F486902

General Info

Members Datasets Scaffolds Average Seq Length
962 320 1924 306

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_26346_c1|nmdc:mga09592_26346_c1_2432_3499
Length 355
Sequence MPLRRRSSRLFDARGRARLYSGTPAGGGDHHLAAVDGYWPILMPRRGHAMKRFVLRRLGYALVSLALLSITIFVFVRLTGDPALLLVEPGASKADVDAVRERFGLDQPLVVQYAKFMNGLLRGDFGQSFYYRTPVLELYLSRLPNSLMLAAVAMSFSLLIGIPTGILAAVRVNSWLDRAGRIFALLGLSLPSFWIGLVLILFFSVYLGWLPSSGSGTVLHVLMPAFALGWYFAASHMRLTRSSMLDVLGAEYVKLARLKGLPEQRVIAKHALKNALIPVLTLAGINLVIMINVAVVVETVFAWPGIGRLLYEGIAFRDFPIVQATVLLGGSMIVFVNLIVDVLYGLIDPRIRYER

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
319 2643221629 Devosia sp. Root105 Isolate Unclassified
320 2643221662 Devosia sp. Root413D1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.31
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 2.18
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_26346_c1 3300050508 Bacteria 4816
2 rootH1_10139936 3300003323 Bacteria 3467
3 JGI26141J51220_1001007 3300003503 Bacteria 1658
4 Ga0065707_10045053 3300005295 Bacteria 1124
5 Ga0065707_10127165 3300005295 Bacteria 1989
6 Ga0065707_10234948 3300005295 Bacteria 1175
7 Ga0070676_10000234 3300005328 Bacteria 23763
8 Ga0070683_100060225 3300005329 Bacteria 3528
9 Ga0070683_100137909 3300005329 Bacteria 2311
10 Ga0070690_100047268 3300005330 Bacteria 2738
11 Ga0070690_100096277 3300005330 Bacteria 1956
12 Ga0070670_100021391 3300005331 Bacteria 5565
13 Ga0068869_100001526 3300005334 Bacteria 13742
14 Ga0068869_100010180 3300005334 Bacteria 6123
15 Ga0068869_100105147 3300005334 Bacteria 2141
16 Ga0068869_100120080 3300005334 Bacteria 2009
17 Ga0070680_100025333 3300005336 Bacteria 4741
18 Ga0070680_100289703 3300005336 Bacteria 1388
19 Ga0070682_100001738 3300005337 Bacteria 12114
20 Ga0068868_100079609 3300005338 Bacteria 2625
21 Ga0070660_100000338 3300005339 Bacteria 31123
22 Ga0070689_100089539 3300005340 Bacteria 2424
23 Ga0070689_100093751 3300005340 Bacteria 2370
24 Ga0070691_10001306 3300005341 Bacteria 10581
25 Ga0070691_10008381 3300005341 Bacteria 4733
26 Ga0070687_100192916 3300005343 Bacteria 1229
27 Ga0070661_100012583 3300005344 Bacteria 5921
28 Ga0070661_100036789 3300005344 Bacteria 3558
29 Ga0070692_10007725 3300005345 Bacteria 4759
30 Ga0070692_10155690 3300005345 Bacteria 1305
31 Ga0070669_100066673 3300005353 Bacteria 2654
32 Ga0070669_100074873 3300005353 Bacteria 2510
33 Ga0070669_100085084 3300005353 Bacteria 2361
34 Ga0070669_100242069 3300005353 Bacteria 1434
35 Ga0070675_100105948 3300005354 Bacteria 2373
36 Ga0070675_100221578 3300005354 Bacteria 1647
37 Ga0070671_100072513 3300005355 Bacteria 2876
38 Ga0070673_100082142 3300005364 Bacteria 2615
39 Ga0070688_100144086 3300005365 Bacteria 1622
40 Ga0070659_100000431 3300005366 Bacteria 31617
41 Ga0070703_10014197 3300005406 Bacteria 2267
42 Ga0070709_10000308 3300005434 Bacteria 30984
43 Ga0070709_10196925 3300005434 Bacteria 1425
44 Ga0070714_100094967 3300005435 Bacteria 2618
45 Ga0070714_100179248 3300005435 Bacteria 1927
46 Ga0070714_100409318 3300005435 Bacteria 1283
47 Ga0070713_100006903 3300005436 Bacteria 7923
48 Ga0070713_100075205 3300005436 Bacteria 2864
49 Ga0070713_100082842 3300005436 Bacteria 2741
50 Ga0070713_100197779 3300005436 Bacteria 1814
51 Ga0070710_10000782 3300005437 Bacteria 15226
52 Ga0070710_10063440 3300005437 Bacteria 2111
53 Ga0070710_10166432 3300005437 Bacteria 1371
54 Ga0070710_10168136 3300005437 Bacteria 1364
55 Ga0070701_10004446 3300005438 Bacteria 5681
56 Ga0070701_10080838 3300005438 Bacteria 1759
57 Ga0070711_100011646 3300005439 Bacteria 5466
58 Ga0070711_100065993 3300005439 Bacteria 2534
59 Ga0070711_100096722 3300005439 Bacteria 2140
60 Ga0070711_100120970 3300005439 Bacteria 1936
61 Ga0070711_100150038 3300005439 Bacteria 1757
62 Ga0070705_100084588 3300005440 Bacteria 1958
63 Ga0070705_100133580 3300005440 Bacteria 1622
64 Ga0070705_100281026 3300005440 Bacteria 1183
65 Ga0070705_100313332 3300005440 Bacteria 1130
66 Ga0070700_100114486 3300005441 Bacteria 1798
67 Ga0070694_100004737 3300005444 Bacteria 8194
68 Ga0070694_100047963 3300005444 Bacteria 2872
69 Ga0070694_100159375 3300005444 Bacteria 1654
70 Ga0070694_100160744 3300005444 Bacteria 1648
71 Ga0070694_100236810 3300005444 Bacteria 1375
72 Ga0070708_100050048 3300005445 Bacteria 3698
73 Ga0070708_100076185 3300005445 Bacteria 3029
74 Ga0070708_100109509 3300005445 Bacteria 2537
75 Ga0070708_100132185 3300005445 Bacteria 2310
76 Ga0070708_100219565 3300005445 Bacteria 1782
77 Ga0070708_100260106 3300005445 Bacteria 1631
78 Ga0070662_100068033 3300005457 Bacteria 2617
79 Ga0070662_100092983 3300005457 Bacteria 2268
80 Ga0070681_10274366 3300005458 Bacteria 1597
81 Ga0068867_100049511 3300005459 Bacteria 3094
82 Ga0068867_100084782 3300005459 Bacteria 2394
83 Ga0070706_100001917 3300005467 Bacteria 21451
84 Ga0070706_100005212 3300005467 Bacteria 12400
85 Ga0070706_100017099 3300005467 Bacteria 6701
86 Ga0070706_100040406 3300005467 Bacteria 4305
87 Ga0070706_100041777 3300005467 Bacteria 4234
88 Ga0070706_100073920 3300005467 Bacteria 3156
89 Ga0070706_100075255 3300005467 Bacteria 3124
90 Ga0070706_100157921 3300005467 Bacteria 2117
91 Ga0070706_100190177 3300005467 Bacteria 1918
92 Ga0070706_100208255 3300005467 Bacteria 1826
93 Ga0070706_100305737 3300005467 Bacteria 1483
94 Ga0070707_100000746 3300005468 Bacteria 32258
95 Ga0070707_100001477 3300005468 Bacteria 22964
96 Ga0070707_100004668 3300005468 Bacteria 12831
97 Ga0070707_100007658 3300005468 Bacteria 10028
98 Ga0070707_100008810 3300005468 Bacteria 9360
99 Ga0070707_100032862 3300005468 Bacteria 4944
100 Ga0070707_100038153 3300005468 Bacteria 4587
101 Ga0070707_100079921 3300005468 Bacteria 3156
102 Ga0070707_100117242 3300005468 Bacteria 2584
103 Ga0070707_100302818 3300005468 Bacteria 1553
104 Ga0070707_100332124 3300005468 Bacteria 1477
105 Ga0070698_100000483 3300005471 Bacteria 42307
106 Ga0070698_100002750 3300005471 Bacteria 19341
107 Ga0070698_100025708 3300005471 Bacteria 6133
108 Ga0070698_100036014 3300005471 Bacteria 5115
109 Ga0070698_100049702 3300005471 Bacteria 4279
110 Ga0070698_100073429 3300005471 Bacteria 3427
111 Ga0070698_100084496 3300005471 Bacteria 3162
112 Ga0070698_100334138 3300005471 Bacteria 1446
113 Ga0070699_100001653 3300005518 Bacteria 20338
114 Ga0070699_100077248 3300005518 Bacteria 2898
115 Ga0070699_100104175 3300005518 Bacteria 2488
116 Ga0070699_100112380 3300005518 Bacteria 2393
117 Ga0070699_100175087 3300005518 Bacteria 1902
118 Ga0070679_100000975 3300005530 Bacteria 24930
119 Ga0070679_100081658 3300005530 Bacteria 3222
120 Ga0070684_100003405 3300005535 Bacteria 11934
121 Ga0070697_100001149 3300005536 Bacteria 20060
122 Ga0070697_100003003 3300005536 Bacteria 12950
123 Ga0070697_100010998 3300005536 Bacteria 7071
124 Ga0070697_100030018 3300005536 Bacteria 4364
125 Ga0070697_100035644 3300005536 Bacteria 4015
126 Ga0070697_100089493 3300005536 Bacteria 2543
127 Ga0070697_100171275 3300005536 Bacteria 1838
128 Ga0070697_100293633 3300005536 Bacteria 1396
129 Ga0068853_100003158 3300005539 Bacteria 12598
130 Ga0068853_100484489 3300005539 Bacteria 1166
131 Ga0070686_100302968 3300005544 Bacteria 1186
132 Ga0070695_100005906 3300005545 Bacteria 7223
133 Ga0070695_100006683 3300005545 Bacteria 6819
134 Ga0070695_100030571 3300005545 Bacteria 3354
135 Ga0070695_100046667 3300005545 Bacteria 2764
136 Ga0070695_100162287 3300005545 Bacteria 1570
137 Ga0070695_100213622 3300005545 Bacteria 1386
138 Ga0070696_100040153 3300005546 Bacteria 3231
139 Ga0070696_100081774 3300005546 Bacteria 2289
140 Ga0070696_100138555 3300005546 Bacteria 1776
141 Ga0070693_100001205 3300005547 Bacteria 11647
142 Ga0070693_100235756 3300005547 Bacteria 1206
143 Ga0070704_100023823 3300005549 Bacteria 4006
144 Ga0070704_100037034 3300005549 Bacteria 3329
145 Ga0070704_100039292 3300005549 Bacteria 3248
146 Ga0070704_100058708 3300005549 Bacteria 2741
147 Ga0068855_100000993 3300005563 Bacteria 35303
148 Ga0068855_100047139 3300005563 Bacteria 5092
149 Ga0070664_100053373 3300005564 Bacteria 3426
150 Ga0070664_100116699 3300005564 Bacteria 2334
151 Ga0068857_100004916 3300005577 Bacteria 11340
152 Ga0068857_100262695 3300005577 Bacteria 1585
153 Ga0068856_100029378 3300005614 Bacteria 5370
154 Ga0070702_100074068 3300005615 Bacteria 2019
155 Ga0068852_100019640 3300005616 Bacteria 5354
156 Ga0068859_100011951 3300005617 Bacteria 8720
157 Ga0068859_100059656 3300005617 Bacteria 3844
158 Ga0068864_100014540 3300005618 Bacteria 6540
159 Ga0068864_100091520 3300005618 Bacteria 2683
160 Ga0068864_100287871 3300005618 Bacteria 1535
161 Ga0068866_10073234 3300005718 Bacteria 1817
162 Ga0068861_100014859 3300005719 Bacteria 5471
163 Ga0068861_100128073 3300005719 Bacteria 2057
164 Ga0068861_100196329 3300005719 Bacteria 1691
165 Ga0068861_100220769 3300005719 Bacteria 1602
166 Ga0068870_10003942 3300005840 Bacteria 6335
167 Ga0068863_100167521 3300005841 Bacteria 2107
168 Ga0068863_100680706 3300005841 Bacteria 1021
169 Ga0068858_100259485 3300005842 Bacteria 1652
170 Ga0068858_100313512 3300005842 Bacteria 1498
171 Ga0068858_100383544 3300005842 Bacteria 1349
172 Ga0068860_100021130 3300005843 Bacteria 6304
173 Ga0068860_100116823 3300005843 Bacteria 2552
174 Ga0068860_100141784 3300005843 Bacteria 2310
175 Ga0068860_100213651 3300005843 Bacteria 1871
176 Ga0068860_100343821 3300005843 Unclassified 1467
177 Ga0068860_100380322 3300005843 Bacteria 1394
178 Ga0068862_100011813 3300005844 Bacteria 7212
179 Ga0068862_100054736 3300005844 Bacteria 3416
180 Ga0068862_100101330 3300005844 Bacteria 2519
181 Ga0068862_100308665 3300005844 Bacteria 1457
182 Ga0068862_100347608 3300005844 Bacteria 1375
183 Ga0081455_10000302 3300005937 Bacteria 65101
184 Ga0081455_10001686 3300005937 Bacteria 26786
185 Ga0081455_10011423 3300005937 Bacteria 8926
186 Ga0081455_10048085 3300005937 Bacteria 3688
187 Ga0081455_10048636 3300005937 Bacteria 3662
188 Ga0081538_10038073 3300005981 Bacteria 3109
189 Ga0081538_10072760 3300005981 Bacteria 1882
190 Ga0081540_1001904 3300005983 Bacteria 17469
191 Ga0081539_10000020 3300005985 Bacteria 366549
192 Ga0081539_10024038 3300005985 Bacteria 3967
193 Ga0070717_10031915 3300006028 Bacteria 4240
194 Ga0070717_10067249 3300006028 Bacteria 2981
195 Ga0070717_10144302 3300006028 Bacteria 2055
196 Ga0070717_10159538 3300006028 Bacteria 1956
197 Ga0070717_10210075 3300006028 Bacteria 1708
198 Ga0070717_10263402 3300006028 Bacteria 1525
199 Ga0070717_10563748 3300006028 Bacteria 1032
200 Ga0070715_10086340 3300006163 Bacteria 1434
201 Ga0070715_10091509 3300006163 Bacteria 1401
202 Ga0070716_100038293 3300006173 Bacteria 2655
203 Ga0070716_100067848 3300006173 Bacteria 2084
204 Ga0070716_100155188 3300006173 Bacteria 1477
205 Ga0070716_100239853 3300006173 Bacteria 1229
206 Ga0070712_100004566 3300006175 Bacteria 8549
207 Ga0070712_100295233 3300006175 Bacteria 1310
208 Ga0075362_10060169 3300006177 Bacteria 1716
209 Ga0075367_10103033 3300006178 Bacteria 1746
210 Ga0075428_100001365 3300006844 Bacteria 25940
211 Ga0075428_100002513 3300006844 Bacteria 19932
212 Ga0075428_100002795 3300006844 Bacteria 18990
213 Ga0075428_100004121 3300006844 Bacteria 16002
214 Ga0075428_100026566 3300006844 Bacteria 6409
215 Ga0075428_100039429 3300006844 Bacteria 5199
216 Ga0075428_100058315 3300006844 Bacteria 4226
217 Ga0075428_100065269 3300006844 Bacteria 3986
218 Ga0075428_100217374 3300006844 Bacteria 2064
219 Ga0075430_100000052 3300006846 Bacteria 60703
220 Ga0075430_100003800 3300006846 Bacteria 12709
221 Ga0075430_100008106 3300006846 Bacteria 8881
222 Ga0075430_100097897 3300006846 Bacteria 2451
223 Ga0075430_100205664 3300006846 Bacteria 1634
224 Ga0075430_100469256 3300006846 Bacteria 1039
225 Ga0075431_100000038 3300006847 Bacteria 68191
226 Ga0075431_100000309 3300006847 Bacteria 38472
227 Ga0075431_100003560 3300006847 Bacteria 15083
228 Ga0075431_100007008 3300006847 Bacteria 11202
229 Ga0075431_100024096 3300006847 Bacteria 6232
230 Ga0075431_100028574 3300006847 Bacteria 5733
231 Ga0075431_100035130 3300006847 Bacteria 5162
232 Ga0075431_100037217 3300006847 Bacteria 5015
233 Ga0075431_100050327 3300006847 Bacteria 4296
234 Ga0075431_100132756 3300006847 Bacteria 2568
235 Ga0075431_100267638 3300006847 Bacteria 1733
236 Ga0075433_10003962 3300006852 Bacteria 11467
237 Ga0075433_10021259 3300006852 Bacteria 5441
238 Ga0075433_10021776 3300006852 Bacteria 5377
239 Ga0075433_10036035 3300006852 Bacteria 4259
240 Ga0075433_10077383 3300006852 Bacteria 2930
241 Ga0075433_10077845 3300006852 Bacteria 2921
242 Ga0075433_10080727 3300006852 Bacteria 2867
243 Ga0075433_10080881 3300006852 Bacteria 2864
244 Ga0075433_10104636 3300006852 Bacteria 2507
245 Ga0075433_10105431 3300006852 Bacteria 2498
246 Ga0075433_10123934 3300006852 Bacteria 2296
247 Ga0075433_10197245 3300006852 Bacteria 1790
248 Ga0075433_10242629 3300006852 Bacteria 1599
249 Ga0075434_100002184 3300006871 Bacteria 17055
250 Ga0075434_100005484 3300006871 Bacteria 11555
251 Ga0075434_100015821 3300006871 Bacteria 7243
252 Ga0075434_100019916 3300006871 Bacteria 6498
253 Ga0075434_100030497 3300006871 Bacteria 5310
254 Ga0075434_100066176 3300006871 Bacteria 3599
255 Ga0075434_100069045 3300006871 Bacteria 3522
256 Ga0075434_100069318 3300006871 Bacteria 3516
257 Ga0075434_100096127 3300006871 Bacteria 2968
258 Ga0075434_100103906 3300006871 Bacteria 2850
259 Ga0075434_100104150 3300006871 Bacteria 2847
260 Ga0075434_100119635 3300006871 Bacteria 2648
261 Ga0075434_100123969 3300006871 Bacteria 2600
262 Ga0075434_100142639 3300006871 Bacteria 2416
263 Ga0075434_100163274 3300006871 Bacteria 2247
264 Ga0075434_100193815 3300006871 Bacteria 2052
265 Ga0075434_100267158 3300006871 Bacteria 1730
266 Ga0075434_100341900 3300006871 Bacteria 1517
267 Ga0075434_100408491 3300006871 Bacteria 1379
268 Ga0075429_100000898 3300006880 Bacteria 23530
269 Ga0075429_100003643 3300006880 Bacteria 13121
270 Ga0075429_100004919 3300006880 Bacteria 11517
271 Ga0075429_100004927 3300006880 Bacteria 11504
272 Ga0075429_100008268 3300006880 Bacteria 9045
273 Ga0075429_100025005 3300006880 Bacteria 5184
274 Ga0075429_100044487 3300006880 Bacteria 3862
275 Ga0075429_100091607 3300006880 Bacteria 2652
276 Ga0075429_100167590 3300006880 Bacteria 1924
277 Ga0075436_100001335 3300006914 Bacteria 16778
278 Ga0075436_100045807 3300006914 Bacteria 3016
279 Ga0075436_100117144 3300006914 Bacteria 1862
280 Ga0075436_100126837 3300006914 Bacteria 1788
281 Ga0075436_100162162 3300006914 Bacteria 1576
282 Ga0097620_100011951 3300006931 Bacteria 8720
283 Ga0097620_100059656 3300006931 Bacteria 3844
284 Ga0075435_100007945 3300007076 Bacteria 7591
285 Ga0075435_100014830 3300007076 Bacteria 5842
286 Ga0075435_100043402 3300007076 Bacteria 3599
287 Ga0075435_100060165 3300007076 Bacteria 3079
288 Ga0075435_100067863 3300007076 Bacteria 2904
289 Ga0075435_100098773 3300007076 Bacteria 2417
290 Ga0075435_100186675 3300007076 Bacteria 1753
291 Ga0075435_100222332 3300007076 Bacteria 1603
292 Ga0099794_10040928 3300007265 Bacteria 2205
293 Ga0099794_10121985 3300007265 Bacteria 1312
294 Ga0099795_10029218 3300007788 Bacteria 1882
295 Ga0111539_10000552 3300009094 Bacteria 47861
296 Ga0111539_10001850 3300009094 Bacteria 28137
297 Ga0111539_10004281 3300009094 Bacteria 18675
298 Ga0111539_10005162 3300009094 Bacteria 16926
299 Ga0111539_10007358 3300009094 Bacteria 14102
300 Ga0111539_10013327 3300009094 Bacteria 10273
301 Ga0111539_10113883 3300009094 Bacteria 3172
302 Ga0111539_10118504 3300009094 Bacteria 3103
303 Ga0111539_10125815 3300009094 Bacteria 3003
304 Ga0111539_10131021 3300009094 Bacteria 2936
305 Ga0105245_10105506 3300009098 Bacteria 2614
306 Ga0105245_10110885 3300009098 Bacteria 2551
307 Ga0105245_10203828 3300009098 Bacteria 1901
308 Ga0105247_10048184 3300009101 Bacteria 2617
309 Ga0105247_10156988 3300009101 Bacteria 1503
310 Ga0114129_10000919 3300009147 Bacteria 38401
311 Ga0114129_10002160 3300009147 Bacteria 27095
312 Ga0114129_10002604 3300009147 Bacteria 25084
313 Ga0114129_10009756 3300009147 Bacteria 13694
314 Ga0114129_10016331 3300009147 Bacteria 10568
315 Ga0114129_10016728 3300009147 Bacteria 10446
316 Ga0114129_10016827 3300009147 Bacteria 10410
317 Ga0114129_10020955 3300009147 Bacteria 9285
318 Ga0114129_10025104 3300009147 Bacteria 8446
319 Ga0114129_10032397 3300009147 Bacteria 7386
320 Ga0114129_10037962 3300009147 Bacteria 6795
321 Ga0114129_10044316 3300009147 Bacteria 6258
322 Ga0114129_10056789 3300009147 Bacteria 5481
323 Ga0114129_10099934 3300009147 Bacteria 4014
324 Ga0114129_10113634 3300009147 Bacteria 3734
325 Ga0114129_10116037 3300009147 Bacteria 3689
326 Ga0114129_10165830 3300009147 Bacteria 3015
327 Ga0114129_10242005 3300009147 Bacteria 2425
328 Ga0114129_10283263 3300009147 Bacteria 2214
329 Ga0114129_10305772 3300009147 Bacteria 2118
330 Ga0114129_10320764 3300009147 Bacteria 2060
331 Ga0114129_10414753 3300009147 Bacteria 1772
332 Ga0114129_10675294 3300009147 Bacteria 1331
333 Ga0114129_10982280 3300009147 Bacteria 1064
334 Ga0105243_10031204 3300009148 Bacteria 4107
335 Ga0105243_10034011 3300009148 Bacteria 3944
336 Ga0105243_10385599 3300009148 Bacteria 1297
337 Ga0105243_10601477 3300009148 Bacteria 1059
338 Ga0105241_10002786 3300009174 Bacteria 13092
339 Ga0105241_10020521 3300009174 Bacteria 4882
340 Ga0105241_10334171 3300009174 Bacteria 1311
341 Ga0105242_10345935 3300009176 Bacteria 1372
342 Ga0105248_10052063 3300009177 Bacteria 4594
343 Ga0105248_10125244 3300009177 Bacteria 2899
344 Ga0105248_10167472 3300009177 Bacteria 2477
345 Ga0105248_10607894 3300009177 Bacteria 1233
346 Ga0105237_10243589 3300009545 Bacteria 1799
347 Ga0105238_10013568 3300009551 Bacteria 8226
348 Ga0105249_10252240 3300009553 Bacteria 1750
349 Ga0105249_10823279 3300009553 Bacteria 993
350 Ga0099796_10023570 3300010159 Bacteria 1923
351 Ga0099796_10040026 3300010159 Bacteria 1580
352 Ga0105239_10137704 3300010375 Bacteria 2718
353 Ga0105246_10050764 3300011119 Bacteria 2846
354 Ga0157373_10272568 3300013100 Bacteria 1198
355 Ga0157371_10023126 3300013102 Bacteria 4546
356 Ga0157370_10080096 3300013104 Bacteria 3075
357 Ga0157369_10037565 3300013105 Bacteria 5302
358 Ga0157369_10038752 3300013105 Bacteria 5210
359 Ga0157369_10190134 3300013105 Bacteria 2157
360 Ga0157369_10625036 3300013105 Bacteria 1111
361 Ga0157374_10324831 3300013296 Bacteria 1525
362 Ga0157378_10085835 3300013297 Bacteria 2852
363 Ga0157378_10096016 3300013297 Bacteria 2701
364 Ga0163162_10149302 3300013306 Bacteria 2454
365 Ga0163162_10215229 3300013306 Bacteria 2051
366 Ga0163162_10266715 3300013306 Bacteria 1844
367 Ga0163162_10594105 3300013306 Bacteria 1233
368 Ga0157372_10053246 3300013307 Bacteria 4509
369 Ga0157372_10114313 3300013307 Bacteria 3094
370 Ga0157372_10561219 3300013307 Bacteria 1331
371 Ga0157375_10020032 3300013308 Bacteria 6102
372 Ga0157375_10031764 3300013308 Bacteria 4998
373 Ga0157375_10085761 3300013308 Bacteria 3199
374 Ga0163163_10062659 3300014325 Bacteria 3686
375 Ga0163163_10365404 3300014325 Bacteria 1500
376 Ga0157380_10042364 3300014326 Bacteria 3559
377 Ga0182008_10015169 3300014497 Bacteria 4025
378 Ga0182008_10026473 3300014497 Bacteria 2941
379 Ga0182008_10095858 3300014497 Bacteria 1464
380 Ga0157379_10073273 3300014968 Bacteria 3065
381 Ga0157379_10164511 3300014968 Bacteria 2002
382 Ga0157376_10064328 3300014969 Bacteria 3093
383 Ga0213876_10098264 3300021384 Bacteria 1551
384 Ga0207653_10014150 3300025885 Bacteria 2502
385 Ga0207653_10033038 3300025885 Bacteria 1676
386 Ga0207653_10063573 3300025885 Bacteria 1249
387 Ga0207692_10023418 3300025898 Bacteria 2855
388 Ga0207688_10019475 3300025901 Bacteria 3699
389 Ga0207647_10064617 3300025904 Bacteria 2223
390 Ga0207685_10067429 3300025905 Bacteria 1439
391 Ga0207699_10021021 3300025906 Bacteria 3509
392 Ga0207699_10045424 3300025906 Bacteria 2564
393 Ga0207699_10062240 3300025906 Bacteria 2249
394 Ga0207699_10207726 3300025906 Bacteria 1330
395 Ga0207645_10000033 3300025907 Bacteria 91108
396 Ga0207643_10001741 3300025908 Bacteria 12201
397 Ga0207705_10357583 3300025909 Bacteria 1126
398 Ga0207684_10000290 3300025910 Bacteria 72057
399 Ga0207684_10001142 3300025910 Bacteria 29651
400 Ga0207684_10002251 3300025910 Bacteria 19668
401 Ga0207684_10014240 3300025910 Bacteria 6862
402 Ga0207684_10014347 3300025910 Bacteria 6834
403 Ga0207684_10017676 3300025910 Bacteria 6118
404 Ga0207684_10032919 3300025910 Bacteria 4409
405 Ga0207684_10040928 3300025910 Bacteria 3929
406 Ga0207684_10070167 3300025910 Bacteria 2978
407 Ga0207684_10134046 3300025910 Bacteria 2126
408 Ga0207684_10173724 3300025910 Bacteria 1857
409 Ga0207684_10188999 3300025910 Bacteria 1776
410 Ga0207684_10304272 3300025910 Bacteria 1374
411 Ga0207654_10011720 3300025911 Bacteria 4476
412 Ga0207654_10087075 3300025911 Bacteria 1895
413 Ga0207654_10110861 3300025911 Bacteria 1707
414 Ga0207707_10001156 3300025912 Bacteria 25046
415 Ga0207707_10175316 3300025912 Bacteria 1873
416 Ga0207671_10132772 3300025914 Bacteria 1912
417 Ga0207693_10002165 3300025915 Bacteria 17116
418 Ga0207693_10002395 3300025915 Bacteria 16271
419 Ga0207693_10018827 3300025915 Bacteria 5495
420 Ga0207693_10052009 3300025915 Bacteria 3213
421 Ga0207693_10245222 3300025915 Bacteria 1406
422 Ga0207693_10294985 3300025915 Bacteria 1270
423 Ga0207660_10013811 3300025917 Bacteria 5300
424 Ga0207660_10020315 3300025917 Bacteria 4454
425 Ga0207660_10039356 3300025917 Bacteria 3304
426 Ga0207660_10109684 3300025917 Bacteria 2075
427 Ga0207660_10220683 3300025917 Bacteria 1488
428 Ga0207660_10303584 3300025917 Bacteria 1271
429 Ga0207662_10258851 3300025918 Bacteria 1145
430 Ga0207649_10007990 3300025920 Bacteria 5755
431 Ga0207649_10022741 3300025920 Bacteria 3622
432 Ga0207652_10001565 3300025921 Bacteria 20129
433 Ga0207652_10050772 3300025921 Bacteria 3554
434 Ga0207646_10000203 3300025922 Bacteria 80626
435 Ga0207646_10000259 3300025922 Bacteria 72047
436 Ga0207646_10000361 3300025922 Bacteria 61092
437 Ga0207646_10000561 3300025922 Bacteria 48912
438 Ga0207646_10000960 3300025922 Bacteria 37149
439 Ga0207646_10008416 3300025922 Bacteria 10344
440 Ga0207646_10016073 3300025922 Bacteria 7032
441 Ga0207646_10033880 3300025922 Bacteria 4616
442 Ga0207646_10050043 3300025922 Bacteria 3741
443 Ga0207646_10058200 3300025922 Bacteria 3452
444 Ga0207646_10165454 3300025922 Bacteria 1996
445 Ga0207681_10056356 3300025923 Bacteria 2680
446 Ga0207681_10057574 3300025923 Bacteria 2657
447 Ga0207681_10083829 3300025923 Bacteria 2257
448 Ga0207694_10032416 3300025924 Bacteria 4000
449 Ga0207659_10356690 3300025926 Bacteria 1214
450 Ga0207687_10141378 3300025927 Bacteria 1826
451 Ga0207700_10007878 3300025928 Bacteria 6553
452 Ga0207700_10012847 3300025928 Bacteria 5418
453 Ga0207700_10059835 3300025928 Bacteria 2882
454 Ga0207700_10095531 3300025928 Bacteria 2358
455 Ga0207700_10116229 3300025928 Bacteria 2161
456 Ga0207700_10118479 3300025928 Bacteria 2143
457 Ga0207700_10140753 3300025928 Bacteria 1982
458 Ga0207664_10123263 3300025929 Bacteria 2172
459 Ga0207664_10139799 3300025929 Bacteria 2047
460 Ga0207664_10375971 3300025929 Bacteria 1260
461 Ga0207644_10054000 3300025931 Bacteria 2893
462 Ga0207644_10324654 3300025931 Bacteria 1245
463 Ga0207690_10002520 3300025932 Bacteria 11072
464 Ga0207706_10031319 3300025933 Bacteria 4739
465 Ga0207706_10055724 3300025933 Bacteria 3485
466 Ga0207706_10059335 3300025933 Bacteria 3369
467 Ga0207706_10185376 3300025933 Bacteria 1827
468 Ga0207686_10223239 3300025934 Bacteria 1362
469 Ga0207709_10013989 3300025935 Bacteria 4430
470 Ga0207709_10073275 3300025935 Bacteria 2182
471 Ga0207665_10000522 3300025939 Bacteria 25926
472 Ga0207665_10024366 3300025939 Bacteria 3990
473 Ga0207665_10197534 3300025939 Bacteria 1464
474 Ga0207691_10035022 3300025940 Bacteria 4665
475 Ga0207711_10055103 3300025941 Bacteria 3413
476 Ga0207689_10000139 3300025942 Bacteria 62281
477 Ga0207689_10005613 3300025942 Bacteria 11180
478 Ga0207689_10012502 3300025942 Bacteria 7252
479 Ga0207689_10062731 3300025942 Bacteria 3057
480 Ga0207689_10367884 3300025942 Bacteria 1196
481 Ga0207661_10020435 3300025944 Bacteria 4950
482 Ga0207661_10109383 3300025944 Bacteria 2335
483 Ga0207679_10000654 3300025945 Bacteria 23208
484 Ga0207667_10137423 3300025949 Bacteria 2516
485 Ga0207712_10273798 3300025961 Bacteria 1375
486 Ga0207668_10033646 3300025972 Bacteria 3397
487 Ga0207668_10342189 3300025972 Bacteria 1248
488 Ga0207677_10057686 3300026023 Bacteria 2668
489 Ga0207703_10351545 3300026035 Bacteria 1357
490 Ga0207703_10464987 3300026035 Bacteria 1183
491 Ga0207639_10002449 3300026041 Bacteria 12448
492 Ga0207639_10031224 3300026041 Bacteria 3914
493 Ga0207678_10008120 3300026067 Bacteria 9253
494 Ga0207678_10374120 3300026067 Bacteria 1231
495 Ga0207708_10048607 3300026075 Bacteria 3229
496 Ga0207702_10001416 3300026078 Bacteria 23943
497 Ga0207702_10006161 3300026078 Bacteria 10379
498 Ga0207702_10063224 3300026078 Bacteria 3164
499 Ga0207702_10079052 3300026078 Bacteria 2849
500 Ga0207702_10133186 3300026078 Bacteria 2239
501 Ga0207702_10202125 3300026078 Bacteria 1842
502 Ga0207641_10237011 3300026088 Bacteria 1698
503 Ga0207648_10040503 3300026089 Bacteria 4094
504 Ga0207648_10095835 3300026089 Bacteria 2596
505 Ga0207676_10266499 3300026095 Bacteria 1549
506 Ga0207674_10003977 3300026116 Bacteria 17968
507 Ga0207674_10007974 3300026116 Bacteria 12288
508 Ga0207674_10126766 3300026116 Bacteria 2518
509 Ga0207674_10306607 3300026116 Bacteria 1537
510 Ga0207674_10347762 3300026116 Bacteria 1433
511 Ga0207675_100009654 3300026118 Bacteria 9029
512 Ga0207675_100056374 3300026118 Bacteria 3665
513 Ga0207675_100060260 3300026118 Bacteria 3543
514 Ga0207675_100060331 3300026118 Bacteria 3541
515 Ga0207675_100164904 3300026118 Bacteria 2115
516 Ga0209967_1001289 3300027364 Bacteria 3213
517 Ga0210000_1002847 3300027462 Bacteria 2470
518 Ga0210000_1010738 3300027462 Bacteria 1355
519 Ga0209995_1003655 3300027471 Bacteria 2453
520 Ga0209982_1002551 3300027552 Bacteria 2563
521 Ga0209970_1000999 3300027614 Bacteria 5030
522 Ga0209983_1000359 3300027665 Bacteria 9610
523 Ga0209588_1003205 3300027671 Bacteria 4517
524 Ga0209588_1003234 3300027671 Bacteria 4501
525 Ga0209588_1018405 3300027671 Bacteria 2174
526 Ga0209971_1000091 3300027682 Bacteria 27342
527 Ga0209966_1000471 3300027695 Bacteria 10948
528 Ga0209998_10000487 3300027717 Bacteria 10916
529 Ga0209974_10000497 3300027876 Bacteria 13125
530 Ga0209974_10037847 3300027876 Bacteria 1602
531 Ga0207428_10000035 3300027907 Bacteria 229100
532 Ga0207428_10000173 3300027907 Bacteria 90064
533 Ga0207428_10005690 3300027907 Bacteria 11584
534 Ga0207428_10028359 3300027907 Bacteria 4652
535 Ga0207428_10056842 3300027907 Bacteria 3108
536 Ga0207428_10094552 3300027907 Bacteria 2317
537 Ga0207428_10187692 3300027907 Bacteria 1559
538 Ga0268265_10018444 3300028380 Bacteria 4835
539 Ga0268265_10121148 3300028380 Bacteria 2155
540 Ga0268264_10079667 3300028381 Bacteria 2795
541 Ga0268264_10118799 3300028381 Bacteria 2327
542 Ga0268264_10149062 3300028381 Bacteria 2095
543 Ga0268264_10172043 3300028381 Bacteria 1960
544 Ga0268264_10201824 3300028381 Bacteria 1820
545 Ga0268264_10230929 3300028381 Bacteria 1709
546 Ga0268264_10249319 3300028381 Bacteria 1649
547 Ga0265338_10013666 3300028800 Bacteria 9140
548 Ga0307408_100014396 3300031548 Bacteria 5254
549 Ga0307408_100047261 3300031548 Bacteria 3081
550 Ga0307405_10237110 3300031731 Bacteria 1349
551 Ga0307406_10090638 3300031901 Bacteria 2058
552 Ga0307409_100027155 3300031995 Bacteria 4052
553 Ga0307416_100020346 3300032002 Bacteria 4733
554 Ga0307411_10287386 3300032005 Bacteria 1312
555 Ga0307411_10318955 3300032005 Bacteria 1254
556 Ga0373930_0010303 3300034816 Bacteria 1669
557 Ga0373926_0009719 3300035083 Bacteria 3213
558 Ga0373940_0000139 3300035088 Bacteria 9317
559 Ga0373940_0010005 3300035088 Bacteria 2219
560 Ga0373940_0040857 3300035088 Bacteria 1274
561 Ga0373949_0005423 3300035090 Bacteria 2846
562 Ga0373951_0013401 3300035091 Bacteria 1843
563 Ga0373932_0015158 3300035112 Bacteria 1950
564 Ga0373932_0037545 3300035112 Bacteria 1381
565 Ga0373939_0001067 3300035114 Bacteria 6756
566 Ga0373941_0005531 3300035115 Bacteria 2979
567 Ga0373941_0019989 3300035115 Bacteria 1872
568 Ga0373953_0002546 3300035117 Bacteria 5506
569 Ga0373953_0007114 3300035117 Bacteria 3730
570 Ga0373953_0067348 3300035117 Bacteria 1473
571 Ga0373954_0010485 3300035118 Bacteria 4089
572 Ga0373956_0042410 3300035119 Bacteria 2023
573 Ga0373956_0068123 3300035119 Bacteria 1621
574 Ga0373960_0046047 3300035121 Bacteria 1279
575 Ga0373943_0024187 3300035170 Bacteria 2831
576 Ga0373946_0074765 3300035171 Bacteria 1471
577 Ga0373955_0027308 3300035172 Bacteria 2949
578 Ga0373955_0173990 3300035172 Bacteria 1275
579 Ga0373961_0006785 3300035241 Bacteria 2754
580 Ga0373961_0037508 3300035241 Bacteria 1385
581 Ga0373961_0059706 3300035241 Bacteria 1154
582 Ga0373962_0011679 3300035242 Bacteria 2204
583 Ga0373962_0045363 3300035242 Bacteria 1252
584 Ga0373924_0010243 3300035410 Bacteria 3451
585 Ga0373931_0001525 3300035691 Bacteria 9986
586 Ga0373931_0013166 3300035691 Bacteria 4023
587 Ga0373931_0039166 3300035691 Bacteria 2483
588 Ga0373931_0056109 3300035691 Bacteria 2110
589 Ga0373935_0078086 3300035692 Bacteria 2147
590 Ga0373935_0192731 3300035692 Bacteria 1405
591 Ga0373927_0130180 3300035695 Bacteria 1644
592 Ga0373933_0003852 3300035724 Bacteria 8277
593 Ga0373933_0006509 3300035724 Bacteria 6360
594 Ga0373933_0010835 3300035724 Bacteria 5002
595 Ga0373933_0026071 3300035724 Bacteria 3354
596 Ga0373947_0173504 3300035725 Bacteria 1400
597 Ga0373937_0001752 3300036401 Bacteria 18253
598 Ga0373937_0003961 3300036401 Bacteria 12519
599 Ga0373937_0004705 3300036401 Bacteria 11610
600 Ga0373937_0007059 3300036401 Bacteria 9699
601 Ga0373937_0040437 3300036401 Bacteria 4250
602 Ga0373937_0070780 3300036401 Bacteria 3217
603 Ga0373925_0176165 3300037068 Bacteria 1690
604 Ga0373925_0244504 3300037068 Bacteria 1438
605 Ga0395899_0012853 3300037312 Bacteria 6411
606 Ga0395899_0158151 3300037312 Bacteria 1602
607 Ga0395899_0195403 3300037312 Bacteria 1414
608 Ga0395900_0015260 3300037418 Bacteria 7833
609 Ga0395900_0027289 3300037418 Bacteria 5847
610 Ga0395900_0033238 3300037418 Bacteria 5309
611 Ga0395905_0104957 3300037471 Bacteria 2653
612 Ga0436364_0352896 3300037853 Bacteria 22874
613 Ga0436364_0492055 3300037853 Bacteria 1953
614 Ga0436364_0596927 3300037853 Bacteria 4966
615 Ga0436364_0960178 3300037853 Bacteria 4582
616 Ga0395901_0003030 3300038443 Bacteria 16937
617 Ga0395901_0015493 3300038443 Bacteria 7762
618 Ga0395901_0021176 3300038443 Bacteria 6659
619 Ga0395901_0067877 3300038443 Bacteria 3715
620 Ga0436365_0406591 3300039437 Bacteria 2659
621 Ga0436365_0552152 3300039437 Bacteria 19748
622 Ga0436365_0913869 3300039437 Bacteria 6311
623 Ga0436365_1107776 3300039437 Bacteria 1110
624 Ga0436365_1466484 3300039437 Bacteria 15322
625 Ga0436365_1637095 3300039437 Bacteria 3023
626 Ga0436360_0157380 3300039438 Bacteria 1335
627 Ga0436360_0933318 3300039438 Bacteria 1692
628 Ga0436363_0805001 3300039450 Bacteria 937
629 Ga0436363_1085715 3300039450 Bacteria 3677
630 Ga0436362_0363237 3300039453 Bacteria 1922
631 Ga0436362_0410971 3300039453 Bacteria 2463
632 Ga0436362_0872576 3300039453 Bacteria 945
633 Ga0436362_1087269 3300039453 Bacteria 1637
634 Ga0439448_0003964 3300042005 Bacteria 4156
635 Ga0439458_0003833 3300042157 Bacteria 3477
636 Ga0439460_0003075 3300042461 Bacteria 4033
637 Ga0451577_0002345 3300042876 Bacteria 22791
638 Ga0451577_0008397 3300042876 Bacteria 10052
639 Ga0451577_0030609 3300042876 Bacteria 4862
640 Ga0451577_0055798 3300042876 Bacteria 3524
641 Ga0451577_0105087 3300042876 Bacteria 2524
642 Ga0453683_0014510 3300044673 Bacteria 5112
643 Ga0453683_0021239 3300044673 Bacteria 4145
644 Ga0453683_0041629 3300044673 Bacteria 2885
645 Ga0453683_0059302 3300044673 Bacteria 2393
646 Ga0453683_0090488 3300044673 Bacteria 1918
647 Ga0453683_0254588 3300044673 Bacteria 1119
648 Ga0453684_0021719 3300044712 Bacteria 9569
649 Ga0453684_0198544 3300044712 Bacteria 2340
650 Ga0453684_0670363 3300044712 Bacteria 1130
651 Ga0451576_0005434 3300045051 Bacteria 15978
652 Ga0451576_0009543 3300045051 Bacteria 11242
653 Ga0451576_0010098 3300045051 Bacteria 10871
654 Ga0451576_0033973 3300045051 Bacteria 5418
655 Ga0451576_0053050 3300045051 Bacteria 4249
656 Ga0451576_0067860 3300045051 Bacteria 3712
657 Ga0451576_0082818 3300045051 Bacteria 3337
658 Ga0451576_0317870 3300045051 Bacteria 1629
659 Ga0451576_0335332 3300045051 Bacteria 1583
660 Ga0451576_0524708 3300045051 Bacteria 1244
661 Ga0495592_0028921 3300046454 Bacteria 4195
662 Ga0495592_0087330 3300046454 Bacteria 2244
663 Ga0495592_0098274 3300046454 Bacteria 2090
664 Ga0495603_0105419 3300046455 Bacteria 1645
665 Ga0495590_0016860 3300046457 Bacteria 2636
666 Ga0495651_0222655 3300046462 Bacteria 1305
667 Ga0495653_0132079 3300046463 Bacteria 1766
668 Ga0495580_0003139 3300046472 Bacteria 14158
669 Ga0495580_0050110 3300046472 Bacteria 2953
670 Ga0495580_0287650 3300046472 Bacteria 1121
671 Ga0495639_0070236 3300046475 Bacteria 1617
672 Ga0495664_0000446 3300046477 Bacteria 20340
673 Ga0495594_0037965 3300046499 Bacteria 2629
674 Ga0495608_0006614 3300046511 Bacteria 8230
675 Ga0495608_0018542 3300046511 Bacteria 4798
676 Ga0495608_0024289 3300046511 Bacteria 4147
677 Ga0495618_0141029 3300046514 Bacteria 1542
678 Ga0495652_0181502 3300046529 Bacteria 1614
679 Ga0495665_0166663 3300046531 Bacteria 1148
680 Ga0495640_0136892 3300046533 Bacteria 1581
681 Ga0495587_0002855 3300046536 Bacteria 11574
682 Ga0495587_0078495 3300046536 Bacteria 1915
683 Ga0495645_0002507 3300046543 Bacteria 12463
684 Ga0495667_0002100 3300046559 Bacteria 13237
685 Ga0495667_0002371 3300046559 Bacteria 12587
686 Ga0495667_0005451 3300046559 Bacteria 8595
687 Ga0495656_0004975 3300046615 Bacteria 4578
688 Ga0495634_0347533 3300046642 Bacteria 889
689 Ga0495635_0013483 3300046663 Bacteria 5719
690 Ga0495635_0135153 3300046663 Bacteria 1681
691 Ga0495659_0056298 3300046664 Bacteria 1443
692 Ga0495599_0041473 3300046678 Bacteria 2890
693 Ga0495646_0007471 3300046680 Bacteria 6946
694 Ga0495669_0020917 3300046684 Bacteria 2835
695 Ga0495669_0056476 3300046684 Bacteria 1769
696 Ga0495604_0003702 3300047317 Bacteria 12178
697 Ga0495680_0061658 3300047322 Bacteria 2884
698 Ga0495675_0123781 3300047444 Bacteria 1610
699 Ga0495675_0144256 3300047444 Bacteria 1474
700 Ga0495684_0137816 3300047471 Bacteria 1830
701 Ga0495684_0332188 3300047471 Bacteria 1084
702 Ga0495602_0000599 3300048088 Bacteria 33832
703 Ga0495602_0035046 3300048088 Bacteria 4685
704 Ga0495602_0066430 3300048088 Bacteria 3107
705 Ga0496100_0106989 3300048903 Bacteria 1937
706 Ga0496100_0407389 3300048903 Bacteria 1037
707 Ga0496102_0044173 3300048905 Bacteria 4043
708 Ga0496103_0015830 3300048906 Bacteria 4497
709 Ga0496104_0057655 3300048907 Bacteria 3675
710 Ga0496104_0665487 3300048907 Bacteria 950
711 Ga0496106_0110941 3300048909 Bacteria 2135
712 Ga0496106_0145736 3300048909 Bacteria 1865
713 Ga0496106_0382858 3300048909 Bacteria 1130
714 Ga0496108_0026850 3300048911 Bacteria 4752
715 Ga0496108_0055272 3300048911 Bacteria 3333
716 Ga0496109_0020386 3300048912 Bacteria 5856
717 Ga0496110_0026516 3300048913 Bacteria 4960
718 Ga0496110_0063298 3300048913 Bacteria 3268
719 Ga0496111_0172969 3300048914 Bacteria 1605
720 Ga0496112_0240231 3300048915 Bacteria 1764
721 Ga0496112_0498286 3300048915 Bacteria 1154
722 Ga0496113_0023142 3300048916 Bacteria 4404
723 Ga0496113_0065941 3300048916 Bacteria 2741
724 Ga0496114_0128366 3300048917 Bacteria 2188
725 Ga0496115_0284055 3300048918 Bacteria 1358
726 Ga0496126_0090225 3300048929 Bacteria 2697
727 Ga0496126_0109080 3300048929 Bacteria 2413
728 Ga0501298_025425 3300049521 Bacteria 1134
729 Ga0501031_0063074 3300049568 Bacteria 2415
730 Ga0501034_0001551 3300049571 Bacteria 30141
731 Ga0501038_0104581 3300049574 Bacteria 2353
732 Ga0501038_0563026 3300049574 Bacteria 866
733 Ga0501039_0010436 3300049575 Bacteria 7078
734 Ga0501039_0160299 3300049575 Bacteria 1768
735 Ga0501039_0169707 3300049575 Bacteria 1715
736 Ga0501039_0212623 3300049575 Bacteria 1521
737 Ga0501040_0017862 3300049576 Bacteria 4709
738 Ga0501040_0020351 3300049576 Bacteria 4420
739 Ga0501040_0065738 3300049576 Bacteria 2498
740 Ga0501040_0218788 3300049576 Bacteria 1355
741 Ga0501041_0002268 3300049577 Bacteria 10876
742 Ga0501041_0085644 3300049577 Bacteria 1943
743 Ga0501041_0124465 3300049577 Bacteria 1604
744 Ga0501041_0203423 3300049577 Bacteria 1242
745 Ga0501042_0029633 3300049578 Bacteria 3860
746 Ga0501042_0280935 3300049578 Bacteria 1202
747 Ga0501042_0408434 3300049578 Bacteria 984
748 Ga0501043_0160162 3300049579 Bacteria 1759
749 Ga0501043_0215332 3300049579 Bacteria 1488
750 Ga0501046_0000256 3300049580 Bacteria 54366
751 Ga0501046_0012623 3300049580 Bacteria 7183
752 Ga0501046_0043384 3300049580 Bacteria 3581
753 Ga0501048_0116498 3300049582 Bacteria 1888
754 Ga0501067_0014703 3300049583 Bacteria 4330
755 Ga0501068_0069312 3300049584 Bacteria 2150
756 Ga0501068_0121244 3300049584 Bacteria 1630
757 Ga0501068_0173203 3300049584 Bacteria 1363
758 Ga0501068_0211343 3300049584 Bacteria 1232
759 Ga0501069_0048946 3300049585 Bacteria 2349
760 Ga0501069_0052978 3300049585 Bacteria 2260
761 Ga0501069_0093528 3300049585 Bacteria 1701
762 Ga0501070_0357506 3300049586 Bacteria 1185
763 Ga0501071_0031991 3300049587 Bacteria 3733
764 Ga0501071_0115643 3300049587 Bacteria 1985
765 Ga0501071_0308235 3300049587 Bacteria 1201
766 Ga0501072_0008890 3300049588 Bacteria 7633
767 Ga0501072_0028873 3300049588 Bacteria 4330
768 Ga0501072_0055625 3300049588 Bacteria 3118
769 Ga0501072_0104538 3300049588 Bacteria 2252
770 Ga0501072_0157303 3300049588 Bacteria 1812
771 Ga0501072_0194258 3300049588 Bacteria 1619
772 Ga0501072_0271673 3300049588 Bacteria 1349
773 Ga0501074_0034129 3300049590 Bacteria 3688
774 Ga0501074_0064319 3300049590 Bacteria 2641
775 Ga0501074_0065903 3300049590 Bacteria 2606
776 Ga0501074_0200582 3300049590 Bacteria 1422
777 Ga0501075_0003599 3300049591 Bacteria 10385
778 Ga0501075_0004963 3300049591 Bacteria 9071
779 Ga0501075_0064500 3300049591 Bacteria 2763
780 Ga0501075_0068734 3300049591 Bacteria 2677
781 Ga0501075_0080905 3300049591 Bacteria 2459
782 Ga0501075_0148856 3300049591 Bacteria 1784
783 Ga0501075_0356291 3300049591 Bacteria 1115
784 Ga0501076_0002735 3300049592 Bacteria 12207
785 Ga0501076_0004323 3300049592 Bacteria 10076
786 Ga0501076_0004588 3300049592 Bacteria 9833
787 Ga0501076_0005794 3300049592 Bacteria 8914
788 Ga0501076_0110850 3300049592 Bacteria 2218
789 Ga0501076_0150309 3300049592 Bacteria 1894
790 Ga0501076_0221469 3300049592 Bacteria 1546
791 Ga0501077_0002642 3300049593 Bacteria 10733
792 Ga0501077_0006223 3300049593 Bacteria 7295
793 Ga0501077_0019717 3300049593 Bacteria 4266
794 Ga0501077_0043131 3300049593 Bacteria 2867
795 Ga0501077_0230086 3300049593 Bacteria 1178
796 Ga0501079_0002601 3300049741 Bacteria 13121
797 Ga0501079_0003445 3300049741 Bacteria 11623
798 Ga0501079_0101219 3300049741 Bacteria 2234
799 Ga0501079_0134763 3300049741 Bacteria 1923
800 Ga0501079_0384549 3300049741 Bacteria 1100
801 Ga0501080_0087696 3300049742 Bacteria 2891
802 Ga0501081_0002007 3300049743 Bacteria 12673
803 Ga0501081_0006225 3300049743 Bacteria 7735
804 Ga0501081_0023340 3300049743 Bacteria 4145
805 Ga0501081_0177873 3300049743 Bacteria 1538
806 Ga0501081_0198027 3300049743 Bacteria 1456
807 Ga0501081_0297115 3300049743 Bacteria 1184
808 Ga0501083_0004985 3300049744 Bacteria 9413
809 Ga0501083_0053708 3300049744 Bacteria 2705
810 Ga0501035_0284889 3300049822 Bacteria 1396
811 Ga0501045_0000178 3300049824 Bacteria 35077
812 Ga0501045_0231390 3300049824 Bacteria 1376
813 Ga0501045_0326944 3300049824 Bacteria 1141
814 nmdc:mga07m45_54238_c1 3300050496 Bacteria 2266
815 nmdc:mga05p37_10320_c1 3300050507 Bacteria 11092
816 nmdc:mga05p37_103433_c1 3300050507 Bacteria 3506
817 nmdc:mga05p37_113254_c1 3300050507 Bacteria 3335
818 nmdc:mga05p37_135779_c1 3300050507 Bacteria 3017
819 nmdc:mga05p37_160493_c1 3300050507 Bacteria 2746
820 nmdc:mga05p37_194952_c1 3300050507 Bacteria 2457
821 nmdc:mga05p37_2009_c1 3300050507 Bacteria 23745
822 nmdc:mga05p37_242328_c1 3300050507 Bacteria 2167
823 nmdc:mga05p37_29407_c1 3300050507 Bacteria 6705
824 nmdc:mga05p37_298640_c1 3300050507 Bacteria 1915
825 nmdc:mga05p37_30746_c1 3300050507 Bacteria 6553
826 nmdc:mga05p37_317213_c1 3300050507 Bacteria 1846
827 nmdc:mga05p37_347971_c1 3300050507 Bacteria 1746
828 nmdc:mga05p37_385317_c1 3300050507 Bacteria 1641
829 nmdc:mga05p37_38575_c1 3300050507 Bacteria 5860
830 nmdc:mga05p37_434318_c1 3300050507 Bacteria 1525
831 nmdc:mga05p37_455498_c1 3300050507 Bacteria 1479
832 nmdc:mga05p37_48283_c1 3300050507 Bacteria 5235
833 nmdc:mga05p37_4960_c1 3300050507 Bacteria 15593
834 nmdc:mga05p37_538319_c1 3300050507 Bacteria 1332
835 nmdc:mga05p37_5898_c1 3300050507 Bacteria 14410
836 nmdc:mga05p37_74134_c1 3300050507 Bacteria 4189
837 nmdc:mga05p37_8835_c1 3300050507 Bacteria 11903
838 nmdc:mga05p37_893430_c1 3300050507 Bacteria 959
839 nmdc:mga05p37_927435_c1 3300050507 Bacteria 935
840 nmdc:mga09592_12036_c1 3300050508 Bacteria 7039
841 nmdc:mga09592_1465_c1 3300050508 Bacteria 18943
842 nmdc:mga09592_16050_c1 3300050508 Bacteria 6122
843 nmdc:mga09592_168231_c1 3300050508 Unclassified 1895
844 nmdc:mga09592_170863_c1 3300050508 Bacteria 1880
845 nmdc:mga09592_32607_c1 3300050508 Bacteria 4343
846 nmdc:mga09592_365264_c1 3300050508 Bacteria 1249
847 nmdc:mga09592_7120_c1 3300050508 Bacteria 9093
848 nmdc:mga09592_73577_c1 3300050508 Bacteria 2903
849 nmdc:mga09592_88982_c1 3300050508 Bacteria 2637
850 nmdc:mga09592_94649_c1 3300050508 Bacteria 2555
851 nmdc:mga09592_99640_c1 3300050508 Bacteria 2488
852 nmdc:mga0qj67_137269_c1 3300050509 Bacteria 1981
853 nmdc:mga0qj67_15200_c1 3300050509 Bacteria 5826
854 nmdc:mga0qj67_156976_c1 3300050509 Bacteria 1847
855 nmdc:mga0qj67_30561_c1 3300050509 Bacteria 4194
856 nmdc:mga0qj67_369533_c1 3300050509 Bacteria 1158
857 nmdc:mga0qj67_449_c1 3300050509 Bacteria 28141
858 nmdc:mga0qj67_5329_c1 3300050509 Bacteria 9382
859 nmdc:mga0qj67_71070_c1 3300050509 Bacteria 2777
860 nmdc:mga06r32_1206_c1 3300050510 Bacteria 23285
861 nmdc:mga06r32_160246_c1 3300050510 Bacteria 2232
862 nmdc:mga06r32_29012_c1 3300050510 Bacteria 5181
863 nmdc:mga06r32_29446_c1 3300050510 Bacteria 5146
864 nmdc:mga06r32_29463_c1 3300050510 Bacteria 5145
865 nmdc:mga06r32_30755_c1 3300050510 Bacteria 5038
866 nmdc:mga06r32_37763_c1 3300050510 Bacteria 4569
867 nmdc:mga06r32_40957_c1 3300050510 Bacteria 4400
868 nmdc:mga06r32_42517_c1 3300050510 Bacteria 4321
869 nmdc:mga06r32_4577_c1 3300050510 Bacteria 12400
870 nmdc:mga06r32_4734_c1 3300050510 Bacteria 12237
871 nmdc:mga06r32_5623_c1 3300050510 Bacteria 11275
872 nmdc:mga06r32_75773_c1 3300050510 Bacteria 3266
873 nmdc:mga06r32_93069_c1 3300050510 Bacteria 2947
874 nmdc:mga08y16_12285_c1 3300050511 Bacteria 9003
875 nmdc:mga08y16_1477_c1 3300050511 Bacteria 23610
876 nmdc:mga08y16_18262_c1 3300050511 Bacteria 7389
877 nmdc:mga08y16_2085_c1 3300050511 Bacteria 20512
878 nmdc:mga08y16_48691_c1 3300050511 Bacteria 4435
879 nmdc:mga08y16_83181_c1 3300050511 Bacteria 3336
880 nmdc:mga0n895_109937_c1 3300050512 Bacteria 2772
881 nmdc:mga0n895_110591_c1 3300050512 Bacteria 2764
882 nmdc:mga0n895_120133_c1 3300050512 Bacteria 2649
883 nmdc:mga0n895_130456_c1 3300050512 Bacteria 2538
884 nmdc:mga0n895_156062_c1 3300050512 Bacteria 2313
885 nmdc:mga0n895_17105_c1 3300050512 Bacteria 6678
886 nmdc:mga0n895_199727_c1 3300050512 Bacteria 2031
887 nmdc:mga0n895_23781_c1 3300050512 Bacteria 5765
888 nmdc:mga0n895_23838_c1 3300050512 Bacteria 5759
889 nmdc:mga0n895_26869_c1 3300050512 Bacteria 5460
890 nmdc:mga0n895_270150_c1 3300050512 Bacteria 1725
891 nmdc:mga0n895_38311_c1 3300050512 Bacteria 4644
892 nmdc:mga0n895_50967_c1 3300050512 Bacteria 4060
893 nmdc:mga0n895_591837_c1 3300050512 Bacteria 1112
894 nmdc:mga0n895_65749_c1 3300050512 Bacteria 3590
895 nmdc:mga0n895_75362_c1 3300050512 Bacteria 3354
896 nmdc:mga0n895_86217_c1 3300050512 Bacteria 3136
897 nmdc:mga0n895_95547_c1 3300050512 Bacteria 2977
898 nmdc:mga0rr50_12033_c1 3300050513 Bacteria 3854
899 nmdc:mga0rr50_126063_c1 3300050513 Bacteria 2045
900 nmdc:mga0rr50_15534_c1 3300050513 Bacteria 5029
901 nmdc:mga0rr50_171359_c1 3300050513 Bacteria 1769
902 nmdc:mga0rr50_218042_c1 3300050513 Bacteria 1575
903 nmdc:mga0rr50_2234_c1 3300050513 Bacteria 10866
904 nmdc:mga0rr50_24021_c1 3300050513 Bacteria 4216
905 nmdc:mga0rr50_68395_c1 3300050513 Bacteria 2701
906 nmdc:mga08x19_117586_c1 3300050514 Bacteria 1779
907 nmdc:mga08x19_132248_c1 3300050514 Bacteria 1679
908 nmdc:mga08x19_22861_c1 3300050514 Bacteria 3875
909 nmdc:mga08x19_5207_c1 3300050514 Bacteria 7692
910 nmdc:mga08x19_96146_c1 3300050514 Bacteria 1960
911 nmdc:mga08x19_96568_c1 3300050514 Bacteria 1956
912 nmdc:mga0a205_12064_c1 3300050515 Bacteria 6964
913 nmdc:mga0a205_16698_c1 3300050515 Bacteria 3184
914 nmdc:mga0a205_171021_c1 3300050515 Bacteria 2069
915 nmdc:mga0a205_1874_c1 3300050515 Bacteria 18212
916 nmdc:mga0a205_2612_c1 3300050515 Bacteria 15917
917 nmdc:mga0a205_28600_c1 3300050515 Bacteria 5330
918 nmdc:mga0a205_295392_c1 3300050515 Bacteria 1494
919 nmdc:mga0a205_3238_c1 3300050515 Bacteria 14477
920 nmdc:mga0a205_3655_c1 3300050515 Bacteria 13775
921 nmdc:mga0a205_36620_c1 3300050515 Bacteria 4715
922 nmdc:mga0a205_44402_c1 3300050515 Bacteria 4284
923 nmdc:mga0a205_451388_c1 3300050515 Bacteria 1146
924 nmdc:mga0a205_68377_c1 3300050515 Bacteria 3431
925 nmdc:mga0a205_85448_c1 3300050515 Bacteria 3047
926 nmdc:mga0a205_98794_c1 3300050515 Bacteria 2817
927 Ga0495601_0000349 3300053077 Bacteria 24294
928 Ga0495612_0006272 3300053078 Bacteria 4900
929 Ga0495595_0003968 3300053084 Bacteria 5915
930 Ga0495595_0015972 3300053084 Bacteria 3206
931 Ga0495595_0018474 3300053084 Bacteria 3013
932 Ga0495595_0019505 3300053084 Bacteria 2943
933 Ga0495619_0023092 3300053085 Bacteria 3984
934 Ga0495619_0039442 3300053085 Bacteria 3083
935 Ga0501084_0002999 3300054114 Bacteria 13674
936 Ga0501084_0004605 3300054114 Bacteria 11266
937 Ga0501084_0007236 3300054114 Bacteria 9149
938 Ga0501084_0013238 3300054114 Bacteria 6827
939 Ga0501084_0029766 3300054114 Bacteria 4568
940 Ga0501084_0051036 3300054114 Bacteria 3462
941 Ga0501084_0056136 3300054114 Bacteria 3295
942 Ga0501084_0065986 3300054114 Bacteria 3028
943 Ga0501084_0133347 3300054114 Bacteria 2091
944 Ga0590071_005393 3300059421 Bacteria 3075
945 Ga0587070_019478 3300059491 Bacteria 1124
946 Ga0587073_0010869 3300059492 Bacteria 1541
947 Ga0587071_002850 3300060344 Bacteria 2408
948 Ga0501082_0005151 3300060353 Bacteria 11379
949 Ga0501082_0012317 3300060353 Bacteria 7350
950 Ga0501082_0012756 3300060353 Bacteria 7222
951 Ga0501082_0042568 3300060353 Bacteria 3915
952 Ga0501082_0053769 3300060353 Bacteria 3470
953 Ga0501082_0089589 3300060353 Bacteria 2656
954 Ga0501082_0276817 3300060353 Bacteria 1461
955 Ga0530510_0015244 3300061734 Bacteria 5428
956 Ga0530510_0019687 3300061734 Bacteria 4792
957 Ga0530510_0061626 3300061734 Bacteria 2716
958 Ga0530510_0080553 3300061734 Bacteria 2370
959 Ga0530510_0214710 3300061734 Bacteria 1429
960 Ga0530510_0255027 3300061734 Bacteria 1307
961 2644165223 2643221629 Bacteria 5850260
962 2644350975 2643221662 Bacteria 5851492
963 nmdc:mga09592_26346_c1
964 rootH1_10139936
965 JGI26141J51220_1001007
966 Ga0065707_10045053
967 Ga0065707_10127165
968 Ga0065707_10234948
969 Ga0070676_10000234
970 Ga0070683_100060225
971 Ga0070683_100137909
972 Ga0070690_100047268
973 Ga0070690_100096277
974 Ga0070670_100021391
975 Ga0068869_100001526
976 Ga0068869_100010180
977 Ga0068869_100105147
978 Ga0068869_100120080
979 Ga0070680_100025333
980 Ga0070680_100289703
981 Ga0070682_100001738
982 Ga0068868_100079609
983 Ga0070660_100000338
984 Ga0070689_100089539
985 Ga0070689_100093751
986 Ga0070691_10001306
987 Ga0070691_10008381
988 Ga0070687_100192916
989 Ga0070661_100012583
990 Ga0070661_100036789
991 Ga0070692_10007725
992 Ga0070692_10155690
993 Ga0070669_100066673
994 Ga0070669_100074873
995 Ga0070669_100085084
996 Ga0070669_100242069
997 Ga0070675_100105948
998 Ga0070675_100221578
999 Ga0070671_100072513
1000 Ga0070673_100082142
1001 Ga0070688_100144086
1002 Ga0070659_100000431
1003 Ga0070703_10014197
1004 Ga0070709_10000308
1005 Ga0070709_10196925
1006 Ga0070714_100094967
1007 Ga0070714_100179248
1008 Ga0070714_100409318
1009 Ga0070713_100006903
1010 Ga0070713_100075205
1011 Ga0070713_100082842
1012 Ga0070713_100197779
1013 Ga0070710_10000782
1014 Ga0070710_10063440
1015 Ga0070710_10166432
1016 Ga0070710_10168136
1017 Ga0070701_10004446
1018 Ga0070701_10080838
1019 Ga0070711_100011646
1020 Ga0070711_100065993
1021 Ga0070711_100096722
1022 Ga0070711_100120970
1023 Ga0070711_100150038
1024 Ga0070705_100084588
1025 Ga0070705_100133580
1026 Ga0070705_100281026
1027 Ga0070705_100313332
1028 Ga0070700_100114486
1029 Ga0070694_100004737
1030 Ga0070694_100047963
1031 Ga0070694_100159375
1032 Ga0070694_100160744
1033 Ga0070694_100236810
1034 Ga0070708_100050048
1035 Ga0070708_100076185
1036 Ga0070708_100109509
1037 Ga0070708_100132185
1038 Ga0070708_100219565
1039 Ga0070708_100260106
1040 Ga0070662_100068033
1041 Ga0070662_100092983
1042 Ga0070681_10274366
1043 Ga0068867_100049511
1044 Ga0068867_100084782
1045 Ga0070706_100001917
1046 Ga0070706_100005212
1047 Ga0070706_100017099
1048 Ga0070706_100040406
1049 Ga0070706_100041777
1050 Ga0070706_100073920
1051 Ga0070706_100075255
1052 Ga0070706_100157921
1053 Ga0070706_100190177
1054 Ga0070706_100208255
1055 Ga0070706_100305737
1056 Ga0070707_100000746
1057 Ga0070707_100001477
1058 Ga0070707_100004668
1059 Ga0070707_100007658
1060 Ga0070707_100008810
1061 Ga0070707_100032862
1062 Ga0070707_100038153
1063 Ga0070707_100079921
1064 Ga0070707_100117242
1065 Ga0070707_100302818
1066 Ga0070707_100332124
1067 Ga0070698_100000483
1068 Ga0070698_100002750
1069 Ga0070698_100025708
1070 Ga0070698_100036014
1071 Ga0070698_100049702
1072 Ga0070698_100073429
1073 Ga0070698_100084496
1074 Ga0070698_100334138
1075 Ga0070699_100001653
1076 Ga0070699_100077248
1077 Ga0070699_100104175
1078 Ga0070699_100112380
1079 Ga0070699_100175087
1080 Ga0070679_100000975
1081 Ga0070679_100081658
1082 Ga0070684_100003405
1083 Ga0070697_100001149
1084 Ga0070697_100003003
1085 Ga0070697_100010998
1086 Ga0070697_100030018
1087 Ga0070697_100035644
1088 Ga0070697_100089493
1089 Ga0070697_100171275
1090 Ga0070697_100293633
1091 Ga0068853_100003158
1092 Ga0068853_100484489
1093 Ga0070686_100302968
1094 Ga0070695_100005906
1095 Ga0070695_100006683
1096 Ga0070695_100030571
1097 Ga0070695_100046667
1098 Ga0070695_100162287
1099 Ga0070695_100213622
1100 Ga0070696_100040153
1101 Ga0070696_100081774
1102 Ga0070696_100138555
1103 Ga0070693_100001205
1104 Ga0070693_100235756
1105 Ga0070704_100023823
1106 Ga0070704_100037034
1107 Ga0070704_100039292
1108 Ga0070704_100058708
1109 Ga0068855_100000993
1110 Ga0068855_100047139
1111 Ga0070664_100053373
1112 Ga0070664_100116699
1113 Ga0068857_100004916
1114 Ga0068857_100262695
1115 Ga0068856_100029378
1116 Ga0070702_100074068
1117 Ga0068852_100019640
1118 Ga0068859_100011951
1119 Ga0068859_100059656
1120 Ga0068864_100014540
1121 Ga0068864_100091520
1122 Ga0068864_100287871
1123 Ga0068866_10073234
1124 Ga0068861_100014859
1125 Ga0068861_100128073
1126 Ga0068861_100196329
1127 Ga0068861_100220769
1128 Ga0068870_10003942
1129 Ga0068863_100167521
1130 Ga0068863_100680706
1131 Ga0068858_100259485
1132 Ga0068858_100313512
1133 Ga0068858_100383544
1134 Ga0068860_100021130
1135 Ga0068860_100116823
1136 Ga0068860_100141784
1137 Ga0068860_100213651
1138 Ga0068860_100343821
1139 Ga0068860_100380322
1140 Ga0068862_100011813
1141 Ga0068862_100054736
1142 Ga0068862_100101330
1143 Ga0068862_100308665
1144 Ga0068862_100347608
1145 Ga0081455_10000302
1146 Ga0081455_10001686
1147 Ga0081455_10011423
1148 Ga0081455_10048085
1149 Ga0081455_10048636
1150 Ga0081538_10038073
1151 Ga0081538_10072760
1152 Ga0081540_1001904
1153 Ga0081539_10000020
1154 Ga0081539_10024038
1155 Ga0070717_10031915
1156 Ga0070717_10067249
1157 Ga0070717_10144302
1158 Ga0070717_10159538
1159 Ga0070717_10210075
1160 Ga0070717_10263402
1161 Ga0070717_10563748
1162 Ga0070715_10086340
1163 Ga0070715_10091509
1164 Ga0070716_100038293
1165 Ga0070716_100067848
1166 Ga0070716_100155188
1167 Ga0070716_100239853
1168 Ga0070712_100004566
1169 Ga0070712_100295233
1170 Ga0075362_10060169
1171 Ga0075367_10103033
1172 Ga0075428_100001365
1173 Ga0075428_100002513
1174 Ga0075428_100002795
1175 Ga0075428_100004121
1176 Ga0075428_100026566
1177 Ga0075428_100039429
1178 Ga0075428_100058315
1179 Ga0075428_100065269
1180 Ga0075428_100217374
1181 Ga0075430_100000052
1182 Ga0075430_100003800
1183 Ga0075430_100008106
1184 Ga0075430_100097897
1185 Ga0075430_100205664
1186 Ga0075430_100469256
1187 Ga0075431_100000038
1188 Ga0075431_100000309
1189 Ga0075431_100003560
1190 Ga0075431_100007008
1191 Ga0075431_100024096
1192 Ga0075431_100028574
1193 Ga0075431_100035130
1194 Ga0075431_100037217
1195 Ga0075431_100050327
1196 Ga0075431_100132756
1197 Ga0075431_100267638
1198 Ga0075433_10003962
1199 Ga0075433_10021259
1200 Ga0075433_10021776
1201 Ga0075433_10036035
1202 Ga0075433_10077383
1203 Ga0075433_10077845
1204 Ga0075433_10080727
1205 Ga0075433_10080881
1206 Ga0075433_10104636
1207 Ga0075433_10105431
1208 Ga0075433_10123934
1209 Ga0075433_10197245
1210 Ga0075433_10242629
1211 Ga0075434_100002184
1212 Ga0075434_100005484
1213 Ga0075434_100015821
1214 Ga0075434_100019916
1215 Ga0075434_100030497
1216 Ga0075434_100066176
1217 Ga0075434_100069045
1218 Ga0075434_100069318
1219 Ga0075434_100096127
1220 Ga0075434_100103906
1221 Ga0075434_100104150
1222 Ga0075434_100119635
1223 Ga0075434_100123969
1224 Ga0075434_100142639
1225 Ga0075434_100163274
1226 Ga0075434_100193815
1227 Ga0075434_100267158
1228 Ga0075434_100341900
1229 Ga0075434_100408491
1230 Ga0075429_100000898
1231 Ga0075429_100003643
1232 Ga0075429_100004919
1233 Ga0075429_100004927
1234 Ga0075429_100008268
1235 Ga0075429_100025005
1236 Ga0075429_100044487
1237 Ga0075429_100091607
1238 Ga0075429_100167590
1239 Ga0075436_100001335
1240 Ga0075436_100045807
1241 Ga0075436_100117144
1242 Ga0075436_100126837
1243 Ga0075436_100162162
1244 Ga0097620_100011951
1245 Ga0097620_100059656
1246 Ga0075435_100007945
1247 Ga0075435_100014830
1248 Ga0075435_100043402
1249 Ga0075435_100060165
1250 Ga0075435_100067863
1251 Ga0075435_100098773
1252 Ga0075435_100186675
1253 Ga0075435_100222332
1254 Ga0099794_10040928
1255 Ga0099794_10121985
1256 Ga0099795_10029218
1257 Ga0111539_10000552
1258 Ga0111539_10001850
1259 Ga0111539_10004281
1260 Ga0111539_10005162
1261 Ga0111539_10007358
1262 Ga0111539_10013327
1263 Ga0111539_10113883
1264 Ga0111539_10118504
1265 Ga0111539_10125815
1266 Ga0111539_10131021
1267 Ga0105245_10105506
1268 Ga0105245_10110885
1269 Ga0105245_10203828
1270 Ga0105247_10048184
1271 Ga0105247_10156988
1272 Ga0114129_10000919
1273 Ga0114129_10002160
1274 Ga0114129_10002604
1275 Ga0114129_10009756
1276 Ga0114129_10016331
1277 Ga0114129_10016728
1278 Ga0114129_10016827
1279 Ga0114129_10020955
1280 Ga0114129_10025104
1281 Ga0114129_10032397
1282 Ga0114129_10037962
1283 Ga0114129_10044316
1284 Ga0114129_10056789
1285 Ga0114129_10099934
1286 Ga0114129_10113634
1287 Ga0114129_10116037
1288 Ga0114129_10165830
1289 Ga0114129_10242005
1290 Ga0114129_10283263
1291 Ga0114129_10305772
1292 Ga0114129_10320764
1293 Ga0114129_10414753
1294 Ga0114129_10675294
1295 Ga0114129_10982280
1296 Ga0105243_10031204
1297 Ga0105243_10034011
1298 Ga0105243_10385599
1299 Ga0105243_10601477
1300 Ga0105241_10002786
1301 Ga0105241_10020521
1302 Ga0105241_10334171
1303 Ga0105242_10345935
1304 Ga0105248_10052063
1305 Ga0105248_10125244
1306 Ga0105248_10167472
1307 Ga0105248_10607894
1308 Ga0105237_10243589
1309 Ga0105238_10013568
1310 Ga0105249_10252240
1311 Ga0105249_10823279
1312 Ga0099796_10023570
1313 Ga0099796_10040026
1314 Ga0105239_10137704
1315 Ga0105246_10050764
1316 Ga0157373_10272568
1317 Ga0157371_10023126
1318 Ga0157370_10080096
1319 Ga0157369_10037565
1320 Ga0157369_10038752
1321 Ga0157369_10190134
1322 Ga0157369_10625036
1323 Ga0157374_10324831
1324 Ga0157378_10085835
1325 Ga0157378_10096016
1326 Ga0163162_10149302
1327 Ga0163162_10215229
1328 Ga0163162_10266715
1329 Ga0163162_10594105
1330 Ga0157372_10053246
1331 Ga0157372_10114313
1332 Ga0157372_10561219
1333 Ga0157375_10020032
1334 Ga0157375_10031764
1335 Ga0157375_10085761
1336 Ga0163163_10062659
1337 Ga0163163_10365404
1338 Ga0157380_10042364
1339 Ga0182008_10015169
1340 Ga0182008_10026473
1341 Ga0182008_10095858
1342 Ga0157379_10073273
1343 Ga0157379_10164511
1344 Ga0157376_10064328
1345 Ga0213876_10098264
1346 Ga0207653_10014150
1347 Ga0207653_10033038
1348 Ga0207653_10063573
1349 Ga0207692_10023418
1350 Ga0207688_10019475
1351 Ga0207647_10064617
1352 Ga0207685_10067429
1353 Ga0207699_10021021
1354 Ga0207699_10045424
1355 Ga0207699_10062240
1356 Ga0207699_10207726
1357 Ga0207645_10000033
1358 Ga0207643_10001741
1359 Ga0207705_10357583
1360 Ga0207684_10000290
1361 Ga0207684_10001142
1362 Ga0207684_10002251
1363 Ga0207684_10014240
1364 Ga0207684_10014347
1365 Ga0207684_10017676
1366 Ga0207684_10032919
1367 Ga0207684_10040928
1368 Ga0207684_10070167
1369 Ga0207684_10134046
1370 Ga0207684_10173724
1371 Ga0207684_10188999
1372 Ga0207684_10304272
1373 Ga0207654_10011720
1374 Ga0207654_10087075
1375 Ga0207654_10110861
1376 Ga0207707_10001156
1377 Ga0207707_10175316
1378 Ga0207671_10132772
1379 Ga0207693_10002165
1380 Ga0207693_10002395
1381 Ga0207693_10018827
1382 Ga0207693_10052009
1383 Ga0207693_10245222
1384 Ga0207693_10294985
1385 Ga0207660_10013811
1386 Ga0207660_10020315
1387 Ga0207660_10039356
1388 Ga0207660_10109684
1389 Ga0207660_10220683
1390 Ga0207660_10303584
1391 Ga0207662_10258851
1392 Ga0207649_10007990
1393 Ga0207649_10022741
1394 Ga0207652_10001565
1395 Ga0207652_10050772
1396 Ga0207646_10000203
1397 Ga0207646_10000259
1398 Ga0207646_10000361
1399 Ga0207646_10000561
1400 Ga0207646_10000960
1401 Ga0207646_10008416
1402 Ga0207646_10016073
1403 Ga0207646_10033880
1404 Ga0207646_10050043
1405 Ga0207646_10058200
1406 Ga0207646_10165454
1407 Ga0207681_10056356
1408 Ga0207681_10057574
1409 Ga0207681_10083829
1410 Ga0207694_10032416
1411 Ga0207659_10356690
1412 Ga0207687_10141378
1413 Ga0207700_10007878
1414 Ga0207700_10012847
1415 Ga0207700_10059835
1416 Ga0207700_10095531
1417 Ga0207700_10116229
1418 Ga0207700_10118479
1419 Ga0207700_10140753
1420 Ga0207664_10123263
1421 Ga0207664_10139799
1422 Ga0207664_10375971
1423 Ga0207644_10054000
1424 Ga0207644_10324654
1425 Ga0207690_10002520
1426 Ga0207706_10031319
1427 Ga0207706_10055724
1428 Ga0207706_10059335
1429 Ga0207706_10185376
1430 Ga0207686_10223239
1431 Ga0207709_10013989
1432 Ga0207709_10073275
1433 Ga0207665_10000522
1434 Ga0207665_10024366
1435 Ga0207665_10197534
1436 Ga0207691_10035022
1437 Ga0207711_10055103
1438 Ga0207689_10000139
1439 Ga0207689_10005613
1440 Ga0207689_10012502
1441 Ga0207689_10062731
1442 Ga0207689_10367884
1443 Ga0207661_10020435
1444 Ga0207661_10109383
1445 Ga0207679_10000654
1446 Ga0207667_10137423
1447 Ga0207712_10273798
1448 Ga0207668_10033646
1449 Ga0207668_10342189
1450 Ga0207677_10057686
1451 Ga0207703_10351545
1452 Ga0207703_10464987
1453 Ga0207639_10002449
1454 Ga0207639_10031224
1455 Ga0207678_10008120
1456 Ga0207678_10374120
1457 Ga0207708_10048607
1458 Ga0207702_10001416
1459 Ga0207702_10006161
1460 Ga0207702_10063224
1461 Ga0207702_10079052
1462 Ga0207702_10133186
1463 Ga0207702_10202125
1464 Ga0207641_10237011
1465 Ga0207648_10040503
1466 Ga0207648_10095835
1467 Ga0207676_10266499
1468 Ga0207674_10003977
1469 Ga0207674_10007974
1470 Ga0207674_10126766
1471 Ga0207674_10306607
1472 Ga0207674_10347762
1473 Ga0207675_100009654
1474 Ga0207675_100056374
1475 Ga0207675_100060260
1476 Ga0207675_100060331
1477 Ga0207675_100164904
1478 Ga0209967_1001289
1479 Ga0210000_1002847
1480 Ga0210000_1010738
1481 Ga0209995_1003655
1482 Ga0209982_1002551
1483 Ga0209970_1000999
1484 Ga0209983_1000359
1485 Ga0209588_1003205
1486 Ga0209588_1003234
1487 Ga0209588_1018405
1488 Ga0209971_1000091
1489 Ga0209966_1000471
1490 Ga0209998_10000487
1491 Ga0209974_10000497
1492 Ga0209974_10037847
1493 Ga0207428_10000035
1494 Ga0207428_10000173
1495 Ga0207428_10005690
1496 Ga0207428_10028359
1497 Ga0207428_10056842
1498 Ga0207428_10094552
1499 Ga0207428_10187692
1500 Ga0268265_10018444
1501 Ga0268265_10121148
1502 Ga0268264_10079667
1503 Ga0268264_10118799
1504 Ga0268264_10149062
1505 Ga0268264_10172043
1506 Ga0268264_10201824
1507 Ga0268264_10230929
1508 Ga0268264_10249319
1509 Ga0265338_10013666
1510 Ga0307408_100014396
1511 Ga0307408_100047261
1512 Ga0307405_10237110
1513 Ga0307406_10090638
1514 Ga0307409_100027155
1515 Ga0307416_100020346
1516 Ga0307411_10287386
1517 Ga0307411_10318955
1518 Ga0373930_0010303
1519 Ga0373926_0009719
1520 Ga0373940_0000139
1521 Ga0373940_0010005
1522 Ga0373940_0040857
1523 Ga0373949_0005423
1524 Ga0373951_0013401
1525 Ga0373932_0015158
1526 Ga0373932_0037545
1527 Ga0373939_0001067
1528 Ga0373941_0005531
1529 Ga0373941_0019989
1530 Ga0373953_0002546
1531 Ga0373953_0007114
1532 Ga0373953_0067348
1533 Ga0373954_0010485
1534 Ga0373956_0042410
1535 Ga0373956_0068123
1536 Ga0373960_0046047
1537 Ga0373943_0024187
1538 Ga0373946_0074765
1539 Ga0373955_0027308
1540 Ga0373955_0173990
1541 Ga0373961_0006785
1542 Ga0373961_0037508
1543 Ga0373961_0059706
1544 Ga0373962_0011679
1545 Ga0373962_0045363
1546 Ga0373924_0010243
1547 Ga0373931_0001525
1548 Ga0373931_0013166
1549 Ga0373931_0039166
1550 Ga0373931_0056109
1551 Ga0373935_0078086
1552 Ga0373935_0192731
1553 Ga0373927_0130180
1554 Ga0373933_0003852
1555 Ga0373933_0006509
1556 Ga0373933_0010835
1557 Ga0373933_0026071
1558 Ga0373947_0173504
1559 Ga0373937_0001752
1560 Ga0373937_0003961
1561 Ga0373937_0004705
1562 Ga0373937_0007059
1563 Ga0373937_0040437
1564 Ga0373937_0070780
1565 Ga0373925_0176165
1566 Ga0373925_0244504
1567 Ga0395899_0012853
1568 Ga0395899_0158151
1569 Ga0395899_0195403
1570 Ga0395900_0015260
1571 Ga0395900_0027289
1572 Ga0395900_0033238
1573 Ga0395905_0104957
1574 Ga0436364_0352896
1575 Ga0436364_0492055
1576 Ga0436364_0596927
1577 Ga0436364_0960178
1578 Ga0395901_0003030
1579 Ga0395901_0015493
1580 Ga0395901_0021176
1581 Ga0395901_0067877
1582 Ga0436365_0406591
1583 Ga0436365_0552152
1584 Ga0436365_0913869
1585 Ga0436365_1107776
1586 Ga0436365_1466484
1587 Ga0436365_1637095
1588 Ga0436360_0157380
1589 Ga0436360_0933318
1590 Ga0436363_0805001
1591 Ga0436363_1085715
1592 Ga0436362_0363237
1593 Ga0436362_0410971
1594 Ga0436362_0872576
1595 Ga0436362_1087269
1596 Ga0439448_0003964
1597 Ga0439458_0003833
1598 Ga0439460_0003075
1599 Ga0451577_0002345
1600 Ga0451577_0008397
1601 Ga0451577_0030609
1602 Ga0451577_0055798
1603 Ga0451577_0105087
1604 Ga0453683_0014510
1605 Ga0453683_0021239
1606 Ga0453683_0041629
1607 Ga0453683_0059302
1608 Ga0453683_0090488
1609 Ga0453683_0254588
1610 Ga0453684_0021719
1611 Ga0453684_0198544
1612 Ga0453684_0670363
1613 Ga0451576_0005434
1614 Ga0451576_0009543
1615 Ga0451576_0010098
1616 Ga0451576_0033973
1617 Ga0451576_0053050
1618 Ga0451576_0067860
1619 Ga0451576_0082818
1620 Ga0451576_0317870
1621 Ga0451576_0335332
1622 Ga0451576_0524708
1623 Ga0495592_0028921
1624 Ga0495592_0087330
1625 Ga0495592_0098274
1626 Ga0495603_0105419
1627 Ga0495590_0016860
1628 Ga0495651_0222655
1629 Ga0495653_0132079
1630 Ga0495580_0003139
1631 Ga0495580_0050110
1632 Ga0495580_0287650
1633 Ga0495639_0070236
1634 Ga0495664_0000446
1635 Ga0495594_0037965
1636 Ga0495608_0006614
1637 Ga0495608_0018542
1638 Ga0495608_0024289
1639 Ga0495618_0141029
1640 Ga0495652_0181502
1641 Ga0495665_0166663
1642 Ga0495640_0136892
1643 Ga0495587_0002855
1644 Ga0495587_0078495
1645 Ga0495645_0002507
1646 Ga0495667_0002100
1647 Ga0495667_0002371
1648 Ga0495667_0005451
1649 Ga0495656_0004975
1650 Ga0495634_0347533
1651 Ga0495635_0013483
1652 Ga0495635_0135153
1653 Ga0495659_0056298
1654 Ga0495599_0041473
1655 Ga0495646_0007471
1656 Ga0495669_0020917
1657 Ga0495669_0056476
1658 Ga0495604_0003702
1659 Ga0495680_0061658
1660 Ga0495675_0123781
1661 Ga0495675_0144256
1662 Ga0495684_0137816
1663 Ga0495684_0332188
1664 Ga0495602_0000599
1665 Ga0495602_0035046
1666 Ga0495602_0066430
1667 Ga0496100_0106989
1668 Ga0496100_0407389
1669 Ga0496102_0044173
1670 Ga0496103_0015830
1671 Ga0496104_0057655
1672 Ga0496104_0665487
1673 Ga0496106_0110941
1674 Ga0496106_0145736
1675 Ga0496106_0382858
1676 Ga0496108_0026850
1677 Ga0496108_0055272
1678 Ga0496109_0020386
1679 Ga0496110_0026516
1680 Ga0496110_0063298
1681 Ga0496111_0172969
1682 Ga0496112_0240231
1683 Ga0496112_0498286
1684 Ga0496113_0023142
1685 Ga0496113_0065941
1686 Ga0496114_0128366
1687 Ga0496115_0284055
1688 Ga0496126_0090225
1689 Ga0496126_0109080
1690 Ga0501298_025425
1691 Ga0501031_0063074
1692 Ga0501034_0001551
1693 Ga0501038_0104581
1694 Ga0501038_0563026
1695 Ga0501039_0010436
1696 Ga0501039_0160299
1697 Ga0501039_0169707
1698 Ga0501039_0212623
1699 Ga0501040_0017862
1700 Ga0501040_0020351
1701 Ga0501040_0065738
1702 Ga0501040_0218788
1703 Ga0501041_0002268
1704 Ga0501041_0085644
1705 Ga0501041_0124465
1706 Ga0501041_0203423
1707 Ga0501042_0029633
1708 Ga0501042_0280935
1709 Ga0501042_0408434
1710 Ga0501043_0160162
1711 Ga0501043_0215332
1712 Ga0501046_0000256
1713 Ga0501046_0012623
1714 Ga0501046_0043384
1715 Ga0501048_0116498
1716 Ga0501067_0014703
1717 Ga0501068_0069312
1718 Ga0501068_0121244
1719 Ga0501068_0173203
1720 Ga0501068_0211343
1721 Ga0501069_0048946
1722 Ga0501069_0052978
1723 Ga0501069_0093528
1724 Ga0501070_0357506
1725 Ga0501071_0031991
1726 Ga0501071_0115643
1727 Ga0501071_0308235
1728 Ga0501072_0008890
1729 Ga0501072_0028873
1730 Ga0501072_0055625
1731 Ga0501072_0104538
1732 Ga0501072_0157303
1733 Ga0501072_0194258
1734 Ga0501072_0271673
1735 Ga0501074_0034129
1736 Ga0501074_0064319
1737 Ga0501074_0065903
1738 Ga0501074_0200582
1739 Ga0501075_0003599
1740 Ga0501075_0004963
1741 Ga0501075_0064500
1742 Ga0501075_0068734
1743 Ga0501075_0080905
1744 Ga0501075_0148856
1745 Ga0501075_0356291
1746 Ga0501076_0002735
1747 Ga0501076_0004323
1748 Ga0501076_0004588
1749 Ga0501076_0005794
1750 Ga0501076_0110850
1751 Ga0501076_0150309
1752 Ga0501076_0221469
1753 Ga0501077_0002642
1754 Ga0501077_0006223
1755 Ga0501077_0019717
1756 Ga0501077_0043131
1757 Ga0501077_0230086
1758 Ga0501079_0002601
1759 Ga0501079_0003445
1760 Ga0501079_0101219
1761 Ga0501079_0134763
1762 Ga0501079_0384549
1763 Ga0501080_0087696
1764 Ga0501081_0002007
1765 Ga0501081_0006225
1766 Ga0501081_0023340
1767 Ga0501081_0177873
1768 Ga0501081_0198027
1769 Ga0501081_0297115
1770 Ga0501083_0004985
1771 Ga0501083_0053708
1772 Ga0501035_0284889
1773 Ga0501045_0000178
1774 Ga0501045_0231390
1775 Ga0501045_0326944
1776 nmdc:mga07m45_54238_c1
1777 nmdc:mga05p37_10320_c1
1778 nmdc:mga05p37_103433_c1
1779 nmdc:mga05p37_113254_c1
1780 nmdc:mga05p37_135779_c1
1781 nmdc:mga05p37_160493_c1
1782 nmdc:mga05p37_194952_c1
1783 nmdc:mga05p37_2009_c1
1784 nmdc:mga05p37_242328_c1
1785 nmdc:mga05p37_29407_c1
1786 nmdc:mga05p37_298640_c1
1787 nmdc:mga05p37_30746_c1
1788 nmdc:mga05p37_317213_c1
1789 nmdc:mga05p37_347971_c1
1790 nmdc:mga05p37_385317_c1
1791 nmdc:mga05p37_38575_c1
1792 nmdc:mga05p37_434318_c1
1793 nmdc:mga05p37_455498_c1
1794 nmdc:mga05p37_48283_c1
1795 nmdc:mga05p37_4960_c1
1796 nmdc:mga05p37_538319_c1
1797 nmdc:mga05p37_5898_c1
1798 nmdc:mga05p37_74134_c1
1799 nmdc:mga05p37_8835_c1
1800 nmdc:mga05p37_893430_c1
1801 nmdc:mga05p37_927435_c1
1802 nmdc:mga09592_12036_c1
1803 nmdc:mga09592_1465_c1
1804 nmdc:mga09592_16050_c1
1805 nmdc:mga09592_168231_c1
1806 nmdc:mga09592_170863_c1
1807 nmdc:mga09592_32607_c1
1808 nmdc:mga09592_365264_c1
1809 nmdc:mga09592_7120_c1
1810 nmdc:mga09592_73577_c1
1811 nmdc:mga09592_88982_c1
1812 nmdc:mga09592_94649_c1
1813 nmdc:mga09592_99640_c1
1814 nmdc:mga0qj67_137269_c1
1815 nmdc:mga0qj67_15200_c1
1816 nmdc:mga0qj67_156976_c1
1817 nmdc:mga0qj67_30561_c1
1818 nmdc:mga0qj67_369533_c1
1819 nmdc:mga0qj67_449_c1
1820 nmdc:mga0qj67_5329_c1
1821 nmdc:mga0qj67_71070_c1
1822 nmdc:mga06r32_1206_c1
1823 nmdc:mga06r32_160246_c1
1824 nmdc:mga06r32_29012_c1
1825 nmdc:mga06r32_29446_c1
1826 nmdc:mga06r32_29463_c1
1827 nmdc:mga06r32_30755_c1
1828 nmdc:mga06r32_37763_c1
1829 nmdc:mga06r32_40957_c1
1830 nmdc:mga06r32_42517_c1
1831 nmdc:mga06r32_4577_c1
1832 nmdc:mga06r32_4734_c1
1833 nmdc:mga06r32_5623_c1
1834 nmdc:mga06r32_75773_c1
1835 nmdc:mga06r32_93069_c1
1836 nmdc:mga08y16_12285_c1
1837 nmdc:mga08y16_1477_c1
1838 nmdc:mga08y16_18262_c1
1839 nmdc:mga08y16_2085_c1
1840 nmdc:mga08y16_48691_c1
1841 nmdc:mga08y16_83181_c1
1842 nmdc:mga0n895_109937_c1
1843 nmdc:mga0n895_110591_c1
1844 nmdc:mga0n895_120133_c1
1845 nmdc:mga0n895_130456_c1
1846 nmdc:mga0n895_156062_c1
1847 nmdc:mga0n895_17105_c1
1848 nmdc:mga0n895_199727_c1
1849 nmdc:mga0n895_23781_c1
1850 nmdc:mga0n895_23838_c1
1851 nmdc:mga0n895_26869_c1
1852 nmdc:mga0n895_270150_c1
1853 nmdc:mga0n895_38311_c1
1854 nmdc:mga0n895_50967_c1
1855 nmdc:mga0n895_591837_c1
1856 nmdc:mga0n895_65749_c1
1857 nmdc:mga0n895_75362_c1
1858 nmdc:mga0n895_86217_c1
1859 nmdc:mga0n895_95547_c1
1860 nmdc:mga0rr50_12033_c1
1861 nmdc:mga0rr50_126063_c1
1862 nmdc:mga0rr50_15534_c1
1863 nmdc:mga0rr50_171359_c1
1864 nmdc:mga0rr50_218042_c1
1865 nmdc:mga0rr50_2234_c1
1866 nmdc:mga0rr50_24021_c1
1867 nmdc:mga0rr50_68395_c1
1868 nmdc:mga08x19_117586_c1
1869 nmdc:mga08x19_132248_c1
1870 nmdc:mga08x19_22861_c1
1871 nmdc:mga08x19_5207_c1
1872 nmdc:mga08x19_96146_c1
1873 nmdc:mga08x19_96568_c1
1874 nmdc:mga0a205_12064_c1
1875 nmdc:mga0a205_16698_c1
1876 nmdc:mga0a205_171021_c1
1877 nmdc:mga0a205_1874_c1
1878 nmdc:mga0a205_2612_c1
1879 nmdc:mga0a205_28600_c1
1880 nmdc:mga0a205_295392_c1
1881 nmdc:mga0a205_3238_c1
1882 nmdc:mga0a205_3655_c1
1883 nmdc:mga0a205_36620_c1
1884 nmdc:mga0a205_44402_c1
1885 nmdc:mga0a205_451388_c1
1886 nmdc:mga0a205_68377_c1
1887 nmdc:mga0a205_85448_c1
1888 nmdc:mga0a205_98794_c1
1889 Ga0495601_0000349
1890 Ga0495612_0006272
1891 Ga0495595_0003968
1892 Ga0495595_0015972
1893 Ga0495595_0018474
1894 Ga0495595_0019505
1895 Ga0495619_0023092
1896 Ga0495619_0039442
1897 Ga0501084_0002999
1898 Ga0501084_0004605
1899 Ga0501084_0007236
1900 Ga0501084_0013238
1901 Ga0501084_0029766
1902 Ga0501084_0051036
1903 Ga0501084_0056136
1904 Ga0501084_0065986
1905 Ga0501084_0133347
1906 Ga0590071_005393
1907 Ga0587070_019478
1908 Ga0587073_0010869
1909 Ga0587071_002850
1910 Ga0501082_0005151
1911 Ga0501082_0012317
1912 Ga0501082_0012756
1913 Ga0501082_0042568
1914 Ga0501082_0053769
1915 Ga0501082_0089589
1916 Ga0501082_0276817
1917 Ga0530510_0015244
1918 Ga0530510_0019687
1919 Ga0530510_0061626
1920 Ga0530510_0080553
1921 Ga0530510_0214710
1922 Ga0530510_0255027
1923 2644165223
1924 2644350975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

161

353

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

50

150

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.5601 93 308
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.4942 91 323
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.4747 91 323
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.4735 93 308
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.4615 91 323
ID Description Score Start End Superfamily
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6713 74 325 1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6412 74 325 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6293 84 326 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6223 84 326 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6174 93 324 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1Q7GCF6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.7933 11 328 GO:0005886
GO:0055085
AF-A0A1Q7GCF6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.774 11 328 GO:0005886
GO:0055085
AF-A0A1F4FQI8-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.7579 8 328 GO:0005886
GO:0071916
AF-A0A1H1KIC5-F1-model_v4 Peptide/nickel transport system permease protein 0.7525 9 327 GO:0005886
GO:0071916
AF-A0A1Y3QQA8-F1-model_v4 Peptide ABC transporter permease 0.7496 9 329 GO:0005886
GO:0071916

Map