F486927

General Info

Members Datasets Scaffolds Average Seq Length
964 351 952 235

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10001613|rootH2_1000161317
Length 267
Sequence LARRAIISRFGQKGYFYSNPFGLQDAETSWPEPIMSSKISILLVEDEENLHEALKLNLELEGYEITSAFEGTQALKAIQSEYFDLIILDVMLPGVDGISVTETIRVQNNDVPILILSAKNASADRVLGLKKGADDYLTKPFNLEELLLRIQKLIEKNKKMQEKESFGDVYSFGKNIIDFKAQEATTKDGDRIQLSKKEAMLLKLLIENRNEVVTREKILQAVWGYNVYPTTRTIDNFVLNFRKYFEEDSRHPKYFHSVRGVGYKYTE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
6 2818991444 Filimonas endophytica 3197 Isolate Unclassified
7 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
8 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
9 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
10 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
11 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
12 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
13 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
14 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
15 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
16 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
17 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
247 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
250 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
251 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
252 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
253 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
254 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
255 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
256 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
313 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
314 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
326 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
327 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
331 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
332 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
333 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
339 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
340 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
344 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
347 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.2
Nodule 0
Rhizoplane 0.62
Rhizosphere 85.68
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_981202 2162886006 Bacteria 1020
2 MRS1b_contig_3268472 2162886011 Bacteria 1165
3 MBSR1b_contig_11128225 2162886012 Bacteria 1147
4 MBSR1b_contig_5448556 2162886012 Bacteria 1163
5 JGI24740J21852_10007294 3300001979 Bacteria 4504
6 JGI24739J22299_10000030 3300001989 Bacteria 39896
7 JGI24737J22298_10056043 3300001990 Bacteria 1191
8 JGI25154J39366_1000023 3300002738 Bacteria 219569
9 JGI25158J39367_1022306 3300002739 Bacteria 763
10 JGI25157J39369_1001946 3300002741 Bacteria 6161
11 JGI25406J46586_10001649 3300003203 Bacteria 10542
12 JGI25153J46596_10000551 3300003215 Bacteria 23390
13 rootH1_10084469 3300003316 Bacteria 3964
14 rootH1_10108546 3300003316 Bacteria 7212
15 rootH1_10108546 3300003323 Unclassified 2346
16 rootH1_10119675 3300003316 Bacteria 1337
17 rootH1_10189687 3300003316 Bacteria 1349
18 rootH2_10001613 3300003320 Bacteria 20111
19 rootH2_10001614 3300003320 Bacteria 29985
20 rootH2_10006434 3300003320 Bacteria 3616
21 rootH2_10023604 3300003320 Bacteria 13207
22 rootH2_10035434 3300003320 Bacteria 17210
23 rootL2_10003209 3300003322 Bacteria 1865
24 rootL2_10026021 3300003322 Bacteria 20401
25 rootL2_10109532 3300003322 Bacteria 2760
26 rootH1_10005885 3300003316 Bacteria 2871
27 rootH1_10005885 3300003323 Bacteria 12245
28 rootH1_10007189 3300003323 Bacteria 65578
29 rootH1_10069904 3300003323 Bacteria 4252
30 rootH1_10148649 3300003316 Bacteria 2170
31 rootH1_10148649 3300003323 Bacteria 2343
32 rootH1_10162497 3300003323 Bacteria 1777
33 rootH1_10174566 3300003323 Bacteria 10046
34 rootH1_10300162 3300003323 Unclassified 2070
35 JGI25160J50197_1000262 3300003354 Bacteria 39642
36 JGI25160J50197_1003292 3300003354 Bacteria 7275
37 JGI25160J50197_1005474 3300003354 Bacteria 5281
38 JGI25160J50197_1011378 3300003354 Bacteria 3161
39 Ga0055542_1004489 3300003762 Bacteria 3377
40 Ga0055526_1014933 3300003771 Bacteria 3154
41 Ga0055528_1005109 3300003790 Bacteria 6183
42 Ga0055530_10000185 3300003791 Bacteria 55895
43 Ga0055531_10000080 3300003794 Bacteria 103922
44 Ga0055531_10015829 3300003794 Bacteria 3295
45 Ga0065165_1000658 3300005262 Bacteria 49852
46 Ga0065165_1015870 3300005262 Bacteria 2851
47 Ga0065165_1016647 3300005262 Bacteria 2744
48 Ga0065714_10169900 3300005288 Bacteria 1009
49 Ga0065704_10083111 3300005289 Bacteria 3507
50 Ga0065712_10001811 3300005290 Bacteria 7619
51 Ga0065712_10131490 3300005290 Bacteria 1521
52 Ga0065715_10107465 3300005293 Bacteria 2768
53 Ga0070658_10141172 3300005327 Bacteria 2012
54 Ga0070658_10146069 3300005327 Bacteria 1978
55 Ga0070658_10148731 3300005327 Unclassified 1960
56 Ga0070658_10370041 3300005327 Bacteria 1228
57 Ga0070676_10026974 3300005328 Bacteria 3254
58 Ga0070683_100002723 3300005329 Bacteria 14112
59 Ga0070683_100010919 3300005329 Bacteria 7822
60 Ga0070683_100016236 3300005329 Bacteria 6560
61 Ga0070683_100021184 3300005329 Bacteria 5796
62 Ga0070683_100057092 3300005329 Bacteria 3626
63 Ga0070690_100008208 3300005330 Bacteria 6006
64 Ga0070690_100042207 3300005330 Bacteria 2889
65 Ga0070690_100047194 3300005330 Bacteria 2740
66 Ga0070690_100091596 3300005330 Bacteria 2003
67 Ga0070670_100042974 3300005331 Unclassified 3886
68 Ga0070670_100080557 3300005331 Bacteria 2798
69 Ga0070670_100381812 3300005331 Bacteria 1241
70 Ga0070677_10185787 3300005333 Bacteria 993
71 Ga0068869_100010867 3300005334 Bacteria 5954
72 Ga0068869_100023482 3300005334 Bacteria 4260
73 Ga0068869_100023826 3300005334 Bacteria 4234
74 Ga0068869_100025876 3300005334 Bacteria 4079
75 Ga0068869_100545350 3300005334 Bacteria 973
76 Ga0070666_10018584 3300005335 Bacteria 4473
77 Ga0070666_10019589 3300005335 Bacteria 4370
78 Ga0070666_10022880 3300005335 Bacteria 4063
79 Ga0070666_10071360 3300005335 Bacteria 2363
80 Ga0070666_10094173 3300005335 Bacteria 2060
81 Ga0070680_100009821 3300005336 Bacteria 7368
82 Ga0070680_100034885 3300005336 Bacteria 4059
83 Ga0070680_100062884 3300005336 Bacteria 3040
84 Ga0070680_100230985 3300005336 Bacteria 1563
85 Ga0070682_100002989 3300005337 Bacteria 9381
86 Ga0070682_100008284 3300005337 Bacteria 5861
87 Ga0070682_100070789 3300005337 Bacteria 2231
88 Ga0068868_100008122 3300005338 Bacteria 7508
89 Ga0068868_100030461 3300005338 Bacteria 4138
90 Ga0068868_100050988 3300005338 Bacteria 3252
91 Ga0068868_100148964 3300005338 Bacteria 1926
92 Ga0068868_100163007 3300005338 Bacteria 1842
93 Ga0070660_100001701 3300005339 Bacteria 15090
94 Ga0070660_100020297 3300005339 Bacteria 4882
95 Ga0070660_100153020 3300005339 Bacteria 1855
96 Ga0070660_100162679 3300005339 Bacteria 1799
97 Ga0070660_100222651 3300005339 Bacteria 1534
98 Ga0070660_100364986 3300005339 Bacteria 1190
99 Ga0070689_100083354 3300005340 Bacteria 2512
100 Ga0070689_100092162 3300005340 Bacteria 2390
101 Ga0070689_100166838 3300005340 Bacteria 1782
102 Ga0070689_100215216 3300005340 Bacteria 1574
103 Ga0070691_10014940 3300005341 Bacteria 3565
104 Ga0070687_100002175 3300005343 Bacteria 7248
105 Ga0070661_100010396 3300005344 Bacteria 6469
106 Ga0070661_100036849 3300005344 Bacteria 3555
107 Ga0070661_100169976 3300005344 Bacteria 1655
108 Ga0070661_100196607 3300005344 Unclassified 1539
109 Ga0070692_10141671 3300005345 Unclassified 1361
110 Ga0070668_100038898 3300005347 Bacteria 3638
111 Ga0070668_100084352 3300005347 Bacteria 2495
112 Ga0070668_100445560 3300005347 Bacteria 1112
113 Ga0070669_100001473 3300005353 Bacteria 17021
114 Ga0070669_100002379 3300005353 Bacteria 13607
115 Ga0070669_100232571 3300005353 Bacteria 1461
116 Ga0070669_100330819 3300005353 Bacteria 1232
117 Ga0070669_100365431 3300005353 Bacteria 1174
118 Ga0070675_100002848 3300005354 Bacteria 13041
119 Ga0070675_100031505 3300005354 Bacteria 4287
120 Ga0070675_100073774 3300005354 Bacteria 2833
121 Ga0070675_100147193 3300005354 Bacteria 2017
122 Ga0070675_100170583 3300005354 Bacteria 1876
123 Ga0070675_100174451 3300005354 Bacteria 1856
124 Ga0070671_100139769 3300005355 Unclassified 2043
125 Ga0070674_100028730 3300005356 Bacteria 3654
126 Ga0070674_100111383 3300005356 Bacteria 2010
127 Ga0070673_100016516 3300005364 Bacteria 5222
128 Ga0070673_100032649 3300005364 Bacteria 3923
129 Ga0070673_100056711 3300005364 Bacteria 3092
130 Ga0070673_100188037 3300005364 Bacteria 1772
131 Ga0070673_100206890 3300005364 Bacteria 1692
132 Ga0070673_100231519 3300005364 Bacteria 1603
133 Ga0070688_100014189 3300005365 Bacteria 4511
134 Ga0070688_100032799 3300005365 Bacteria 3135
135 Ga0070659_100020079 3300005366 Bacteria 5073
136 Ga0070659_100039015 3300005366 Bacteria 3706
137 Ga0070659_100069244 3300005366 Bacteria 2800
138 Ga0070667_100021229 3300005367 Bacteria 5395
139 Ga0070667_100105559 3300005367 Bacteria 2438
140 Ga0070667_100124634 3300005367 Bacteria 2244
141 Ga0070667_100175646 3300005367 Bacteria 1893
142 Ga0070667_100197785 3300005367 Bacteria 1783
143 Ga0070667_100531129 3300005367 Bacteria 1080
144 Ga0070667_100620507 3300005367 Bacteria 997
145 Ga0070714_100097141 3300005435 Bacteria 2589
146 Ga0070713_100115595 3300005436 Bacteria 2345
147 Ga0070701_10010862 3300005438 Bacteria 4044
148 Ga0070700_100017034 3300005441 Bacteria 4150
149 Ga0070663_100023838 3300005455 Bacteria 4108
150 Ga0070663_100650154 3300005455 Bacteria 892
151 Ga0070678_100012152 3300005456 Bacteria 5340
152 Ga0070678_100027845 3300005456 Bacteria 3843
153 Ga0070678_100113898 3300005456 Bacteria 2121
154 Ga0070662_100003337 3300005457 Bacteria 10011
155 Ga0070662_100004529 3300005457 Bacteria 8803
156 Ga0070662_100007311 3300005457 Bacteria 7156
157 Ga0070662_100043670 3300005457 Bacteria 3208
158 Ga0070662_100225848 3300005457 Bacteria 1496
159 Ga0070662_100644692 3300005457 Bacteria 893
160 Ga0070681_10018659 3300005458 Bacteria 6937
161 Ga0070681_10029652 3300005458 Bacteria 5494
162 Ga0070681_10047183 3300005458 Bacteria 4306
163 Ga0070681_10409182 3300005458 Bacteria 1268
164 Ga0070681_10502991 3300005458 Bacteria 1125
165 Ga0068867_100003149 3300005459 Bacteria 11633
166 Ga0068867_100011145 3300005459 Bacteria 6342
167 Ga0068867_100034427 3300005459 Bacteria 3671
168 Ga0068867_100039464 3300005459 Bacteria 3442
169 Ga0068867_100069965 3300005459 Bacteria 2622
170 Ga0068867_100128318 3300005459 Bacteria 1968
171 Ga0068867_100247171 3300005459 Unclassified 1449
172 Ga0068867_100684361 3300005459 Bacteria 903
173 Ga0070685_10005889 3300005466 Bacteria 6238
174 Ga0070685_10057717 3300005466 Bacteria 2260
175 Ga0070706_100160349 3300005467 Bacteria 2100
176 Ga0070698_100072788 3300005471 Bacteria 3444
177 Ga0070699_100744618 3300005518 Bacteria 896
178 Ga0070679_100006985 3300005530 Bacteria 10536
179 Ga0070679_100057085 3300005530 Bacteria 3890
180 Ga0070679_100084362 3300005530 Bacteria 3165
181 Ga0070679_100177700 3300005530 Bacteria 2101
182 Ga0070684_100002319 3300005535 Bacteria 14029
183 Ga0070684_100018469 3300005535 Bacteria 5744
184 Ga0070684_100045790 3300005535 Unclassified 3789
185 Ga0068853_100001650 3300005539 Bacteria 16317
186 Ga0068853_100009686 3300005539 Bacteria 7769
187 Ga0068853_100011889 3300005539 Bacteria 7078
188 Ga0068853_100012660 3300005539 Bacteria 6868
189 Ga0068853_100026641 3300005539 Bacteria 4856
190 Ga0068853_100031274 3300005539 Bacteria 4502
191 Ga0068853_100112140 3300005539 Bacteria 2424
192 Ga0068853_100126287 3300005539 Bacteria 2285
193 Ga0068853_100158738 3300005539 Bacteria 2039
194 Ga0070672_100264670 3300005543 Bacteria 1451
195 Ga0070672_100270528 3300005543 Bacteria 1435
196 Ga0070686_100002348 3300005544 Bacteria 10422
197 Ga0070693_100155375 3300005547 Bacteria 1452
198 Ga0070693_100367100 3300005547 Bacteria 989
199 Ga0070693_100429698 3300005547 Unclassified 922
200 Ga0070665_100000014 3300005548 Bacteria 484881
201 Ga0070665_100010501 3300005548 Bacteria 9368
202 Ga0070704_100651303 3300005549 Bacteria 930
203 Ga0068855_100001027 3300005563 Bacteria 34809
204 Ga0068855_100010998 3300005563 Bacteria 10920
205 Ga0068855_100022282 3300005563 Bacteria 7591
206 Ga0068855_100044640 3300005563 Bacteria 5245
207 Ga0068855_100066276 3300005563 Bacteria 4210
208 Ga0068855_100087504 3300005563 Bacteria 3600
209 Ga0068855_100090034 3300005563 Bacteria 3542
210 Ga0068855_100115699 3300005563 Bacteria 3074
211 Ga0068855_100128374 3300005563 Bacteria 2897
212 Ga0068855_100133349 3300005563 Bacteria 2835
213 Ga0068855_100553509 3300005563 Unclassified 1245
214 Ga0070664_100005866 3300005564 Bacteria 9910
215 Ga0070664_100020090 3300005564 Bacteria 5499
216 Ga0070664_100154183 3300005564 Bacteria 2029
217 Ga0070664_100211093 3300005564 Bacteria 1735
218 Ga0070664_100304484 3300005564 Bacteria 1441
219 Ga0068857_100009364 3300005577 Bacteria 8503
220 Ga0068857_100025602 3300005577 Bacteria 5195
221 Ga0068857_100043224 3300005577 Bacteria 3997
222 Ga0068857_100140488 3300005577 Bacteria 2183
223 Ga0068857_100215361 3300005577 Bacteria 1753
224 Ga0068857_100224835 3300005577 Bacteria 1715
225 Ga0068857_100627451 3300005577 Unclassified 1017
226 Ga0068854_100005213 3300005578 Bacteria 8197
227 Ga0068854_100023108 3300005578 Bacteria 4243
228 Ga0068854_100024925 3300005578 Bacteria 4102
229 Ga0068854_100202862 3300005578 Bacteria 1560
230 Ga0068854_100295385 3300005578 Bacteria 1309
231 Ga0068856_100029521 3300005614 Bacteria 5356
232 Ga0068856_100195408 3300005614 Bacteria 2037
233 Ga0068856_100394467 3300005614 Bacteria 1404
234 Ga0070702_100012795 3300005615 Bacteria 4220
235 Ga0068852_100001786 3300005616 Bacteria 14607
236 Ga0068852_100013163 3300005616 Bacteria 6323
237 Ga0068852_100027749 3300005616 Bacteria 4619
238 Ga0068852_100032243 3300005616 Bacteria 4336
239 Ga0068852_100039363 3300005616 Unclassified 3980
240 Ga0068852_100053083 3300005616 Bacteria 3487
241 Ga0068852_100183721 3300005616 Bacteria 1968
242 Ga0068852_100331546 3300005616 Bacteria 1481
243 Ga0068852_100464625 3300005616 Bacteria 1255
244 Ga0068859_100001537 3300005617 Bacteria 23548
245 Ga0068859_100052034 3300005617 Bacteria 4118
246 Ga0068859_100057535 3300005617 Bacteria 3916
247 Ga0068859_100065234 3300005617 Bacteria 3675
248 Ga0068859_100206749 3300005617 Bacteria 2048
249 Ga0068859_100402314 3300005617 Unclassified 1465
250 Ga0068864_100327593 3300005618 Unclassified 1440
251 Ga0068864_100554786 3300005618 Bacteria 1111
252 Ga0068866_10089167 3300005718 Bacteria 1675
253 Ga0068866_10205294 3300005718 Bacteria 1180
254 Ga0068861_100005965 3300005719 Bacteria 8274
255 Ga0068861_100142260 3300005719 Bacteria 1959
256 Ga0068870_10015841 3300005840 Bacteria 3587
257 Ga0068870_10238647 3300005840 Bacteria 1121
258 Ga0068863_100030065 3300005841 Bacteria 5189
259 Ga0068863_100249545 3300005841 Bacteria 1714
260 Ga0068863_100327402 3300005841 Bacteria 1489
261 Ga0068863_100363016 3300005841 Bacteria 1412
262 Ga0068863_100424242 3300005841 Unclassified 1303
263 Ga0068858_100043642 3300005842 Bacteria 4158
264 Ga0068858_100069589 3300005842 Bacteria 3262
265 Ga0068858_100081884 3300005842 Bacteria 3000
266 Ga0068858_100184815 3300005842 Bacteria 1969
267 Ga0068858_100478197 3300005842 Bacteria 1202
268 Ga0068860_100000061 3300005843 Bacteria 192548
269 Ga0068860_100012083 3300005843 Bacteria 8504
270 Ga0068860_100020912 3300005843 Bacteria 6340
271 Ga0068860_100061044 3300005843 Bacteria 3581
272 Ga0068860_100096462 3300005843 Bacteria 2819
273 Ga0068860_100103769 3300005843 Bacteria 2714
274 Ga0068860_100122333 3300005843 Bacteria 2493
275 Ga0068860_100142112 3300005843 Bacteria 2307
276 Ga0068860_100165733 3300005843 Bacteria 2133
277 Ga0068862_100003320 3300005844 Bacteria 13899
278 Ga0068862_100127044 3300005844 Bacteria 2252
279 Ga0068862_100185882 3300005844 Bacteria 1867
280 Ga0068862_100207999 3300005844 Bacteria 1767
281 Ga0068862_100238029 3300005844 Bacteria 1654
282 Ga0068862_100693688 3300005844 Bacteria 986
283 Ga0081540_1016808 3300005983 Bacteria 4560
284 Ga0081539_10001169 3300005985 Bacteria 47510
285 Ga0070712_100201394 3300006175 Bacteria 1564
286 Ga0075366_10008445 3300006195 Bacteria 5728
287 Ga0075366_10013810 3300006195 Bacteria 4605
288 Ga0075366_10016298 3300006195 Bacteria 4270
289 Ga0075366_10020526 3300006195 Bacteria 3834
290 Ga0097621_100008140 3300006237 Bacteria 7539
291 Ga0097621_100034071 3300006237 Bacteria 4059
292 Ga0097621_100213347 3300006237 Bacteria 1680
293 Ga0097621_100483174 3300006237 Unclassified 1120
294 Ga0068871_100005800 3300006358 Bacteria 8678
295 Ga0068871_100011294 3300006358 Bacteria 6549
296 Ga0068871_100025524 3300006358 Bacteria 4599
297 Ga0068871_100156605 3300006358 Bacteria 1946
298 Ga0068871_100236567 3300006358 Bacteria 1587
299 Ga0068871_100258495 3300006358 Unclassified 1518
300 Ga0068871_100311914 3300006358 Bacteria 1383
301 Ga0068871_100359685 3300006358 Bacteria 1289
302 Ga0075430_100478339 3300006846 Bacteria 1028
303 Ga0075429_100415624 3300006880 Bacteria 1178
304 Ga0068865_100014376 3300006881 Bacteria 5028
305 Ga0068865_100054058 3300006881 Unclassified 2788
306 Ga0068865_100174859 3300006881 Bacteria 1649
307 Ga0097620_100001537 3300006931 Bacteria 23548
308 Ga0097620_100052035 3300006931 Bacteria 4118
309 Ga0097620_100057538 3300006931 Bacteria 3916
310 Ga0097620_100065241 3300006931 Bacteria 3675
311 Ga0097620_100206762 3300006931 Bacteria 2048
312 Ga0097620_100312077 3300006931 Bacteria 1666
313 Ga0097620_100402270 3300006931 Unclassified 1465
314 Ga0105240_10000800 3300009093 Bacteria 56989
315 Ga0105240_10001787 3300009093 Bacteria 36277
316 Ga0105240_10001808 3300009093 Bacteria 36002
317 Ga0105240_10004358 3300009093 Bacteria 21601
318 Ga0105240_10029970 3300009093 Bacteria 7078
319 Ga0105240_10067649 3300009093 Bacteria 4428
320 Ga0105240_10300854 3300009093 Bacteria 1835
321 Ga0105240_10705280 3300009093 Bacteria 1101
322 Ga0105240_10817748 3300009093 Bacteria 1008
323 Ga0105240_11022734 3300009093 Bacteria 883
324 Ga0111539_10005159 3300009094 Bacteria 16933
325 Ga0111539_10011279 3300009094 Bacteria 11226
326 Ga0111539_10103371 3300009094 Bacteria 3344
327 Ga0105247_10000312 3300009101 Bacteria 43730
328 Ga0105247_10047668 3300009101 Bacteria 2632
329 Ga0105243_10082441 3300009148 Bacteria 2628
330 Ga0105241_10000608 3300009174 Bacteria 26997
331 Ga0105241_10007179 3300009174 Bacteria 8200
332 Ga0105241_10040180 3300009174 Bacteria 3531
333 Ga0105241_10143104 3300009174 Bacteria 1949
334 Ga0105241_10343175 3300009174 Bacteria 1294
335 Ga0105241_10576960 3300009174 Bacteria 1013
336 Ga0105241_10981968 3300009174 Bacteria 789
337 Ga0105241_11033057 3300009174 Bacteria 770
338 Ga0105242_10023950 3300009176 Bacteria 4817
339 Ga0105242_10027545 3300009176 Bacteria 4514
340 Ga0105242_10135198 3300009176 Bacteria 2133
341 Ga0105242_10173117 3300009176 Unclassified 1899
342 Ga0105242_10268998 3300009176 Bacteria 1543
343 Ga0105242_10297728 3300009176 Bacteria 1471
344 Ga0105242_10444777 3300009176 Bacteria 1220
345 Ga0105248_10192276 3300009177 Bacteria 2299
346 Ga0105248_11468427 3300009177 Bacteria 772
347 Ga0105237_10001055 3300009545 Bacteria 37018
348 Ga0105237_10005526 3300009545 Bacteria 14250
349 Ga0105237_10006018 3300009545 Bacteria 13573
350 Ga0105237_10006998 3300009545 Bacteria 12429
351 Ga0105237_10007301 3300009545 Bacteria 12120
352 Ga0105237_10011542 3300009545 Bacteria 9343
353 Ga0105237_10017111 3300009545 Bacteria 7521
354 Ga0105237_10207088 3300009545 Bacteria 1962
355 Ga0105237_10446460 3300009545 Bacteria 1299
356 Ga0105237_10665885 3300009545 Bacteria 1048
357 Ga0105238_10000592 3300009551 Bacteria 38095
358 Ga0105238_10092053 3300009551 Bacteria 3019
359 Ga0105238_10159963 3300009551 Bacteria 2227
360 Ga0105238_10651836 3300009551 Bacteria 1063
361 Ga0105249_10010102 3300009553 Bacteria 8286
362 Ga0105249_10013950 3300009553 Bacteria 7102
363 Ga0105249_10017890 3300009553 Bacteria 6298
364 Ga0105249_10044259 3300009553 Bacteria 4048
365 Ga0105249_10351052 3300009553 Bacteria 1494
366 Ga0105249_10820063 3300009553 Bacteria 995
367 Ga0105239_10000019 3300010375 Bacteria 273836
368 Ga0105239_10001405 3300010375 Bacteria 32195
369 Ga0105239_10004672 3300010375 Bacteria 16278
370 Ga0105239_10013173 3300010375 Bacteria 9189
371 Ga0105239_10027401 3300010375 Bacteria 6272
372 Ga0105239_10131992 3300010375 Bacteria 2779
373 Ga0105239_10234930 3300010375 Bacteria 2057
374 Ga0105239_10248630 3300010375 Bacteria 1997
375 Ga0105239_10346502 3300010375 Bacteria 1677
376 Ga0105239_10398219 3300010375 Bacteria 1558
377 Ga0105239_10435887 3300010375 Bacteria 1485
378 Ga0105246_10123991 3300011119 Bacteria 1919
379 Ga0105246_10162933 3300011119 Bacteria 1700
380 Ga0157373_10000927 3300013100 Bacteria 22674
381 Ga0157373_10003672 3300013100 Bacteria 11604
382 Ga0157373_10008630 3300013100 Bacteria 7563
383 Ga0157373_10031894 3300013100 Bacteria 3795
384 Ga0157373_10145917 3300013100 Bacteria 1664
385 Ga0157373_10187209 3300013100 Bacteria 1458
386 Ga0157371_10000218 3300013102 Bacteria 83919
387 Ga0157371_10005551 3300013102 Bacteria 10609
388 Ga0157371_10005559 3300013102 Bacteria 10598
389 Ga0157371_10009581 3300013102 Bacteria 7618
390 Ga0157371_10010719 3300013102 Bacteria 7118
391 Ga0157371_10014278 3300013102 Bacteria 6000
392 Ga0157371_10040978 3300013102 Bacteria 3306
393 Ga0157371_10081734 3300013102 Bacteria 2287
394 Ga0157371_10096881 3300013102 Bacteria 2091
395 Ga0157371_10112231 3300013102 Bacteria 1935
396 Ga0157371_10176975 3300013102 Bacteria 1525
397 Ga0157370_10001029 3300013104 Bacteria 35080
398 Ga0157370_10003402 3300013104 Bacteria 18690
399 Ga0157370_10018211 3300013104 Bacteria 7067
400 Ga0157370_10060865 3300013104 Bacteria 3584
401 Ga0157370_10465930 3300013104 Bacteria 1161
402 Ga0157369_10009590 3300013105 Bacteria 11070
403 Ga0157369_10010400 3300013105 Bacteria 10605
404 Ga0157369_10025346 3300013105 Bacteria 6584
405 Ga0157369_10034211 3300013105 Bacteria 5579
406 Ga0157369_10059094 3300013105 Bacteria 4135
407 Ga0157369_10101397 3300013105 Bacteria 3067
408 Ga0157369_10188622 3300013105 Bacteria 2167
409 Ga0157369_10216187 3300013105 Bacteria 2008
410 Ga0157369_10473626 3300013105 Bacteria 1296
411 Ga0157369_10868613 3300013105 Bacteria 926
412 Ga0157374_10000011 3300013296 Bacteria 466749
413 Ga0157374_10025078 3300013296 Bacteria 5350
414 Ga0157374_10033168 3300013296 Bacteria 4710
415 Ga0157374_10038891 3300013296 Bacteria 4375
416 Ga0157374_10042729 3300013296 Bacteria 4182
417 Ga0157374_10107601 3300013296 Bacteria 2680
418 Ga0157374_10152419 3300013296 Bacteria 2248
419 Ga0157374_10165790 3300013296 Unclassified 2153
420 Ga0157374_10221176 3300013296 Bacteria 1858
421 Ga0157378_10005523 3300013297 Bacteria 11078
422 Ga0157378_10027293 3300013297 Bacteria 5039
423 Ga0157378_10037242 3300013297 Bacteria 4308
424 Ga0157378_10062778 3300013297 Bacteria 3318
425 Ga0157378_10142475 3300013297 Unclassified 2227
426 Ga0157378_10159054 3300013297 Bacteria 2111
427 Ga0157378_10268770 3300013297 Bacteria 1639
428 Ga0157378_10398812 3300013297 Bacteria 1355
429 Ga0157378_11105649 3300013297 Bacteria 830
430 Ga0163162_10000131 3300013306 Bacteria 67924
431 Ga0163162_10004708 3300013306 Bacteria 13154
432 Ga0163162_10005290 3300013306 Bacteria 12454
433 Ga0163162_10038605 3300013306 Bacteria 4766
434 Ga0163162_10039779 3300013306 Bacteria 4699
435 Ga0163162_10061753 3300013306 Bacteria 3785
436 Ga0163162_10073172 3300013306 Bacteria 3483
437 Ga0163162_10104996 3300013306 Bacteria 2920
438 Ga0163162_10131408 3300013306 Bacteria 2612
439 Ga0163162_10137584 3300013306 Bacteria 2554
440 Ga0163162_10151565 3300013306 Bacteria 2437
441 Ga0163162_10213432 3300013306 Bacteria 2060
442 Ga0163162_10616528 3300013306 Bacteria 1210
443 Ga0157372_10002419 3300013307 Bacteria 20209
444 Ga0157372_10003581 3300013307 Bacteria 16712
445 Ga0157372_10007454 3300013307 Bacteria 11637
446 Ga0157372_10010103 3300013307 Bacteria 10026
447 Ga0157372_10012118 3300013307 Bacteria 9184
448 Ga0157372_10028193 3300013307 Bacteria 6127
449 Ga0157372_10031379 3300013307 Bacteria 5818
450 Ga0157372_10047349 3300013307 Bacteria 4778
451 Ga0157372_10104492 3300013307 Bacteria 3238
452 Ga0157372_10121312 3300013307 Bacteria 3003
453 Ga0157372_10142033 3300013307 Bacteria 2767
454 Ga0157372_10213475 3300013307 Bacteria 2236
455 Ga0157372_10351612 3300013307 Unclassified 1717
456 Ga0157372_10417051 3300013307 Bacteria 1564
457 Ga0157372_10489888 3300013307 Bacteria 1433
458 Ga0157372_10617596 3300013307 Bacteria 1263
459 Ga0157372_10728386 3300013307 Bacteria 1153
460 Ga0157372_10747771 3300013307 Bacteria 1137
461 Ga0157375_10017033 3300013308 Bacteria 6547
462 Ga0157375_10020278 3300013308 Bacteria 6068
463 Ga0157375_10022629 3300013308 Bacteria 5786
464 Ga0157375_10041404 3300013308 Bacteria 4448
465 Ga0157375_10067495 3300013308 Bacteria 3574
466 Ga0157375_10104801 3300013308 Bacteria 2917
467 Ga0157375_10546896 3300013308 Bacteria 1320
468 Ga0157375_10700957 3300013308 Bacteria 1166
469 Ga0157375_11090716 3300013308 Bacteria 934
470 Ga0163163_10000368 3300014325 Bacteria 43257
471 Ga0163163_10000591 3300014325 Bacteria 31919
472 Ga0163163_10002613 3300014325 Bacteria 15252
473 Ga0163163_10035392 3300014325 Bacteria 4843
474 Ga0163163_10520060 3300014325 Bacteria 1252
475 Ga0163163_10993533 3300014325 Bacteria 902
476 Ga0157380_10001169 3300014326 Bacteria 17017
477 Ga0157380_10013173 3300014326 Bacteria 6022
478 Ga0157380_10172186 3300014326 Bacteria 1893
479 Ga0157380_10245907 3300014326 Bacteria 1616
480 Ga0157380_10346062 3300014326 Bacteria 1389
481 Ga0157377_10000583 3300014745 Bacteria 15210
482 Ga0157377_10010639 3300014745 Bacteria 4559
483 Ga0157377_10042633 3300014745 Bacteria 2521
484 Ga0157377_10068561 3300014745 Bacteria 2044
485 Ga0157377_10104123 3300014745 Bacteria 1696
486 Ga0157377_10279978 3300014745 Bacteria 1093
487 Ga0157379_10065726 3300014968 Bacteria 3242
488 Ga0157379_10115111 3300014968 Unclassified 2418
489 Ga0157379_10178514 3300014968 Bacteria 1918
490 Ga0157379_10301294 3300014968 Bacteria 1461
491 Ga0157379_10319530 3300014968 Bacteria 1417
492 Ga0157379_10352364 3300014968 Bacteria 1348
493 Ga0157376_10007481 3300014969 Bacteria 7803
494 Ga0157376_10071819 3300014969 Bacteria 2943
495 Ga0157376_10144156 3300014969 Bacteria 2140
496 Ga0157376_10212351 3300014969 Unclassified 1787
497 Ga0182005_1000347 3300015265 Bacteria 26332
498 Ga0163161_10014248 3300017792 Bacteria 5536
499 Ga0163161_10061547 3300017792 Bacteria 2733
500 Ga0163161_10210465 3300017792 Bacteria 1502
501 Ga0163161_10832109 3300017792 Bacteria 778
502 Ga0209436_100381 3300025208 Bacteria 20022
503 Ga0209436_105597 3300025208 Bacteria 2862
504 Ga0209258_100116 3300025242 Bacteria 190317
505 Ga0209646_1000004 3300025246 Bacteria 786587
506 Ga0209026_1000136 3300025250 Bacteria 116507
507 Ga0209148_1000175 3300025254 Bacteria 129536
508 Ga0209129_1013267 3300025258 Bacteria 1825
509 Ga0209673_1000203 3300025273 Bacteria 119623
510 Ga0209130_1001665 3300025284 Bacteria 13575
511 Ga0209564_1029275 3300025295 Bacteria 1737
512 Ga0209758_1003355 3300025297 Bacteria 14686
513 Ga0209758_1035284 3300025297 Bacteria 1973
514 Ga0209050_1000276 3300025298 Bacteria 109997
515 Ga0207426_1000024 3300025302 Bacteria 534075
516 Ga0207426_1000059 3300025302 Bacteria 363842
517 Ga0207426_1000957 3300025302 Bacteria 28456
518 Ga0207426_1001807 3300025302 Bacteria 15872
519 Ga0207426_1004921 3300025302 Bacteria 6304
520 Ga0209051_1028556 3300025303 Bacteria 2201
521 Ga0209257_1000004 3300025304 Bacteria 1678347
522 Ga0209257_1000736 3300025304 Bacteria 49668
523 Ga0207697_10014327 3300025315 Bacteria 3289
524 Ga0207642_10066117 3300025899 Bacteria 1701
525 Ga0207642_10128593 3300025899 Bacteria 1318
526 Ga0207710_10003454 3300025900 Bacteria 7040
527 Ga0207688_10014553 3300025901 Bacteria 4274
528 Ga0207680_10059167 3300025903 Bacteria 2326
529 Ga0207680_10065274 3300025903 Bacteria 2234
530 Ga0207680_10078434 3300025903 Unclassified 2068
531 Ga0207680_10087851 3300025903 Bacteria 1969
532 Ga0207647_10012067 3300025904 Bacteria 6031
533 Ga0207647_10015325 3300025904 Bacteria 5259
534 Ga0207647_10067803 3300025904 Bacteria 2161
535 Ga0207647_10133698 3300025904 Bacteria 1456
536 Ga0207647_10174232 3300025904 Bacteria 1252
537 Ga0207685_10046005 3300025905 Bacteria 1658
538 Ga0207685_10070455 3300025905 Bacteria 1415
539 Ga0207645_10002259 3300025907 Bacteria 15319
540 Ga0207645_10045080 3300025907 Bacteria 2819
541 Ga0207645_10233734 3300025907 Bacteria 1214
542 Ga0207643_10001726 3300025908 Bacteria 12257
543 Ga0207643_10002959 3300025908 Bacteria 9169
544 Ga0207705_10016061 3300025909 Bacteria 5374
545 Ga0207705_10048638 3300025909 Bacteria 3050
546 Ga0207705_10603120 3300025909 Bacteria 854
547 Ga0207654_10006600 3300025911 Bacteria 5833
548 Ga0207654_10011213 3300025911 Bacteria 4567
549 Ga0207654_10178152 3300025911 Bacteria 1385
550 Ga0207707_10021785 3300025912 Bacteria 5601
551 Ga0207707_10031463 3300025912 Bacteria 4643
552 Ga0207707_10064134 3300025912 Bacteria 3198
553 Ga0207707_10477892 3300025912 Bacteria 1065
554 Ga0207695_10000087 3300025913 Bacteria 276412
555 Ga0207695_10000863 3300025913 Bacteria 55452
556 Ga0207695_10001230 3300025913 Bacteria 43841
557 Ga0207695_10001645 3300025913 Bacteria 35984
558 Ga0207695_10016157 3300025913 Bacteria 8752
559 Ga0207695_10016635 3300025913 Bacteria 8597
560 Ga0207695_10044762 3300025913 Bacteria 4704
561 Ga0207695_10052763 3300025913 Bacteria 4257
562 Ga0207695_10092647 3300025913 Bacteria 3032
563 Ga0207671_10000311 3300025914 Bacteria 71753
564 Ga0207671_10000931 3300025914 Bacteria 36651
565 Ga0207671_10004520 3300025914 Bacteria 13223
566 Ga0207671_10071468 3300025914 Bacteria 2588
567 Ga0207671_10128850 3300025914 Bacteria 1941
568 Ga0207671_10194419 3300025914 Bacteria 1582
569 Ga0207671_10282927 3300025914 Bacteria 1308
570 Ga0207671_10285284 3300025914 Bacteria 1303
571 Ga0207660_10011620 3300025917 Bacteria 5740
572 Ga0207660_10147988 3300025917 Bacteria 1802
573 Ga0207660_10159791 3300025917 Bacteria 1738
574 Ga0207662_10150672 3300025918 Bacteria 1479
575 Ga0207657_10004301 3300025919 Bacteria 15090
576 Ga0207657_10004450 3300025919 Bacteria 14828
577 Ga0207657_10013194 3300025919 Bacteria 8113
578 Ga0207657_10055721 3300025919 Bacteria 3413
579 Ga0207657_10062275 3300025919 Bacteria 3195
580 Ga0207657_10195260 3300025919 Bacteria 1631
581 Ga0207657_10218906 3300025919 Bacteria 1526
582 Ga0207649_10009764 3300025920 Bacteria 5257
583 Ga0207649_10024760 3300025920 Bacteria 3492
584 Ga0207652_10015279 3300025921 Bacteria 6232
585 Ga0207652_10024919 3300025921 Bacteria 4967
586 Ga0207652_10050800 3300025921 Bacteria 3553
587 Ga0207652_10098398 3300025921 Bacteria 2580
588 Ga0207681_10005188 3300025923 Bacteria 8000
589 Ga0207681_10151369 3300025923 Bacteria 1739
590 Ga0207681_10220221 3300025923 Bacteria 1468
591 Ga0207681_10305519 3300025923 Bacteria 1260
592 Ga0207681_10390928 3300025923 Bacteria 1121
593 Ga0207681_10570078 3300025923 Bacteria 933
594 Ga0207694_10031984 3300025924 Bacteria 4023
595 Ga0207694_10048275 3300025924 Bacteria 3294
596 Ga0207694_10048733 3300025924 Bacteria 3278
597 Ga0207694_10141674 3300025924 Bacteria 1934
598 Ga0207650_10008659 3300025925 Bacteria 6950
599 Ga0207650_10355213 3300025925 Bacteria 1206
600 Ga0207650_10601117 3300025925 Unclassified 925
601 Ga0207650_10692301 3300025925 Bacteria 861
602 Ga0207659_10035016 3300025926 Bacteria 3467
603 Ga0207659_10073350 3300025926 Bacteria 2506
604 Ga0207659_10080311 3300025926 Unclassified 2409
605 Ga0207700_10683205 3300025928 Bacteria 916
606 Ga0207664_10259690 3300025929 Bacteria 1519
607 Ga0207644_10215706 3300025931 Unclassified 1519
608 Ga0207690_10037538 3300025932 Bacteria 3146
609 Ga0207690_10042491 3300025932 Bacteria 2986
610 Ga0207690_10152754 3300025932 Bacteria 1713
611 Ga0207706_10010112 3300025933 Bacteria 8639
612 Ga0207706_10012685 3300025933 Bacteria 7670
613 Ga0207706_10014218 3300025933 Bacteria 7215
614 Ga0207706_10027202 3300025933 Bacteria 5115
615 Ga0207706_10047628 3300025933 Bacteria 3792
616 Ga0207706_10061401 3300025933 Bacteria 3309
617 Ga0207706_10110337 3300025933 Bacteria 2420
618 Ga0207706_10135341 3300025933 Bacteria 2168
619 Ga0207686_10079691 3300025934 Bacteria 2133
620 Ga0207686_10160542 3300025934 Bacteria 1575
621 Ga0207670_10004555 3300025936 Bacteria 7485
622 Ga0207670_10017672 3300025936 Bacteria 4314
623 Ga0207670_10067853 3300025936 Bacteria 2455
624 Ga0207669_10049990 3300025937 Bacteria 2496
625 Ga0207669_10087744 3300025937 Bacteria 2016
626 Ga0207669_10202361 3300025937 Bacteria 1442
627 Ga0207704_10068555 3300025938 Unclassified 2237
628 Ga0207704_10291008 3300025938 Bacteria 1246
629 Ga0207691_10021958 3300025940 Bacteria 6023
630 Ga0207691_10041817 3300025940 Bacteria 4228
631 Ga0207691_10085172 3300025940 Bacteria 2837
632 Ga0207691_10146521 3300025940 Bacteria 2078
633 Ga0207689_10002915 3300025942 Bacteria 15788
634 Ga0207689_10007600 3300025942 Bacteria 9495
635 Ga0207689_10031405 3300025942 Bacteria 4422
636 Ga0207689_10074508 3300025942 Bacteria 2789
637 Ga0207689_10133923 3300025942 Bacteria 2040
638 Ga0207661_10002997 3300025944 Bacteria 11677
639 Ga0207661_10023607 3300025944 Bacteria 4649
640 Ga0207661_10129311 3300025944 Bacteria 2161
641 Ga0207661_10132054 3300025944 Bacteria 2140
642 Ga0207661_10152979 3300025944 Bacteria 1995
643 Ga0207679_10002990 3300025945 Bacteria 10485
644 Ga0207679_10051676 3300025945 Bacteria 3010
645 Ga0207679_10090875 3300025945 Bacteria 2361
646 Ga0207679_10137024 3300025945 Bacteria 1972
647 Ga0207679_10281133 3300025945 Bacteria 1427
648 Ga0207667_10000098 3300025949 Bacteria 140051
649 Ga0207667_10000279 3300025949 Bacteria 70460
650 Ga0207667_10004113 3300025949 Bacteria 17874
651 Ga0207667_10015607 3300025949 Bacteria 8616
652 Ga0207667_10036738 3300025949 Bacteria 5246
653 Ga0207667_10067886 3300025949 Bacteria 3714
654 Ga0207667_10092444 3300025949 Bacteria 3124
655 Ga0207667_10153360 3300025949 Bacteria 2370
656 Ga0207667_10304291 3300025949 Bacteria 1629
657 Ga0207667_10308841 3300025949 Unclassified 1615
658 Ga0207667_10411371 3300025949 Unclassified 1377
659 Ga0207667_10446595 3300025949 Bacteria 1314
660 Ga0207651_10055766 3300025960 Bacteria 2716
661 Ga0207651_10068694 3300025960 Bacteria 2499
662 Ga0207651_10406754 3300025960 Bacteria 1159
663 Ga0207651_10568262 3300025960 Bacteria 988
664 Ga0207651_10703119 3300025960 Bacteria 891
665 Ga0207712_10048361 3300025961 Bacteria 2958
666 Ga0207712_10113716 3300025961 Bacteria 2035
667 Ga0207712_10115514 3300025961 Bacteria 2021
668 Ga0207640_10054839 3300025981 Bacteria 2608
669 Ga0207640_10116265 3300025981 Bacteria 1906
670 Ga0207640_10168360 3300025981 Bacteria 1630
671 Ga0207658_10014921 3300025986 Bacteria 5325
672 Ga0207658_10287708 3300025986 Bacteria 1411
673 Ga0207658_10343050 3300025986 Bacteria 1299
674 Ga0207658_10747588 3300025986 Unclassified 885
675 Ga0207677_10061412 3300026023 Bacteria 2602
676 Ga0207677_10218413 3300026023 Bacteria 1527
677 Ga0207703_10667275 3300026035 Bacteria 987
678 Ga0207639_10009288 3300026041 Bacteria 6780
679 Ga0207639_10028028 3300026041 Bacteria 4108
680 Ga0207639_10041905 3300026041 Bacteria 3429
681 Ga0207639_10100693 3300026041 Bacteria 2334
682 Ga0207639_10111554 3300026041 Bacteria 2230
683 Ga0207639_10138452 3300026041 Bacteria 2025
684 Ga0207639_10140722 3300026041 Bacteria 2010
685 Ga0207678_10028489 3300026067 Bacteria 4876
686 Ga0207678_10136670 3300026067 Bacteria 2091
687 Ga0207708_10024439 3300026075 Bacteria 4570
688 Ga0207708_10415485 3300026075 Bacteria 1115
689 Ga0207702_10039691 3300026078 Bacteria 3946
690 Ga0207702_10100345 3300026078 Bacteria 2554
691 Ga0207702_10245666 3300026078 Bacteria 1679
692 Ga0207641_10256895 3300026088 Bacteria 1634
693 Ga0207641_10283722 3300026088 Bacteria 1559
694 Ga0207641_10420365 3300026088 Unclassified 1287
695 Ga0207648_10002473 3300026089 Bacteria 19851
696 Ga0207648_10003197 3300026089 Bacteria 17252
697 Ga0207648_10007616 3300026089 Bacteria 10615
698 Ga0207648_10054782 3300026089 Bacteria 3483
699 Ga0207648_10086149 3300026089 Bacteria 2741
700 Ga0207648_10126118 3300026089 Bacteria 2252
701 Ga0207648_10487329 3300026089 Bacteria 1127
702 Ga0207648_10535812 3300026089 Bacteria 1074
703 Ga0207676_10099230 3300026095 Bacteria 2410
704 Ga0207676_10294458 3300026095 Unclassified 1479
705 Ga0207676_10408837 3300026095 Bacteria 1270
706 Ga0207676_10469819 3300026095 Unclassified 1189
707 Ga0207674_10000969 3300026116 Bacteria 37567
708 Ga0207674_10009448 3300026116 Bacteria 11142
709 Ga0207674_10047506 3300026116 Bacteria 4399
710 Ga0207674_10051915 3300026116 Bacteria 4183
711 Ga0207674_10123610 3300026116 Bacteria 2554
712 Ga0207674_10377589 3300026116 Bacteria 1370
713 Ga0207674_10461027 3300026116 Unclassified 1228
714 Ga0207674_10633061 3300026116 Bacteria 1033
715 Ga0207675_100000654 3300026118 Bacteria 34117
716 Ga0207675_100003600 3300026118 Bacteria 15104
717 Ga0207675_100067678 3300026118 Bacteria 3338
718 Ga0207675_100104872 3300026118 Bacteria 2664
719 Ga0207675_100153648 3300026118 Bacteria 2192
720 Ga0207675_100645481 3300026118 Bacteria 1064
721 Ga0207683_10001428 3300026121 Bacteria 21608
722 Ga0207683_10009987 3300026121 Bacteria 8101
723 Ga0207683_10030224 3300026121 Bacteria 4694
724 Ga0207683_10159291 3300026121 Unclassified 2040
725 Ga0207698_10000937 3300026142 Bacteria 16993
726 Ga0207698_10030751 3300026142 Bacteria 3866
727 Ga0207698_10047300 3300026142 Bacteria 3258
728 Ga0207698_10069896 3300026142 Bacteria 2779
729 Ga0207698_10090694 3300026142 Unclassified 2500
730 Ga0207698_10132943 3300026142 Bacteria 2130
731 Ga0207698_10154573 3300026142 Bacteria 1996
732 Ga0207698_10575339 3300026142 Unclassified 1107
733 Ga0207698_10701506 3300026142 Bacteria 1007
734 Ga0207698_10908417 3300026142 Bacteria 888
735 Ga0209974_10178453 3300027876 Bacteria 777
736 Ga0207428_10009020 3300027907 Bacteria 8978
737 Ga0268266_10000068 3300028379 Bacteria 241100
738 Ga0268266_10177309 3300028379 Bacteria 1938
739 Ga0268266_10230016 3300028379 Bacteria 1707
740 Ga0268266_10515390 3300028379 Bacteria 1143
741 Ga0268265_10054849 3300028380 Bacteria 3026
742 Ga0268265_10756567 3300028380 Bacteria 943
743 Ga0268264_10000079 3300028381 Bacteria 249516
744 Ga0268264_10002043 3300028381 Bacteria 18025
745 Ga0268264_10004073 3300028381 Bacteria 12513
746 Ga0268264_10008382 3300028381 Bacteria 8592
747 Ga0268264_10024643 3300028381 Bacteria 4913
748 Ga0268264_10119283 3300028381 Bacteria 2323
749 Ga0268264_10123800 3300028381 Bacteria 2282
750 Ga0268264_10440654 3300028381 Bacteria 1260
751 Ga0268264_10478570 3300028381 Unclassified 1211
752 Ga0307517_10001481 3300028786 Bacteria 39285
753 Ga0307515_10000001 3300028794 Bacteria 4259510
754 Ga0307515_10407697 3300028794 Unclassified 983
755 Ga0307511_10000201 3300030521 Bacteria 60079
756 Ga0316177_1143555 3300030731 Bacteria 1344
757 Ga0265327_10000006 3300031251 Bacteria 693716
758 Ga0265327_10015178 3300031251 Bacteria 4990
759 Ga0265327_10105431 3300031251 Bacteria 1354
760 Ga0307513_10089008 3300031456 Bacteria 3153
761 Ga0307513_10143808 3300031456 Bacteria 2307
762 Ga0307513_10168021 3300031456 Bacteria 2075
763 Ga0307509_10075949 3300031507 Bacteria 3488
764 Ga0307509_10136092 3300031507 Bacteria 2402
765 Ga0307508_10001083 3300031616 Bacteria 31499
766 Ga0307516_10003458 3300031730 Bacteria 20249
767 Ga0307405_10448635 3300031731 Unclassified 1022
768 Ga0307413_10014902 3300031824 Bacteria 3966
769 Ga0307410_10036382 3300031852 Bacteria 3206
770 Ga0307407_10275716 3300031903 Bacteria 1163
771 Ga0307412_10367335 3300031911 Bacteria 1161
772 Ga0307416_100703478 3300032002 Bacteria 1100
773 Ga0307414_10121535 3300032004 Bacteria 2009
774 Ga0307414_10223667 3300032004 Bacteria 1547
775 Ga0307411_10372226 3300032005 Unclassified 1172
776 Ga0307415_100356310 3300032126 Bacteria 1234
777 Ga0307507_10171810 3300033179 Bacteria 1573
778 Ga0307510_10008700 3300033180 Bacteria 12090
779 Ga0373934_0054546 3300035086 Bacteria 1587
780 Ga0373935_0731115 3300035692 Bacteria 729
781 Ga0373933_0040109 3300035724 Bacteria 2757
782 Ga0373937_0041388 3300036401 Bacteria 4202
783 Ga0373937_0116024 3300036401 Bacteria 2494
784 Ga0395899_0009123 3300037312 Bacteria 7619
785 Ga0395899_0026127 3300037312 Bacteria 4407
786 Ga0395899_0039218 3300037312 Bacteria 3546
787 Ga0395899_0066712 3300037312 Bacteria 2642
788 Ga0395900_0086961 3300037418 Bacteria 3212
789 Ga0395900_0167250 3300037418 Bacteria 2240
790 Ga0395900_0269218 3300037418 Bacteria 1699
791 Ga0395898_0022627 3300037466 Bacteria 6364
792 Ga0395898_0098120 3300037466 Bacteria 2813
793 Ga0395898_0475765 3300037466 Bacteria 1188
794 Ga0395905_0060068 3300037471 Bacteria 3555
795 Ga0395905_0249181 3300037471 Bacteria 1659
796 Ga0395901_0007671 3300038443 Bacteria 10885
797 Ga0395901_0028563 3300038443 Bacteria 5737
798 Ga0395901_0055582 3300038443 Bacteria 4117
799 Ga0395901_0122950 3300038443 Bacteria 2727
800 Ga0436365_1831652 3300039437 Bacteria 3666
801 Ga0439439_0011631 3300041406 Unclassified 2121
802 Ga0451793_0181996 3300041452 Bacteria 1575
803 Ga0451804_1111977 3300041463 Bacteria 795
804 Ga0451807_0395518 3300041486 Bacteria 1110
805 Ga0451841_0356308 3300041498 Bacteria 1528
806 Ga0451849_0545289 3300041505 Unclassified 783
807 Ga0451851_1127070 3300041507 Bacteria 1088
808 Ga0439431_0013852 3300041997 Unclassified 1864
809 Ga0439445_0031519 3300042004 Bacteria 1378
810 Ga0439449_0082707 3300042007 Bacteria 1184
811 Ga0439446_0082229 3300042156 Bacteria 999
812 Ga0439434_0001630 3300042435 Bacteria 6486
813 Ga0451577_0280639 3300042876 Bacteria 1509
814 Ga0451577_0281363 3300042876 Bacteria 1507
815 Ga0466972_0000021 3300044658 Bacteria 196266
816 Ga0466972_0008143 3300044658 Bacteria 5257
817 Ga0466965_0005791 3300044683 Bacteria 5577
818 Ga0466961_0153839 3300044693 Bacteria 1435
819 Ga0466964_0066241 3300044706 Bacteria 1515
820 Ga0466968_0055589 3300044735 Bacteria 1699
821 Ga0466970_0001020 3300044765 Bacteria 13511
822 Ga0466957_0050124 3300044842 Bacteria 2540
823 Ga0466958_0048247 3300045836 Bacteria 2573
824 Ga0495627_029697 3300046453 Bacteria 1737
825 Ga0495629_0223363 3300046459 Bacteria 1299
826 Ga0495638_0084489 3300046460 Bacteria 1921
827 Ga0495638_0241846 3300046460 Bacteria 999
828 Ga0495650_0016596 3300046471 Bacteria 3724
829 Ga0495580_0046645 3300046472 Bacteria 3074
830 Ga0495606_0064736 3300046507 Bacteria 2325
831 Ga0495608_0027308 3300046511 Bacteria 3884
832 Ga0495628_0164769 3300046516 Bacteria 1683
833 Ga0495648_0086382 3300046524 Bacteria 1769
834 Ga0495652_0292846 3300046529 Bacteria 1187
835 Ga0495640_0148898 3300046533 Bacteria 1505
836 Ga0495587_0106078 3300046536 Unclassified 1616
837 Ga0495633_0000116 3300046558 Bacteria 108667
838 Ga0495668_0000235 3300046616 Bacteria 78964
839 Ga0495668_0002655 3300046616 Bacteria 14375
840 Ga0495611_0000026 3300046648 Bacteria 118428
841 Ga0495611_0030385 3300046648 Unclassified 2375
842 Ga0495625_0043643 3300046660 Bacteria 3251
843 Ga0495635_0225787 3300046663 Bacteria 1266
844 Ga0495599_0185059 3300046678 Bacteria 1283
845 Ga0495623_0156881 3300046679 Bacteria 1341
846 Ga0495646_0232112 3300046680 Bacteria 994
847 Ga0495670_0033326 3300046691 Unclassified 2563
848 Ga0495600_0221809 3300046809 Bacteria 1209
849 Ga0495672_0115229 3300047320 Bacteria 1437
850 Ga0495680_0159270 3300047322 Bacteria 1640
851 Ga0495687_001838 3300047443 Bacteria 18636
852 Ga0495684_0222379 3300047471 Bacteria 1384
853 Ga0495686_0000005 3300047472 Bacteria 827143
854 Ga0495686_0001217 3300047472 Bacteria 29546
855 Ga0496109_0481980 3300048912 Bacteria 1171
856 Ga0496110_0009618 3300048913 Bacteria 7828
857 Ga0496111_0513055 3300048914 Bacteria 882
858 Ga0496126_0015380 3300048929 Bacteria 7698
859 Ga0501031_0013457 3300049568 Bacteria 5334
860 Ga0501031_0076966 3300049568 Bacteria 2173
861 Ga0501032_0014560 3300049569 Bacteria 5570
862 Ga0501032_0255073 3300049569 Bacteria 1138
863 Ga0501033_0044589 3300049570 Bacteria 3301
864 Ga0501033_0385727 3300049570 Bacteria 978
865 Ga0501034_0000004 3300049571 Bacteria 382255
866 Ga0501034_0005186 3300049571 Bacteria 14296
867 Ga0501034_0028416 3300049571 Bacteria 5691
868 Ga0501034_0053717 3300049571 Bacteria 4056
869 Ga0501034_0712444 3300049571 Bacteria 901
870 Ga0501036_0005238 3300049572 Bacteria 10492
871 Ga0501036_0055566 3300049572 Bacteria 3354
872 Ga0501037_0004139 3300049573 Bacteria 10526
873 Ga0501037_0005433 3300049573 Bacteria 9280
874 Ga0501038_0020656 3300049574 Bacteria 5919
875 Ga0501038_0032811 3300049574 Bacteria 4577
876 Ga0501039_0078832 3300049575 Bacteria 2562
877 Ga0501043_0007747 3300049579 Bacteria 8498
878 Ga0501043_0034982 3300049579 Bacteria 3951
879 Ga0501043_0051202 3300049579 Bacteria 3245
880 Ga0501043_0249742 3300049579 Bacteria 1367
881 Ga0501046_0237520 3300049580 Bacteria 1345
882 Ga0501047_0016908 3300049581 Bacteria 6973
883 Ga0501047_0071717 3300049581 Bacteria 3334
884 Ga0501047_0149418 3300049581 Bacteria 2213
885 Ga0501047_0406186 3300049581 Bacteria 1195
886 Ga0501047_0575056 3300049581 Bacteria 950
887 Ga0501048_0436981 3300049582 Bacteria 937
888 Ga0501067_0031005 3300049583 Unclassified 2967
889 Ga0501070_0088403 3300049586 Bacteria 2564
890 Ga0501072_0384824 3300049588 Bacteria 1113
891 Ga0501217_082276 3300049661 Unclassified 893
892 Ga0501257_005682 3300049686 Bacteria 2755
893 Ga0501219_000704 3300049703 Bacteria 4619
894 Ga0501079_0659548 3300049741 Bacteria 824
895 Ga0501083_0022214 3300049744 Bacteria 4402
896 Ga0501269_003839 3300049766 Bacteria 1806
897 Ga0501035_0114753 3300049822 Bacteria 2358
898 Ga0501035_0319559 3300049822 Bacteria 1304
899 Ga0501044_0001506 3300049823 Bacteria 27312
900 Ga0501044_0006596 3300049823 Bacteria 12806
901 Ga0501044_0067425 3300049823 Bacteria 3646
902 Ga0501044_0070719 3300049823 Bacteria 3549
903 Ga0501044_0123794 3300049823 Bacteria 2584
904 Ga0501044_0188050 3300049823 Bacteria 2029
905 Ga0501284_00036 3300050005 Bacteria 57905
906 Ga0501284_04967 3300050005 Bacteria 755
907 nmdc:mga0k408_12581_c1 3300050493 Bacteria 4626
908 nmdc:mga0k408_214014_c1 3300050493 Bacteria 1151
909 nmdc:mga0k408_2243_c2 3300050493 Bacteria 5931
910 nmdc:mga0k408_257387_c1 3300050493 Bacteria 1042
911 nmdc:mga09592_198000_c1 3300050508 Bacteria 1739
912 nmdc:mga0qj67_359562_c1 3300050509 Bacteria 1176
913 nmdc:mga06r32_868945_c1 3300050510 Bacteria 860
914 Ga0500644_0000260 3300053088 Bacteria 30005
915 Ga0500644_0014085 3300053088 Bacteria 2249
916 Ga0500646_0001629 3300053090 Bacteria 5935
917 Ga0500646_0002227 3300053090 Bacteria 5047
918 Ga0500646_0033314 3300053090 Bacteria 1425
919 Ga0500583_0000076 3300053092 Bacteria 59162
920 Ga0500583_0000557 3300053092 Bacteria 11283
921 Ga0500583_0000662 3300053092 Bacteria 10175
922 Ga0500583_0050409 3300053092 Bacteria 1930
923 Ga0500651_0031174 3300053093 Bacteria 3358
924 Ga0500641_0022545 3300053096 Bacteria 2413
925 Ga0500641_0105659 3300053096 Bacteria 1210
926 Ga0500562_000038 3300053108 Bacteria 72186
927 Ga0500569_000126 3300053109 Bacteria 11996
928 Ga0500607_084876 3300053121 Bacteria 1607
929 Ga0500655_016844 3300053133 Bacteria 1348
930 Ga0500658_0003845 3300053134 Bacteria 5648
931 Ga0500559_0064467 3300053136 Bacteria 1639
932 Ga0500568_0001023 3300053139 Bacteria 19133
933 Ga0500568_0019739 3300053139 Bacteria 2924
934 Ga0500577_0010546 3300053142 Bacteria 2725
935 Ga0500577_0113138 3300053142 Bacteria 1122
936 Ga0500588_0020852 3300053146 Bacteria 1762
937 Ga0500588_0037377 3300053146 Bacteria 1441
938 Ga0500589_011678 3300053147 Bacteria 3814
939 Ga0500590_125891 3300053148 Bacteria 1193
940 Ga0500616_0001355 3300053153 Bacteria 23862
941 Ga0500616_0116780 3300053153 Bacteria 1280
942 Ga0500622_0000212 3300053156 Bacteria 61612
943 Ga0500622_0000340 3300053156 Bacteria 45986
944 Ga0500622_0001733 3300053156 Bacteria 16854
945 Ga0500633_0019517 3300053160 Bacteria 2028
946 Ga0500639_038750 3300053163 Bacteria 2510
947 Ga0500636_0002821 3300053177 Bacteria 9699
948 Ga0500637_0142145 3300053178 Bacteria 1389
949 Ga0500611_000101 3300053727 Bacteria 21697
950 Ga0500645_049652 3300053730 Bacteria 1227
951 Ga0501084_0276631 3300054114 Bacteria 1417
952 Ga0466962_0018303 3300061719 Bacteria 3370

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10007189 rootH1_1000718912 214
2 3300005327 Ga0070658_10146069 Ga0070658_101460692 221
3 3300005329 Ga0070683_100021184 Ga0070683_1000211843 221
4 3300005335 Ga0070666_10022880 Ga0070666_100228802 221
5 3300005337 Ga0070682_100008284 Ga0070682_1000082843 221
6 3300005338 Ga0068868_100030461 Ga0068868_1000304612 221
7 3300005339 Ga0070660_100153020 Ga0070660_1001530202 221
8 3300005344 Ga0070661_100036849 Ga0070661_1000368492 221
9 3300005345 Ga0070692_10141671 Ga0070692_101416712 221
10 3300005354 Ga0070675_100073774 Ga0070675_1000737742 221
11 3300005364 Ga0070673_100032649 Ga0070673_1000326492 221
12 3300005366 Ga0070659_100039015 Ga0070659_1000390152 221
13 3300005457 Ga0070662_100004529 Ga0070662_1000045298 221
14 3300005459 Ga0068867_100247171 Ga0068867_1002471712 221
15 3300005530 Ga0070679_100177700 Ga0070679_1001777002 221
16 3300005539 Ga0068853_100031274 Ga0068853_1000312743 221
17 3300005563 Ga0068855_100087504 Ga0068855_1000875043 221
18 3300005564 Ga0070664_100005866 Ga0070664_10000586610 221
19 3300005578 Ga0068854_100024925 Ga0068854_1000249252 221
20 3300006237 Ga0097621_100008140 Ga0097621_1000081403 221
21 3300006358 Ga0068871_100025524 Ga0068871_1000255242 221
22 3300013100 Ga0157373_10008630 Ga0157373_100086303 221
23 3300013102 Ga0157371_10040978 Ga0157371_100409782 221
24 3300013105 Ga0157369_10009590 Ga0157369_100095903 221
25 3300013296 Ga0157374_10033168 Ga0157374_100331682 221
26 3300013297 Ga0157378_10027293 Ga0157378_100272932 221
27 3300014745 Ga0157377_10042633 Ga0157377_100426332 221
28 3300025903 Ga0207680_10065274 Ga0207680_100652742 221
29 3300025909 Ga0207705_10603120 Ga0207705_106031201 221
30 3300025912 Ga0207707_10477892 Ga0207707_104778922 221
31 3300025919 Ga0207657_10004450 Ga0207657_100044506 221
32 3300025920 Ga0207649_10024760 Ga0207649_100247602 221
33 3300025926 Ga0207659_10080311 Ga0207659_100803112 221
34 3300025932 Ga0207690_10037538 Ga0207690_100375383 221
35 3300025933 Ga0207706_10010112 Ga0207706_100101122 221
36 3300025945 Ga0207679_10281133 Ga0207679_102811332 221
37 3300025949 Ga0207667_10308841 Ga0207667_103088412 221
38 3300025960 Ga0207651_10068694 Ga0207651_100686942 221
39 3300005577 Ga0068857_100140488 Ga0068857_1001404882 222
40 3300025944 Ga0207661_10152979 Ga0207661_101529792 222
41 3300025934 Ga0207686_10160542 Ga0207686_101605422 224
42 3300031251 Ga0265327_10105431 Ga0265327_101054311 224
43 3300035692 Ga0373935_0731115 Ga0373935_0731115_12_686 224
44 3300049570 Ga0501033_0385727 Ga0501033_0385727_282_956 224
45 3300005564 Ga0070664_100211093 Ga0070664_1002110932 225
46 3300005616 Ga0068852_100331546 Ga0068852_1003315462 225
47 3300005841 Ga0068863_100249545 Ga0068863_1002495452 225
48 3300005843 Ga0068860_100103769 Ga0068860_1001037694 225
49 3300006358 Ga0068871_100236567 Ga0068871_1002365672 225
50 3300025933 Ga0207706_10135341 Ga0207706_101353413 225
51 3300025937 Ga0207669_10087744 Ga0207669_100877442 225
52 3300025940 Ga0207691_10041817 Ga0207691_100418172 225
53 3300026121 Ga0207683_10030224 Ga0207683_100302242 225
54 3300046616 Ga0495668_0000235 Ga0495668_0000235_30488_31198 225
55 3300049569 Ga0501032_0255073 Ga0501032_0255073_443_1126 225
56 3300049766 Ga0501269_003839 Ga0501269_003839_1010_1720 225
57 3300053096 Ga0500641_0105659 Ga0500641_0105659_159_869 225
58 3300053142 Ga0500577_0113138 Ga0500577_0113138_141_851 225
59 3300053153 Ga0500616_0001355 Ga0500616_0001355_3305_4015 225
60 3300025940 Ga0207691_10021958 Ga0207691_100219583 226
61 3300026035 Ga0207703_10667275 Ga0207703_106672752 226
62 3300026041 Ga0207639_10100693 Ga0207639_101006932 227
63 iso_pu_bacteria 2738541278 2738725630 229
64 3300047320 Ga0495672_0115229 Ga0495672_0115229_326_1048 230
65 3300026089 Ga0207648_10487329 Ga0207648_104873292 231
66 3300041505 Ga0451849_0545289 Ga0451849_0545289_40_735 231
67 iso_pu_bacteria 2818991442 2819575020 231
68 iso_pu_bacteria 2818991444 2819585514 231
69 iso_pu_bacteria 2818991460 2819676981 231
70 iso_pu_bacteria 2821136567 2821141116 231
71 iso_pu_bacteria 2881955468 2881958350 231
72 iso_pu_bacteria 2884791551 2884796820 231
73 iso_pu_bacteria 2904467357 2904471617 231
74 iso_pu_bacteria 2929154850 2929159830 231
75 iso_pu_bacteria 2929177148 2929177663 231
76 iso_pu_bacteria 2929239360 2929240030 231
77 iso_pu_bacteria 2929921140 2929921737 231
78 iso_pu_bacteria 2945977869 2945980012 231
79 iso_pu_bacteria 2946013367 2946014127 231
80 iso_pu_bacteria 8003151029 8003154284 231
81 3300005614 Ga0068856_100394467 Ga0068856_1003944672 232
82 3300009174 Ga0105241_10343175 Ga0105241_103431752 232
83 3300009545 Ga0105237_10446460 Ga0105237_104464602 232
84 3300010375 Ga0105239_10435887 Ga0105239_104358872 232
85 3300025914 Ga0207671_10282927 Ga0207671_102829272 232
86 3300031456 Ga0307513_10089008 Ga0307513_100890082 232
87 3300031507 Ga0307509_10075949 Ga0307509_100759492 232
88 3300031507 Ga0307509_10136092 Ga0307509_101360923 232
89 3300031616 Ga0307508_10001083 Ga0307508_1000108320 232
90 3300039437 Ga0436365_1831652 Ga0436365_1831652_1821_2525 232
91 3300046660 Ga0495625_0043643 Ga0495625_0043643_2498_3199 232
92 3300053090 Ga0500646_0001629 Ga0500646_0001629_3208_3909 232
93 3300053146 Ga0500588_0020852 Ga0500588_0020852_869_1570 232
94 3300003316 rootH1_10084469 rootH1_100844693 233
95 3300003320 rootH2_10001613 rootH2_1000161317 233
96 3300003320 rootH2_10001614 rootH2_1000161417 233
97 3300003320 rootH2_10023604 rootH2_100236046 233
98 3300003323 rootH1_10300162 rootH1_103001622 233
99 3300005327 Ga0070658_10141172 Ga0070658_101411722 233
100 3300005329 Ga0070683_100002723 Ga0070683_10000272313 233
101 3300005329 Ga0070683_100057092 Ga0070683_1000570921 233
102 3300005330 Ga0070690_100091596 Ga0070690_1000915962 233
103 3300005335 Ga0070666_10018584 Ga0070666_100185844 233
104 3300005336 Ga0070680_100009821 Ga0070680_1000098212 233
105 3300005336 Ga0070680_100034885 Ga0070680_1000348852 233
106 3300005337 Ga0070682_100002989 Ga0070682_10000298910 233
107 3300005337 Ga0070682_100070789 Ga0070682_1000707893 233
108 3300005339 Ga0070660_100020297 Ga0070660_1000202976 233
109 3300005354 Ga0070675_100031505 Ga0070675_1000315052 233
110 3300005436 Ga0070713_100115595 Ga0070713_1001155952 233
111 3300005458 Ga0070681_10047183 Ga0070681_100471832 233
112 3300005458 Ga0070681_10502991 Ga0070681_105029911 233
113 3300005471 Ga0070698_100072788 Ga0070698_1000727884 233
114 3300005530 Ga0070679_100006985 Ga0070679_1000069853 233
115 3300005530 Ga0070679_100057085 Ga0070679_1000570852 233
116 3300005539 Ga0068853_100001650 Ga0068853_10000165014 233
117 3300005539 Ga0068853_100009686 Ga0068853_1000096867 233
118 3300005539 Ga0068853_100011889 Ga0068853_1000118892 233
119 3300005548 Ga0070665_100000014 Ga0070665_100000014222 233
120 3300005563 Ga0068855_100010998 Ga0068855_1000109984 233
121 3300005563 Ga0068855_100044640 Ga0068855_1000446404 233
122 3300005563 Ga0068855_100066276 Ga0068855_1000662762 233
123 3300005563 Ga0068855_100090034 Ga0068855_1000900342 233
124 3300005563 Ga0068855_100115699 Ga0068855_1001156992 233
125 3300005563 Ga0068855_100128374 Ga0068855_1001283741 233
126 3300005563 Ga0068855_100133349 Ga0068855_1001333492 233
127 3300005577 Ga0068857_100025602 Ga0068857_1000256022 233
128 3300005577 Ga0068857_100224835 Ga0068857_1002248351 233
129 3300005578 Ga0068854_100005213 Ga0068854_1000052137 233
130 3300005578 Ga0068854_100202862 Ga0068854_1002028622 233
131 3300005614 Ga0068856_100195408 Ga0068856_1001954082 233
132 3300005616 Ga0068852_100001786 Ga0068852_10000178612 233
133 3300005616 Ga0068852_100013163 Ga0068852_1000131636 233
134 3300005616 Ga0068852_100032243 Ga0068852_1000322433 233
135 3300005616 Ga0068852_100039363 Ga0068852_1000393634 233
136 3300005617 Ga0068859_100001537 Ga0068859_10000153726 233
137 3300005843 Ga0068860_100000061 Ga0068860_10000006125 233
138 3300005843 Ga0068860_100012083 Ga0068860_1000120837 233
139 3300005983 Ga0081540_1016808 Ga0081540_10168082 233
140 3300006175 Ga0070712_100201394 Ga0070712_1002013942 233
141 3300006195 Ga0075366_10016298 Ga0075366_100162983 233
142 3300006358 Ga0068871_100359685 Ga0068871_1003596852 233
143 3300006846 Ga0075430_100478339 Ga0075430_1004783392 233
144 3300006931 Ga0097620_100001537 Ga0097620_10000153726 233
145 3300009093 Ga0105240_10000800 Ga0105240_1000080043 233
146 3300009093 Ga0105240_10001787 Ga0105240_1000178735 233
147 3300009093 Ga0105240_10001808 Ga0105240_1000180835 233
148 3300009093 Ga0105240_10004358 Ga0105240_1000435812 233
149 3300009093 Ga0105240_10029970 Ga0105240_100299707 233
150 3300009093 Ga0105240_10067649 Ga0105240_100676494 233
151 3300009093 Ga0105240_10817748 Ga0105240_108177482 233
152 3300009093 Ga0105240_11022734 Ga0105240_110227342 233
153 3300009094 Ga0111539_10011279 Ga0111539_100112793 233
154 3300009174 Ga0105241_10000608 Ga0105241_1000060823 233
155 3300009174 Ga0105241_10007179 Ga0105241_100071794 233
156 3300009174 Ga0105241_10143104 Ga0105241_101431042 233
157 3300009174 Ga0105241_10576960 Ga0105241_105769602 233
158 3300009174 Ga0105241_10981968 Ga0105241_109819681 233
159 3300009174 Ga0105241_11033057 Ga0105241_110330571 233
160 3300009545 Ga0105237_10005526 Ga0105237_1000552610 233
161 3300009545 Ga0105237_10006018 Ga0105237_100060185 233
162 3300009545 Ga0105237_10006998 Ga0105237_100069985 233
163 3300009545 Ga0105237_10007301 Ga0105237_1000730114 233
164 3300009545 Ga0105237_10011542 Ga0105237_100115429 233
165 3300009545 Ga0105237_10017111 Ga0105237_100171113 233
166 3300009545 Ga0105237_10207088 Ga0105237_102070882 233
167 3300009545 Ga0105237_10665885 Ga0105237_106658852 233
168 3300009551 Ga0105238_10000592 Ga0105238_100005922 233
169 3300009551 Ga0105238_10092053 Ga0105238_100920533 233
170 3300009551 Ga0105238_10159963 Ga0105238_101599632 233
171 3300009551 Ga0105238_10651836 Ga0105238_106518362 233
172 3300009553 Ga0105249_10351052 Ga0105249_103510522 233
173 3300010375 Ga0105239_10000019 Ga0105239_1000001979 233
174 3300010375 Ga0105239_10001405 Ga0105239_1000140531 233
175 3300010375 Ga0105239_10004672 Ga0105239_100046729 233
176 3300010375 Ga0105239_10027401 Ga0105239_100274017 233
177 3300010375 Ga0105239_10248630 Ga0105239_102486302 233
178 3300010375 Ga0105239_10346502 Ga0105239_103465022 233
179 3300013100 Ga0157373_10000927 Ga0157373_1000092710 233
180 3300013100 Ga0157373_10187209 Ga0157373_101872092 233
181 3300013102 Ga0157371_10112231 Ga0157371_101122312 233
182 3300013104 Ga0157370_10018211 Ga0157370_100182117 233
183 3300013105 Ga0157369_10010400 Ga0157369_100104007 233
184 3300013105 Ga0157369_10034211 Ga0157369_100342115 233
185 3300013105 Ga0157369_10059094 Ga0157369_100590942 233
186 3300013105 Ga0157369_10188622 Ga0157369_101886222 233
187 3300013296 Ga0157374_10000011 Ga0157374_10000011329 233
188 3300013296 Ga0157374_10107601 Ga0157374_101076012 233
189 3300013297 Ga0157378_10268770 Ga0157378_102687702 233
190 3300013306 Ga0163162_10004708 Ga0163162_100047089 233
191 3300013307 Ga0157372_10003581 Ga0157372_1000358116 233
192 3300013307 Ga0157372_10012118 Ga0157372_100121182 233
193 3300013307 Ga0157372_10031379 Ga0157372_100313793 233
194 3300013307 Ga0157372_10121312 Ga0157372_101213124 233
195 3300014745 Ga0157377_10279978 Ga0157377_102799782 233
196 3300014969 Ga0157376_10007481 Ga0157376_100074812 233
197 3300025904 Ga0207647_10067803 Ga0207647_100678032 233
198 3300025904 Ga0207647_10174232 Ga0207647_101742322 233
199 3300025909 Ga0207705_10048638 Ga0207705_100486382 233
200 3300025911 Ga0207654_10006600 Ga0207654_100066005 233
201 3300025911 Ga0207654_10011213 Ga0207654_100112134 233
202 3300025911 Ga0207654_10178152 Ga0207654_101781522 233
203 3300025912 Ga0207707_10064134 Ga0207707_100641344 233
204 3300025913 Ga0207695_10000087 Ga0207695_1000008752 233
205 3300025913 Ga0207695_10000863 Ga0207695_1000086336 233
206 3300025913 Ga0207695_10001230 Ga0207695_1000123025 233
207 3300025913 Ga0207695_10001645 Ga0207695_1000164535 233
208 3300025913 Ga0207695_10016157 Ga0207695_100161572 233
209 3300025913 Ga0207695_10016635 Ga0207695_100166359 233
210 3300025913 Ga0207695_10044762 Ga0207695_100447625 233
211 3300025913 Ga0207695_10052763 Ga0207695_100527634 233
212 3300025913 Ga0207695_10092647 Ga0207695_100926473 233
213 3300025914 Ga0207671_10000311 Ga0207671_100003115 233
214 3300025914 Ga0207671_10000931 Ga0207671_1000093112 233
215 3300025914 Ga0207671_10004520 Ga0207671_1000452013 233
216 3300025914 Ga0207671_10071468 Ga0207671_100714682 233
217 3300025914 Ga0207671_10128850 Ga0207671_101288502 233
218 3300025914 Ga0207671_10194419 Ga0207671_101944191 233
219 3300025917 Ga0207660_10147988 Ga0207660_101479882 233
220 3300025919 Ga0207657_10013194 Ga0207657_100131942 233
221 3300025921 Ga0207652_10024919 Ga0207652_100249192 233
222 3300025921 Ga0207652_10050800 Ga0207652_100508002 233
223 3300025924 Ga0207694_10031984 Ga0207694_100319844 233
224 3300025924 Ga0207694_10048275 Ga0207694_100482753 233
225 3300025924 Ga0207694_10048733 Ga0207694_100487332 233
226 3300025924 Ga0207694_10141674 Ga0207694_101416742 233
227 3300025925 Ga0207650_10692301 Ga0207650_106923012 233
228 3300025928 Ga0207700_10683205 Ga0207700_106832052 233
229 3300025944 Ga0207661_10002997 Ga0207661_100029972 233
230 3300025944 Ga0207661_10129311 Ga0207661_101293111 233
231 3300025949 Ga0207667_10000098 Ga0207667_1000009888 233
232 3300025949 Ga0207667_10000279 Ga0207667_1000027952 233
233 3300025949 Ga0207667_10036738 Ga0207667_100367384 233
234 3300025949 Ga0207667_10067886 Ga0207667_100678863 233
235 3300025949 Ga0207667_10092444 Ga0207667_100924441 233
236 3300025949 Ga0207667_10304291 Ga0207667_103042912 233
237 3300025981 Ga0207640_10054839 Ga0207640_100548393 233
238 3300025981 Ga0207640_10116265 Ga0207640_101162652 233
239 3300025981 Ga0207640_10168360 Ga0207640_101683602 233
240 3300025986 Ga0207658_10343050 Ga0207658_103430502 233
241 3300026041 Ga0207639_10009288 Ga0207639_100092881 233
242 3300026041 Ga0207639_10041905 Ga0207639_100419053 233
243 3300026041 Ga0207639_10138452 Ga0207639_101384522 233
244 3300026078 Ga0207702_10039691 Ga0207702_100396912 233
245 3300026078 Ga0207702_10245666 Ga0207702_102456662 233
246 3300026116 Ga0207674_10000969 Ga0207674_1000096921 233
247 3300026118 Ga0207675_100104872 Ga0207675_1001048722 233
248 3300026142 Ga0207698_10000937 Ga0207698_1000093715 233
249 3300026142 Ga0207698_10047300 Ga0207698_100473002 233
250 3300026142 Ga0207698_10069896 Ga0207698_100698962 233
251 3300026142 Ga0207698_10090694 Ga0207698_100906942 233
252 3300026142 Ga0207698_10908417 Ga0207698_109084172 233
253 3300027876 Ga0209974_10178453 Ga0209974_101784531 233
254 3300028379 Ga0268266_10000068 Ga0268266_10000068211 233
255 3300028381 Ga0268264_10000079 Ga0268264_10000079158 233
256 3300028381 Ga0268264_10002043 Ga0268264_1000204319 233
257 3300028786 Ga0307517_10001481 Ga0307517_1000148140 233
258 3300028794 Ga0307515_10000001 Ga0307515_100000012280 233
259 3300028794 Ga0307515_10407697 Ga0307515_104076972 233
260 3300030521 Ga0307511_10000201 Ga0307511_1000020146 233
261 3300031456 Ga0307513_10143808 Ga0307513_101438082 233
262 3300031730 Ga0307516_10003458 Ga0307516_1000345823 233
263 3300032126 Ga0307415_100356310 Ga0307415_1003563102 233
264 3300033179 Ga0307507_10171810 Ga0307507_101718102 233
265 3300033180 Ga0307510_10008700 Ga0307510_1000870013 233
266 3300041498 Ga0451841_0356308 Ga0451841_0356308_263_964 233
267 3300041507 Ga0451851_1127070 Ga0451851_1127070_37_738 233
268 3300044658 Ga0466972_0008143 Ga0466972_0008143_4104_4805 233
269 3300044693 Ga0466961_0153839 Ga0466961_0153839_533_1234 233
270 3300044706 Ga0466964_0066241 Ga0466964_0066241_468_1169 233
271 3300044735 Ga0466968_0055589 Ga0466968_0055589_160_861 233
272 3300044842 Ga0466957_0050124 Ga0466957_0050124_1301_2002 233
273 3300045836 Ga0466958_0048247 Ga0466958_0048247_833_1534 233
274 3300046460 Ga0495638_0084489 Ga0495638_0084489_1063_1764 233
275 3300046507 Ga0495606_0064736 Ga0495606_0064736_1517_2218 233
276 3300046524 Ga0495648_0086382 Ga0495648_0086382_319_1020 233
277 3300046616 Ga0495668_0002655 Ga0495668_0002655_6950_7651 233
278 3300046648 Ga0495611_0000026 Ga0495611_0000026_3537_4238 233
279 3300047443 Ga0495687_001838 Ga0495687_001838_620_1321 233
280 3300047472 Ga0495686_0000005 Ga0495686_0000005_519551_520252 233
281 3300049568 Ga0501031_0076966 Ga0501031_0076966_514_1218 233
282 3300049569 Ga0501032_0014560 Ga0501032_0014560_1623_2327 233
283 3300049571 Ga0501034_0005186 Ga0501034_0005186_8607_9311 233
284 3300049572 Ga0501036_0005238 Ga0501036_0005238_1158_1862 233
285 3300049573 Ga0501037_0004139 Ga0501037_0004139_1815_2519 233
286 3300049574 Ga0501038_0020656 Ga0501038_0020656_3810_4514 233
287 3300049579 Ga0501043_0034982 Ga0501043_0034982_638_1342 233
288 3300049579 Ga0501043_0051202 Ga0501043_0051202_2128_2832 233
289 3300049579 Ga0501043_0249742 Ga0501043_0249742_598_1299 233
290 3300049581 Ga0501047_0016908 Ga0501047_0016908_1822_2526 233
291 3300049581 Ga0501047_0071717 Ga0501047_0071717_2123_2824 233
292 3300049581 Ga0501047_0406186 Ga0501047_0406186_32_733 233
293 3300049686 Ga0501257_005682 Ga0501257_005682_252_953 233
294 3300049703 Ga0501219_000704 Ga0501219_000704_2132_2833 233
295 3300049823 Ga0501044_0001506 Ga0501044_0001506_1360_2061 233
296 3300049823 Ga0501044_0006596 Ga0501044_0006596_7814_8518 233
297 3300049823 Ga0501044_0188050 Ga0501044_0188050_452_1159 233
298 3300050005 Ga0501284_00036 Ga0501284_00036_38796_39497 233
299 3300050005 Ga0501284_04967 Ga0501284_04967_24_725 233
300 3300050493 nmdc:mga0k408_12581_c1 nmdc:mga0k408_12581_c1_1825_2526 233
301 3300050509 nmdc:mga0qj67_359562_c1 nmdc:mga0qj67_359562_c1_349_1053 233
302 3300050510 nmdc:mga06r32_868945_c1 nmdc:mga06r32_868945_c1_45_749 233
303 3300053090 Ga0500646_0033314 Ga0500646_0033314_387_1088 233
304 3300053092 Ga0500583_0000076 Ga0500583_0000076_36024_36731 233
305 3300053092 Ga0500583_0000557 Ga0500583_0000557_9979_10680 233
306 3300053092 Ga0500583_0000662 Ga0500583_0000662_5206_5907 233
307 3300053133 Ga0500655_016844 Ga0500655_016844_388_1089 233
308 3300053139 Ga0500568_0019739 Ga0500568_0019739_1289_1990 233
309 3300053146 Ga0500588_0037377 Ga0500588_0037377_673_1374 233
310 3300053147 Ga0500589_011678 Ga0500589_011678_716_1417 233
311 3300053156 Ga0500622_0001733 Ga0500622_0001733_3980_4681 233
312 3300053163 Ga0500639_038750 Ga0500639_038750_1266_1967 233
313 3300053178 Ga0500637_0142145 Ga0500637_0142145_649_1350 233
314 3300061719 Ga0466962_0018303 Ga0466962_0018303_1454_2155 233
315 3300001979 JGI24740J21852_10007294 JGI24740J21852_100072945 234
316 3300001989 JGI24739J22299_10000030 JGI24739J22299_1000003019 234
317 3300001990 JGI24737J22298_10056043 JGI24737J22298_100560431 234
318 3300002738 JGI25154J39366_1000023 JGI25154J39366_10000239 234
319 3300002739 JGI25158J39367_1022306 JGI25158J39367_10223061 234
320 3300002741 JGI25157J39369_1001946 JGI25157J39369_10019463 234
321 3300003215 JGI25153J46596_10000551 JGI25153J46596_1000055123 234
322 3300003316 rootH1_10108546 rootH1_101085467 234
323 3300003320 rootH2_10006434 rootH2_100064342 234
324 3300003320 rootH2_10035434 rootH2_1003543411 234
325 3300003322 rootL2_10003209 rootL2_100032091 234
326 3300003322 rootL2_10026021 rootL2_100260218 234
327 3300003323 rootH1_10005885 rootH1_100058855 234
328 3300003323 rootH1_10069904 rootH1_100699046 234
329 3300003323 rootH1_10148649 rootH1_101486492 234
330 3300003323 rootH1_10162497 rootH1_101624972 234
331 3300003354 JGI25160J50197_1000262 JGI25160J50197_100026227 234
332 3300003354 JGI25160J50197_1003292 JGI25160J50197_10032926 234
333 3300003354 JGI25160J50197_1005474 JGI25160J50197_10054745 234
334 3300003354 JGI25160J50197_1011378 JGI25160J50197_10113782 234
335 3300003762 Ga0055542_1004489 Ga0055542_10044892 234
336 3300003771 Ga0055526_1014933 Ga0055526_10149332 234
337 3300003790 Ga0055528_1005109 Ga0055528_10051094 234
338 3300003791 Ga0055530_10000185 Ga0055530_1000018524 234
339 3300003794 Ga0055531_10000080 Ga0055531_1000008077 234
340 3300003794 Ga0055531_10015829 Ga0055531_100158292 234
341 3300005262 Ga0065165_1000658 Ga0065165_100065843 234
342 3300005262 Ga0065165_1015870 Ga0065165_10158703 234
343 3300005262 Ga0065165_1016647 Ga0065165_10166473 234
344 3300005327 Ga0070658_10148731 Ga0070658_101487312 234
345 3300005327 Ga0070658_10370041 Ga0070658_103700412 234
346 3300005334 Ga0068869_100023826 Ga0068869_1000238262 234
347 3300005336 Ga0070680_100062884 Ga0070680_1000628841 234
348 3300005339 Ga0070660_100001701 Ga0070660_10000170114 234
349 3300005339 Ga0070660_100162679 Ga0070660_1001626792 234
350 3300005339 Ga0070660_100364986 Ga0070660_1003649861 234
351 3300005343 Ga0070687_100002175 Ga0070687_1000021755 234
352 3300005354 Ga0070675_100170583 Ga0070675_1001705831 234
353 3300005356 Ga0070674_100028730 Ga0070674_1000287303 234
354 3300005366 Ga0070659_100020079 Ga0070659_1000200792 234
355 3300005367 Ga0070667_100175646 Ga0070667_1001756462 234
356 3300005435 Ga0070714_100097141 Ga0070714_1000971412 234
357 3300005455 Ga0070663_100023838 Ga0070663_1000238383 234
358 3300005455 Ga0070663_100650154 Ga0070663_1006501541 234
359 3300005456 Ga0070678_100012152 Ga0070678_1000121522 234
360 3300005457 Ga0070662_100225848 Ga0070662_1002258482 234
361 3300005458 Ga0070681_10018659 Ga0070681_100186593 234
362 3300005458 Ga0070681_10029652 Ga0070681_100296524 234
363 3300005459 Ga0068867_100128318 Ga0068867_1001283182 234
364 3300005530 Ga0070679_100084362 Ga0070679_1000843622 234
365 3300005539 Ga0068853_100126287 Ga0068853_1001262872 234
366 3300005549 Ga0070704_100651303 Ga0070704_1006513031 234
367 3300005563 Ga0068855_100001027 Ga0068855_10000102715 234
368 3300005563 Ga0068855_100022282 Ga0068855_1000222826 234
369 3300005563 Ga0068855_100553509 Ga0068855_1005535092 234
370 3300005577 Ga0068857_100043224 Ga0068857_1000432244 234
371 3300005614 Ga0068856_100029521 Ga0068856_1000295212 234
372 3300005615 Ga0070702_100012795 Ga0070702_1000127954 234
373 3300005616 Ga0068852_100053083 Ga0068852_1000530833 234
374 3300005841 Ga0068863_100030065 Ga0068863_1000300656 234
375 3300005842 Ga0068858_100043642 Ga0068858_1000436424 234
376 3300005843 Ga0068860_100020912 Ga0068860_1000209125 234
377 3300006195 Ga0075366_10020526 Ga0075366_100205264 234
378 3300006880 Ga0075429_100415624 Ga0075429_1004156242 234
379 3300006931 Ga0097620_100312077 Ga0097620_1003120772 234
380 3300009094 Ga0111539_10103371 Ga0111539_101033711 234
381 3300009176 Ga0105242_10444777 Ga0105242_104447771 234
382 3300009177 Ga0105248_11468427 Ga0105248_114684271 234
383 3300009545 Ga0105237_10001055 Ga0105237_1000105515 234
384 3300009553 Ga0105249_10044259 Ga0105249_100442596 234
385 3300010375 Ga0105239_10013173 Ga0105239_100131737 234
386 3300010375 Ga0105239_10234930 Ga0105239_102349302 234
387 3300013100 Ga0157373_10003672 Ga0157373_100036722 234
388 3300013102 Ga0157371_10000218 Ga0157371_1000021875 234
389 3300013102 Ga0157371_10005551 Ga0157371_100055517 234
390 3300013102 Ga0157371_10005559 Ga0157371_100055595 234
391 3300013102 Ga0157371_10009581 Ga0157371_100095814 234
392 3300013102 Ga0157371_10081734 Ga0157371_100817342 234
393 3300013102 Ga0157371_10096881 Ga0157371_100968812 234
394 3300013104 Ga0157370_10001029 Ga0157370_1000102922 234
395 3300013104 Ga0157370_10003402 Ga0157370_100034026 234
396 3300013104 Ga0157370_10060865 Ga0157370_100608652 234
397 3300013105 Ga0157369_10473626 Ga0157369_104736262 234
398 3300013297 Ga0157378_10005523 Ga0157378_1000552311 234
399 3300013306 Ga0163162_10005290 Ga0163162_100052903 234
400 3300013306 Ga0163162_10104996 Ga0163162_101049964 234
401 3300013306 Ga0163162_10213432 Ga0163162_102134322 234
402 3300013307 Ga0157372_10007454 Ga0157372_1000745411 234
403 3300013307 Ga0157372_10010103 Ga0157372_1001010310 234
404 3300013307 Ga0157372_10028193 Ga0157372_100281932 234
405 3300013307 Ga0157372_10047349 Ga0157372_100473492 234
406 3300013307 Ga0157372_10142033 Ga0157372_101420332 234
407 3300013308 Ga0157375_10104801 Ga0157375_101048012 234
408 3300014325 Ga0163163_10993533 Ga0163163_109935332 234
409 3300014745 Ga0157377_10068561 Ga0157377_100685612 234
410 3300015265 Ga0182005_1000347 Ga0182005_100034714 234
411 3300025208 Ga0209436_100381 Ga0209436_1003816 234
412 3300025208 Ga0209436_105597 Ga0209436_1055973 234
413 3300025242 Ga0209258_100116 Ga0209258_10011691 234
414 3300025246 Ga0209646_1000004 Ga0209646_1000004586 234
415 3300025250 Ga0209026_1000136 Ga0209026_100013673 234
416 3300025254 Ga0209148_1000175 Ga0209148_100017522 234
417 3300025258 Ga0209129_1013267 Ga0209129_10132672 234
418 3300025273 Ga0209673_1000203 Ga0209673_1000203104 234
419 3300025284 Ga0209130_1001665 Ga0209130_10016657 234
420 3300025295 Ga0209564_1029275 Ga0209564_10292751 234
421 3300025297 Ga0209758_1003355 Ga0209758_10033555 234
422 3300025297 Ga0209758_1035284 Ga0209758_10352843 234
423 3300025298 Ga0209050_1000276 Ga0209050_100027645 234
424 3300025302 Ga0207426_1000024 Ga0207426_1000024114 234
425 3300025302 Ga0207426_1000059 Ga0207426_100005945 234
426 3300025302 Ga0207426_1000957 Ga0207426_100095724 234
427 3300025302 Ga0207426_1001807 Ga0207426_100180716 234
428 3300025302 Ga0207426_1004921 Ga0207426_10049212 234
429 3300025303 Ga0209051_1028556 Ga0209051_10285563 234
430 3300025304 Ga0209257_1000004 Ga0209257_100000477 234
431 3300025304 Ga0209257_1000736 Ga0209257_100073610 234
432 3300025904 Ga0207647_10015325 Ga0207647_100153252 234
433 3300025904 Ga0207647_10133698 Ga0207647_101336981 234
434 3300025909 Ga0207705_10016061 Ga0207705_100160615 234
435 3300025912 Ga0207707_10021785 Ga0207707_100217852 234
436 3300025912 Ga0207707_10031463 Ga0207707_100314632 234
437 3300025914 Ga0207671_10285284 Ga0207671_102852842 234
438 3300025917 Ga0207660_10011620 Ga0207660_100116203 234
439 3300025917 Ga0207660_10159791 Ga0207660_101597912 234
440 3300025919 Ga0207657_10004301 Ga0207657_1000430114 234
441 3300025919 Ga0207657_10055721 Ga0207657_100557212 234
442 3300025919 Ga0207657_10062275 Ga0207657_100622754 234
443 3300025921 Ga0207652_10015279 Ga0207652_100152794 234
444 3300025921 Ga0207652_10098398 Ga0207652_100983982 234
445 3300025929 Ga0207664_10259690 Ga0207664_102596902 234
446 3300025932 Ga0207690_10152754 Ga0207690_101527542 234
447 3300025937 Ga0207669_10049990 Ga0207669_100499902 234
448 3300025942 Ga0207689_10074508 Ga0207689_100745084 234
449 3300025945 Ga0207679_10051676 Ga0207679_100516763 234
450 3300025949 Ga0207667_10004113 Ga0207667_100041136 234
451 3300025949 Ga0207667_10015607 Ga0207667_100156074 234
452 3300025949 Ga0207667_10153360 Ga0207667_101533603 234
453 3300025949 Ga0207667_10446595 Ga0207667_104465952 234
454 3300026041 Ga0207639_10111554 Ga0207639_101115543 234
455 3300026067 Ga0207678_10136670 Ga0207678_101366703 234
456 3300026078 Ga0207702_10100345 Ga0207702_101003453 234
457 3300026118 Ga0207675_100645481 Ga0207675_1006454811 234
458 3300026142 Ga0207698_10132943 Ga0207698_101329432 234
459 3300026142 Ga0207698_10575339 Ga0207698_105753392 234
460 3300028381 Ga0268264_10004073 Ga0268264_100040734 234
461 3300032004 Ga0307414_10121535 Ga0307414_101215353 234
462 3300037312 Ga0395899_0009123 Ga0395899_0009123_332_1039 234
463 3300037312 Ga0395899_0026127 Ga0395899_0026127_1677_2384 234
464 3300037312 Ga0395899_0039218 Ga0395899_0039218_1753_2460 234
465 3300037418 Ga0395900_0086961 Ga0395900_0086961_337_1044 234
466 3300037418 Ga0395900_0167250 Ga0395900_0167250_1396_2103 234
467 3300037418 Ga0395900_0269218 Ga0395900_0269218_641_1348 234
468 3300037466 Ga0395898_0098120 Ga0395898_0098120_2087_2794 234
469 3300037466 Ga0395898_0475765 Ga0395898_0475765_376_1083 234
470 3300037471 Ga0395905_0249181 Ga0395905_0249181_528_1235 234
471 3300038443 Ga0395901_0007671 Ga0395901_0007671_9432_10139 234
472 3300038443 Ga0395901_0028563 Ga0395901_0028563_4626_5333 234
473 3300038443 Ga0395901_0055582 Ga0395901_0055582_292_999 234
474 3300038443 Ga0395901_0122950 Ga0395901_0122950_1157_1864 234
475 3300041452 Ga0451793_0181996 Ga0451793_0181996_18_725 234
476 3300041463 Ga0451804_1111977 Ga0451804_1111977_47_751 234
477 3300042004 Ga0439445_0031519 Ga0439445_0031519_11_721 234
478 3300042007 Ga0439449_0082707 Ga0439449_0082707_298_1005 234
479 3300042876 Ga0451577_0280639 Ga0451577_0280639_279_983 234
480 3300044683 Ga0466965_0005791 Ga0466965_0005791_4384_5091 234
481 3300046453 Ga0495627_029697 Ga0495627_029697_269_976 234
482 3300046558 Ga0495633_0000116 Ga0495633_0000116_55457_56164 234
483 3300048929 Ga0496126_0015380 Ga0496126_0015380_6384_7091 234
484 3300049570 Ga0501033_0044589 Ga0501033_0044589_1608_2318 234
485 3300049571 Ga0501034_0000004 Ga0501034_0000004_338324_339031 234
486 3300049571 Ga0501034_0028416 Ga0501034_0028416_3634_4344 234
487 3300049571 Ga0501034_0053717 Ga0501034_0053717_1556_2266 234
488 3300049822 Ga0501035_0319559 Ga0501035_0319559_227_937 234
489 3300049823 Ga0501044_0067425 Ga0501044_0067425_2653_3363 234
490 3300050493 nmdc:mga0k408_257387_c1 nmdc:mga0k408_257387_c1_293_997 234
491 3300050508 nmdc:mga09592_198000_c1 nmdc:mga09592_198000_c1_235_939 234
492 3300053088 Ga0500644_0000260 Ga0500644_0000260_4649_5356 234
493 3300053090 Ga0500646_0002227 Ga0500646_0002227_2269_2976 234
494 3300053092 Ga0500583_0050409 Ga0500583_0050409_1001_1708 234
495 3300053093 Ga0500651_0031174 Ga0500651_0031174_1996_2703 234
496 3300053109 Ga0500569_000126 Ga0500569_000126_965_1672 234
497 3300053121 Ga0500607_084876 Ga0500607_084876_169_876 234
498 3300053134 Ga0500658_0003845 Ga0500658_0003845_4602_5309 234
499 3300053136 Ga0500559_0064467 Ga0500559_0064467_114_821 234
500 3300053142 Ga0500577_0010546 Ga0500577_0010546_1707_2414 234
501 3300053148 Ga0500590_125891 Ga0500590_125891_376_1083 234
502 3300053153 Ga0500616_0116780 Ga0500616_0116780_290_997 234
503 3300053156 Ga0500622_0000212 Ga0500622_0000212_4239_4946 234
504 3300053160 Ga0500633_0019517 Ga0500633_0019517_856_1563 234
505 3300053177 Ga0500636_0002821 Ga0500636_0002821_972_1679 234
506 2162886006 SwRhRL3b_contig_981202 SwRhRL3b_0159.00000260 235
507 2162886011 MRS1b_contig_3268472 MRS1b_0325.00000700 235
508 2162886012 MBSR1b_contig_11128225 MBSR1b_0076.00000370 235
509 2162886012 MBSR1b_contig_5448556 MBSR1b_0478.00005130 235
510 3300003203 JGI25406J46586_10001649 JGI25406J46586_100016497 235
511 3300003316 rootH1_10119675 rootH1_101196752 235
512 3300003316 rootH1_10189687 rootH1_101896872 235
513 3300003322 rootL2_10109532 rootL2_101095324 235
514 3300003323 rootH1_10174566 rootH1_101745664 235
515 3300005288 Ga0065714_10169900 Ga0065714_101699002 235
516 3300005289 Ga0065704_10083111 Ga0065704_100831114 235
517 3300005290 Ga0065712_10001811 Ga0065712_100018113 235
518 3300005290 Ga0065712_10131490 Ga0065712_101314902 235
519 3300005293 Ga0065715_10107465 Ga0065715_101074652 235
520 3300005328 Ga0070676_10026974 Ga0070676_100269743 235
521 3300005329 Ga0070683_100010919 Ga0070683_1000109195 235
522 3300005329 Ga0070683_100016236 Ga0070683_1000162364 235
523 3300005330 Ga0070690_100008208 Ga0070690_1000082082 235
524 3300005330 Ga0070690_100042207 Ga0070690_1000422072 235
525 3300005330 Ga0070690_100047194 Ga0070690_1000471942 235
526 3300005331 Ga0070670_100042974 Ga0070670_1000429742 235
527 3300005331 Ga0070670_100080557 Ga0070670_1000805572 235
528 3300005331 Ga0070670_100381812 Ga0070670_1003818122 235
529 3300005333 Ga0070677_10185787 Ga0070677_101857871 235
530 3300005334 Ga0068869_100010867 Ga0068869_1000108675 235
531 3300005334 Ga0068869_100023482 Ga0068869_1000234824 235
532 3300005334 Ga0068869_100025876 Ga0068869_1000258764 235
533 3300005334 Ga0068869_100545350 Ga0068869_1005453501 235
534 3300005335 Ga0070666_10019589 Ga0070666_100195894 235
535 3300005335 Ga0070666_10071360 Ga0070666_100713602 235
536 3300005335 Ga0070666_10094173 Ga0070666_100941732 235
537 3300005336 Ga0070680_100230985 Ga0070680_1002309852 235
538 3300005338 Ga0068868_100008122 Ga0068868_1000081222 235
539 3300005338 Ga0068868_100050988 Ga0068868_1000509882 235
540 3300005338 Ga0068868_100148964 Ga0068868_1001489641 235
541 3300005338 Ga0068868_100163007 Ga0068868_1001630072 235
542 3300005339 Ga0070660_100222651 Ga0070660_1002226512 235
543 3300005340 Ga0070689_100083354 Ga0070689_1000833543 235
544 3300005340 Ga0070689_100092162 Ga0070689_1000921622 235
545 3300005340 Ga0070689_100166838 Ga0070689_1001668382 235
546 3300005340 Ga0070689_100215216 Ga0070689_1002152162 235
547 3300005341 Ga0070691_10014940 Ga0070691_100149403 235
548 3300005344 Ga0070661_100010396 Ga0070661_1000103965 235
549 3300005344 Ga0070661_100169976 Ga0070661_1001699762 235
550 3300005344 Ga0070661_100196607 Ga0070661_1001966072 235
551 3300005347 Ga0070668_100038898 Ga0070668_1000388982 235
552 3300005347 Ga0070668_100084352 Ga0070668_1000843523 235
553 3300005347 Ga0070668_100445560 Ga0070668_1004455601 235
554 3300005353 Ga0070669_100001473 Ga0070669_1000014734 235
555 3300005353 Ga0070669_100002379 Ga0070669_1000023799 235
556 3300005353 Ga0070669_100232571 Ga0070669_1002325711 235
557 3300005353 Ga0070669_100330819 Ga0070669_1003308192 235
558 3300005353 Ga0070669_100365431 Ga0070669_1003654312 235
559 3300005354 Ga0070675_100002848 Ga0070675_1000028487 235
560 3300005354 Ga0070675_100147193 Ga0070675_1001471932 235
561 3300005354 Ga0070675_100174451 Ga0070675_1001744513 235
562 3300005355 Ga0070671_100139769 Ga0070671_1001397692 235
563 3300005356 Ga0070674_100111383 Ga0070674_1001113833 235
564 3300005364 Ga0070673_100016516 Ga0070673_1000165165 235
565 3300005364 Ga0070673_100056711 Ga0070673_1000567112 235
566 3300005364 Ga0070673_100188037 Ga0070673_1001880371 235
567 3300005364 Ga0070673_100206890 Ga0070673_1002068902 235
568 3300005364 Ga0070673_100231519 Ga0070673_1002315192 235
569 3300005365 Ga0070688_100014189 Ga0070688_1000141893 235
570 3300005365 Ga0070688_100032799 Ga0070688_1000327992 235
571 3300005366 Ga0070659_100069244 Ga0070659_1000692442 235
572 3300005367 Ga0070667_100021229 Ga0070667_1000212292 235
573 3300005367 Ga0070667_100105559 Ga0070667_1001055592 235
574 3300005367 Ga0070667_100124634 Ga0070667_1001246342 235
575 3300005367 Ga0070667_100197785 Ga0070667_1001977852 235
576 3300005367 Ga0070667_100531129 Ga0070667_1005311291 235
577 3300005367 Ga0070667_100620507 Ga0070667_1006205072 235
578 3300005438 Ga0070701_10010862 Ga0070701_100108622 235
579 3300005441 Ga0070700_100017034 Ga0070700_1000170344 235
580 3300005456 Ga0070678_100027845 Ga0070678_1000278452 235
581 3300005456 Ga0070678_100113898 Ga0070678_1001138983 235
582 3300005457 Ga0070662_100003337 Ga0070662_1000033377 235
583 3300005457 Ga0070662_100007311 Ga0070662_1000073118 235
584 3300005457 Ga0070662_100043670 Ga0070662_1000436704 235
585 3300005457 Ga0070662_100644692 Ga0070662_1006446922 235
586 3300005458 Ga0070681_10409182 Ga0070681_104091822 235
587 3300005459 Ga0068867_100003149 Ga0068867_1000031496 235
588 3300005459 Ga0068867_100011145 Ga0068867_1000111452 235
589 3300005459 Ga0068867_100034427 Ga0068867_1000344274 235
590 3300005459 Ga0068867_100039464 Ga0068867_1000394644 235
591 3300005459 Ga0068867_100069965 Ga0068867_1000699652 235
592 3300005459 Ga0068867_100684361 Ga0068867_1006843611 235
593 3300005466 Ga0070685_10005889 Ga0070685_100058892 235
594 3300005466 Ga0070685_10057717 Ga0070685_100577171 235
595 3300005467 Ga0070706_100160349 Ga0070706_1001603493 235
596 3300005518 Ga0070699_100744618 Ga0070699_1007446181 235
597 3300005535 Ga0070684_100002319 Ga0070684_1000023195 235
598 3300005535 Ga0070684_100018469 Ga0070684_1000184695 235
599 3300005535 Ga0070684_100045790 Ga0070684_1000457903 235
600 3300005539 Ga0068853_100012660 Ga0068853_1000126605 235
601 3300005539 Ga0068853_100026641 Ga0068853_1000266414 235
602 3300005539 Ga0068853_100112140 Ga0068853_1001121403 235
603 3300005539 Ga0068853_100158738 Ga0068853_1001587382 235
604 3300005543 Ga0070672_100264670 Ga0070672_1002646702 235
605 3300005543 Ga0070672_100270528 Ga0070672_1002705282 235
606 3300005544 Ga0070686_100002348 Ga0070686_1000023482 235
607 3300005547 Ga0070693_100155375 Ga0070693_1001553751 235
608 3300005547 Ga0070693_100367100 Ga0070693_1003671002 235
609 3300005547 Ga0070693_100429698 Ga0070693_1004296982 235
610 3300005548 Ga0070665_100010501 Ga0070665_1000105019 235
611 3300005564 Ga0070664_100020090 Ga0070664_1000200905 235
612 3300005564 Ga0070664_100154183 Ga0070664_1001541832 235
613 3300005564 Ga0070664_100304484 Ga0070664_1003044842 235
614 3300005577 Ga0068857_100009364 Ga0068857_1000093645 235
615 3300005577 Ga0068857_100215361 Ga0068857_1002153612 235
616 3300005577 Ga0068857_100627451 Ga0068857_1006274512 235
617 3300005578 Ga0068854_100023108 Ga0068854_1000231082 235
618 3300005578 Ga0068854_100295385 Ga0068854_1002953852 235
619 3300005616 Ga0068852_100027749 Ga0068852_1000277495 235
620 3300005616 Ga0068852_100183721 Ga0068852_1001837212 235
621 3300005616 Ga0068852_100464625 Ga0068852_1004646252 235
622 3300005617 Ga0068859_100052034 Ga0068859_1000520342 235
623 3300005617 Ga0068859_100057535 Ga0068859_1000575354 235
624 3300005617 Ga0068859_100065234 Ga0068859_1000652342 235
625 3300005617 Ga0068859_100206749 Ga0068859_1002067492 235
626 3300005617 Ga0068859_100402314 Ga0068859_1004023141 235
627 3300005618 Ga0068864_100327593 Ga0068864_1003275932 235
628 3300005618 Ga0068864_100554786 Ga0068864_1005547862 235
629 3300005718 Ga0068866_10089167 Ga0068866_100891672 235
630 3300005718 Ga0068866_10205294 Ga0068866_102052941 235
631 3300005719 Ga0068861_100005965 Ga0068861_1000059652 235
632 3300005719 Ga0068861_100142260 Ga0068861_1001422603 235
633 3300005840 Ga0068870_10015841 Ga0068870_100158412 235
634 3300005840 Ga0068870_10238647 Ga0068870_102386472 235
635 3300005841 Ga0068863_100327402 Ga0068863_1003274021 235
636 3300005841 Ga0068863_100363016 Ga0068863_1003630162 235
637 3300005841 Ga0068863_100424242 Ga0068863_1004242423 235
638 3300005842 Ga0068858_100069589 Ga0068858_1000695892 235
639 3300005842 Ga0068858_100081884 Ga0068858_1000818842 235
640 3300005842 Ga0068858_100184815 Ga0068858_1001848152 235
641 3300005842 Ga0068858_100478197 Ga0068858_1004781972 235
642 3300005843 Ga0068860_100061044 Ga0068860_1000610442 235
643 3300005843 Ga0068860_100096462 Ga0068860_1000964622 235
644 3300005843 Ga0068860_100122333 Ga0068860_1001223332 235
645 3300005843 Ga0068860_100142112 Ga0068860_1001421122 235
646 3300005843 Ga0068860_100165733 Ga0068860_1001657332 235
647 3300005844 Ga0068862_100003320 Ga0068862_1000033207 235
648 3300005844 Ga0068862_100127044 Ga0068862_1001270443 235
649 3300005844 Ga0068862_100185882 Ga0068862_1001858822 235
650 3300005844 Ga0068862_100207999 Ga0068862_1002079992 235
651 3300005844 Ga0068862_100238029 Ga0068862_1002380292 235
652 3300005844 Ga0068862_100693688 Ga0068862_1006936882 235
653 3300005985 Ga0081539_10001169 Ga0081539_1000116926 235
654 3300006195 Ga0075366_10008445 Ga0075366_100084457 235
655 3300006195 Ga0075366_10013810 Ga0075366_100138106 235
656 3300006237 Ga0097621_100034071 Ga0097621_1000340712 235
657 3300006237 Ga0097621_100213347 Ga0097621_1002133471 235
658 3300006237 Ga0097621_100483174 Ga0097621_1004831742 235
659 3300006358 Ga0068871_100005800 Ga0068871_1000058008 235
660 3300006358 Ga0068871_100011294 Ga0068871_1000112946 235
661 3300006358 Ga0068871_100156605 Ga0068871_1001566052 235
662 3300006358 Ga0068871_100258495 Ga0068871_1002584952 235
663 3300006358 Ga0068871_100311914 Ga0068871_1003119142 235
664 3300006881 Ga0068865_100014376 Ga0068865_1000143764 235
665 3300006881 Ga0068865_100054058 Ga0068865_1000540582 235
666 3300006881 Ga0068865_100174859 Ga0068865_1001748592 235
667 3300006931 Ga0097620_100052035 Ga0097620_1000520352 235
668 3300006931 Ga0097620_100057538 Ga0097620_1000575384 235
669 3300006931 Ga0097620_100065241 Ga0097620_1000652414 235
670 3300006931 Ga0097620_100206762 Ga0097620_1002067622 235
671 3300006931 Ga0097620_100402270 Ga0097620_1004022701 235
672 3300009093 Ga0105240_10300854 Ga0105240_103008542 235
673 3300009093 Ga0105240_10705280 Ga0105240_107052802 235
674 3300009094 Ga0111539_10005159 Ga0111539_1000515915 235
675 3300009101 Ga0105247_10000312 Ga0105247_1000031232 235
676 3300009101 Ga0105247_10047668 Ga0105247_100476682 235
677 3300009148 Ga0105243_10082441 Ga0105243_100824412 235
678 3300009174 Ga0105241_10040180 Ga0105241_100401802 235
679 3300009176 Ga0105242_10023950 Ga0105242_100239502 235
680 3300009176 Ga0105242_10027545 Ga0105242_100275452 235
681 3300009176 Ga0105242_10135198 Ga0105242_101351981 235
682 3300009176 Ga0105242_10173117 Ga0105242_101731172 235
683 3300009176 Ga0105242_10268998 Ga0105242_102689982 235
684 3300009176 Ga0105242_10297728 Ga0105242_102977282 235
685 3300009177 Ga0105248_10192276 Ga0105248_101922761 235
686 3300009553 Ga0105249_10010102 Ga0105249_100101023 235
687 3300009553 Ga0105249_10013950 Ga0105249_100139505 235
688 3300009553 Ga0105249_10017890 Ga0105249_100178902 235
689 3300009553 Ga0105249_10820063 Ga0105249_108200632 235
690 3300010375 Ga0105239_10131992 Ga0105239_101319922 235
691 3300010375 Ga0105239_10398219 Ga0105239_103982192 235
692 3300011119 Ga0105246_10123991 Ga0105246_101239911 235
693 3300011119 Ga0105246_10162933 Ga0105246_101629332 235
694 3300013100 Ga0157373_10031894 Ga0157373_100318942 235
695 3300013100 Ga0157373_10145917 Ga0157373_101459172 235
696 3300013102 Ga0157371_10010719 Ga0157371_100107191 235
697 3300013102 Ga0157371_10014278 Ga0157371_100142782 235
698 3300013102 Ga0157371_10176975 Ga0157371_101769752 235
699 3300013104 Ga0157370_10465930 Ga0157370_104659301 235
700 3300013105 Ga0157369_10025346 Ga0157369_100253466 235
701 3300013105 Ga0157369_10101397 Ga0157369_101013972 235
702 3300013105 Ga0157369_10216187 Ga0157369_102161872 235
703 3300013105 Ga0157369_10868613 Ga0157369_108686131 235
704 3300013296 Ga0157374_10025078 Ga0157374_100250782 235
705 3300013296 Ga0157374_10038891 Ga0157374_100388913 235
706 3300013296 Ga0157374_10042729 Ga0157374_100427294 235
707 3300013296 Ga0157374_10152419 Ga0157374_101524192 235
708 3300013296 Ga0157374_10165790 Ga0157374_101657902 235
709 3300013296 Ga0157374_10221176 Ga0157374_102211762 235
710 3300013297 Ga0157378_10037242 Ga0157378_100372422 235
711 3300013297 Ga0157378_10062778 Ga0157378_100627783 235
712 3300013297 Ga0157378_10142475 Ga0157378_101424752 235
713 3300013297 Ga0157378_10159054 Ga0157378_101590542 235
714 3300013297 Ga0157378_10398812 Ga0157378_103988122 235
715 3300013297 Ga0157378_11105649 Ga0157378_111056492 235
716 3300013306 Ga0163162_10000131 Ga0163162_1000013156 235
717 3300013306 Ga0163162_10038605 Ga0163162_100386054 235
718 3300013306 Ga0163162_10039779 Ga0163162_100397792 235
719 3300013306 Ga0163162_10061753 Ga0163162_100617533 235
720 3300013306 Ga0163162_10073172 Ga0163162_100731721 235
721 3300013306 Ga0163162_10131408 Ga0163162_101314082 235
722 3300013306 Ga0163162_10137584 Ga0163162_101375842 235
723 3300013306 Ga0163162_10151565 Ga0163162_101515651 235
724 3300013306 Ga0163162_10616528 Ga0163162_106165282 235
725 3300013307 Ga0157372_10002419 Ga0157372_100024198 235
726 3300013307 Ga0157372_10104492 Ga0157372_101044921 235
727 3300013307 Ga0157372_10213475 Ga0157372_102134753 235
728 3300013307 Ga0157372_10351612 Ga0157372_103516122 235
729 3300013307 Ga0157372_10417051 Ga0157372_104170512 235
730 3300013307 Ga0157372_10489888 Ga0157372_104898882 235
731 3300013307 Ga0157372_10617596 Ga0157372_106175961 235
732 3300013307 Ga0157372_10728386 Ga0157372_107283861 235
733 3300013307 Ga0157372_10747771 Ga0157372_107477712 235
734 3300013308 Ga0157375_10017033 Ga0157375_100170332 235
735 3300013308 Ga0157375_10020278 Ga0157375_100202784 235
736 3300013308 Ga0157375_10022629 Ga0157375_100226295 235
737 3300013308 Ga0157375_10041404 Ga0157375_100414042 235
738 3300013308 Ga0157375_10067495 Ga0157375_100674952 235
739 3300013308 Ga0157375_10546896 Ga0157375_105468962 235
740 3300013308 Ga0157375_10700957 Ga0157375_107009571 235
741 3300013308 Ga0157375_11090716 Ga0157375_110907161 235
742 3300014325 Ga0163163_10000368 Ga0163163_100003684 235
743 3300014325 Ga0163163_10000591 Ga0163163_1000059135 235
744 3300014325 Ga0163163_10002613 Ga0163163_100026135 235
745 3300014325 Ga0163163_10035392 Ga0163163_100353925 235
746 3300014325 Ga0163163_10520060 Ga0163163_105200602 235
747 3300014326 Ga0157380_10001169 Ga0157380_1000116915 235
748 3300014326 Ga0157380_10013173 Ga0157380_100131736 235
749 3300014326 Ga0157380_10172186 Ga0157380_101721862 235
750 3300014326 Ga0157380_10245907 Ga0157380_102459072 235
751 3300014326 Ga0157380_10346062 Ga0157380_103460622 235
752 3300014745 Ga0157377_10000583 Ga0157377_1000058311 235
753 3300014745 Ga0157377_10010639 Ga0157377_100106392 235
754 3300014745 Ga0157377_10104123 Ga0157377_101041232 235
755 3300014968 Ga0157379_10065726 Ga0157379_100657263 235
756 3300014968 Ga0157379_10115111 Ga0157379_101151113 235
757 3300014968 Ga0157379_10178514 Ga0157379_101785142 235
758 3300014968 Ga0157379_10301294 Ga0157379_103012942 235
759 3300014968 Ga0157379_10319530 Ga0157379_103195302 235
760 3300014968 Ga0157379_10352364 Ga0157379_103523642 235
761 3300014969 Ga0157376_10071819 Ga0157376_100718192 235
762 3300014969 Ga0157376_10144156 Ga0157376_101441562 235
763 3300014969 Ga0157376_10212351 Ga0157376_102123512 235
764 3300017792 Ga0163161_10014248 Ga0163161_100142486 235
765 3300017792 Ga0163161_10061547 Ga0163161_100615472 235
766 3300017792 Ga0163161_10210465 Ga0163161_102104652 235
767 3300017792 Ga0163161_10832109 Ga0163161_108321091 235
768 3300025315 Ga0207697_10014327 Ga0207697_100143273 235
769 3300025899 Ga0207642_10066117 Ga0207642_100661172 235
770 3300025899 Ga0207642_10128593 Ga0207642_101285931 235
771 3300025900 Ga0207710_10003454 Ga0207710_100034544 235
772 3300025901 Ga0207688_10014553 Ga0207688_100145534 235
773 3300025903 Ga0207680_10059167 Ga0207680_100591671 235
774 3300025903 Ga0207680_10078434 Ga0207680_100784342 235
775 3300025903 Ga0207680_10087851 Ga0207680_100878512 235
776 3300025904 Ga0207647_10012067 Ga0207647_100120674 235
777 3300025905 Ga0207685_10046005 Ga0207685_100460052 235
778 3300025905 Ga0207685_10070455 Ga0207685_100704552 235
779 3300025907 Ga0207645_10002259 Ga0207645_100022596 235
780 3300025907 Ga0207645_10045080 Ga0207645_100450802 235
781 3300025907 Ga0207645_10233734 Ga0207645_102337341 235
782 3300025908 Ga0207643_10001726 Ga0207643_100017265 235
783 3300025908 Ga0207643_10002959 Ga0207643_100029591 235
784 3300025918 Ga0207662_10150672 Ga0207662_101506722 235
785 3300025919 Ga0207657_10195260 Ga0207657_101952602 235
786 3300025919 Ga0207657_10218906 Ga0207657_102189062 235
787 3300025920 Ga0207649_10009764 Ga0207649_100097645 235
788 3300025923 Ga0207681_10005188 Ga0207681_100051885 235
789 3300025923 Ga0207681_10151369 Ga0207681_101513692 235
790 3300025923 Ga0207681_10220221 Ga0207681_102202211 235
791 3300025923 Ga0207681_10305519 Ga0207681_103055192 235
792 3300025923 Ga0207681_10390928 Ga0207681_103909282 235
793 3300025923 Ga0207681_10570078 Ga0207681_105700781 235
794 3300025925 Ga0207650_10008659 Ga0207650_100086593 235
795 3300025925 Ga0207650_10355213 Ga0207650_103552131 235
796 3300025925 Ga0207650_10601117 Ga0207650_106011171 235
797 3300025926 Ga0207659_10035016 Ga0207659_100350163 235
798 3300025926 Ga0207659_10073350 Ga0207659_100733502 235
799 3300025931 Ga0207644_10215706 Ga0207644_102157062 235
800 3300025932 Ga0207690_10042491 Ga0207690_100424912 235
801 3300025933 Ga0207706_10012685 Ga0207706_100126856 235
802 3300025933 Ga0207706_10014218 Ga0207706_100142185 235
803 3300025933 Ga0207706_10027202 Ga0207706_100272022 235
804 3300025933 Ga0207706_10047628 Ga0207706_100476285 235
805 3300025933 Ga0207706_10061401 Ga0207706_100614013 235
806 3300025933 Ga0207706_10110337 Ga0207706_101103372 235
807 3300025934 Ga0207686_10079691 Ga0207686_100796912 235
808 3300025936 Ga0207670_10004555 Ga0207670_100045552 235
809 3300025936 Ga0207670_10017672 Ga0207670_100176724 235
810 3300025936 Ga0207670_10067853 Ga0207670_100678532 235
811 3300025937 Ga0207669_10202361 Ga0207669_102023612 235
812 3300025938 Ga0207704_10068555 Ga0207704_100685552 235
813 3300025938 Ga0207704_10291008 Ga0207704_102910082 235
814 3300025940 Ga0207691_10085172 Ga0207691_100851722 235
815 3300025940 Ga0207691_10146521 Ga0207691_101465212 235
816 3300025942 Ga0207689_10002915 Ga0207689_100029152 235
817 3300025942 Ga0207689_10007600 Ga0207689_100076009 235
818 3300025942 Ga0207689_10031405 Ga0207689_100314052 235
819 3300025942 Ga0207689_10133923 Ga0207689_101339232 235
820 3300025944 Ga0207661_10023607 Ga0207661_100236073 235
821 3300025944 Ga0207661_10132054 Ga0207661_101320542 235
822 3300025945 Ga0207679_10002990 Ga0207679_100029906 235
823 3300025945 Ga0207679_10090875 Ga0207679_100908752 235
824 3300025945 Ga0207679_10137024 Ga0207679_101370242 235
825 3300025949 Ga0207667_10411371 Ga0207667_104113712 235
826 3300025960 Ga0207651_10055766 Ga0207651_100557662 235
827 3300025960 Ga0207651_10406754 Ga0207651_104067541 235
828 3300025960 Ga0207651_10568262 Ga0207651_105682621 235
829 3300025960 Ga0207651_10703119 Ga0207651_107031191 235
830 3300025961 Ga0207712_10048361 Ga0207712_100483613 235
831 3300025961 Ga0207712_10113716 Ga0207712_101137162 235
832 3300025961 Ga0207712_10115514 Ga0207712_101155143 235
833 3300025986 Ga0207658_10014921 Ga0207658_100149216 235
834 3300025986 Ga0207658_10287708 Ga0207658_102877082 235
835 3300025986 Ga0207658_10747588 Ga0207658_107475881 235
836 3300026023 Ga0207677_10061412 Ga0207677_100614122 235
837 3300026023 Ga0207677_10218413 Ga0207677_102184132 235
838 3300026041 Ga0207639_10028028 Ga0207639_100280283 235
839 3300026041 Ga0207639_10140722 Ga0207639_101407222 235
840 3300026067 Ga0207678_10028489 Ga0207678_100284892 235
841 3300026075 Ga0207708_10024439 Ga0207708_100244394 235
842 3300026075 Ga0207708_10415485 Ga0207708_104154852 235
843 3300026088 Ga0207641_10256895 Ga0207641_102568952 235
844 3300026088 Ga0207641_10283722 Ga0207641_102837222 235
845 3300026088 Ga0207641_10420365 Ga0207641_104203651 235
846 3300026089 Ga0207648_10002473 Ga0207648_1000247316 235
847 3300026089 Ga0207648_10003197 Ga0207648_100031979 235
848 3300026089 Ga0207648_10007616 Ga0207648_100076162 235
849 3300026089 Ga0207648_10054782 Ga0207648_100547821 235
850 3300026089 Ga0207648_10086149 Ga0207648_100861493 235
851 3300026089 Ga0207648_10126118 Ga0207648_101261182 235
852 3300026089 Ga0207648_10535812 Ga0207648_105358121 235
853 3300026095 Ga0207676_10099230 Ga0207676_100992302 235
854 3300026095 Ga0207676_10294458 Ga0207676_102944582 235
855 3300026095 Ga0207676_10408837 Ga0207676_104088372 235
856 3300026095 Ga0207676_10469819 Ga0207676_104698192 235
857 3300026116 Ga0207674_10009448 Ga0207674_100094488 235
858 3300026116 Ga0207674_10047506 Ga0207674_100475062 235
859 3300026116 Ga0207674_10051915 Ga0207674_100519152 235
860 3300026116 Ga0207674_10123610 Ga0207674_101236102 235
861 3300026116 Ga0207674_10377589 Ga0207674_103775892 235
862 3300026116 Ga0207674_10461027 Ga0207674_104610272 235
863 3300026116 Ga0207674_10633061 Ga0207674_106330612 235
864 3300026118 Ga0207675_100000654 Ga0207675_10000065418 235
865 3300026118 Ga0207675_100003600 Ga0207675_1000036009 235
866 3300026118 Ga0207675_100067678 Ga0207675_1000676782 235
867 3300026118 Ga0207675_100153648 Ga0207675_1001536482 235
868 3300026121 Ga0207683_10001428 Ga0207683_100014288 235
869 3300026121 Ga0207683_10009987 Ga0207683_100099878 235
870 3300026121 Ga0207683_10159291 Ga0207683_101592913 235
871 3300026142 Ga0207698_10030751 Ga0207698_100307514 235
872 3300026142 Ga0207698_10154573 Ga0207698_101545732 235
873 3300026142 Ga0207698_10701506 Ga0207698_107015061 235
874 3300027907 Ga0207428_10009020 Ga0207428_100090205 235
875 3300028379 Ga0268266_10177309 Ga0268266_101773092 235
876 3300028379 Ga0268266_10230016 Ga0268266_102300162 235
877 3300028379 Ga0268266_10515390 Ga0268266_105153901 235
878 3300028380 Ga0268265_10054849 Ga0268265_100548492 235
879 3300028380 Ga0268265_10756567 Ga0268265_107565672 235
880 3300028381 Ga0268264_10008382 Ga0268264_100083824 235
881 3300028381 Ga0268264_10024643 Ga0268264_100246434 235
882 3300028381 Ga0268264_10119283 Ga0268264_101192832 235
883 3300028381 Ga0268264_10123800 Ga0268264_101238002 235
884 3300028381 Ga0268264_10440654 Ga0268264_104406542 235
885 3300028381 Ga0268264_10478570 Ga0268264_104785702 235
886 3300030731 Ga0316177_1143555 Ga0316177_11435552 235
887 3300031251 Ga0265327_10000006 Ga0265327_10000006566 235
888 3300031251 Ga0265327_10015178 Ga0265327_100151782 235
889 3300031456 Ga0307513_10168021 Ga0307513_101680212 235
890 3300031731 Ga0307405_10448635 Ga0307405_104486352 235
891 3300031824 Ga0307413_10014902 Ga0307413_100149022 235
892 3300031852 Ga0307410_10036382 Ga0307410_100363822 235
893 3300031903 Ga0307407_10275716 Ga0307407_102757162 235
894 3300031911 Ga0307412_10367335 Ga0307412_103673352 235
895 3300032002 Ga0307416_100703478 Ga0307416_1007034782 235
896 3300032004 Ga0307414_10223667 Ga0307414_102236672 235
897 3300032005 Ga0307411_10372226 Ga0307411_103722261 235
898 3300035086 Ga0373934_0054546 Ga0373934_0054546_253_960 235
899 3300035724 Ga0373933_0040109 Ga0373933_0040109_445_1152 235
900 3300036401 Ga0373937_0041388 Ga0373937_0041388_541_1248 235
901 3300036401 Ga0373937_0116024 Ga0373937_0116024_1734_2441 235
902 3300037312 Ga0395899_0066712 Ga0395899_0066712_1776_2543 235
903 3300037466 Ga0395898_0022627 Ga0395898_0022627_1710_2477 235
904 3300037471 Ga0395905_0060068 Ga0395905_0060068_1131_1838 235
905 3300041406 Ga0439439_0011631 Ga0439439_0011631_1060_1767 235
906 3300041486 Ga0451807_0395518 Ga0451807_0395518_307_1014 235
907 3300041997 Ga0439431_0013852 Ga0439431_0013852_1076_1783 235
908 3300042156 Ga0439446_0082229 Ga0439446_0082229_188_895 235
909 3300042435 Ga0439434_0001630 Ga0439434_0001630_5505_6212 235
910 3300042876 Ga0451577_0281363 Ga0451577_0281363_103_822 235
911 3300044658 Ga0466972_0000021 Ga0466972_0000021_138758_139465 235
912 3300044765 Ga0466970_0001020 Ga0466970_0001020_2200_2907 235
913 3300046459 Ga0495629_0223363 Ga0495629_0223363_408_1115 235
914 3300046460 Ga0495638_0241846 Ga0495638_0241846_156_863 235
915 3300046471 Ga0495650_0016596 Ga0495650_0016596_1545_2261 235
916 3300046472 Ga0495580_0046645 Ga0495580_0046645_2056_2763 235
917 3300046511 Ga0495608_0027308 Ga0495608_0027308_3135_3842 235
918 3300046516 Ga0495628_0164769 Ga0495628_0164769_378_1085 235
919 3300046529 Ga0495652_0292846 Ga0495652_0292846_409_1116 235
920 3300046533 Ga0495640_0148898 Ga0495640_0148898_630_1337 235
921 3300046536 Ga0495587_0106078 Ga0495587_0106078_347_1054 235
922 3300046648 Ga0495611_0030385 Ga0495611_0030385_723_1433 235
923 3300046663 Ga0495635_0225787 Ga0495635_0225787_206_913 235
924 3300046678 Ga0495599_0185059 Ga0495599_0185059_449_1156 235
925 3300046679 Ga0495623_0156881 Ga0495623_0156881_160_867 235
926 3300046680 Ga0495646_0232112 Ga0495646_0232112_178_885 235
927 3300046691 Ga0495670_0033326 Ga0495670_0033326_482_1189 235
928 3300046809 Ga0495600_0221809 Ga0495600_0221809_353_1060 235
929 3300047322 Ga0495680_0159270 Ga0495680_0159270_522_1229 235
930 3300047471 Ga0495684_0222379 Ga0495684_0222379_426_1133 235
931 3300047472 Ga0495686_0001217 Ga0495686_0001217_20973_21689 235
932 3300048912 Ga0496109_0481980 Ga0496109_0481980_422_1129 235
933 3300048913 Ga0496110_0009618 Ga0496110_0009618_886_1662 235
934 3300048914 Ga0496111_0513055 Ga0496111_0513055_73_780 235
935 3300049568 Ga0501031_0013457 Ga0501031_0013457_1827_2537 235
936 3300049571 Ga0501034_0712444 Ga0501034_0712444_65_772 235
937 3300049572 Ga0501036_0055566 Ga0501036_0055566_1045_1755 235
938 3300049573 Ga0501037_0005433 Ga0501037_0005433_5342_6052 235
939 3300049574 Ga0501038_0032811 Ga0501038_0032811_2062_2772 235
940 3300049575 Ga0501039_0078832 Ga0501039_0078832_356_1066 235
941 3300049579 Ga0501043_0007747 Ga0501043_0007747_4635_5345 235
942 3300049580 Ga0501046_0237520 Ga0501046_0237520_308_1018 235
943 3300049581 Ga0501047_0149418 Ga0501047_0149418_220_930 235
944 3300049581 Ga0501047_0575056 Ga0501047_0575056_55_762 235
945 3300049582 Ga0501048_0436981 Ga0501048_0436981_52_759 235
946 3300049583 Ga0501067_0031005 Ga0501067_0031005_1983_2690 235
947 3300049586 Ga0501070_0088403 Ga0501070_0088403_1530_2237 235
948 3300049588 Ga0501072_0384824 Ga0501072_0384824_316_1026 235
949 3300049661 Ga0501217_082276 Ga0501217_082276_34_774 235
950 3300049741 Ga0501079_0659548 Ga0501079_0659548_36_743 235
951 3300049744 Ga0501083_0022214 Ga0501083_0022214_2639_3346 235
952 3300049822 Ga0501035_0114753 Ga0501035_0114753_1606_2316 235
953 3300049823 Ga0501044_0070719 Ga0501044_0070719_824_1531 235
954 3300049823 Ga0501044_0123794 Ga0501044_0123794_289_999 235
955 3300050493 nmdc:mga0k408_214014_c1 nmdc:mga0k408_214014_c1_394_1101 235
956 3300050493 nmdc:mga0k408_2243_c2 nmdc:mga0k408_2243_c2_152_859 235
957 3300053088 Ga0500644_0014085 Ga0500644_0014085_120_827 235
958 3300053096 Ga0500641_0022545 Ga0500641_0022545_1171_1881 235
959 3300053108 Ga0500562_000038 Ga0500562_000038_40544_41251 235
960 3300053139 Ga0500568_0001023 Ga0500568_0001023_6569_7279 235
961 3300053156 Ga0500622_0000340 Ga0500622_0000340_847_1554 235
962 3300053727 Ga0500611_000101 Ga0500611_000101_12104_12811 235
963 3300053730 Ga0500645_049652 Ga0500645_049652_110_817 235
964 3300054114 Ga0501084_0276631 Ga0501084_0276631_491_1198 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

41

151

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

189

265

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9729 7 126
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9701 8 124
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.97 8 124
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9676 6 122
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9669 7 123
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9945 8 89 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9943 7 85 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.984 5 85 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9825 8 85 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9792 8 85 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A350Y6D3-F1-model_v4 Histidine kinase 0.9701 7 108 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0016301
GO:0032993
AF-A0A6P0PEW0-F1-model_v4 Adenylate/guanylate cyclase domain-containing response regulator 0.97 5 129 GO:0000160
GO:0003677
GO:0004016
GO:0006171
AF-A0A3M1M3I0-F1-model_v4 Adenylate/guanylate cyclase domain-containing response regulator 0.9699 4 129 GO:0000156
GO:0000976
GO:0004016
GO:0005829
GO:0006355
GO:0009190
GO:0032993
AF-A0A2N2TQE8-F1-model_v4 Adenylate/guanylate cyclase domain-containing response regulator 0.9694 7 129 GO:0000156
GO:0000976
GO:0004016
GO:0005829
GO:0006355
GO:0009190
GO:0032993
AF-A0A1G8SP82-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9677 1 122 GO:0000155
GO:0006935

Feature Viewer

pLDDT pTM Quality
89.51 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map