_10355213 | Ga0207650_103552131 | 235 |
| 796 | 3300025925 | Ga0207650_10601117 | Ga0207650_106011171 | 235 |
| 797 | 3300025926 | Ga0207659_10035016 | Ga0207659_100350163 | 235 |
| 798 | 3300025926 | Ga0207659_10073350 | Ga0207659_100733502 | 235 |
| 799 | 3300025931 | Ga0207644_10215706 | Ga0207644_102157062 | 235 |
| 800 | 3300025932 | Ga0207690_10042491 | Ga0207690_100424912 | 235 |
| 801 | 3300025933 | Ga0207706_10012685 | Ga0207706_100126856 | 235 |
| 802 | 3300025933 | Ga0207706_10014218 | Ga0207706_100142185 | 235 |
| 803 | 3300025933 | Ga0207706_10027202 | Ga0207706_100272022 | 235 |
| 804 | 3300025933 | Ga0207706_10047628 | Ga0207706_100476285 | 235 |
| 805 | 3300025933 | Ga0207706_10061401 | Ga0207706_100614013 | 235 |
| 806 | 3300025933 | Ga0207706_10110337 | Ga0207706_101103372 | 235 |
| 807 | 3300025934 | Ga0207686_10079691 | Ga0207686_100796912 | 235 |
| 808 | 3300025936 | Ga0207670_10004555 | Ga0207670_100045552 | 235 |
| 809 | 3300025936 | Ga0207670_10017672 | Ga0207670_100176724 | 235 |
| 810 | 3300025936 | Ga0207670_10067853 | Ga0207670_100678532 | 235 |
| 811 | 3300025937 | Ga0207669_10202361 | Ga0207669_102023612 | 235 |
| 812 | 3300025938 | Ga0207704_10068555 | Ga0207704_100685552 | 235 |
| 813 | 3300025938 | Ga0207704_10291008 | Ga0207704_102910082 | 235 |
| 814 | 3300025940 | Ga0207691_10085172 | Ga0207691_100851722 | 235 |
| 815 | 3300025940 | Ga0207691_10146521 | Ga0207691_101465212 | 235 |
| 816 | 3300025942 | Ga0207689_10002915 | Ga0207689_100029152 | 235 |
| 817 | 3300025942 | Ga0207689_10007600 | Ga0207689_100076009 | 235 |
| 818 | 3300025942 | Ga0207689_10031405 | Ga0207689_100314052 | 235 |
| 819 | 3300025942 | Ga0207689_10133923 | Ga0207689_101339232 | 235 |
| 820 | 3300025944 | Ga0207661_10023607 | Ga0207661_100236073 | 235 |
| 821 | 3300025944 | Ga0207661_10132054 | Ga0207661_101320542 | 235 |
| 822 | 3300025945 | Ga0207679_10002990 | Ga0207679_100029906 | 235 |
| 823 | 3300025945 | Ga0207679_10090875 | Ga0207679_100908752 | 235 |
| 824 | 3300025945 | Ga0207679_10137024 | Ga0207679_101370242 | 235 |
| 825 | 3300025949 | Ga0207667_10411371 | Ga0207667_104113712 | 235 |
| 826 | 3300025960 | Ga0207651_10055766 | Ga0207651_100557662 | 235 |
| 827 | 3300025960 | Ga0207651_10406754 | Ga0207651_104067541 | 235 |
| 828 | 3300025960 | Ga0207651_10568262 | Ga0207651_105682621 | 235 |
| 829 | 3300025960 | Ga0207651_10703119 | Ga0207651_107031191 | 235 |
| 830 | 3300025961 | Ga0207712_10048361 | Ga0207712_100483613 | 235 |
| 831 | 3300025961 | Ga0207712_10113716 | Ga0207712_101137162 | 235 |
| 832 | 3300025961 | Ga0207712_10115514 | Ga0207712_101155143 | 235 |
| 833 | 3300025986 | Ga0207658_10014921 | Ga0207658_100149216 | 235 |
| 834 | 3300025986 | Ga0207658_10287708 | Ga0207658_102877082 | 235 |
| 835 | 3300025986 | Ga0207658_10747588 | Ga0207658_107475881 | 235 |
| 836 | 3300026023 | Ga0207677_10061412 | Ga0207677_100614122 | 235 |
| 837 | 3300026023 | Ga0207677_10218413 | Ga0207677_102184132 | 235 |
| 838 | 3300026041 | Ga0207639_10028028 | Ga0207639_100280283 | 235 |
| 839 | 3300026041 | Ga0207639_10140722 | Ga0207639_101407222 | 235 |
| 840 | 3300026067 | Ga0207678_10028489 | Ga0207678_100284892 | 235 |
| 841 | 3300026075 | Ga0207708_10024439 | Ga0207708_100244394 | 235 |
| 842 | 3300026075 | Ga0207708_10415485 | Ga0207708_104154852 | 235 |
| 843 | 3300026088 | Ga0207641_10256895 | Ga0207641_102568952 | 235 |
| 844 | 3300026088 | Ga0207641_10283722 | Ga0207641_102837222 | 235 |
| 845 | 3300026088 | Ga0207641_10420365 | Ga0207641_104203651 | 235 |
| 846 | 3300026089 | Ga0207648_10002473 | Ga0207648_1000247316 | 235 |
| 847 | 3300026089 | Ga0207648_10003197 | Ga0207648_100031979 | 235 |
| 848 | 3300026089 | Ga0207648_10007616 | Ga0207648_100076162 | 235 |
| 849 | 3300026089 | Ga0207648_10054782 | Ga0207648_100547821 | 235 |
| 850 | 3300026089 | Ga0207648_10086149 | Ga0207648_100861493 | 235 |
| 851 | 3300026089 | Ga0207648_10126118 | Ga0207648_101261182 | 235 |
| 852 | 3300026089 | Ga0207648_10535812 | Ga0207648_105358121 | 235 |
| 853 | 3300026095 | Ga0207676_10099230 | Ga0207676_100992302 | 235 |
| 854 | 3300026095 | Ga0207676_10294458 | Ga0207676_102944582 | 235 |
| 855 | 3300026095 | Ga0207676_10408837 | Ga0207676_104088372 | 235 |
| 856 | 3300026095 | Ga0207676_10469819 | Ga0207676_104698192 | 235 |
| 857 | 3300026116 | Ga0207674_10009448 | Ga0207674_100094488 | 235 |
| 858 | 3300026116 | Ga0207674_10047506 | Ga0207674_100475062 | 235 |
| 859 | 3300026116 | Ga0207674_10051915 | Ga0207674_100519152 | 235 |
| 860 | 3300026116 | Ga0207674_10123610 | Ga0207674_101236102 | 235 |
| 861 | 3300026116 | Ga0207674_10377589 | Ga0207674_103775892 | 235 |
| 862 | 3300026116 | Ga0207674_10461027 | Ga0207674_104610272 | 235 |
| 863 | 3300026116 | Ga0207674_10633061 | Ga0207674_106330612 | 235 |
| 864 | 3300026118 | Ga0207675_100000654 | Ga0207675_10000065418 | 235 |
| 865 | 3300026118 | Ga0207675_100003600 | Ga0207675_1000036009 | 235 |
| 866 | 3300026118 | Ga0207675_100067678 | Ga0207675_1000676782 | 235 |
| 867 | 3300026118 | Ga0207675_100153648 | Ga0207675_1001536482 | 235 |
| 868 | 3300026121 | Ga0207683_10001428 | Ga0207683_100014288 | 235 |
| 869 | 3300026121 | Ga0207683_10009987 | Ga0207683_100099878 | 235 |
| 870 | 3300026121 | Ga0207683_10159291 | Ga0207683_101592913 | 235 |
| 871 | 3300026142 | Ga0207698_10030751 | Ga0207698_100307514 | 235 |
| 872 | 3300026142 | Ga0207698_10154573 | Ga0207698_101545732 | 235 |
| 873 | 3300026142 | Ga0207698_10701506 | Ga0207698_107015061 | 235 |
| 874 | 3300027907 | Ga0207428_10009020 | Ga0207428_100090205 | 235 |
| 875 | 3300028379 | Ga0268266_10177309 | Ga0268266_101773092 | 235 |
| 876 | 3300028379 | Ga0268266_10230016 | Ga0268266_102300162 | 235 |
| 877 | 3300028379 | Ga0268266_10515390 | Ga0268266_105153901 | 235 |
| 878 | 3300028380 | Ga0268265_10054849 | Ga0268265_100548492 | 235 |
| 879 | 3300028380 | Ga0268265_10756567 | Ga0268265_107565672 | 235 |
| 880 | 3300028381 | Ga0268264_10008382 | Ga0268264_100083824 | 235 |
| 881 | 3300028381 | Ga0268264_10024643 | Ga0268264_100246434 | 235 |
| 882 | 3300028381 | Ga0268264_10119283 | Ga0268264_101192832 | 235 |
| 883 | 3300028381 | Ga0268264_10123800 | Ga0268264_101238002 | 235 |
| 884 | 3300028381 | Ga0268264_10440654 | Ga0268264_104406542 | 235 |
| 885 | 3300028381 | Ga0268264_10478570 | Ga0268264_104785702 | 235 |
| 886 | 3300030731 | Ga0316177_1143555 | Ga0316177_11435552 | 235 |
| 887 | 3300031251 | Ga0265327_10000006 | Ga0265327_10000006566 | 235 |
| 888 | 3300031251 | Ga0265327_10015178 | Ga0265327_100151782 | 235 |
| 889 | 3300031456 | Ga0307513_10168021 | Ga0307513_101680212 | 235 |
| 890 | 3300031731 | Ga0307405_10448635 | Ga0307405_104486352 | 235 |
| 891 | 3300031824 | Ga0307413_10014902 | Ga0307413_100149022 | 235 |
| 892 | 3300031852 | Ga0307410_10036382 | Ga0307410_100363822 | 235 |
| 893 | 3300031903 | Ga0307407_10275716 | Ga0307407_102757162 | 235 |
| 894 | 3300031911 | Ga0307412_10367335 | Ga0307412_103673352 | 235 |
| 895 | 3300032002 | Ga0307416_100703478 | Ga0307416_1007034782 | 235 |
| 896 | 3300032004 | Ga0307414_10223667 | Ga0307414_102236672 | 235 |
| 897 | 3300032005 | Ga0307411_10372226 | Ga0307411_103722261 | 235 |
| 898 | 3300035086 | Ga0373934_0054546 | Ga0373934_0054546_253_960 | 235 |
| 899 | 3300035724 | Ga0373933_0040109 | Ga0373933_0040109_445_1152 | 235 |
| 900 | 3300036401 | Ga0373937_0041388 | Ga0373937_0041388_541_1248 | 235 |
| 901 | 3300036401 | Ga0373937_0116024 | Ga0373937_0116024_1734_2441 | 235 |
| 902 | 3300037312 | Ga0395899_0066712 | Ga0395899_0066712_1776_2543 | 235 |
| 903 | 3300037466 | Ga0395898_0022627 | Ga0395898_0022627_1710_2477 | 235 |
| 904 | 3300037471 | Ga0395905_0060068 | Ga0395905_0060068_1131_1838 | 235 |
| 905 | 3300041406 | Ga0439439_0011631 | Ga0439439_0011631_1060_1767 | 235 |
| 906 | 3300041486 | Ga0451807_0395518 | Ga0451807_0395518_307_1014 | 235 |
| 907 | 3300041997 | Ga0439431_0013852 | Ga0439431_0013852_1076_1783 | 235 |
| 908 | 3300042156 | Ga0439446_0082229 | Ga0439446_0082229_188_895 | 235 |
| 909 | 3300042435 | Ga0439434_0001630 | Ga0439434_0001630_5505_6212 | 235 |
| 910 | 3300042876 | Ga0451577_0281363 | Ga0451577_0281363_103_822 | 235 |
| 911 | 3300044658 | Ga0466972_0000021 | Ga0466972_0000021_138758_139465 | 235 |
| 912 | 3300044765 | Ga0466970_0001020 | Ga0466970_0001020_2200_2907 | 235 |
| 913 | 3300046459 | Ga0495629_0223363 | Ga0495629_0223363_408_1115 | 235 |
| 914 | 3300046460 | Ga0495638_0241846 | Ga0495638_0241846_156_863 | 235 |
| 915 | 3300046471 | Ga0495650_0016596 | Ga0495650_0016596_1545_2261 | 235 |
| 916 | 3300046472 | Ga0495580_0046645 | Ga0495580_0046645_2056_2763 | 235 |
| 917 | 3300046511 | Ga0495608_0027308 | Ga0495608_0027308_3135_3842 | 235 |
| 918 | 3300046516 | Ga0495628_0164769 | Ga0495628_0164769_378_1085 | 235 |
| 919 | 3300046529 | Ga0495652_0292846 | Ga0495652_0292846_409_1116 | 235 |
| 920 | 3300046533 | Ga0495640_0148898 | Ga0495640_0148898_630_1337 | 235 |
| 921 | 3300046536 | Ga0495587_0106078 | Ga0495587_0106078_347_1054 | 235 |
| 922 | 3300046648 | Ga0495611_0030385 | Ga0495611_0030385_723_1433 | 235 |
| 923 | 3300046663 | Ga0495635_0225787 | Ga0495635_0225787_206_913 | 235 |
| 924 | 3300046678 | Ga0495599_0185059 | Ga0495599_0185059_449_1156 | 235 |
| 925 | 3300046679 | Ga0495623_0156881 | Ga0495623_0156881_160_867 | 235 |
| 926 | 3300046680 | Ga0495646_0232112 | Ga0495646_0232112_178_885 | 235 |
| 927 | 3300046691 | Ga0495670_0033326 | Ga0495670_0033326_482_1189 | 235 |
| 928 | 3300046809 | Ga0495600_0221809 | Ga0495600_0221809_353_1060 | 235 |
| 929 | 3300047322 | Ga0495680_0159270 | Ga0495680_0159270_522_1229 | 235 |
| 930 | 3300047471 | Ga0495684_0222379 | Ga0495684_0222379_426_1133 | 235 |
| 931 | 3300047472 | Ga0495686_0001217 | Ga0495686_0001217_20973_21689 | 235 |
| 932 | 3300048912 | Ga0496109_0481980 | Ga0496109_0481980_422_1129 | 235 |
| 933 | 3300048913 | Ga0496110_0009618 | Ga0496110_0009618_886_1662 | 235 |
| 934 | 3300048914 | Ga0496111_0513055 | Ga0496111_0513055_73_780 | 235 |
| 935 | 3300049568 | Ga0501031_0013457 | Ga0501031_0013457_1827_2537 | 235 |
| 936 | 3300049571 | Ga0501034_0712444 | Ga0501034_0712444_65_772 | 235 |
| 937 | 3300049572 | Ga0501036_0055566 | Ga0501036_0055566_1045_1755 | 235 |
| 938 | 3300049573 | Ga0501037_0005433 | Ga0501037_0005433_5342_6052 | 235 |
| 939 | 3300049574 | Ga0501038_0032811 | Ga0501038_0032811_2062_2772 | 235 |
| 940 | 3300049575 | Ga0501039_0078832 | Ga0501039_0078832_356_1066 | 235 |
| 941 | 3300049579 | Ga0501043_0007747 | Ga0501043_0007747_4635_5345 | 235 |
| 942 | 3300049580 | Ga0501046_0237520 | Ga0501046_0237520_308_1018 | 235 |
| 943 | 3300049581 | Ga0501047_0149418 | Ga0501047_0149418_220_930 | 235 |
| 944 | 3300049581 | Ga0501047_0575056 | Ga0501047_0575056_55_762 | 235 |
| 945 | 3300049582 | Ga0501048_0436981 | Ga0501048_0436981_52_759 | 235 |
| 946 | 3300049583 | Ga0501067_0031005 | Ga0501067_0031005_1983_2690 | 235 |
| 947 | 3300049586 | Ga0501070_0088403 | Ga0501070_0088403_1530_2237 | 235 |
| 948 | 3300049588 | Ga0501072_0384824 | Ga0501072_0384824_316_1026 | 235 |
| 949 | 3300049661 | Ga0501217_082276 | Ga0501217_082276_34_774 | 235 |
| 950 | 3300049741 | Ga0501079_0659548 | Ga0501079_0659548_36_743 | 235 |
| 951 | 3300049744 | Ga0501083_0022214 | Ga0501083_0022214_2639_3346 | 235 |
| 952 | 3300049822 | Ga0501035_0114753 | Ga0501035_0114753_1606_2316 | 235 |
| 953 | 3300049823 | Ga0501044_0070719 | Ga0501044_0070719_824_1531 | 235 |
| 954 | 3300049823 | Ga0501044_0123794 | Ga0501044_0123794_289_999 | 235 |
| 955 | 3300050493 | nmdc:mga0k408_214014_c1 | nmdc:mga0k408_214014_c1_394_1101 | 235 |
| 956 | 3300050493 | nmdc:mga0k408_2243_c2 | nmdc:mga0k408_2243_c2_152_859 | 235 |
| 957 | 3300053088 | Ga0500644_0014085 | Ga0500644_0014085_120_827 | 235 |
| 958 | 3300053096 | Ga0500641_0022545 | Ga0500641_0022545_1171_1881 | 235 |
| 959 | 3300053108 | Ga0500562_000038 | Ga0500562_000038_40544_41251 | 235 |
| 960 | 3300053139 | Ga0500568_0001023 | Ga0500568_0001023_6569_7279 | 235 |
| 961 | 3300053156 | Ga0500622_0000340 | Ga0500622_0000340_847_1554 | 235 |
| 962 | 3300053727 | Ga0500611_000101 | Ga0500611_000101_12104_12811 | 235 |
| 963 | 3300053730 | Ga0500645_049652 | Ga0500645_049652_110_817 | 235 |
| 964 | 3300054114 | Ga0501084_0276631 | Ga0501084_0276631_491_1198 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9729 | 7 | 126 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9701 | 8 | 124 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.97 | 8 | 124 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9676 | 6 | 122 |
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9669 | 7 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9945 | 8 | 89 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9943 | 7 | 85 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.984 | 5 | 85 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9825 | 8 | 85 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9792 | 8 | 85 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350Y6D3-F1-model_v4 | Histidine kinase | 0.9701 | 7 | 108 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0016301 GO:0032993 |
| AF-A0A6P0PEW0-F1-model_v4 | Adenylate/guanylate cyclase domain-containing response regulator | 0.97 | 5 | 129 |
GO:0000160
GO:0003677 GO:0004016 GO:0006171 |
| AF-A0A3M1M3I0-F1-model_v4 | Adenylate/guanylate cyclase domain-containing response regulator | 0.9699 | 4 | 129 |
GO:0000156
GO:0000976 GO:0004016 GO:0005829 GO:0006355 GO:0009190 GO:0032993 |
| AF-A0A2N2TQE8-F1-model_v4 | Adenylate/guanylate cyclase domain-containing response regulator | 0.9694 | 7 | 129 |
GO:0000156
GO:0000976 GO:0004016 GO:0005829 GO:0006355 GO:0009190 GO:0032993 |
| AF-A0A1G8SP82-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9677 | 1 | 122 |
GO:0000155
GO:0006935 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar