F486823

General Info

Members Datasets Scaffolds Average Seq Length
959 400 895 450

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10090626|Ga0307516_100906262
Length 448
Sequence MGRKLLLEKANVEGIRGYDVYRREGGYRSVEKALKTMTPDQVTDEVKKSGLRGRGGAGFPTGMKWSFLAKPEGVPRYLVCNADESEPGTFKDRYLMEFIPHLLIEGLIVSSYALGSHATYIYIRGEYAWIPDILEQAVEEAKAANILGTGYDLEIYVHRGAGAYICGEETALIESLEGKRGNPRIKPPFPAVKGVWDCPTVVNNVETLAAVVPIINNGGEDYSKIGVGKSTGTKLLSACGNINKPGVYEIDMTISVEEFIYSDEYCGGIPNGKRLKACIPGGSSVPILPANLLLKTAKGETRMMNYESLSDGGFAKGSMMGSGGFIVLDEDQCVVRHTLTLARFYRHESCGQCSPCREGTGWMEKILKNIEYGKGKSSDIDLLWDIQRKIEGNTICPLGDAAAWPVAAAIRHFRDEFEWHVANPQESQGRNYGLANYADPLPLAPTPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
22 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
23 2738541278 Niastella sp. CF465 Isolate Unclassified
24 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
25 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
26 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
27 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
28 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
29 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
30 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
31 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
32 2818991444 Filimonas endophytica 3197 Isolate Unclassified
33 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
34 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
35 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
36 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
37 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
38 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
39 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
40 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
41 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
42 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
43 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
44 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
45 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
46 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
47 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
48 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
49 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
50 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
51 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
52 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
53 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
54 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
55 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
56 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
57 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
58 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
59 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
60 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
61 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
62 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
63 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
64 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
65 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
66 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
67 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
69 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
72 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
84 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
85 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
86 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
87 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
88 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
89 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
90 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
91 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
92 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
93 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
94 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
95 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
96 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
108 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
109 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
110 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
111 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
112 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
113 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
114 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
115 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
116 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
122 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
123 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
124 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
125 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
126 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
127 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
128 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
129 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
130 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
131 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
135 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
139 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
140 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
141 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
143 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
144 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
145 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
146 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
147 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
150 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
153 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
154 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
155 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
158 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
173 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
174 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
175 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
176 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
177 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
178 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
179 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
180 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
181 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
182 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
183 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
186 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
187 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
250 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
251 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
252 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
253 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
254 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
255 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
256 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
273 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
274 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
280 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
281 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
296 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
297 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
356 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
357 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
358 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
359 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
360 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
361 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
362 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
363 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
364 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
365 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
366 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
367 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
368 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
369 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
372 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
373 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
374 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
375 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
377 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
385 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
386 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
387 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
388 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
389 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
390 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
393 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
396 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
397 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
398 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.22
Metatranscriptomes 0
Isolates 6.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 5.01
Nodule 0.1
Rhizoplane 0.94
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1203094 2162886007 Bacteria 2513
2 SwRhRL2b_contig_3262938 2162886007 Bacteria 1997
3 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
4 JGI24737J22298_10007402 3300001990 Bacteria 3706
5 JGI25406J46586_10003552 3300003203 Bacteria 7306
6 JGI25153J46596_10015999 3300003215 Bacteria 3028
7 rootH2_10000933 3300003320 Bacteria 60850
8 rootH2_10012714 3300003320 Bacteria 66260
9 rootH2_10027208 3300003320 Bacteria 3894
10 rootH2_10065769 3300003320 Bacteria 9761
11 rootH2_10073988 3300003320 Bacteria 4230
12 rootH1_10009896 3300003316 Bacteria 1485
13 rootH1_10009896 3300003323 Bacteria 7746
14 rootH1_10066896 3300003323 Bacteria 4568
15 rootH1_10101281 3300003323 Bacteria 2750
16 JGI25160J50197_1002225 3300003354 Bacteria 9104
17 JGI25160J50197_1007805 3300003354 Bacteria 4144
18 JGI25160J50197_1009408 3300003354 Bacteria 3626
19 Ga0055542_1004849 3300003762 Bacteria 3152
20 Ga0055526_1009867 3300003771 Bacteria 4529
21 Ga0055534_1007919 3300003784 Bacteria 2468
22 Ga0055528_1001384 3300003790 Bacteria 14897
23 Ga0055530_10000584 3300003791 Bacteria 31522
24 Ga0055531_10000132 3300003794 Bacteria 85251
25 Ga0055531_10029285 3300003794 Bacteria 1878
26 Ga0065165_1000914 3300005262 Bacteria 38063
27 Ga0065165_1028630 3300005262 Bacteria 1796
28 Ga0065714_10064700 3300005288 Bacteria 22656
29 Ga0065704_10002179 3300005289 Bacteria 9547
30 Ga0065704_10070133 3300005289 Bacteria 1266035
31 Ga0065704_10071654 3300005289 Bacteria 10363
32 Ga0065704_10076736 3300005289 Bacteria 4983
33 Ga0065712_10072974 3300005290 Bacteria 4496
34 Ga0065712_10074656 3300005290 Bacteria 4042
35 Ga0070658_10011839 3300005327 Bacteria 7002
36 Ga0070658_10021983 3300005327 Bacteria 5115
37 Ga0070658_10101610 3300005327 Bacteria 2377
38 Ga0070676_10000113 3300005328 Bacteria 29666
39 Ga0070676_10001094 3300005328 Bacteria 13533
40 Ga0070676_10005256 3300005328 Bacteria 6883
41 Ga0070683_100000553 3300005329 Bacteria 26515
42 Ga0070683_100002523 3300005329 Bacteria 14587
43 Ga0070683_100004195 3300005329 Bacteria 11821
44 Ga0070683_100005141 3300005329 Bacteria 10883
45 Ga0070683_100045229 3300005329 Bacteria 4063
46 Ga0070683_100081489 3300005329 Bacteria 3030
47 Ga0070683_100156917 3300005329 Bacteria 2158
48 Ga0070690_100016610 3300005330 Bacteria 4413
49 Ga0070690_100021267 3300005330 Bacteria 3959
50 Ga0070690_100128920 3300005330 Bacteria 1706
51 Ga0070670_100032098 3300005331 Bacteria 4522
52 Ga0070670_100091270 3300005331 Bacteria 2619
53 Ga0070670_100100003 3300005331 Bacteria 2496
54 Ga0070670_100109275 3300005331 Bacteria 2383
55 Ga0070670_100243744 3300005331 Bacteria 1565
56 Ga0070677_10028216 3300005333 Bacteria 2119
57 Ga0070677_10038879 3300005333 Bacteria 1864
58 Ga0068869_100003465 3300005334 Bacteria 9646
59 Ga0068869_100006312 3300005334 Bacteria 7504
60 Ga0068869_100025796 3300005334 Bacteria 4085
61 Ga0068869_100064509 3300005334 Bacteria 2694
62 Ga0070666_10000019 3300005335 Bacteria 185877
63 Ga0070666_10003803 3300005335 Bacteria 9154
64 Ga0070666_10011816 3300005335 Bacteria 5490
65 Ga0070666_10046115 3300005335 Bacteria 2923
66 Ga0070680_100003171 3300005336 Bacteria 12221
67 Ga0070680_100101249 3300005336 Bacteria 2391
68 Ga0070680_100182096 3300005336 Bacteria 1770
69 Ga0070682_100000095 3300005337 Bacteria 80688
70 Ga0070682_100000129 3300005337 Bacteria 64098
71 Ga0070682_100002730 3300005337 Bacteria 9779
72 Ga0070682_100021389 3300005337 Bacteria 3817
73 Ga0068868_100001431 3300005338 Bacteria 16462
74 Ga0068868_100006616 3300005338 Bacteria 8217
75 Ga0068868_100023995 3300005338 Bacteria 4622
76 Ga0068868_100057848 3300005338 Bacteria 3064
77 Ga0068868_100179953 3300005338 Bacteria 1753
78 Ga0070660_100001175 3300005339 Bacteria 17707
79 Ga0070660_100022055 3300005339 Bacteria 4705
80 Ga0070660_100123168 3300005339 Bacteria 2070
81 Ga0070660_100133547 3300005339 Bacteria 1987
82 Ga0070689_100041636 3300005340 Bacteria 3526
83 Ga0070689_100053033 3300005340 Bacteria 3138
84 Ga0070689_100130139 3300005340 Bacteria 2018
85 Ga0070691_10000858 3300005341 Bacteria 12290
86 Ga0070687_100062734 3300005343 Bacteria 1969
87 Ga0070661_100000179 3300005344 Bacteria 52306
88 Ga0070661_100077158 3300005344 Bacteria 2456
89 Ga0070668_100001636 3300005347 Bacteria 16228
90 Ga0070668_100036105 3300005347 Bacteria 3771
91 Ga0070669_100006616 3300005353 Bacteria 8344
92 Ga0070669_100085507 3300005353 Bacteria 2355
93 Ga0070675_100208513 3300005354 Bacteria 1698
94 Ga0070671_100022897 3300005355 Bacteria 5106
95 Ga0070671_100090702 3300005355 Bacteria 2559
96 Ga0070671_100131533 3300005355 Bacteria 2107
97 Ga0070671_100219718 3300005355 Bacteria 1612
98 Ga0070674_100004529 3300005356 Bacteria 7935
99 Ga0070673_100035374 3300005364 Bacteria 3787
100 Ga0070673_100048895 3300005364 Bacteria 3299
101 Ga0070673_100129050 3300005364 Bacteria 2119
102 Ga0070673_100135041 3300005364 Bacteria 2075
103 Ga0070673_100145283 3300005364 Bacteria 2005
104 Ga0070673_100147895 3300005364 Bacteria 1987
105 Ga0070688_100002588 3300005365 Bacteria 9164
106 Ga0070688_100011134 3300005365 Bacteria 4993
107 Ga0070659_100001588 3300005366 Bacteria 16376
108 Ga0070659_100017521 3300005366 Bacteria 5394
109 Ga0070659_100021878 3300005366 Bacteria 4878
110 Ga0070659_100092731 3300005366 Bacteria 2422
111 Ga0070659_100096396 3300005366 Bacteria 2376
112 Ga0070667_100001113 3300005367 Bacteria 24519
113 Ga0070667_100002121 3300005367 Bacteria 17485
114 Ga0070667_100066412 3300005367 Bacteria 3065
115 Ga0070667_100073882 3300005367 Bacteria 2908
116 Ga0070667_100100035 3300005367 Bacteria 2503
117 Ga0070667_100168373 3300005367 Bacteria 1933
118 Ga0070701_10026249 3300005438 Bacteria 2839
119 Ga0070700_100091756 3300005441 Bacteria 1984
120 Ga0070663_100109185 3300005455 Bacteria 2076
121 Ga0070678_100000905 3300005456 Bacteria 15223
122 Ga0070678_100003904 3300005456 Bacteria 8381
123 Ga0070678_100009316 3300005456 Bacteria 5941
124 Ga0070662_100006914 3300005457 Bacteria 7344
125 Ga0070662_100013751 3300005457 Bacteria 5390
126 Ga0070662_100036378 3300005457 Bacteria 3482
127 Ga0070662_100053128 3300005457 Bacteria 2932
128 Ga0070662_100095908 3300005457 Bacteria 2237
129 Ga0070662_100129292 3300005457 Bacteria 1945
130 Ga0070681_10048862 3300005458 Bacteria 4226
131 Ga0070681_10066593 3300005458 Bacteria 3571
132 Ga0070681_10094284 3300005458 Bacteria 2942
133 Ga0068867_100003787 3300005459 Bacteria 10644
134 Ga0068867_100016216 3300005459 Bacteria 5291
135 Ga0068867_100023112 3300005459 Bacteria 4450
136 Ga0068867_100061101 3300005459 Bacteria 2797
137 Ga0068867_100165642 3300005459 Bacteria 1746
138 Ga0070685_10079666 3300005466 Bacteria 1960
139 Ga0070698_100003913 3300005471 Bacteria 16377
140 Ga0070698_100009186 3300005471 Bacteria 10609
141 Ga0070698_100169495 3300005471 Bacteria 2125
142 Ga0070698_100171722 3300005471 Bacteria 2109
143 Ga0070699_100060944 3300005518 Bacteria 3270
144 Ga0070679_100001926 3300005530 Bacteria 18645
145 Ga0070679_100010564 3300005530 Bacteria 8758
146 Ga0070679_100019927 3300005530 Bacteria 6533
147 Ga0070679_100056362 3300005530 Bacteria 3915
148 Ga0070679_100110417 3300005530 Bacteria 2736
149 Ga0070679_100253010 3300005530 Bacteria 1717
150 Ga0070684_100001469 3300005535 Bacteria 17002
151 Ga0070684_100011020 3300005535 Bacteria 7191
152 Ga0070684_100011625 3300005535 Bacteria 7016
153 Ga0070684_100042255 3300005535 Bacteria 3934
154 Ga0068853_100001537 3300005539 Bacteria 16786
155 Ga0068853_100021044 3300005539 Bacteria 5430
156 Ga0068853_100024340 3300005539 Bacteria 5075
157 Ga0068853_100032462 3300005539 Bacteria 4423
158 Ga0068853_100041673 3300005539 Bacteria 3924
159 Ga0068853_100084041 3300005539 Bacteria 2789
160 Ga0070672_100001082 3300005543 Bacteria 16598
161 Ga0070672_100004444 3300005543 Bacteria 9178
162 Ga0070672_100069759 3300005543 Bacteria 2792
163 Ga0070672_100073243 3300005543 Bacteria 2730
164 Ga0070693_100074587 3300005547 Bacteria 2007
165 Ga0070665_100000094 3300005548 Bacteria 171072
166 Ga0070665_100004249 3300005548 Bacteria 15068
167 Ga0070665_100005115 3300005548 Bacteria 13603
168 Ga0070665_100031963 3300005548 Bacteria 5298
169 Ga0070665_100117865 3300005548 Bacteria 2658
170 Ga0070704_100051890 3300005549 Bacteria 2891
171 Ga0068855_100000399 3300005563 Bacteria 53597
172 Ga0068855_100009093 3300005563 Bacteria 12007
173 Ga0068855_100027369 3300005563 Bacteria 6820
174 Ga0068855_100036378 3300005563 Bacteria 5860
175 Ga0068855_100068908 3300005563 Bacteria 4117
176 Ga0068855_100113157 3300005563 Bacteria 3114
177 Ga0068855_100208823 3300005563 Bacteria 2195
178 Ga0068855_100248059 3300005563 Bacteria 1987
179 Ga0068855_100248143 3300005563 Bacteria 1986
180 Ga0068855_100279633 3300005563 Bacteria 1854
181 Ga0070664_100001077 3300005564 Bacteria 21494
182 Ga0070664_100001338 3300005564 Bacteria 19647
183 Ga0070664_100004250 3300005564 Bacteria 11518
184 Ga0070664_100250991 3300005564 Bacteria 1590
185 Ga0068857_100011099 3300005577 Bacteria 7837
186 Ga0068857_100022387 3300005577 Bacteria 5560
187 Ga0068857_100032063 3300005577 Bacteria 4645
188 Ga0068857_100057307 3300005577 Bacteria 3458
189 Ga0068854_100007104 3300005578 Bacteria 7149
190 Ga0068856_100006224 3300005614 Bacteria 11711
191 Ga0068856_100039390 3300005614 Bacteria 4640
192 Ga0068856_100074039 3300005614 Bacteria 3371
193 Ga0068852_100001228 3300005616 Bacteria 17072
194 Ga0068852_100020168 3300005616 Bacteria 5296
195 Ga0068852_100026592 3300005616 Bacteria 4706
196 Ga0068852_100027173 3300005616 Bacteria 4661
197 Ga0068852_100044678 3300005616 Bacteria 3765
198 Ga0068852_100127635 3300005616 Bacteria 2338
199 Ga0068859_100000013 3300005617 Bacteria 291126
200 Ga0068859_100009898 3300005617 Bacteria 9629
201 Ga0068859_100010935 3300005617 Bacteria 9136
202 Ga0068859_100032552 3300005617 Bacteria 5237
203 Ga0068859_100048393 3300005617 Bacteria 4271
204 Ga0068859_100057532 3300005617 Bacteria 3916
205 Ga0068859_100098912 3300005617 Bacteria 2972
206 Ga0068859_100173554 3300005617 Bacteria 2237
207 Ga0068859_100227010 3300005617 Bacteria 1955
208 Ga0068859_100243764 3300005617 Bacteria 1887
209 Ga0068859_100279643 3300005617 Bacteria 1761
210 Ga0068864_100023214 3300005618 Bacteria 5207
211 Ga0068864_100030528 3300005618 Bacteria 4568
212 Ga0068866_10081356 3300005718 Bacteria 1740
213 Ga0068861_100000312 3300005719 Bacteria 27173
214 Ga0068861_100001193 3300005719 Bacteria 16169
215 Ga0068861_100061833 3300005719 Bacteria 2875
216 Ga0068870_10028139 3300005840 Bacteria 2819
217 Ga0068863_100014098 3300005841 Bacteria 7700
218 Ga0068863_100027191 3300005841 Bacteria 5455
219 Ga0068863_100063235 3300005841 Bacteria 3500
220 Ga0068863_100068572 3300005841 Bacteria 3355
221 Ga0068858_100001874 3300005842 Bacteria 21456
222 Ga0068858_100027822 3300005842 Bacteria 5252
223 Ga0068858_100030456 3300005842 Bacteria 5010
224 Ga0068858_100094319 3300005842 Bacteria 2788
225 Ga0068858_100118933 3300005842 Bacteria 2470
226 Ga0068860_100000052 3300005843 Bacteria 207351
227 Ga0068860_100006756 3300005843 Bacteria 11507
228 Ga0068860_100013335 3300005843 Bacteria 8058
229 Ga0068860_100038399 3300005843 Bacteria 4580
230 Ga0068860_100056184 3300005843 Bacteria 3743
231 Ga0068860_100190834 3300005843 Bacteria 1983
232 Ga0068860_100201020 3300005843 Bacteria 1931
233 Ga0068862_100004828 3300005844 Bacteria 11355
234 Ga0068862_100283256 3300005844 Bacteria 1520
235 Ga0081539_10000418 3300005985 Bacteria 90493
236 Ga0070716_100011309 3300006173 Bacteria 4494
237 Ga0097621_100000015 3300006237 Bacteria 92182
238 Ga0097621_100000611 3300006237 Bacteria 25252
239 Ga0097621_100004099 3300006237 Bacteria 10109
240 Ga0097621_100012278 3300006237 Bacteria 6340
241 Ga0097621_100019146 3300006237 Bacteria 5248
242 Ga0097621_100246296 3300006237 Bacteria 1564
243 Ga0068871_100000051 3300006358 Bacteria 64844
244 Ga0068871_100000634 3300006358 Bacteria 24163
245 Ga0068871_100002800 3300006358 Bacteria 11923
246 Ga0068871_100020463 3300006358 Bacteria 5070
247 Ga0068871_100045310 3300006358 Bacteria 3540
248 Ga0068871_100063228 3300006358 Bacteria 3026
249 Ga0068871_100063902 3300006358 Bacteria 3011
250 Ga0068871_100100867 3300006358 Bacteria 2418
251 Ga0068871_100229903 3300006358 Bacteria 1609
252 Ga0068871_100253906 3300006358 Bacteria 1532
253 Ga0075428_100005379 3300006844 Bacteria 14236
254 Ga0075428_100071519 3300006844 Bacteria 3791
255 Ga0075428_100091050 3300006844 Bacteria 3327
256 Ga0075430_100034421 3300006846 Bacteria 4299
257 Ga0075431_100016396 3300006847 Bacteria 7520
258 Ga0075429_100001571 3300006880 Bacteria 18757
259 Ga0068865_100096438 3300006881 Bacteria 2156
260 Ga0097620_100000013 3300006931 Bacteria 291126
261 Ga0097620_100009898 3300006931 Bacteria 9629
262 Ga0097620_100010935 3300006931 Bacteria 9136
263 Ga0097620_100032554 3300006931 Bacteria 5237
264 Ga0097620_100048393 3300006931 Bacteria 4271
265 Ga0097620_100057536 3300006931 Bacteria 3916
266 Ga0097620_100098915 3300006931 Bacteria 2972
267 Ga0097620_100173555 3300006931 Bacteria 2237
268 Ga0097620_100227012 3300006931 Bacteria 1955
269 Ga0097620_100243780 3300006931 Bacteria 1887
270 Ga0097620_100279634 3300006931 Bacteria 1761
271 Ga0105244_10000018 3300009036 Bacteria 244992
272 Ga0105250_10010960 3300009092 Bacteria 3769
273 Ga0105240_10000066 3300009093 Bacteria 212612
274 Ga0105240_10004785 3300009093 Bacteria 20422
275 Ga0105240_10006482 3300009093 Bacteria 17189
276 Ga0105240_10006663 3300009093 Bacteria 16935
277 Ga0105240_10024475 3300009093 Bacteria 7956
278 Ga0105240_10035148 3300009093 Bacteria 6461
279 Ga0105240_10037888 3300009093 Bacteria 6192
280 Ga0105240_10043248 3300009093 Bacteria 5733
281 Ga0105240_10075976 3300009093 Bacteria 4143
282 Ga0105240_10199358 3300009093 Bacteria 2347
283 Ga0111539_10003295 3300009094 Bacteria 21340
284 Ga0111539_10112694 3300009094 Bacteria 3191
285 Ga0105245_10136931 3300009098 Bacteria 2302
286 Ga0105247_10002997 3300009101 Bacteria 11192
287 Ga0105247_10013814 3300009101 Bacteria 4841
288 Ga0114129_10021024 3300009147 Bacteria 9269
289 Ga0114129_10153551 3300009147 Bacteria 3150
290 Ga0105243_10000003 3300009148 Bacteria 712931
291 Ga0105243_10000089 3300009148 Bacteria 103761
292 Ga0105243_10255070 3300009148 Unclassified 1568
293 Ga0105241_10001659 3300009174 Bacteria 16968
294 Ga0105241_10022955 3300009174 Bacteria 4625
295 Ga0105241_10026514 3300009174 Bacteria 4313
296 Ga0105241_10099075 3300009174 Bacteria 2314
297 Ga0105241_10112978 3300009174 Bacteria 2177
298 Ga0105242_10029088 3300009176 Bacteria 4404
299 Ga0105242_10088408 3300009176 Bacteria 2603
300 Ga0105248_10051086 3300009177 Bacteria 4639
301 Ga0105237_10000474 3300009545 Bacteria 57006
302 Ga0105237_10001895 3300009545 Bacteria 26705
303 Ga0105237_10002029 3300009545 Bacteria 25756
304 Ga0105237_10052853 3300009545 Bacteria 4076
305 Ga0105237_10087162 3300009545 Bacteria 3111
306 Ga0105249_10000679 3300009553 Bacteria 30951
307 Ga0105249_10007529 3300009553 Bacteria 9498
308 Ga0105249_10039631 3300009553 Bacteria 4278
309 Ga0105249_10064934 3300009553 Bacteria 3356
310 Ga0105249_10090960 3300009553 Bacteria 2854
311 Ga0105249_10248929 3300009553 Bacteria 1761
312 Ga0105239_10000935 3300010375 Bacteria 41237
313 Ga0105239_10002278 3300010375 Bacteria 24496
314 Ga0105239_10004572 3300010375 Bacteria 16497
315 Ga0105239_10020118 3300010375 Bacteria 7364
316 Ga0105239_10023061 3300010375 Bacteria 6862
317 Ga0105239_10043427 3300010375 Bacteria 4927
318 Ga0105239_10072896 3300010375 Bacteria 3776
319 Ga0105239_10096879 3300010375 Bacteria 3259
320 Ga0105246_10013343 3300011119 Bacteria 5150
321 Ga0105246_10132829 3300011119 Bacteria 1862
322 Ga0157373_10000006 3300013100 Bacteria 261768
323 Ga0157373_10000678 3300013100 Bacteria 26681
324 Ga0157373_10011301 3300013100 Bacteria 6565
325 Ga0157373_10018289 3300013100 Bacteria 5104
326 Ga0157373_10032325 3300013100 Bacteria 3766
327 Ga0157373_10070171 3300013100 Bacteria 2476
328 Ga0157373_10077735 3300013100 Bacteria 2341
329 Ga0157371_10000012 3300013102 Bacteria 355318
330 Ga0157371_10000107 3300013102 Bacteria 126477
331 Ga0157371_10000168 3300013102 Bacteria 95185
332 Ga0157371_10001199 3300013102 Bacteria 27770
333 Ga0157371_10001473 3300013102 Bacteria 24412
334 Ga0157371_10011618 3300013102 Bacteria 6769
335 Ga0157371_10012460 3300013102 Bacteria 6497
336 Ga0157371_10012519 3300013102 Bacteria 6483
337 Ga0157371_10024544 3300013102 Bacteria 4400
338 Ga0157371_10052714 3300013102 Bacteria 2888
339 Ga0157371_10079833 3300013102 Bacteria 2317
340 Ga0157371_10106640 3300013102 Bacteria 1988
341 Ga0157370_10000817 3300013104 Bacteria 39404
342 Ga0157370_10001336 3300013104 Bacteria 30640
343 Ga0157370_10001929 3300013104 Bacteria 25519
344 Ga0157370_10005025 3300013104 Bacteria 14939
345 Ga0157370_10007905 3300013104 Bacteria 11520
346 Ga0157370_10009760 3300013104 Bacteria 10190
347 Ga0157370_10010241 3300013104 Bacteria 9900
348 Ga0157370_10042422 3300013104 Bacteria 4385
349 Ga0157370_10070057 3300013104 Bacteria 3311
350 Ga0157369_10002537 3300013105 Bacteria 21826
351 Ga0157369_10020179 3300013105 Bacteria 7452
352 Ga0157369_10030384 3300013105 Bacteria 5958
353 Ga0157369_10057853 3300013105 Bacteria 4181
354 Ga0157369_10067961 3300013105 Bacteria 3829
355 Ga0157369_10079828 3300013105 Bacteria 3504
356 Ga0157369_10085509 3300013105 Bacteria 3370
357 Ga0157374_10000024 3300013296 Bacteria 265166
358 Ga0157374_10000237 3300013296 Bacteria 51331
359 Ga0157374_10001665 3300013296 Bacteria 18606
360 Ga0157374_10002410 3300013296 Bacteria 15774
361 Ga0157374_10031205 3300013296 Bacteria 4842
362 Ga0157374_10063424 3300013296 Bacteria 3465
363 Ga0157374_10088985 3300013296 Bacteria 2941
364 Ga0157374_10186839 3300013296 Bacteria 2026
365 Ga0157378_10014757 3300013297 Bacteria 6845
366 Ga0157378_10016099 3300013297 Bacteria 6548
367 Ga0157378_10025398 3300013297 Bacteria 5217
368 Ga0157378_10034022 3300013297 Bacteria 4508
369 Ga0157378_10216788 3300013297 Bacteria 1818
370 Ga0163162_10000595 3300013306 Bacteria 33576
371 Ga0163162_10001161 3300013306 Bacteria 24561
372 Ga0163162_10001403 3300013306 Bacteria 22418
373 Ga0163162_10001696 3300013306 Bacteria 20664
374 Ga0163162_10002066 3300013306 Bacteria 18872
375 Ga0163162_10003454 3300013306 Bacteria 15092
376 Ga0163162_10010491 3300013306 Bacteria 9009
377 Ga0163162_10017686 3300013306 Bacteria 6976
378 Ga0163162_10158083 3300013306 Bacteria 2387
379 Ga0163162_10198371 3300013306 Bacteria 2136
380 Ga0163162_10216044 3300013306 Bacteria 2048
381 Ga0163162_10235290 3300013306 Bacteria 1962
382 Ga0157372_10000238 3300013307 Bacteria 60988
383 Ga0157372_10006195 3300013307 Bacteria 12716
384 Ga0157372_10012017 3300013307 Bacteria 9219
385 Ga0157372_10052990 3300013307 Bacteria 4520
386 Ga0157372_10112855 3300013307 Bacteria 3114
387 Ga0157372_10116638 3300013307 Bacteria 3062
388 Ga0157372_10150825 3300013307 Bacteria 2683
389 Ga0157372_10210026 3300013307 Bacteria 2256
390 Ga0157372_10237648 3300013307 Bacteria 2114
391 Ga0157372_10288161 3300013307 Bacteria 1909
392 Ga0157372_10472485 3300013307 Bacteria 1462
393 Ga0157375_10000614 3300013308 Bacteria 31619
394 Ga0157375_10002275 3300013308 Bacteria 16614
395 Ga0157375_10005435 3300013308 Bacteria 11076
396 Ga0157375_10076250 3300013308 Bacteria 3379
397 Ga0157375_10226897 3300013308 Bacteria 2026
398 Ga0163163_10000088 3300014325 Bacteria 101126
399 Ga0163163_10000352 3300014325 Bacteria 44290
400 Ga0163163_10001835 3300014325 Bacteria 17927
401 Ga0163163_10005167 3300014325 Bacteria 11258
402 Ga0163163_10071074 3300014325 Bacteria 3467
403 Ga0157380_10007323 3300014326 Bacteria 7834
404 Ga0157380_10059143 3300014326 Bacteria 3057
405 Ga0182008_10000003 3300014497 Bacteria 456880
406 Ga0157377_10000354 3300014745 Bacteria 20420
407 Ga0157377_10002113 3300014745 Bacteria 8736
408 Ga0157379_10025131 3300014968 Bacteria 5288
409 Ga0157379_10136218 3300014968 Bacteria 2212
410 Ga0157379_10225420 3300014968 Bacteria 1699
411 Ga0157376_10004780 3300014969 Bacteria 9427
412 Ga0157376_10011668 3300014969 Bacteria 6487
413 Ga0157376_10016249 3300014969 Bacteria 5644
414 Ga0157376_10024787 3300014969 Bacteria 4716
415 Ga0157376_10066517 3300014969 Bacteria 3046
416 Ga0157376_10115554 3300014969 Bacteria 2369
417 Ga0157376_10224255 3300014969 Bacteria 1742
418 Ga0182006_1000079 3300015261 Bacteria 122553
419 Ga0182006_1005760 3300015261 Bacteria 5847
420 Ga0182005_1000116 3300015265 Bacteria 57638
421 Ga0163161_10000620 3300017792 Bacteria 28471
422 Ga0163161_10000869 3300017792 Bacteria 23538
423 Ga0163161_10000968 3300017792 Bacteria 21949
424 Ga0163161_10045614 3300017792 Bacteria 3161
425 Ga0163161_10092342 3300017792 Bacteria 2241
426 Ga0163161_10149168 3300017792 Bacteria 1776
427 Ga0213876_10004817 3300021384 Bacteria 7489
428 Ga0209436_104595 3300025208 Bacteria 3379
429 Ga0209258_100075 3300025242 Bacteria 270751
430 Ga0209646_1000005 3300025246 Bacteria 717627
431 Ga0209646_1001140 3300025246 Bacteria 7798
432 Ga0209026_1000149 3300025250 Bacteria 111200
433 Ga0209148_1000085 3300025254 Bacteria 265193
434 Ga0209233_1001271 3300025261 Bacteria 10114
435 Ga0209233_1011529 3300025261 Bacteria 2601
436 Ga0209673_1000242 3300025273 Bacteria 104669
437 Ga0209130_1005269 3300025284 Bacteria 4550
438 Ga0209675_1000159 3300025291 Bacteria 87316
439 Ga0209758_1000795 3300025297 Bacteria 44872
440 Ga0209050_1000298 3300025298 Bacteria 104315
441 Ga0207426_1000057 3300025302 Bacteria 369548
442 Ga0207426_1000059 3300025302 Bacteria 363842
443 Ga0207426_1000262 3300025302 Bacteria 111889
444 Ga0207426_1004443 3300025302 Bacteria 6840
445 Ga0209051_1033315 3300025303 Bacteria 1950
446 Ga0209257_1000004 3300025304 Bacteria 1678347
447 Ga0209257_1002372 3300025304 Bacteria 18883
448 Ga0207655_1000058 3300025728 Bacteria 267656
449 Ga0207682_10031373 3300025893 Bacteria 2132
450 Ga0207710_10001252 3300025900 Bacteria 12863
451 Ga0207710_10008013 3300025900 Bacteria 4466
452 Ga0207680_10000586 3300025903 Bacteria 17176
453 Ga0207680_10017371 3300025903 Bacteria 3800
454 Ga0207647_10000061 3300025904 Bacteria 83985
455 Ga0207647_10000071 3300025904 Bacteria 79170
456 Ga0207647_10026087 3300025904 Bacteria 3826
457 Ga0207647_10035144 3300025904 Bacteria 3195
458 Ga0207647_10041369 3300025904 Bacteria 2898
459 Ga0207645_10000229 3300025907 Bacteria 46502
460 Ga0207645_10000847 3300025907 Bacteria 25517
461 Ga0207645_10002256 3300025907 Bacteria 15330
462 Ga0207645_10021982 3300025907 Bacteria 4155
463 Ga0207643_10060920 3300025908 Bacteria 2155
464 Ga0207643_10065139 3300025908 Bacteria 2087
465 Ga0207705_10008664 3300025909 Bacteria 7412
466 Ga0207705_10009177 3300025909 Bacteria 7204
467 Ga0207705_10122670 3300025909 Bacteria 1929
468 Ga0207654_10000850 3300025911 Bacteria 16860
469 Ga0207707_10000879 3300025912 Bacteria 29399
470 Ga0207707_10251356 3300025912 Bacteria 1536
471 Ga0207695_10000078 3300025913 Bacteria 297378
472 Ga0207695_10000135 3300025913 Bacteria 217822
473 Ga0207695_10000702 3300025913 Bacteria 65628
474 Ga0207695_10000894 3300025913 Bacteria 54057
475 Ga0207695_10002580 3300025913 Bacteria 26577
476 Ga0207695_10016392 3300025913 Bacteria 8669
477 Ga0207695_10022744 3300025913 Bacteria 7103
478 Ga0207695_10030088 3300025913 Bacteria 5984
479 Ga0207695_10069174 3300025913 Bacteria 3614
480 Ga0207695_10082557 3300025913 Bacteria 3248
481 Ga0207695_10133955 3300025913 Bacteria 2433
482 Ga0207695_10272784 3300025913 Bacteria 1587
483 Ga0207671_10000067 3300025914 Bacteria 162184
484 Ga0207671_10000721 3300025914 Bacteria 42150
485 Ga0207671_10026732 3300025914 Bacteria 4320
486 Ga0207671_10105705 3300025914 Bacteria 2136
487 Ga0207660_10005360 3300025917 Bacteria 8328
488 Ga0207662_10040436 3300025918 Bacteria 2741
489 Ga0207662_10067219 3300025918 Bacteria 2161
490 Ga0207657_10001900 3300025919 Bacteria 22572
491 Ga0207657_10004379 3300025919 Bacteria 14946
492 Ga0207657_10016216 3300025919 Bacteria 7191
493 Ga0207657_10026674 3300025919 Bacteria 5303
494 Ga0207649_10005271 3300025920 Bacteria 6994
495 Ga0207649_10044523 3300025920 Bacteria 2717
496 Ga0207649_10122395 3300025920 Bacteria 1756
497 Ga0207652_10000181 3300025921 Bacteria 66711
498 Ga0207652_10000397 3300025921 Bacteria 45365
499 Ga0207652_10002067 3300025921 Bacteria 17274
500 Ga0207652_10002811 3300025921 Bacteria 14612
501 Ga0207652_10186653 3300025921 Bacteria 1864
502 Ga0207681_10013609 3300025923 Bacteria 5037
503 Ga0207681_10030055 3300025923 Bacteria 3538
504 Ga0207694_10068792 3300025924 Bacteria 2765
505 Ga0207694_10206540 3300025924 Bacteria 1599
506 Ga0207650_10009308 3300025925 Bacteria 6714
507 Ga0207650_10052389 3300025925 Bacteria 3023
508 Ga0207650_10082949 3300025925 Bacteria 2434
509 Ga0207650_10121697 3300025925 Bacteria 2033
510 Ga0207650_10142590 3300025925 Bacteria 1885
511 Ga0207650_10244773 3300025925 Bacteria 1450
512 Ga0207659_10010641 3300025926 Bacteria 5784
513 Ga0207659_10025932 3300025926 Bacteria 3948
514 Ga0207659_10058056 3300025926 Bacteria 2777
515 Ga0207659_10106238 3300025926 Bacteria 2125
516 Ga0207644_10050893 3300025931 Bacteria 2971
517 Ga0207644_10065862 3300025931 Bacteria 2636
518 Ga0207644_10101979 3300025931 Bacteria 2157
519 Ga0207644_10127237 3300025931 Bacteria 1946
520 Ga0207690_10001688 3300025932 Bacteria 13606
521 Ga0207690_10004290 3300025932 Bacteria 8416
522 Ga0207690_10044953 3300025932 Bacteria 2914
523 Ga0207690_10071439 3300025932 Bacteria 2394
524 Ga0207690_10084322 3300025932 Bacteria 2227
525 Ga0207706_10006199 3300025933 Bacteria 11111
526 Ga0207706_10010295 3300025933 Bacteria 8551
527 Ga0207706_10011398 3300025933 Bacteria 8099
528 Ga0207706_10072073 3300025933 Bacteria 3039
529 Ga0207706_10089603 3300025933 Bacteria 2704
530 Ga0207706_10147152 3300025933 Bacteria 2072
531 Ga0207686_10004707 3300025934 Bacteria 7317
532 Ga0207686_10045182 3300025934 Bacteria 2709
533 Ga0207709_10000008 3300025935 Bacteria 713099
534 Ga0207709_10000136 3300025935 Bacteria 106728
535 Ga0207670_10082900 3300025936 Bacteria 2248
536 Ga0207669_10093408 3300025937 Bacteria 1966
537 Ga0207669_10095388 3300025937 Bacteria 1950
538 Ga0207691_10010199 3300025940 Bacteria 9012
539 Ga0207691_10014922 3300025940 Bacteria 7402
540 Ga0207691_10018630 3300025940 Bacteria 6577
541 Ga0207691_10184076 3300025940 Bacteria 1824
542 Ga0207689_10010987 3300025942 Bacteria 7784
543 Ga0207689_10023114 3300025942 Bacteria 5221
544 Ga0207689_10025266 3300025942 Bacteria 4977
545 Ga0207689_10035495 3300025942 Bacteria 4142
546 Ga0207689_10043144 3300025942 Bacteria 3728
547 Ga0207689_10109636 3300025942 Bacteria 2268
548 Ga0207661_10007444 3300025944 Bacteria 7791
549 Ga0207661_10018216 3300025944 Bacteria 5215
550 Ga0207661_10024898 3300025944 Bacteria 4543
551 Ga0207679_10001674 3300025945 Bacteria 13809
552 Ga0207679_10005671 3300025945 Bacteria 7828
553 Ga0207679_10011911 3300025945 Bacteria 5651
554 Ga0207679_10162210 3300025945 Bacteria 1831
555 Ga0207667_10000312 3300025949 Bacteria 67340
556 Ga0207667_10016081 3300025949 Bacteria 8470
557 Ga0207667_10019147 3300025949 Bacteria 7655
558 Ga0207667_10027229 3300025949 Bacteria 6228
559 Ga0207667_10028216 3300025949 Bacteria 6098
560 Ga0207667_10052423 3300025949 Bacteria 4296
561 Ga0207667_10211469 3300025949 Bacteria 1988
562 Ga0207651_10010529 3300025960 Bacteria 5130
563 Ga0207651_10115991 3300025960 Bacteria 2021
564 Ga0207712_10010819 3300025961 Bacteria 5805
565 Ga0207712_10016873 3300025961 Bacteria 4734
566 Ga0207712_10024280 3300025961 Bacteria 4012
567 Ga0207712_10068240 3300025961 Bacteria 2547
568 Ga0207712_10090344 3300025961 Bacteria 2253
569 Ga0207668_10000671 3300025972 Bacteria 21040
570 Ga0207640_10075141 3300025981 Bacteria 2289
571 Ga0207658_10004178 3300025986 Bacteria 10062
572 Ga0207658_10012058 3300025986 Bacteria 5896
573 Ga0207658_10078762 3300025986 Bacteria 2519
574 Ga0207658_10208019 3300025986 Bacteria 1638
575 Ga0207677_10001780 3300026023 Bacteria 11373
576 Ga0207677_10006265 3300026023 Bacteria 6508
577 Ga0207677_10009458 3300026023 Bacteria 5485
578 Ga0207677_10057408 3300026023 Bacteria 2673
579 Ga0207677_10108806 3300026023 Bacteria 2059
580 Ga0207703_10002553 3300026035 Bacteria 15723
581 Ga0207703_10019532 3300026035 Bacteria 5295
582 Ga0207639_10009275 3300026041 Bacteria 6786
583 Ga0207639_10026751 3300026041 Bacteria 4194
584 Ga0207639_10074097 3300026041 Bacteria 2672
585 Ga0207639_10246351 3300026041 Bacteria 1556
586 Ga0207702_10045324 3300026078 Bacteria 3699
587 Ga0207702_10126034 3300026078 Bacteria 2299
588 Ga0207641_10000448 3300026088 Bacteria 47082
589 Ga0207641_10001077 3300026088 Bacteria 27465
590 Ga0207641_10005547 3300026088 Bacteria 10755
591 Ga0207641_10012106 3300026088 Bacteria 7076
592 Ga0207641_10018916 3300026088 Bacteria 5650
593 Ga0207641_10042014 3300026088 Bacteria 3834
594 Ga0207648_10003051 3300026089 Bacteria 17707
595 Ga0207648_10005010 3300026089 Bacteria 13450
596 Ga0207648_10007503 3300026089 Bacteria 10713
597 Ga0207648_10007532 3300026089 Bacteria 10685
598 Ga0207648_10015948 3300026089 Bacteria 6885
599 Ga0207648_10057688 3300026089 Bacteria 3388
600 Ga0207648_10064155 3300026089 Bacteria 3201
601 Ga0207648_10075557 3300026089 Bacteria 2937
602 Ga0207676_10012325 3300026095 Bacteria 6122
603 Ga0207676_10047330 3300026095 Bacteria 3332
604 Ga0207674_10000894 3300026116 Bacteria 38957
605 Ga0207674_10013334 3300026116 Bacteria 9127
606 Ga0207674_10022378 3300026116 Bacteria 6788
607 Ga0207674_10062038 3300026116 Bacteria 3776
608 Ga0207674_10067960 3300026116 Bacteria 3587
609 Ga0207674_10137689 3300026116 Bacteria 2402
610 Ga0207674_10142389 3300026116 Bacteria 2357
611 Ga0207675_100002842 3300026118 Bacteria 17034
612 Ga0207675_100006844 3300026118 Bacteria 10795
613 Ga0207675_100018407 3300026118 Bacteria 6513
614 Ga0207675_100119273 3300026118 Bacteria 2495
615 Ga0207683_10002182 3300026121 Bacteria 17194
616 Ga0207683_10023462 3300026121 Bacteria 5308
617 Ga0207683_10026793 3300026121 Bacteria 4979
618 Ga0207683_10028008 3300026121 Bacteria 4870
619 Ga0207683_10056112 3300026121 Bacteria 3455
620 Ga0207698_10002660 3300026142 Bacteria 10625
621 Ga0207698_10008350 3300026142 Bacteria 6543
622 Ga0207698_10040670 3300026142 Bacteria 3458
623 Ga0207698_10061636 3300026142 Bacteria 2924
624 Ga0207698_10135625 3300026142 Bacteria 2111
625 Ga0268266_10000057 3300028379 Bacteria 284777
626 Ga0268266_10007008 3300028379 Bacteria 10236
627 Ga0268266_10040113 3300028379 Bacteria 3990
628 Ga0268265_10079511 3300028380 Bacteria 2582
629 Ga0268265_10282075 3300028380 Bacteria 1487
630 Ga0268264_10000143 3300028381 Bacteria 170031
631 Ga0268264_10002805 3300028381 Bacteria 15217
632 Ga0268264_10007161 3300028381 Bacteria 9346
633 Ga0268264_10046627 3300028381 Bacteria 3600
634 Ga0268264_10047127 3300028381 Bacteria 3582
635 Ga0268264_10118696 3300028381 Bacteria 2328
636 Ga0307517_10014190 3300028786 Bacteria 10733
637 Ga0307515_10000455 3300028794 Bacteria 97670
638 Ga0307511_10000439 3300030521 Bacteria 44490
639 Ga0316176_1026201 3300030732 Bacteria 12822
640 Ga0316183_1106482 3300030742 Bacteria 31361
641 Ga0316181_1039179 3300030744 Bacteria 5421
642 Ga0265320_10045317 3300031240 Bacteria 2162
643 Ga0265327_10000006 3300031251 Bacteria 693716
644 Ga0265327_10000073 3300031251 Bacteria 214772
645 Ga0265327_10000256 3300031251 Bacteria 105748
646 Ga0265327_10000421 3300031251 Bacteria 77515
647 Ga0265327_10002290 3300031251 Bacteria 20531
648 Ga0265327_10006644 3300031251 Bacteria 9186
649 Ga0307509_10056935 3300031507 Bacteria 4147
650 Ga0307508_10002437 3300031616 Bacteria 19616
651 Ga0307516_10000310 3300031730 Bacteria 63335
652 Ga0307516_10090626 3300031730 Bacteria 2886
653 Ga0307412_10000140 3300031911 Bacteria 52924
654 Ga0307412_10000292 3300031911 Bacteria 31826
655 Ga0307416_100000020 3300032002 Bacteria 192862
656 Ga0307414_10000049 3300032004 Bacteria 130090
657 Ga0307414_10011763 3300032004 Bacteria 5148
658 Ga0307414_10060464 3300032004 Bacteria 2679
659 Ga0307415_100007390 3300032126 Bacteria 6008
660 Ga0307415_100165537 3300032126 Bacteria 1719
661 Ga0373937_0109307 3300036401 Bacteria 2571
662 Ga0395899_0000064 3300037312 Bacteria 207082
663 Ga0395899_0000811 3300037312 Bacteria 30415
664 Ga0395899_0000959 3300037312 Bacteria 26821
665 Ga0395899_0002874 3300037312 Bacteria 13842
666 Ga0395899_0043474 3300037312 Bacteria 3351
667 Ga0395899_0101062 3300037312 Bacteria 2081
668 Ga0395899_0175619 3300037312 Bacteria 1506
669 Ga0395900_0000275 3300037418 Bacteria 78207
670 Ga0395900_0001963 3300037418 Bacteria 23228
671 Ga0395900_0012661 3300037418 Bacteria 8623
672 Ga0395900_0012681 3300037418 Bacteria 8618
673 Ga0395900_0068341 3300037418 Bacteria 3651
674 Ga0395900_0147364 3300037418 Bacteria 2406
675 Ga0395900_0150338 3300037418 Bacteria 2379
676 Ga0395900_0161590 3300037418 Bacteria 2284
677 Ga0395900_0276443 3300037418 Bacteria 1673
678 Ga0395898_0003579 3300037466 Bacteria 17316
679 Ga0395898_0005476 3300037466 Bacteria 13714
680 Ga0395898_0009566 3300037466 Bacteria 10183
681 Ga0395898_0049897 3300037466 Bacteria 4098
682 Ga0395898_0098621 3300037466 Bacteria 2805
683 Ga0395905_0000051 3300037471 Bacteria 223416
684 Ga0395905_0000248 3300037471 Bacteria 81042
685 Ga0395905_0026233 3300037471 Bacteria 5494
686 Ga0395905_0028897 3300037471 Bacteria 5226
687 Ga0395905_0067152 3300037471 Bacteria 3359
688 Ga0395901_0000595 3300038443 Bacteria 42132
689 Ga0395901_0005557 3300038443 Bacteria 12756
690 Ga0395901_0010392 3300038443 Bacteria 9428
691 Ga0395901_0050730 3300038443 Bacteria 4310
692 Ga0395901_0068548 3300038443 Bacteria 3695
693 Ga0436365_0557230 3300039437 Bacteria 3487
694 Ga0436365_1740763 3300039437 Bacteria 18760
695 Ga0436365_1888183 3300039437 Bacteria 4960
696 Ga0439465_0000035 3300041413 Bacteria 27339
697 Ga0439465_0016026 3300041413 Bacteria 2337
698 Ga0451853_2153551 3300041512 Bacteria 2068
699 Ga0439431_0000062 3300041997 Bacteria 16970
700 Ga0439442_006659 3300042002 Bacteria 2321
701 Ga0439445_0000094 3300042004 Bacteria 14134
702 Ga0439448_0002912 3300042005 Bacteria 4690
703 Ga0439457_002934 3300042014 Bacteria 4742
704 Ga0451577_0000015 3300042876 Bacteria 538333
705 Ga0451577_0006314 3300042876 Bacteria 11859
706 Ga0451577_0026339 3300042876 Bacteria 5268
707 Ga0451577_0043978 3300042876 Bacteria 3998
708 Ga0466969_0000847 3300044656 Bacteria 16571
709 Ga0466969_0029848 3300044656 Bacteria 2782
710 Ga0466972_0000010 3300044658 Bacteria 256339
711 Ga0466972_0000143 3300044658 Bacteria 58694
712 Ga0466972_0001431 3300044658 Bacteria 11583
713 Ga0466972_0034173 3300044658 Bacteria 2493
714 Ga0453683_0000509 3300044673 Bacteria 43999
715 Ga0453683_0028064 3300044673 Bacteria 3565
716 Ga0466966_0000176 3300044684 Bacteria 42093
717 Ga0466961_0037351 3300044693 Bacteria 3116
718 Ga0453684_0000081 3300044712 Bacteria 402985
719 Ga0453684_0063668 3300044712 Bacteria 4715
720 Ga0466971_0033117 3300044719 Bacteria 2316
721 Ga0466968_0070229 3300044735 Bacteria 1523
722 Ga0466970_0000471 3300044765 Bacteria 19964
723 Ga0466957_0000372 3300044842 Bacteria 21993
724 Ga0466959_0000016 3300045049 Bacteria 144600
725 Ga0466959_0044930 3300045049 Bacteria 3254
726 Ga0466959_0148750 3300045049 Bacteria 1652
727 Ga0451576_0000294 3300045051 Bacteria 122276
728 Ga0451576_0008161 3300045051 Bacteria 12328
729 Ga0451576_0025171 3300045051 Bacteria 6415
730 Ga0451576_0073880 3300045051 Bacteria 3548
731 Ga0495627_000029 3300046453 Bacteria 232349
732 Ga0495592_0075150 3300046454 Bacteria 2454
733 Ga0495592_0159165 3300046454 Bacteria 1555
734 Ga0495590_0003056 3300046457 Bacteria 6857
735 Ga0495638_0019391 3300046460 Bacteria 4501
736 Ga0495638_0044598 3300046460 Bacteria 2793
737 Ga0495580_0105669 3300046472 Bacteria 1956
738 Ga0495596_0000410 3300046500 Bacteria 27433
739 Ga0495606_0037730 3300046507 Bacteria 3278
740 Ga0495610_0000001 3300046512 Bacteria 1620061
741 Ga0495628_0018695 3300046516 Bacteria 5735
742 Ga0495630_0009753 3300046517 Bacteria 6909
743 Ga0495632_0006333 3300046519 Bacteria 7635
744 Ga0495643_0025161 3300046522 Bacteria 3371
745 Ga0495648_0003590 3300046524 Bacteria 13568
746 Ga0495663_0000021 3300046525 Bacteria 114041
747 Ga0495663_0001260 3300046525 Bacteria 8045
748 Ga0495652_0114033 3300046529 Bacteria 2169
749 Ga0495652_0130545 3300046529 Bacteria 1990
750 Ga0495654_0000008 3300046530 Bacteria 398340
751 Ga0495609_0000010 3300046538 Bacteria 342605
752 Ga0495645_0144519 3300046543 Bacteria 1657
753 Ga0495633_0000022 3300046558 Bacteria 226582
754 Ga0495633_0000048 3300046558 Bacteria 158166
755 Ga0495633_0009165 3300046558 Bacteria 5494
756 Ga0495668_0000321 3300046616 Bacteria 65700
757 Ga0495668_0000450 3300046616 Bacteria 52543
758 Ga0495668_0007476 3300046616 Bacteria 6979
759 Ga0495634_0071154 3300046642 Bacteria 2291
760 Ga0495634_0080033 3300046642 Bacteria 2139
761 Ga0495611_0000081 3300046648 Bacteria 67738
762 Ga0495625_0000658 3300046660 Bacteria 49342
763 Ga0495625_0042194 3300046660 Bacteria 3317
764 Ga0495635_0026484 3300046663 Bacteria 4034
765 Ga0495599_0032634 3300046678 Bacteria 3269
766 Ga0495658_0011871 3300046683 Bacteria 4394
767 Ga0495674_0007992 3300047319 Bacteria 10097
768 Ga0495672_0016760 3300047320 Bacteria 4919
769 Ga0495672_0018029 3300047320 Bacteria 4702
770 Ga0495672_0053737 3300047320 Bacteria 2358
771 Ga0495687_000111 3300047443 Bacteria 124789
772 Ga0495684_0089071 3300047471 Bacteria 2338
773 Ga0495686_0000153 3300047472 Bacteria 133256
774 Ga0495686_0000814 3300047472 Bacteria 40340
775 Ga0495686_0001267 3300047472 Bacteria 28612
776 Ga0495686_0004393 3300047472 Bacteria 11617
777 Ga0495686_0017600 3300047472 Bacteria 4809
778 Ga0496102_0014102 3300048905 Bacteria 6944
779 Ga0496103_0016341 3300048906 Bacteria 4429
780 Ga0496104_0096952 3300048907 Bacteria 2822
781 Ga0496104_0241239 3300048907 Bacteria 1720
782 Ga0496110_0087547 3300048913 Bacteria 2782
783 Ga0496110_0097470 3300048913 Bacteria 2635
784 Ga0496113_0069442 3300048916 Bacteria 2676
785 Ga0496114_0001046 3300048917 Bacteria 20795
786 Ga0496115_0020666 3300048918 Bacteria 5079
787 Ga0496116_0000037 3300048919 Bacteria 374675
788 Ga0496117_0000086 3300048920 Bacteria 212331
789 Ga0496118_0000284 3300048921 Bacteria 88966
790 Ga0496119_0000037 3300048922 Bacteria 210912
791 Ga0496121_0000010 3300048924 Bacteria 793488
792 Ga0496122_0000510 3300048925 Bacteria 80239
793 Ga0496122_0000602 3300048925 Bacteria 73995
794 Ga0496122_0003432 3300048925 Bacteria 20849
795 Ga0496122_0003771 3300048925 Bacteria 19539
796 Ga0496122_0057511 3300048925 Bacteria 2887
797 Ga0496123_0013079 3300048926 Bacteria 7003
798 Ga0496123_0014595 3300048926 Bacteria 6497
799 Ga0496123_0019833 3300048926 Bacteria 5279
800 Ga0496124_0000555 3300048927 Bacteria 63173
801 Ga0496125_0012093 3300048928 Bacteria 8587
802 Ga0496125_0023772 3300048928 Bacteria 5650
803 Ga0496126_0008259 3300048929 Bacteria 11243
804 Ga0496126_0014044 3300048929 Bacteria 8116
805 Ga0496126_0097741 3300048929 Bacteria 2573
806 Ga0501031_0090921 3300049568 Bacteria 1990
807 Ga0501032_0039116 3300049569 Bacteria 3227
808 Ga0501033_0053360 3300049570 Bacteria 2994
809 Ga0501034_0002046 3300049571 Bacteria 25324
810 Ga0501034_0005253 3300049571 Bacteria 14211
811 Ga0501034_0013642 3300049571 Bacteria 8357
812 Ga0501034_0037459 3300049571 Bacteria 4911
813 Ga0501034_0083677 3300049571 Bacteria 3192
814 Ga0501036_0016492 3300049572 Bacteria 6170
815 Ga0501036_0049405 3300049572 Bacteria 3562
816 Ga0501037_0004853 3300049573 Bacteria 9785
817 Ga0501037_0029791 3300049573 Bacteria 4033
818 Ga0501038_0001508 3300049574 Bacteria 21425
819 Ga0501039_0046550 3300049575 Bacteria 3351
820 Ga0501039_0110242 3300049575 Bacteria 2151
821 Ga0501043_0021821 3300049579 Bacteria 5021
822 Ga0501043_0037281 3300049579 Bacteria 3824
823 Ga0501043_0051583 3300049579 Bacteria 3232
824 Ga0501043_0117212 3300049579 Bacteria 2089
825 Ga0501046_0033569 3300049580 Bacteria 4144
826 Ga0501046_0066426 3300049580 Bacteria 2811
827 Ga0501047_0007339 3300049581 Bacteria 10367
828 Ga0501047_0043636 3300049581 Bacteria 4331
829 Ga0501047_0061998 3300049581 Bacteria 3608
830 Ga0501048_0123886 3300049582 Bacteria 1827
831 Ga0501068_0030821 3300049584 Bacteria 3184
832 Ga0501069_0015946 3300049585 Bacteria 4029
833 Ga0501070_0014791 3300049586 Bacteria 6566
834 Ga0501074_0002906 3300049590 Bacteria 12018
835 Ga0501074_0016810 3300049590 Bacteria 5309
836 Ga0501202_005262 3300049652 Bacteria 2291
837 Ga0501217_000087 3300049661 Bacteria 11212
838 Ga0501222_000205 3300049662 Bacteria 10436
839 Ga0501223_000153 3300049663 Bacteria 18205
840 Ga0501223_001264 3300049663 Bacteria 5887
841 Ga0501235_000089 3300049669 Bacteria 14364
842 Ga0501240_000041 3300049673 Bacteria 8075
843 Ga0501250_002354 3300049680 Bacteria 1705
844 Ga0501251_003300 3300049681 Bacteria 1605
845 Ga0501253_000098 3300049683 Bacteria 6183
846 Ga0501259_000111 3300049688 Bacteria 11954
847 Ga0501259_000789 3300049688 Bacteria 5179
848 Ga0501261_000274 3300049690 Bacteria 7107
849 Ga0501219_000023 3300049703 Bacteria 24183
850 Ga0501221_000942 3300049704 Bacteria 4771
851 Ga0501225_0000583 3300049705 Bacteria 11406
852 Ga0501225_0007025 3300049705 Bacteria 3276
853 Ga0501234_003714 3300049707 Bacteria 2400
854 Ga0501080_0046393 3300049742 Bacteria 4045
855 Ga0501080_0179844 3300049742 Bacteria 1947
856 Ga0501241_000009 3300049758 Bacteria 128695
857 Ga0501266_001126 3300049763 Bacteria 3436
858 Ga0501269_000025 3300049766 Bacteria 51990
859 Ga0501280_003927 3300049776 Bacteria 2229
860 Ga0501035_0015729 3300049822 Bacteria 6983
861 Ga0501035_0052200 3300049822 Bacteria 3659
862 Ga0501044_0001663 3300049823 Bacteria 26095
863 Ga0501044_0012930 3300049823 Bacteria 9035
864 Ga0501044_0019648 3300049823 Bacteria 7221
865 Ga0501044_0023918 3300049823 Bacteria 6493
866 Ga0501044_0054411 3300049823 Bacteria 4114
867 Ga0501044_0064559 3300049823 Bacteria 3737
868 Ga0501044_0264979 3300049823 Bacteria 1656
869 Ga0501284_00005 3300050005 Bacteria 164758
870 nmdc:mga05p37_177095_c1 3300050507 Bacteria 2597
871 nmdc:mga05p37_3495_c1 3300050507 Bacteria 6617
872 nmdc:mga09592_8712_c2 3300050508 Bacteria 4067
873 nmdc:mga0qj67_50085_c1 3300050509 Bacteria 3302
874 nmdc:mga06r32_205023_c1 3300050510 Bacteria 1960
875 nmdc:mga08y16_104496_c1 3300050511 Bacteria 2948
876 Ga0495619_0097480 3300053085 Bacteria 1998
877 Ga0500578_0000296 3300053086 Bacteria 61614
878 Ga0500644_0000078 3300053088 Bacteria 59447
879 Ga0500583_0000037 3300053092 Bacteria 92466
880 Ga0500583_0015568 3300053092 Bacteria 3012
881 Ga0500562_000032 3300053108 Bacteria 89989
882 Ga0500607_090211 3300053121 Bacteria 1544
883 Ga0500658_0002864 3300053134 Bacteria 6618
884 Ga0500559_0033293 3300053136 Bacteria 2218
885 Ga0500568_0000863 3300053139 Bacteria 21288
886 Ga0500577_0018098 3300053142 Bacteria 2258
887 Ga0500590_077471 3300053148 Bacteria 1640
888 Ga0500616_0021358 3300053153 Bacteria 3632
889 Ga0500622_0000445 3300053156 Bacteria 39381
890 Ga0500622_0000497 3300053156 Bacteria 36689
891 Ga0500622_0000568 3300053156 Bacteria 33817
892 Ga0500633_0001791 3300053160 Bacteria 4204
893 Ga0500639_083027 3300053163 Bacteria 1611
894 Ga0500611_000010 3300053727 Bacteria 165151
895 Ga0501082_0001933 3300060353 Bacteria 18233

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0179844 Ga0501080_0179844_27_1199 390
2 3300053121 Ga0500607_090211 Ga0500607_090211_344_1522 390
3 3300049569 Ga0501032_0039116 Ga0501032_0039116_47_1294 415
4 3300046472 Ga0495580_0105669 Ga0495580_0105669_645_1895 416
5 3300046529 Ga0495652_0130545 Ga0495652_0130545_709_1959 416
6 3300053085 Ga0495619_0097480 Ga0495619_0097480_716_1966 416
7 3300013102 Ga0157371_10000012 Ga0157371_1000001262 422
8 3300031251 Ga0265327_10006644 Ga0265327_100066448 422
9 3300013297 Ga0157378_10216788 Ga0157378_102167882 423
10 3300037312 Ga0395899_0000064 Ga0395899_0000064_58750_60090 428
11 3300037418 Ga0395900_0012681 Ga0395900_0012681_1302_2642 428
12 3300037312 Ga0395899_0000811 Ga0395899_0000811_13775_15136 429
13 3300037418 Ga0395900_0000275 Ga0395900_0000275_34137_35498 429
14 3300037466 Ga0395898_0009566 Ga0395898_0009566_424_1785 429
15 3300037471 Ga0395905_0000248 Ga0395905_0000248_14411_15772 429
16 3300038443 Ga0395901_0000595 Ga0395901_0000595_13702_15063 429
17 3300001990 JGI24737J22298_10007402 JGI24737J22298_100074023 432
18 3300013100 Ga0157373_10000678 Ga0157373_1000067827 432
19 3300013102 Ga0157371_10000107 Ga0157371_1000010734 432
20 3300013307 Ga0157372_10000238 Ga0157372_1000023822 432
21 3300038443 Ga0395901_0050730 Ga0395901_0050730_1719_3092 432
22 3300005366 Ga0070659_100001588 Ga0070659_10000158822 433
23 3300005577 Ga0068857_100032063 Ga0068857_1000320633 433
24 3300025261 Ga0209233_1001271 Ga0209233_100127110 433
25 3300025904 Ga0207647_10000071 Ga0207647_1000007148 433
26 3300025932 Ga0207690_10001688 Ga0207690_1000168810 433
27 3300026116 Ga0207674_10067960 Ga0207674_100679604 433
28 3300042876 Ga0451577_0000015 Ga0451577_0000015_514205_515509 433
29 3300044712 Ga0453684_0000081 Ga0453684_0000081_331699_333003 433
30 3300045051 Ga0451576_0000294 Ga0451576_0000294_71979_73283 433
31 3300005614 Ga0068856_100074039 Ga0068856_1000740391 439
32 3300037471 Ga0395905_0000051 Ga0395905_0000051_167082_168419 441
33 3300005336 Ga0070680_100182096 Ga0070680_1001820961 442
34 3300005458 Ga0070681_10066593 Ga0070681_100665933 442
35 3300005530 Ga0070679_100056362 Ga0070679_1000563623 442
36 3300005563 Ga0068855_100248143 Ga0068855_1002481433 442
37 3300013102 Ga0157371_10000168 Ga0157371_1000016833 442
38 3300013102 Ga0157371_10012460 Ga0157371_100124602 442
39 3300013104 Ga0157370_10000817 Ga0157370_1000081728 442
40 3300037312 Ga0395899_0002874 Ga0395899_0002874_7373_8725 442
41 3300037312 Ga0395899_0101062 Ga0395899_0101062_584_1936 442
42 3300037312 Ga0395899_0175619 Ga0395899_0175619_94_1446 442
43 3300037418 Ga0395900_0001963 Ga0395900_0001963_16887_18239 442
44 3300037418 Ga0395900_0147364 Ga0395900_0147364_865_2217 442
45 3300037466 Ga0395898_0005476 Ga0395898_0005476_4990_6342 442
46 3300037466 Ga0395898_0098621 Ga0395898_0098621_317_1669 442
47 3300037471 Ga0395905_0028897 Ga0395905_0028897_3230_4582 442
48 3300038443 Ga0395901_0010392 Ga0395901_0010392_4670_6022 442
49 3300038443 Ga0395901_0068548 Ga0395901_0068548_1479_2831 442
50 iso_pu_bacteria 2839989709 2839991743 442
51 iso_pu_bacteria 2896317667 2896320617 442
52 3300031240 Ga0265320_10045317 Ga0265320_100453172 443
53 3300042876 Ga0451577_0006314 Ga0451577_0006314_9848_11182 443
54 3300042876 Ga0451577_0043978 Ga0451577_0043978_2373_3707 443
55 3300044673 Ga0453683_0000509 Ga0453683_0000509_10624_11958 443
56 3300044673 Ga0453683_0028064 Ga0453683_0028064_184_1518 443
57 3300045051 Ga0451576_0025171 Ga0451576_0025171_2048_3382 443
58 3300045051 Ga0451576_0073880 Ga0451576_0073880_2048_3382 443
59 3300046454 Ga0495592_0075150 Ga0495592_0075150_981_2321 443
60 iso_pu_bacteria 2890737413 2890738860 443
61 3300005327 Ga0070658_10021983 Ga0070658_100219834 444
62 3300005328 Ga0070676_10001094 Ga0070676_1000109410 444
63 3300005347 Ga0070668_100001636 Ga0070668_10000163616 444
64 3300005367 Ga0070667_100002121 Ga0070667_10000212115 444
65 3300005456 Ga0070678_100009316 Ga0070678_1000093167 444
66 3300005459 Ga0068867_100016216 Ga0068867_1000162164 444
67 3300005543 Ga0070672_100001082 Ga0070672_1000010829 444
68 3300005548 Ga0070665_100031963 Ga0070665_1000319632 444
69 3300005618 Ga0068864_100023214 Ga0068864_1000232142 444
70 3300005719 Ga0068861_100061833 Ga0068861_1000618333 444
71 3300005842 Ga0068858_100030456 Ga0068858_1000304562 444
72 3300006237 Ga0097621_100019146 Ga0097621_1000191462 444
73 3300025261 Ga0209233_1011529 Ga0209233_10115292 444
74 3300025933 Ga0207706_10089603 Ga0207706_100896032 444
75 3300025949 Ga0207667_10027229 Ga0207667_100272295 444
76 3300025972 Ga0207668_10000671 Ga0207668_1000067114 444
77 3300025986 Ga0207658_10004178 Ga0207658_100041787 444
78 3300026023 Ga0207677_10006265 Ga0207677_100062653 444
79 3300026089 Ga0207648_10015948 Ga0207648_100159488 444
80 3300028381 Ga0268264_10046627 Ga0268264_100466272 444
81 3300031251 Ga0265327_10002290 Ga0265327_1000229011 444
82 iso_pu_bacteria 2842903701 2842904796 444
83 iso_pu_bacteria 3003233435 3003235836 444
84 iso_pu_bacteria 8055588893 8055592071 444
85 3300006173 Ga0070716_100011309 Ga0070716_1000113093 445
86 3300025904 Ga0207647_10041369 Ga0207647_100413692 445
87 3300025913 Ga0207695_10133955 Ga0207695_101339552 445
88 3300026078 Ga0207702_10045324 Ga0207702_100453242 445
89 3300049663 Ga0501223_000153 Ga0501223_000153_7487_8830 445
90 iso_pu_bacteria 2523533629 2524005745 445
91 iso_pu_bacteria 2818991444 2819590369 445
92 iso_pu_bacteria 2881955468 2881956895 445
93 iso_pu_bacteria 2896344016 2896345418 445
94 iso_pu_bacteria 2898713307 2898714494 445
95 iso_pu_bacteria 2929154850 2929158426 445
96 3300031251 Ga0265327_10000073 Ga0265327_1000007346 446
97 3300031730 Ga0307516_10090626 Ga0307516_100906262 446
98 iso_pu_bacteria 2585428061 2587753621 446
99 iso_pu_bacteria 2585428187 2588230994 446
100 iso_pu_bacteria 2738541278 2738726106 446
101 iso_pu_bacteria 2775506739 2775674078 446
102 iso_pu_bacteria 2919097161 2919099966 446
103 iso_pu_bacteria 2984572630 2984574726 446
104 iso_pu_bacteria 2984606641 2984608177 446
105 iso_pu_bacteria 2993372514 2993374819 446
106 iso_pu_bacteria 2993480792 2993481675 446
107 3300003320 rootH2_10012714 rootH2_1001271442 447
108 3300003320 rootH2_10073988 rootH2_100739883 447
109 3300005328 Ga0070676_10000113 Ga0070676_1000011325 447
110 3300005459 Ga0068867_100003787 Ga0068867_10000378711 447
111 3300005616 Ga0068852_100020168 Ga0068852_1000201687 447
112 3300006237 Ga0097621_100000015 Ga0097621_10000001583 447
113 3300006358 Ga0068871_100000051 Ga0068871_10000005166 447
114 3300009545 Ga0105237_10001895 Ga0105237_1000189524 447
115 3300013296 Ga0157374_10001665 Ga0157374_100016659 447
116 3300017792 Ga0163161_10149168 Ga0163161_101491682 447
117 3300025907 Ga0207645_10000229 Ga0207645_1000022932 447
118 3300025924 Ga0207694_10068792 Ga0207694_100687921 447
119 3300025960 Ga0207651_10010529 Ga0207651_100105297 447
120 3300026041 Ga0207639_10009275 Ga0207639_100092755 447
121 3300026089 Ga0207648_10007503 Ga0207648_1000750311 447
122 3300026121 Ga0207683_10023462 Ga0207683_100234625 447
123 3300042005 Ga0439448_0002912 Ga0439448_0002912_1678_3039 447
124 3300046616 Ga0495668_0000450 Ga0495668_0000450_42404_43747 447
125 3300048918 Ga0496115_0020666 Ga0496115_0020666_2671_4014 447
126 3300049573 Ga0501037_0029791 Ga0501037_0029791_2385_3740 447
127 3300053153 Ga0500616_0021358 Ga0500616_0021358_760_2103 447
128 iso_pu_bacteria 2585428095 2587868476 447
129 iso_pu_bacteria 2818991460 2819677705 447
130 iso_pu_bacteria 2821136567 2821141824 447
131 iso_pu_bacteria 2883068021 2883070483 447
132 iso_pu_bacteria 2884791551 2884797647 447
133 iso_pu_bacteria 2896085136 2896087342 447
134 iso_pu_bacteria 2896109856 2896114669 447
135 iso_pu_bacteria 2904467357 2904469761 447
136 iso_pu_bacteria 2929177148 2929183303 447
137 iso_pu_bacteria 2929239360 2929245421 447
138 iso_pu_bacteria 2929921140 2929927688 447
139 iso_pu_bacteria 2945924605 2945928654 447
140 iso_pu_bacteria 2945977869 2945979263 447
141 iso_pu_bacteria 2946013367 2946014866 447
142 3300005366 Ga0070659_100096396 Ga0070659_1000963962 448
143 3300005367 Ga0070667_100168373 Ga0070667_1001683732 448
144 3300005843 Ga0068860_100038399 Ga0068860_1000383994 448
145 3300010375 Ga0105239_10043427 Ga0105239_100434275 448
146 3300013104 Ga0157370_10001336 Ga0157370_1000133629 448
147 3300013104 Ga0157370_10042422 Ga0157370_100424224 448
148 3300021384 Ga0213876_10004817 Ga0213876_100048173 448
149 3300025932 Ga0207690_10071439 Ga0207690_100714392 448
150 3300030732 Ga0316176_1026201 Ga0316176_10262018 448
151 3300030742 Ga0316183_1106482 Ga0316183_110648226 448
152 3300030744 Ga0316181_1039179 Ga0316181_10391792 448
153 3300031251 Ga0265327_10000256 Ga0265327_1000025616 448
154 3300032004 Ga0307414_10060464 Ga0307414_100604643 448
155 3300039437 Ga0436365_1740763 Ga0436365_1740763_5455_6801 448
156 3300044842 Ga0466957_0000372 Ga0466957_0000372_856_2220 448
157 3300045051 Ga0451576_0008161 Ga0451576_0008161_7190_8542 448
158 3300047472 Ga0495686_0000814 Ga0495686_0000814_9889_11235 448
159 iso_pu_bacteria 2511231000 2511233955 448
160 iso_pu_bacteria 2582581278 2585142433 448
161 iso_pu_bacteria 2582581281 2585156965 448
162 iso_pu_bacteria 2582581282 2585161484 448
163 iso_pu_bacteria 2582581873 2585426652 448
164 iso_pu_bacteria 2585428045 2587681188 448
165 iso_pu_bacteria 2585428060 2587748904 448
166 iso_pu_bacteria 2585428115 2587942510 448
167 iso_pu_bacteria 2585428182 2588211767 448
168 iso_pu_bacteria 2585428183 2588216570 448
169 iso_pu_bacteria 2585428184 2588220646 448
170 iso_pu_bacteria 2585428185 2588225935 448
171 iso_pu_bacteria 2588253712 2588447840 448
172 iso_pu_bacteria 2588254255 2590603600 448
173 iso_pu_bacteria 2588254257 2590610484 448
174 iso_pu_bacteria 2728369107 2729202478 448
175 iso_pu_bacteria 2738541273 2738699965 448
176 iso_pu_bacteria 2738543014 2739253714 448
177 iso_pu_bacteria 2751185877 2753674964 448
178 iso_pu_bacteria 2765235839 2765575977 448
179 iso_pu_bacteria 2772190705 2772607401 448
180 iso_pu_bacteria 2816332188 2816875679 448
181 iso_pu_bacteria 2842083920 2842087836 448
182 iso_pu_bacteria 2871720351 2871724769 448
183 iso_pu_bacteria 2889290771 2889293531 448
184 iso_pu_bacteria 2905999023 2906002080 448
185 iso_pu_bacteria 2919399522 2919403491 448
186 iso_pu_bacteria 2977243572 2977247490 448
187 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00002140 449
188 3300003203 JGI25406J46586_10003552 JGI25406J46586_100035523 449
189 3300003320 rootH2_10065769 rootH2_100657698 449
190 3300003323 rootH1_10101281 rootH1_101012812 449
191 3300005289 Ga0065704_10070133 Ga0065704_10070133275 449
192 3300005290 Ga0065712_10072974 Ga0065712_100729743 449
193 3300005328 Ga0070676_10005256 Ga0070676_100052566 449
194 3300005329 Ga0070683_100000553 Ga0070683_10000055314 449
195 3300005329 Ga0070683_100045229 Ga0070683_1000452293 449
196 3300005329 Ga0070683_100081489 Ga0070683_1000814892 449
197 3300005330 Ga0070690_100021267 Ga0070690_1000212673 449
198 3300005330 Ga0070690_100128920 Ga0070690_1001289201 449
199 3300005331 Ga0070670_100100003 Ga0070670_1001000031 449
200 3300005334 Ga0068869_100025796 Ga0068869_1000257964 449
201 3300005335 Ga0070666_10000019 Ga0070666_10000019165 449
202 3300005335 Ga0070666_10046115 Ga0070666_100461155 449
203 3300005337 Ga0070682_100021389 Ga0070682_1000213894 449
204 3300005338 Ga0068868_100023995 Ga0068868_1000239959 449
205 3300005338 Ga0068868_100179953 Ga0068868_1001799532 449
206 3300005339 Ga0070660_100133547 Ga0070660_1001335472 449
207 3300005340 Ga0070689_100130139 Ga0070689_1001301392 449
208 3300005343 Ga0070687_100062734 Ga0070687_1000627343 449
209 3300005344 Ga0070661_100000179 Ga0070661_10000017911 449
210 3300005344 Ga0070661_100077158 Ga0070661_1000771584 449
211 3300005354 Ga0070675_100208513 Ga0070675_1002085131 449
212 3300005355 Ga0070671_100022897 Ga0070671_1000228974 449
213 3300005355 Ga0070671_100131533 Ga0070671_1001315332 449
214 3300005355 Ga0070671_100219718 Ga0070671_1002197181 449
215 3300005356 Ga0070674_100004529 Ga0070674_1000045297 449
216 3300005364 Ga0070673_100135041 Ga0070673_1001350412 449
217 3300005364 Ga0070673_100145283 Ga0070673_1001452832 449
218 3300005365 Ga0070688_100011134 Ga0070688_1000111344 449
219 3300005366 Ga0070659_100017521 Ga0070659_1000175214 449
220 3300005366 Ga0070659_100021878 Ga0070659_1000218786 449
221 3300005441 Ga0070700_100091756 Ga0070700_1000917562 449
222 3300005457 Ga0070662_100006914 Ga0070662_1000069142 449
223 3300005457 Ga0070662_100013751 Ga0070662_1000137514 449
224 3300005457 Ga0070662_100095908 Ga0070662_1000959083 449
225 3300005457 Ga0070662_100129292 Ga0070662_1001292923 449
226 3300005458 Ga0070681_10094284 Ga0070681_100942843 449
227 3300005459 Ga0068867_100061101 Ga0068867_1000611012 449
228 3300005471 Ga0070698_100003913 Ga0070698_1000039137 449
229 3300005471 Ga0070698_100009186 Ga0070698_1000091864 449
230 3300005471 Ga0070698_100169495 Ga0070698_1001694952 449
231 3300005530 Ga0070679_100010564 Ga0070679_1000105648 449
232 3300005530 Ga0070679_100110417 Ga0070679_1001104173 449
233 3300005535 Ga0070684_100001469 Ga0070684_1000014699 449
234 3300005535 Ga0070684_100042255 Ga0070684_1000422552 449
235 3300005539 Ga0068853_100001537 Ga0068853_10000153719 449
236 3300005539 Ga0068853_100024340 Ga0068853_1000243401 449
237 3300005539 Ga0068853_100032462 Ga0068853_1000324622 449
238 3300005543 Ga0070672_100073243 Ga0070672_1000732431 449
239 3300005547 Ga0070693_100074587 Ga0070693_1000745873 449
240 3300005549 Ga0070704_100051890 Ga0070704_1000518902 449
241 3300005563 Ga0068855_100068908 Ga0068855_1000689081 449
242 3300005563 Ga0068855_100208823 Ga0068855_1002088233 449
243 3300005563 Ga0068855_100279633 Ga0068855_1002796331 449
244 3300005564 Ga0070664_100001077 Ga0070664_1000010775 449
245 3300005564 Ga0070664_100004250 Ga0070664_1000042508 449
246 3300005564 Ga0070664_100250991 Ga0070664_1002509911 449
247 3300005577 Ga0068857_100022387 Ga0068857_1000223875 449
248 3300005578 Ga0068854_100007104 Ga0068854_1000071043 449
249 3300005614 Ga0068856_100039390 Ga0068856_1000393902 449
250 3300005616 Ga0068852_100027173 Ga0068852_1000271733 449
251 3300005616 Ga0068852_100044678 Ga0068852_1000446782 449
252 3300005616 Ga0068852_100127635 Ga0068852_1001276353 449
253 3300005617 Ga0068859_100098912 Ga0068859_1000989123 449
254 3300005617 Ga0068859_100173554 Ga0068859_1001735542 449
255 3300005617 Ga0068859_100227010 Ga0068859_1002270102 449
256 3300005617 Ga0068859_100243764 Ga0068859_1002437642 449
257 3300005617 Ga0068859_100279643 Ga0068859_1002796432 449
258 3300005618 Ga0068864_100030528 Ga0068864_1000305286 449
259 3300005719 Ga0068861_100000312 Ga0068861_10000031213 449
260 3300005840 Ga0068870_10028139 Ga0068870_100281391 449
261 3300005841 Ga0068863_100014098 Ga0068863_1000140984 449
262 3300005841 Ga0068863_100063235 Ga0068863_1000632354 449
263 3300005842 Ga0068858_100027822 Ga0068858_1000278223 449
264 3300005842 Ga0068858_100094319 Ga0068858_1000943194 449
265 3300005844 Ga0068862_100283256 Ga0068862_1002832562 449
266 3300005985 Ga0081539_10000418 Ga0081539_1000041844 449
267 3300006237 Ga0097621_100000611 Ga0097621_1000006119 449
268 3300006237 Ga0097621_100004099 Ga0097621_1000040999 449
269 3300006237 Ga0097621_100246296 Ga0097621_1002462962 449
270 3300006358 Ga0068871_100000634 Ga0068871_1000006344 449
271 3300006358 Ga0068871_100063228 Ga0068871_1000632282 449
272 3300006358 Ga0068871_100063902 Ga0068871_1000639024 449
273 3300006358 Ga0068871_100229903 Ga0068871_1002299031 449
274 3300006844 Ga0075428_100071519 Ga0075428_1000715192 449
275 3300006844 Ga0075428_100091050 Ga0075428_1000910503 449
276 3300006846 Ga0075430_100034421 Ga0075430_1000344213 449
277 3300006847 Ga0075431_100016396 Ga0075431_1000163968 449
278 3300006881 Ga0068865_100096438 Ga0068865_1000964382 449
279 3300006931 Ga0097620_100098915 Ga0097620_1000989152 449
280 3300006931 Ga0097620_100173555 Ga0097620_1001735552 449
281 3300006931 Ga0097620_100227012 Ga0097620_1002270122 449
282 3300006931 Ga0097620_100243780 Ga0097620_1002437801 449
283 3300006931 Ga0097620_100279634 Ga0097620_1002796342 449
284 3300009093 Ga0105240_10024475 Ga0105240_100244757 449
285 3300009094 Ga0111539_10112694 Ga0111539_101126943 449
286 3300009101 Ga0105247_10002997 Ga0105247_100029978 449
287 3300009147 Ga0114129_10153551 Ga0114129_101535514 449
288 3300009148 Ga0105243_10000003 Ga0105243_1000000358 449
289 3300009176 Ga0105242_10029088 Ga0105242_100290882 449
290 3300009177 Ga0105248_10051086 Ga0105248_100510866 449
291 3300009545 Ga0105237_10052853 Ga0105237_100528534 449
292 3300009553 Ga0105249_10000679 Ga0105249_1000067936 449
293 3300009553 Ga0105249_10007529 Ga0105249_100075291 449
294 3300009553 Ga0105249_10064934 Ga0105249_100649343 449
295 3300009553 Ga0105249_10090960 Ga0105249_100909603 449
296 3300009553 Ga0105249_10248929 Ga0105249_102489292 449
297 3300013100 Ga0157373_10011301 Ga0157373_100113012 449
298 3300013100 Ga0157373_10032325 Ga0157373_100323257 449
299 3300013100 Ga0157373_10070171 Ga0157373_100701712 449
300 3300013100 Ga0157373_10077735 Ga0157373_100777353 449
301 3300013102 Ga0157371_10001199 Ga0157371_1000119923 449
302 3300013104 Ga0157370_10010241 Ga0157370_100102415 449
303 3300013105 Ga0157369_10030384 Ga0157369_100303847 449
304 3300013105 Ga0157369_10067961 Ga0157369_100679613 449
305 3300013105 Ga0157369_10079828 Ga0157369_100798282 449
306 3300013296 Ga0157374_10063424 Ga0157374_100634242 449
307 3300013297 Ga0157378_10014757 Ga0157378_100147573 449
308 3300013297 Ga0157378_10025398 Ga0157378_100253986 449
309 3300013306 Ga0163162_10000595 Ga0163162_1000059522 449
310 3300013306 Ga0163162_10001161 Ga0163162_1000116125 449
311 3300013306 Ga0163162_10002066 Ga0163162_1000206615 449
312 3300013306 Ga0163162_10010491 Ga0163162_100104913 449
313 3300013306 Ga0163162_10158083 Ga0163162_101580832 449
314 3300013306 Ga0163162_10216044 Ga0163162_102160442 449
315 3300013307 Ga0157372_10052990 Ga0157372_100529904 449
316 3300013307 Ga0157372_10116638 Ga0157372_101166384 449
317 3300013307 Ga0157372_10237648 Ga0157372_102376483 449
318 3300013308 Ga0157375_10000614 Ga0157375_1000061417 449
319 3300013308 Ga0157375_10226897 Ga0157375_102268972 449
320 3300014325 Ga0163163_10000352 Ga0163163_1000035232 449
321 3300014326 Ga0157380_10059143 Ga0157380_100591433 449
322 3300014968 Ga0157379_10025131 Ga0157379_100251312 449
323 3300014969 Ga0157376_10004780 Ga0157376_100047804 449
324 3300014969 Ga0157376_10024787 Ga0157376_100247874 449
325 3300014969 Ga0157376_10224255 Ga0157376_102242552 449
326 3300015261 Ga0182006_1005760 Ga0182006_10057602 449
327 3300017792 Ga0163161_10000968 Ga0163161_1000096823 449
328 3300017792 Ga0163161_10045614 Ga0163161_100456142 449
329 3300017792 Ga0163161_10092342 Ga0163161_100923422 449
330 3300025900 Ga0207710_10001252 Ga0207710_100012529 449
331 3300025903 Ga0207680_10000586 Ga0207680_1000058610 449
332 3300025907 Ga0207645_10021982 Ga0207645_100219823 449
333 3300025908 Ga0207643_10060920 Ga0207643_100609202 449
334 3300025908 Ga0207643_10065139 Ga0207643_100651392 449
335 3300025909 Ga0207705_10122670 Ga0207705_101226702 449
336 3300025913 Ga0207695_10016392 Ga0207695_100163924 449
337 3300025914 Ga0207671_10000721 Ga0207671_1000072144 449
338 3300025914 Ga0207671_10105705 Ga0207671_101057051 449
339 3300025918 Ga0207662_10040436 Ga0207662_100404362 449
340 3300025919 Ga0207657_10001900 Ga0207657_100019002 449
341 3300025920 Ga0207649_10005271 Ga0207649_100052716 449
342 3300025920 Ga0207649_10044523 Ga0207649_100445234 449
343 3300025921 Ga0207652_10186653 Ga0207652_101866531 449
344 3300025926 Ga0207659_10058056 Ga0207659_100580562 449
345 3300025926 Ga0207659_10106238 Ga0207659_101062381 449
346 3300025931 Ga0207644_10065862 Ga0207644_100658621 449
347 3300025931 Ga0207644_10101979 Ga0207644_101019793 449
348 3300025932 Ga0207690_10004290 Ga0207690_100042906 449
349 3300025933 Ga0207706_10006199 Ga0207706_100061996 449
350 3300025933 Ga0207706_10011398 Ga0207706_100113988 449
351 3300025933 Ga0207706_10072073 Ga0207706_100720733 449
352 3300025934 Ga0207686_10004707 Ga0207686_100047076 449
353 3300025935 Ga0207709_10000008 Ga0207709_10000008516 449
354 3300025937 Ga0207669_10095388 Ga0207669_100953882 449
355 3300025940 Ga0207691_10018630 Ga0207691_100186301 449
356 3300025940 Ga0207691_10184076 Ga0207691_101840762 449
357 3300025942 Ga0207689_10010987 Ga0207689_1001098710 449
358 3300025942 Ga0207689_10035495 Ga0207689_100354952 449
359 3300025944 Ga0207661_10024898 Ga0207661_100248982 449
360 3300025945 Ga0207679_10001674 Ga0207679_1000167410 449
361 3300025945 Ga0207679_10162210 Ga0207679_101622102 449
362 3300025961 Ga0207712_10010819 Ga0207712_100108194 449
363 3300025961 Ga0207712_10016873 Ga0207712_100168735 449
364 3300025961 Ga0207712_10068240 Ga0207712_100682403 449
365 3300025961 Ga0207712_10090344 Ga0207712_100903442 449
366 3300025981 Ga0207640_10075141 Ga0207640_100751411 449
367 3300025986 Ga0207658_10208019 Ga0207658_102080191 449
368 3300026023 Ga0207677_10001780 Ga0207677_1000178013 449
369 3300026035 Ga0207703_10019532 Ga0207703_100195323 449
370 3300026041 Ga0207639_10026751 Ga0207639_100267513 449
371 3300026041 Ga0207639_10246351 Ga0207639_102463511 449
372 3300026078 Ga0207702_10126034 Ga0207702_101260342 449
373 3300026088 Ga0207641_10000448 Ga0207641_1000044834 449
374 3300026088 Ga0207641_10001077 Ga0207641_1000107719 449
375 3300026088 Ga0207641_10012106 Ga0207641_100121066 449
376 3300026088 Ga0207641_10018916 Ga0207641_100189165 449
377 3300026089 Ga0207648_10005010 Ga0207648_1000501015 449
378 3300026089 Ga0207648_10007532 Ga0207648_100075328 449
379 3300026089 Ga0207648_10057688 Ga0207648_100576883 449
380 3300026089 Ga0207648_10064155 Ga0207648_100641552 449
381 3300026095 Ga0207676_10012325 Ga0207676_100123252 449
382 3300026116 Ga0207674_10000894 Ga0207674_1000089426 449
383 3300026118 Ga0207675_100002842 Ga0207675_1000028425 449
384 3300026121 Ga0207683_10056112 Ga0207683_100561122 449
385 3300026142 Ga0207698_10040670 Ga0207698_100406703 449
386 3300026142 Ga0207698_10135625 Ga0207698_101356251 449
387 3300028381 Ga0268264_10002805 Ga0268264_100028053 449
388 3300031251 Ga0265327_10000006 Ga0265327_10000006387 449
389 3300032004 Ga0307414_10011763 Ga0307414_100117632 449
390 3300041413 Ga0439465_0016026 Ga0439465_0016026_932_2284 449
391 3300046454 Ga0495592_0159165 Ga0495592_0159165_123_1472 449
392 3300046516 Ga0495628_0018695 Ga0495628_0018695_2975_4324 449
393 3300046517 Ga0495630_0009753 Ga0495630_0009753_261_1610 449
394 3300046529 Ga0495652_0114033 Ga0495652_0114033_789_2138 449
395 3300046543 Ga0495645_0144519 Ga0495645_0144519_148_1500 449
396 3300046642 Ga0495634_0071154 Ga0495634_0071154_915_2264 449
397 3300046678 Ga0495599_0032634 Ga0495599_0032634_968_2317 449
398 3300047471 Ga0495684_0089071 Ga0495684_0089071_192_1541 449
399 3300048907 Ga0496104_0096952 Ga0496104_0096952_1375_2727 449
400 3300048913 Ga0496110_0087547 Ga0496110_0087547_1068_2417 449
401 3300048913 Ga0496110_0097470 Ga0496110_0097470_1212_2564 449
402 3300048917 Ga0496114_0001046 Ga0496114_0001046_15294_16643 449
403 3300049571 Ga0501034_0005253 Ga0501034_0005253_6439_7791 449
404 3300049571 Ga0501034_0013642 Ga0501034_0013642_6434_7783 449
405 3300049572 Ga0501036_0049405 Ga0501036_0049405_1941_3293 449
406 3300049580 Ga0501046_0033569 Ga0501046_0033569_914_2266 449
407 3300049581 Ga0501047_0043636 Ga0501047_0043636_1949_3301 449
408 3300049822 Ga0501035_0052200 Ga0501035_0052200_2200_3552 449
409 3300049823 Ga0501044_0001663 Ga0501044_0001663_8534_9886 449
410 3300049823 Ga0501044_0023918 Ga0501044_0023918_1897_3249 449
411 3300050507 nmdc:mga05p37_177095_c1 nmdc:mga05p37_177095_c1_1080_2432 449
412 3300050509 nmdc:mga0qj67_50085_c1 nmdc:mga0qj67_50085_c1_1818_3227 449
413 3300050511 nmdc:mga08y16_104496_c1 nmdc:mga08y16_104496_c1_543_1895 449
414 3300053139 Ga0500568_0000863 Ga0500568_0000863_13583_14935 449
415 3300053156 Ga0500622_0000568 Ga0500622_0000568_31192_32544 449
416 3300003323 rootH1_10009896 rootH1_100098964 450
417 3300005290 Ga0065712_10074656 Ga0065712_100746564 450
418 3300005327 Ga0070658_10011839 Ga0070658_100118392 450
419 3300005329 Ga0070683_100002523 Ga0070683_1000025239 450
420 3300005329 Ga0070683_100004195 Ga0070683_1000041959 450
421 3300005329 Ga0070683_100005141 Ga0070683_10000514110 450
422 3300005329 Ga0070683_100156917 Ga0070683_1001569172 450
423 3300005330 Ga0070690_100016610 Ga0070690_1000166104 450
424 3300005331 Ga0070670_100032098 Ga0070670_1000320984 450
425 3300005331 Ga0070670_100091270 Ga0070670_1000912703 450
426 3300005331 Ga0070670_100109275 Ga0070670_1001092751 450
427 3300005331 Ga0070670_100243744 Ga0070670_1002437441 450
428 3300005333 Ga0070677_10028216 Ga0070677_100282162 450
429 3300005334 Ga0068869_100003465 Ga0068869_1000034652 450
430 3300005334 Ga0068869_100006312 Ga0068869_1000063126 450
431 3300005335 Ga0070666_10003803 Ga0070666_100038039 450
432 3300005335 Ga0070666_10011816 Ga0070666_100118162 450
433 3300005336 Ga0070680_100101249 Ga0070680_1001012492 450
434 3300005337 Ga0070682_100000129 Ga0070682_10000012913 450
435 3300005338 Ga0068868_100006616 Ga0068868_1000066167 450
436 3300005338 Ga0068868_100057848 Ga0068868_1000578483 450
437 3300005339 Ga0070660_100123168 Ga0070660_1001231682 450
438 3300005340 Ga0070689_100041636 Ga0070689_1000416363 450
439 3300005340 Ga0070689_100053033 Ga0070689_1000530332 450
440 3300005347 Ga0070668_100036105 Ga0070668_1000361053 450
441 3300005353 Ga0070669_100006616 Ga0070669_1000066164 450
442 3300005353 Ga0070669_100085507 Ga0070669_1000855072 450
443 3300005364 Ga0070673_100048895 Ga0070673_1000488953 450
444 3300005364 Ga0070673_100129050 Ga0070673_1001290502 450
445 3300005364 Ga0070673_100147895 Ga0070673_1001478951 450
446 3300005365 Ga0070688_100002588 Ga0070688_1000025887 450
447 3300005366 Ga0070659_100092731 Ga0070659_1000927312 450
448 3300005367 Ga0070667_100073882 Ga0070667_1000738823 450
449 3300005367 Ga0070667_100100035 Ga0070667_1001000353 450
450 3300005438 Ga0070701_10026249 Ga0070701_100262492 450
451 3300005455 Ga0070663_100109185 Ga0070663_1001091852 450
452 3300005456 Ga0070678_100000905 Ga0070678_10000090512 450
453 3300005456 Ga0070678_100003904 Ga0070678_1000039049 450
454 3300005457 Ga0070662_100036378 Ga0070662_1000363783 450
455 3300005457 Ga0070662_100053128 Ga0070662_1000531283 450
456 3300005459 Ga0068867_100165642 Ga0068867_1001656421 450
457 3300005466 Ga0070685_10079666 Ga0070685_100796662 450
458 3300005471 Ga0070698_100171722 Ga0070698_1001717222 450
459 3300005518 Ga0070699_100060944 Ga0070699_1000609441 450
460 3300005530 Ga0070679_100019927 Ga0070679_1000199276 450
461 3300005530 Ga0070679_100253010 Ga0070679_1002530102 450
462 3300005535 Ga0070684_100011020 Ga0070684_1000110202 450
463 3300005535 Ga0070684_100011625 Ga0070684_1000116258 450
464 3300005539 Ga0068853_100041673 Ga0068853_1000416734 450
465 3300005543 Ga0070672_100004444 Ga0070672_1000044444 450
466 3300005548 Ga0070665_100000094 Ga0070665_100000094128 450
467 3300005548 Ga0070665_100005115 Ga0070665_1000051159 450
468 3300005548 Ga0070665_100117865 Ga0070665_1001178652 450
469 3300005563 Ga0068855_100000399 Ga0068855_10000039931 450
470 3300005563 Ga0068855_100009093 Ga0068855_1000090933 450
471 3300005563 Ga0068855_100027369 Ga0068855_1000273695 450
472 3300005563 Ga0068855_100248059 Ga0068855_1002480592 450
473 3300005564 Ga0070664_100001338 Ga0070664_1000013389 450
474 3300005577 Ga0068857_100011099 Ga0068857_1000110998 450
475 3300005577 Ga0068857_100057307 Ga0068857_1000573074 450
476 3300005616 Ga0068852_100001228 Ga0068852_10000122816 450
477 3300005617 Ga0068859_100032552 Ga0068859_1000325524 450
478 3300005617 Ga0068859_100057532 Ga0068859_1000575322 450
479 3300005718 Ga0068866_10081356 Ga0068866_100813561 450
480 3300005719 Ga0068861_100001193 Ga0068861_1000011932 450
481 3300005841 Ga0068863_100068572 Ga0068863_1000685722 450
482 3300005842 Ga0068858_100118933 Ga0068858_1001189333 450
483 3300005843 Ga0068860_100000052 Ga0068860_100000052130 450
484 3300005843 Ga0068860_100013335 Ga0068860_1000133355 450
485 3300005843 Ga0068860_100056184 Ga0068860_1000561844 450
486 3300005843 Ga0068860_100190834 Ga0068860_1001908342 450
487 3300006237 Ga0097621_100012278 Ga0097621_1000122785 450
488 3300006358 Ga0068871_100020463 Ga0068871_1000204633 450
489 3300006358 Ga0068871_100045310 Ga0068871_1000453105 450
490 3300006358 Ga0068871_100253906 Ga0068871_1002539061 450
491 3300006844 Ga0075428_100005379 Ga0075428_10000537911 450
492 3300006880 Ga0075429_100001571 Ga0075429_1000015719 450
493 3300006931 Ga0097620_100032554 Ga0097620_1000325544 450
494 3300006931 Ga0097620_100057536 Ga0097620_1000575362 450
495 3300009093 Ga0105240_10035148 Ga0105240_100351486 450
496 3300009093 Ga0105240_10037888 Ga0105240_100378887 450
497 3300009093 Ga0105240_10043248 Ga0105240_100432482 450
498 3300009094 Ga0111539_10003295 Ga0111539_1000329515 450
499 3300009098 Ga0105245_10136931 Ga0105245_101369311 450
500 3300009148 Ga0105243_10255070 Ga0105243_102550702 450
501 3300009174 Ga0105241_10026514 Ga0105241_100265143 450
502 3300009176 Ga0105242_10088408 Ga0105242_100884082 450
503 3300010375 Ga0105239_10000935 Ga0105239_1000093535 450
504 3300010375 Ga0105239_10020118 Ga0105239_100201183 450
505 3300010375 Ga0105239_10023061 Ga0105239_100230615 450
506 3300011119 Ga0105246_10013343 Ga0105246_100133435 450
507 3300013100 Ga0157373_10018289 Ga0157373_100182894 450
508 3300013102 Ga0157371_10001473 Ga0157371_1000147313 450
509 3300013102 Ga0157371_10011618 Ga0157371_100116187 450
510 3300013102 Ga0157371_10012519 Ga0157371_100125195 450
511 3300013102 Ga0157371_10024544 Ga0157371_100245441 450
512 3300013102 Ga0157371_10106640 Ga0157371_101066402 450
513 3300013104 Ga0157370_10009760 Ga0157370_100097608 450
514 3300013104 Ga0157370_10070057 Ga0157370_100700572 450
515 3300013105 Ga0157369_10002537 Ga0157369_1000253722 450
516 3300013105 Ga0157369_10020179 Ga0157369_100201798 450
517 3300013105 Ga0157369_10057853 Ga0157369_100578533 450
518 3300013105 Ga0157369_10085509 Ga0157369_100855092 450
519 3300013296 Ga0157374_10000237 Ga0157374_1000023756 450
520 3300013296 Ga0157374_10002410 Ga0157374_1000241014 450
521 3300013296 Ga0157374_10031205 Ga0157374_100312053 450
522 3300013297 Ga0157378_10034022 Ga0157378_100340225 450
523 3300013306 Ga0163162_10001696 Ga0163162_1000169617 450
524 3300013306 Ga0163162_10003454 Ga0163162_100034543 450
525 3300013306 Ga0163162_10017686 Ga0163162_100176863 450
526 3300013306 Ga0163162_10235290 Ga0163162_102352903 450
527 3300013307 Ga0157372_10006195 Ga0157372_100061956 450
528 3300013307 Ga0157372_10012017 Ga0157372_100120176 450
529 3300013307 Ga0157372_10150825 Ga0157372_101508252 450
530 3300013307 Ga0157372_10288161 Ga0157372_102881612 450
531 3300013307 Ga0157372_10472485 Ga0157372_104724851 450
532 3300013308 Ga0157375_10002275 Ga0157375_100022753 450
533 3300013308 Ga0157375_10005435 Ga0157375_1000543513 450
534 3300013308 Ga0157375_10076250 Ga0157375_100762503 450
535 3300014325 Ga0163163_10000088 Ga0163163_1000008819 450
536 3300014325 Ga0163163_10001835 Ga0163163_1000183516 450
537 3300014325 Ga0163163_10005167 Ga0163163_1000516714 450
538 3300014326 Ga0157380_10007323 Ga0157380_100073233 450
539 3300014745 Ga0157377_10000354 Ga0157377_1000035415 450
540 3300014745 Ga0157377_10002113 Ga0157377_100021134 450
541 3300014968 Ga0157379_10225420 Ga0157379_102254201 450
542 3300025246 Ga0209646_1001140 Ga0209646_10011405 450
543 3300025302 Ga0207426_1000059 Ga0207426_1000059298 450
544 3300025893 Ga0207682_10031373 Ga0207682_100313732 450
545 3300025903 Ga0207680_10017371 Ga0207680_100173711 450
546 3300025904 Ga0207647_10000061 Ga0207647_1000006116 450
547 3300025904 Ga0207647_10035144 Ga0207647_100351444 450
548 3300025907 Ga0207645_10000847 Ga0207645_1000084710 450
549 3300025907 Ga0207645_10002256 Ga0207645_1000225610 450
550 3300025909 Ga0207705_10008664 Ga0207705_100086642 450
551 3300025909 Ga0207705_10009177 Ga0207705_100091778 450
552 3300025912 Ga0207707_10251356 Ga0207707_102513561 450
553 3300025913 Ga0207695_10000702 Ga0207695_1000070211 450
554 3300025913 Ga0207695_10000894 Ga0207695_100008947 450
555 3300025913 Ga0207695_10030088 Ga0207695_100300887 450
556 3300025914 Ga0207671_10026732 Ga0207671_100267323 450
557 3300025917 Ga0207660_10005360 Ga0207660_100053603 450
558 3300025918 Ga0207662_10067219 Ga0207662_100672192 450
559 3300025919 Ga0207657_10016216 Ga0207657_100162163 450
560 3300025920 Ga0207649_10122395 Ga0207649_101223951 450
561 3300025921 Ga0207652_10000181 Ga0207652_1000018117 450
562 3300025921 Ga0207652_10002067 Ga0207652_100020675 450
563 3300025923 Ga0207681_10013609 Ga0207681_100136092 450
564 3300025923 Ga0207681_10030055 Ga0207681_100300555 450
565 3300025924 Ga0207694_10206540 Ga0207694_102065401 450
566 3300025925 Ga0207650_10009308 Ga0207650_100093082 450
567 3300025925 Ga0207650_10052389 Ga0207650_100523892 450
568 3300025925 Ga0207650_10142590 Ga0207650_101425901 450
569 3300025925 Ga0207650_10244773 Ga0207650_102447731 450
570 3300025926 Ga0207659_10010641 Ga0207659_100106416 450
571 3300025926 Ga0207659_10025932 Ga0207659_100259322 450
572 3300025932 Ga0207690_10044953 Ga0207690_100449532 450
573 3300025932 Ga0207690_10084322 Ga0207690_100843222 450
574 3300025933 Ga0207706_10010295 Ga0207706_100102958 450
575 3300025933 Ga0207706_10147152 Ga0207706_101471522 450
576 3300025934 Ga0207686_10045182 Ga0207686_100451822 450
577 3300025937 Ga0207669_10093408 Ga0207669_100934082 450
578 3300025940 Ga0207691_10010199 Ga0207691_100101995 450
579 3300025940 Ga0207691_10014922 Ga0207691_100149226 450
580 3300025942 Ga0207689_10023114 Ga0207689_100231146 450
581 3300025942 Ga0207689_10025266 Ga0207689_100252664 450
582 3300025942 Ga0207689_10043144 Ga0207689_100431442 450
583 3300025942 Ga0207689_10109636 Ga0207689_101096361 450
584 3300025944 Ga0207661_10007444 Ga0207661_100074446 450
585 3300025944 Ga0207661_10018216 Ga0207661_100182165 450
586 3300025945 Ga0207679_10005671 Ga0207679_100056719 450
587 3300025945 Ga0207679_10011911 Ga0207679_100119112 450
588 3300025949 Ga0207667_10000312 Ga0207667_1000031247 450
589 3300025949 Ga0207667_10019147 Ga0207667_100191471 450
590 3300025949 Ga0207667_10028216 Ga0207667_100282166 450
591 3300025949 Ga0207667_10052423 Ga0207667_100524233 450
592 3300025949 Ga0207667_10211469 Ga0207667_102114691 450
593 3300025986 Ga0207658_10078762 Ga0207658_100787623 450
594 3300026023 Ga0207677_10009458 Ga0207677_100094586 450
595 3300026023 Ga0207677_10108806 Ga0207677_101088062 450
596 3300026041 Ga0207639_10074097 Ga0207639_100740972 450
597 3300026088 Ga0207641_10005547 Ga0207641_100055473 450
598 3300026089 Ga0207648_10003051 Ga0207648_1000305110 450
599 3300026095 Ga0207676_10047330 Ga0207676_100473302 450
600 3300026116 Ga0207674_10013334 Ga0207674_100133349 450
601 3300026116 Ga0207674_10022378 Ga0207674_100223784 450
602 3300026116 Ga0207674_10062038 Ga0207674_100620382 450
603 3300026116 Ga0207674_10137689 Ga0207674_101376893 450
604 3300026116 Ga0207674_10142389 Ga0207674_101423893 450
605 3300026118 Ga0207675_100006844 Ga0207675_1000068444 450
606 3300026118 Ga0207675_100018407 Ga0207675_1000184073 450
607 3300026118 Ga0207675_100119273 Ga0207675_1001192732 450
608 3300026121 Ga0207683_10002182 Ga0207683_100021829 450
609 3300026121 Ga0207683_10026793 Ga0207683_100267933 450
610 3300026142 Ga0207698_10002660 Ga0207698_100026602 450
611 3300026142 Ga0207698_10061636 Ga0207698_100616362 450
612 3300028379 Ga0268266_10000057 Ga0268266_1000005745 450
613 3300028379 Ga0268266_10040113 Ga0268266_100401133 450
614 3300028380 Ga0268265_10282075 Ga0268265_102820751 450
615 3300028381 Ga0268264_10000143 Ga0268264_1000014347 450
616 3300028381 Ga0268264_10047127 Ga0268264_100471273 450
617 3300028381 Ga0268264_10118696 Ga0268264_101186962 450
618 3300030521 Ga0307511_10000439 Ga0307511_1000043923 450
619 3300031911 Ga0307412_10000292 Ga0307412_1000029231 450
620 3300032126 Ga0307415_100007390 Ga0307415_1000073903 450
621 3300032126 Ga0307415_100165537 Ga0307415_1001655372 450
622 3300037312 Ga0395899_0000959 Ga0395899_0000959_15239_16591 450
623 3300037312 Ga0395899_0043474 Ga0395899_0043474_658_2010 450
624 3300037418 Ga0395900_0012661 Ga0395900_0012661_315_1667 450
625 3300037418 Ga0395900_0068341 Ga0395900_0068341_843_2195 450
626 3300037418 Ga0395900_0150338 Ga0395900_0150338_574_1926 450
627 3300037418 Ga0395900_0161590 Ga0395900_0161590_80_1432 450
628 3300037418 Ga0395900_0276443 Ga0395900_0276443_187_1539 450
629 3300037466 Ga0395898_0003579 Ga0395898_0003579_9218_10570 450
630 3300037466 Ga0395898_0049897 Ga0395898_0049897_1420_2772 450
631 3300037471 Ga0395905_0026233 Ga0395905_0026233_3053_4405 450
632 3300037471 Ga0395905_0067152 Ga0395905_0067152_1579_2931 450
633 3300038443 Ga0395901_0005557 Ga0395901_0005557_343_1695 450
634 3300039437 Ga0436365_0557230 Ga0436365_0557230_314_1681 450
635 3300039437 Ga0436365_1888183 Ga0436365_1888183_149_1504 450
636 3300041413 Ga0439465_0000035 Ga0439465_0000035_18773_20125 450
637 3300041512 Ga0451853_2153551 Ga0451853_2153551_353_1708 450
638 3300042004 Ga0439445_0000094 Ga0439445_0000094_12770_14122 450
639 3300044658 Ga0466972_0000010 Ga0466972_0000010_89978_91333 450
640 3300044658 Ga0466972_0001431 Ga0466972_0001431_1673_3028 450
641 3300044658 Ga0466972_0034173 Ga0466972_0034173_201_1559 450
642 3300044735 Ga0466968_0070229 Ga0466968_0070229_57_1415 450
643 3300044765 Ga0466970_0000471 Ga0466970_0000471_10584_11939 450
644 3300045049 Ga0466959_0148750 Ga0466959_0148750_223_1575 450
645 3300046460 Ga0495638_0019391 Ga0495638_0019391_2361_3719 450
646 3300046519 Ga0495632_0006333 Ga0495632_0006333_3188_4540 450
647 3300046524 Ga0495648_0003590 Ga0495648_0003590_562_1917 450
648 3300046558 Ga0495633_0009165 Ga0495633_0009165_3632_4984 450
649 3300046648 Ga0495611_0000081 Ga0495611_0000081_55640_56995 450
650 3300046660 Ga0495625_0000658 Ga0495625_0000658_35033_36385 450
651 3300047320 Ga0495672_0016760 Ga0495672_0016760_1068_2423 450
652 3300047320 Ga0495672_0018029 Ga0495672_0018029_2304_3659 450
653 3300047443 Ga0495687_000111 Ga0495687_000111_18411_19766 450
654 3300049570 Ga0501033_0053360 Ga0501033_0053360_1075_2427 450
655 3300049571 Ga0501034_0002046 Ga0501034_0002046_1414_2766 450
656 3300049571 Ga0501034_0037459 Ga0501034_0037459_2561_3913 450
657 3300049573 Ga0501037_0004853 Ga0501037_0004853_5426_6778 450
658 3300049575 Ga0501039_0046550 Ga0501039_0046550_1127_2479 450
659 3300049579 Ga0501043_0037281 Ga0501043_0037281_1322_2674 450
660 3300049579 Ga0501043_0051583 Ga0501043_0051583_1211_2563 450
661 3300049579 Ga0501043_0117212 Ga0501043_0117212_59_1411 450
662 3300049581 Ga0501047_0007339 Ga0501047_0007339_187_1539 450
663 3300049652 Ga0501202_005262 Ga0501202_005262_86_1438 450
664 3300049661 Ga0501217_000087 Ga0501217_000087_184_1536 450
665 3300049662 Ga0501222_000205 Ga0501222_000205_5080_6432 450
666 3300049663 Ga0501223_001264 Ga0501223_001264_277_1629 450
667 3300049669 Ga0501235_000089 Ga0501235_000089_8441_9793 450
668 3300049673 Ga0501240_000041 Ga0501240_000041_3946_5298 450
669 3300049680 Ga0501250_002354 Ga0501250_002354_235_1587 450
670 3300049681 Ga0501251_003300 Ga0501251_003300_239_1591 450
671 3300049683 Ga0501253_000098 Ga0501253_000098_1859_3211 450
672 3300049688 Ga0501259_000111 Ga0501259_000111_5528_6880 450
673 3300049688 Ga0501259_000789 Ga0501259_000789_3701_5053 450
674 3300049690 Ga0501261_000274 Ga0501261_000274_3483_4835 450
675 3300049704 Ga0501221_000942 Ga0501221_000942_617_1969 450
676 3300049705 Ga0501225_0000583 Ga0501225_0000583_9677_11029 450
677 3300049705 Ga0501225_0007025 Ga0501225_0007025_788_2152 450
678 3300049707 Ga0501234_003714 Ga0501234_003714_432_1784 450
679 3300049758 Ga0501241_000009 Ga0501241_000009_65867_67219 450
680 3300049763 Ga0501266_001126 Ga0501266_001126_1947_3299 450
681 3300049766 Ga0501269_000025 Ga0501269_000025_9037_10389 450
682 3300049776 Ga0501280_003927 Ga0501280_003927_480_1832 450
683 3300049822 Ga0501035_0015729 Ga0501035_0015729_4608_5960 450
684 3300049823 Ga0501044_0012930 Ga0501044_0012930_1185_2549 450
685 3300049823 Ga0501044_0019648 Ga0501044_0019648_2944_4296 450
686 3300050508 nmdc:mga09592_8712_c2 nmdc:mga09592_8712_c2_523_1878 450
687 3300050510 nmdc:mga06r32_205023_c1 nmdc:mga06r32_205023_c1_343_1695 450
688 3300053092 Ga0500583_0015568 Ga0500583_0015568_1207_2562 450
689 3300053108 Ga0500562_000032 Ga0500562_000032_5972_7327 450
690 3300053156 Ga0500622_0000445 Ga0500622_0000445_15987_17342 450
691 2162886007 SwRhRL2b_contig_3262938 SwRhRL2b_0905.00002540 451
692 3300003215 JGI25153J46596_10015999 JGI25153J46596_100159992 451
693 3300003320 rootH2_10000933 rootH2_1000093334 451
694 3300003320 rootH2_10027208 rootH2_100272085 451
695 3300003354 JGI25160J50197_1002225 JGI25160J50197_10022256 451
696 3300003354 JGI25160J50197_1007805 JGI25160J50197_10078053 451
697 3300003354 JGI25160J50197_1009408 JGI25160J50197_10094083 451
698 3300003762 Ga0055542_1004849 Ga0055542_10048493 451
699 3300003771 Ga0055526_1009867 Ga0055526_10098672 451
700 3300003790 Ga0055528_1001384 Ga0055528_100138410 451
701 3300003791 Ga0055530_10000584 Ga0055530_100005849 451
702 3300003794 Ga0055531_10000132 Ga0055531_1000013268 451
703 3300003794 Ga0055531_10029285 Ga0055531_100292852 451
704 3300005262 Ga0065165_1000914 Ga0065165_100091424 451
705 3300005262 Ga0065165_1028630 Ga0065165_10286302 451
706 3300005288 Ga0065714_10064700 Ga0065714_1006470022 451
707 3300005289 Ga0065704_10071654 Ga0065704_1007165410 451
708 3300005327 Ga0070658_10101610 Ga0070658_101016102 451
709 3300005333 Ga0070677_10038879 Ga0070677_100388791 451
710 3300005334 Ga0068869_100064509 Ga0068869_1000645092 451
711 3300005336 Ga0070680_100003171 Ga0070680_1000031715 451
712 3300005337 Ga0070682_100002730 Ga0070682_1000027306 451
713 3300005338 Ga0068868_100001431 Ga0068868_1000014316 451
714 3300005339 Ga0070660_100001175 Ga0070660_1000011759 451
715 3300005339 Ga0070660_100022055 Ga0070660_1000220552 451
716 3300005341 Ga0070691_10000858 Ga0070691_100008587 451
717 3300005355 Ga0070671_100090702 Ga0070671_1000907021 451
718 3300005364 Ga0070673_100035374 Ga0070673_1000353741 451
719 3300005367 Ga0070667_100001113 Ga0070667_10000111311 451
720 3300005367 Ga0070667_100066412 Ga0070667_1000664123 451
721 3300005458 Ga0070681_10048862 Ga0070681_100488624 451
722 3300005459 Ga0068867_100023112 Ga0068867_1000231123 451
723 3300005530 Ga0070679_100001926 Ga0070679_10000192612 451
724 3300005539 Ga0068853_100021044 Ga0068853_1000210445 451
725 3300005539 Ga0068853_100084041 Ga0068853_1000840413 451
726 3300005543 Ga0070672_100069759 Ga0070672_1000697594 451
727 3300005548 Ga0070665_100004249 Ga0070665_10000424910 451
728 3300005563 Ga0068855_100036378 Ga0068855_1000363786 451
729 3300005563 Ga0068855_100113157 Ga0068855_1001131572 451
730 3300005614 Ga0068856_100006224 Ga0068856_10000622411 451
731 3300005616 Ga0068852_100026592 Ga0068852_1000265922 451
732 3300005617 Ga0068859_100000013 Ga0068859_100000013200 451
733 3300005617 Ga0068859_100009898 Ga0068859_1000098986 451
734 3300005617 Ga0068859_100010935 Ga0068859_1000109353 451
735 3300005617 Ga0068859_100048393 Ga0068859_1000483935 451
736 3300005841 Ga0068863_100027191 Ga0068863_1000271916 451
737 3300005842 Ga0068858_100001874 Ga0068858_10000187415 451
738 3300005843 Ga0068860_100006756 Ga0068860_1000067564 451
739 3300005843 Ga0068860_100201020 Ga0068860_1002010203 451
740 3300005844 Ga0068862_100004828 Ga0068862_1000048287 451
741 3300006358 Ga0068871_100002800 Ga0068871_1000028002 451
742 3300006358 Ga0068871_100100867 Ga0068871_1001008672 451
743 3300006931 Ga0097620_100000013 Ga0097620_100000013200 451
744 3300006931 Ga0097620_100009898 Ga0097620_1000098988 451
745 3300006931 Ga0097620_100010935 Ga0097620_1000109353 451
746 3300006931 Ga0097620_100048393 Ga0097620_1000483935 451
747 3300009092 Ga0105250_10010960 Ga0105250_100109602 451
748 3300009093 Ga0105240_10000066 Ga0105240_1000006622 451
749 3300009093 Ga0105240_10004785 Ga0105240_1000478517 451
750 3300009093 Ga0105240_10006482 Ga0105240_1000648210 451
751 3300009093 Ga0105240_10006663 Ga0105240_100066637 451
752 3300009093 Ga0105240_10075976 Ga0105240_100759764 451
753 3300009093 Ga0105240_10199358 Ga0105240_101993583 451
754 3300009101 Ga0105247_10013814 Ga0105247_100138145 451
755 3300009147 Ga0114129_10021024 Ga0114129_100210243 451
756 3300009174 Ga0105241_10001659 Ga0105241_1000165911 451
757 3300009174 Ga0105241_10022955 Ga0105241_100229552 451
758 3300009174 Ga0105241_10099075 Ga0105241_100990752 451
759 3300009174 Ga0105241_10112978 Ga0105241_101129782 451
760 3300009545 Ga0105237_10000474 Ga0105237_1000047410 451
761 3300009545 Ga0105237_10002029 Ga0105237_1000202921 451
762 3300009545 Ga0105237_10087162 Ga0105237_100871622 451
763 3300010375 Ga0105239_10002278 Ga0105239_1000227812 451
764 3300010375 Ga0105239_10004572 Ga0105239_1000457214 451
765 3300010375 Ga0105239_10072896 Ga0105239_100728962 451
766 3300010375 Ga0105239_10096879 Ga0105239_100968793 451
767 3300011119 Ga0105246_10132829 Ga0105246_101328292 451
768 3300013100 Ga0157373_10000006 Ga0157373_10000006177 451
769 3300013102 Ga0157371_10052714 Ga0157371_100527142 451
770 3300013102 Ga0157371_10079833 Ga0157371_100798332 451
771 3300013104 Ga0157370_10001929 Ga0157370_1000192911 451
772 3300013104 Ga0157370_10007905 Ga0157370_100079056 451
773 3300013296 Ga0157374_10000024 Ga0157374_10000024149 451
774 3300013296 Ga0157374_10088985 Ga0157374_100889852 451
775 3300013296 Ga0157374_10186839 Ga0157374_101868392 451
776 3300013297 Ga0157378_10016099 Ga0157378_100160993 451
777 3300013306 Ga0163162_10001403 Ga0163162_1000140311 451
778 3300013306 Ga0163162_10198371 Ga0163162_101983712 451
779 3300013307 Ga0157372_10112855 Ga0157372_101128552 451
780 3300013307 Ga0157372_10210026 Ga0157372_102100262 451
781 3300014325 Ga0163163_10071074 Ga0163163_100710742 451
782 3300014497 Ga0182008_10000003 Ga0182008_10000003353 451
783 3300014968 Ga0157379_10136218 Ga0157379_101362181 451
784 3300014969 Ga0157376_10011668 Ga0157376_100116683 451
785 3300014969 Ga0157376_10016249 Ga0157376_100162492 451
786 3300014969 Ga0157376_10066517 Ga0157376_100665174 451
787 3300014969 Ga0157376_10115554 Ga0157376_101155542 451
788 3300015265 Ga0182005_1000116 Ga0182005_100011620 451
789 3300017792 Ga0163161_10000620 Ga0163161_1000062026 451
790 3300017792 Ga0163161_10000869 Ga0163161_1000086924 451
791 3300025208 Ga0209436_104595 Ga0209436_1045953 451
792 3300025242 Ga0209258_100075 Ga0209258_10007584 451
793 3300025246 Ga0209646_1000005 Ga0209646_1000005487 451
794 3300025250 Ga0209026_1000149 Ga0209026_100014920 451
795 3300025254 Ga0209148_1000085 Ga0209148_1000085145 451
796 3300025273 Ga0209673_1000242 Ga0209673_100024283 451
797 3300025284 Ga0209130_1005269 Ga0209130_10052693 451
798 3300025297 Ga0209758_1000795 Ga0209758_100079537 451
799 3300025298 Ga0209050_1000298 Ga0209050_10002989 451
800 3300025302 Ga0207426_1000057 Ga0207426_100005750 451
801 3300025302 Ga0207426_1000262 Ga0207426_100026243 451
802 3300025302 Ga0207426_1004443 Ga0207426_10044437 451
803 3300025303 Ga0209051_1033315 Ga0209051_10333152 451
804 3300025304 Ga0209257_1000004 Ga0209257_10000041088 451
805 3300025304 Ga0209257_1002372 Ga0209257_100237215 451
806 3300025900 Ga0207710_10008013 Ga0207710_100080134 451
807 3300025904 Ga0207647_10026087 Ga0207647_100260872 451
808 3300025911 Ga0207654_10000850 Ga0207654_100008503 451
809 3300025912 Ga0207707_10000879 Ga0207707_1000087915 451
810 3300025913 Ga0207695_10000078 Ga0207695_10000078224 451
811 3300025913 Ga0207695_10000135 Ga0207695_10000135148 451
812 3300025913 Ga0207695_10002580 Ga0207695_1000258019 451
813 3300025913 Ga0207695_10022744 Ga0207695_100227444 451
814 3300025913 Ga0207695_10069174 Ga0207695_100691743 451
815 3300025913 Ga0207695_10082557 Ga0207695_100825573 451
816 3300025913 Ga0207695_10272784 Ga0207695_102727841 451
817 3300025914 Ga0207671_10000067 Ga0207671_1000006799 451
818 3300025919 Ga0207657_10004379 Ga0207657_100043796 451
819 3300025919 Ga0207657_10026674 Ga0207657_100266742 451
820 3300025921 Ga0207652_10000397 Ga0207652_1000039730 451
821 3300025921 Ga0207652_10002811 Ga0207652_1000281110 451
822 3300025925 Ga0207650_10082949 Ga0207650_100829493 451
823 3300025925 Ga0207650_10121697 Ga0207650_101216972 451
824 3300025931 Ga0207644_10050893 Ga0207644_100508935 451
825 3300025931 Ga0207644_10127237 Ga0207644_101272372 451
826 3300025936 Ga0207670_10082900 Ga0207670_100829002 451
827 3300025949 Ga0207667_10016081 Ga0207667_100160813 451
828 3300025960 Ga0207651_10115991 Ga0207651_101159912 451
829 3300025986 Ga0207658_10012058 Ga0207658_100120587 451
830 3300026023 Ga0207677_10057408 Ga0207677_100574082 451
831 3300026035 Ga0207703_10002553 Ga0207703_100025532 451
832 3300026088 Ga0207641_10042014 Ga0207641_100420145 451
833 3300026089 Ga0207648_10075557 Ga0207648_100755575 451
834 3300026121 Ga0207683_10028008 Ga0207683_100280082 451
835 3300026142 Ga0207698_10008350 Ga0207698_100083502 451
836 3300028379 Ga0268266_10007008 Ga0268266_100070088 451
837 3300028380 Ga0268265_10079511 Ga0268265_100795114 451
838 3300028381 Ga0268264_10007161 Ga0268264_100071619 451
839 3300028786 Ga0307517_10014190 Ga0307517_100141902 451
840 3300028794 Ga0307515_10000455 Ga0307515_100004557 451
841 3300031251 Ga0265327_10000421 Ga0265327_1000042166 451
842 3300031507 Ga0307509_10056935 Ga0307509_100569354 451
843 3300031616 Ga0307508_10002437 Ga0307508_1000243711 451
844 3300031730 Ga0307516_10000310 Ga0307516_100003102 451
845 3300032004 Ga0307414_10000049 Ga0307414_10000049109 451
846 3300036401 Ga0373937_0109307 Ga0373937_0109307_253_1611 451
847 3300041997 Ga0439431_0000062 Ga0439431_0000062_1827_3188 451
848 3300042002 Ga0439442_006659 Ga0439442_006659_189_1550 451
849 3300042014 Ga0439457_002934 Ga0439457_002934_561_1922 451
850 3300042876 Ga0451577_0026339 Ga0451577_0026339_2803_4161 451
851 3300044656 Ga0466969_0000847 Ga0466969_0000847_9551_10909 451
852 3300044656 Ga0466969_0029848 Ga0466969_0029848_967_2331 451
853 3300044684 Ga0466966_0000176 Ga0466966_0000176_28167_29525 451
854 3300044693 Ga0466961_0037351 Ga0466961_0037351_1161_2519 451
855 3300044712 Ga0453684_0063668 Ga0453684_0063668_702_2060 451
856 3300044719 Ga0466971_0033117 Ga0466971_0033117_364_1722 451
857 3300045049 Ga0466959_0000016 Ga0466959_0000016_76670_78028 451
858 3300045049 Ga0466959_0044930 Ga0466959_0044930_1768_3126 451
859 3300046457 Ga0495590_0003056 Ga0495590_0003056_1691_3046 451
860 3300046507 Ga0495606_0037730 Ga0495606_0037730_598_1956 451
861 3300046525 Ga0495663_0000021 Ga0495663_0000021_110083_111438 451
862 3300046538 Ga0495609_0000010 Ga0495609_0000010_85752_87107 451
863 3300046558 Ga0495633_0000022 Ga0495633_0000022_74049_75413 451
864 3300046616 Ga0495668_0000321 Ga0495668_0000321_63892_65247 451
865 3300046616 Ga0495668_0007476 Ga0495668_0007476_5388_6746 451
866 3300046642 Ga0495634_0080033 Ga0495634_0080033_448_1806 451
867 3300046660 Ga0495625_0042194 Ga0495625_0042194_826_2181 451
868 3300046663 Ga0495635_0026484 Ga0495635_0026484_2431_3789 451
869 3300046683 Ga0495658_0011871 Ga0495658_0011871_2278_3636 451
870 3300047319 Ga0495674_0007992 Ga0495674_0007992_4847_6205 451
871 3300047320 Ga0495672_0053737 Ga0495672_0053737_205_1560 451
872 3300047472 Ga0495686_0001267 Ga0495686_0001267_19849_21207 451
873 3300047472 Ga0495686_0017600 Ga0495686_0017600_1959_3317 451
874 3300048924 Ga0496121_0000010 Ga0496121_0000010_184819_186183 451
875 3300048929 Ga0496126_0014044 Ga0496126_0014044_4496_5860 451
876 3300049568 Ga0501031_0090921 Ga0501031_0090921_215_1573 451
877 3300049571 Ga0501034_0083677 Ga0501034_0083677_952_2325 451
878 3300049572 Ga0501036_0016492 Ga0501036_0016492_4288_5646 451
879 3300049574 Ga0501038_0001508 Ga0501038_0001508_4087_5445 451
880 3300049575 Ga0501039_0110242 Ga0501039_0110242_339_1697 451
881 3300049579 Ga0501043_0021821 Ga0501043_0021821_3534_4892 451
882 3300049580 Ga0501046_0066426 Ga0501046_0066426_647_2005 451
883 3300049581 Ga0501047_0061998 Ga0501047_0061998_517_1875 451
884 3300049582 Ga0501048_0123886 Ga0501048_0123886_157_1530 451
885 3300049584 Ga0501068_0030821 Ga0501068_0030821_1077_2438 451
886 3300049585 Ga0501069_0015946 Ga0501069_0015946_490_1851 451
887 3300049586 Ga0501070_0014791 Ga0501070_0014791_999_2360 451
888 3300049590 Ga0501074_0002906 Ga0501074_0002906_2591_3952 451
889 3300049590 Ga0501074_0016810 Ga0501074_0016810_2771_4144 451
890 3300049703 Ga0501219_000023 Ga0501219_000023_9703_11061 451
891 3300049742 Ga0501080_0046393 Ga0501080_0046393_2547_3908 451
892 3300049823 Ga0501044_0054411 Ga0501044_0054411_2406_3767 451
893 3300049823 Ga0501044_0064559 Ga0501044_0064559_170_1528 451
894 3300049823 Ga0501044_0264979 Ga0501044_0264979_149_1504 451
895 3300050005 Ga0501284_00005 Ga0501284_00005_136127_137485 451
896 3300050507 nmdc:mga05p37_3495_c1 nmdc:mga05p37_3495_c1_1862_3220 451
897 3300053088 Ga0500644_0000078 Ga0500644_0000078_9584_10945 451
898 3300053092 Ga0500583_0000037 Ga0500583_0000037_62380_63738 451
899 3300053134 Ga0500658_0002864 Ga0500658_0002864_2461_3822 451
900 3300053136 Ga0500559_0033293 Ga0500559_0033293_631_1992 451
901 3300053142 Ga0500577_0018098 Ga0500577_0018098_119_1480 451
902 3300053148 Ga0500590_077471 Ga0500590_077471_173_1534 451
903 3300053156 Ga0500622_0000497 Ga0500622_0000497_29866_31230 451
904 3300053160 Ga0500633_0001791 Ga0500633_0001791_552_1913 451
905 3300053163 Ga0500639_083027 Ga0500639_083027_149_1507 451
906 3300053727 Ga0500611_000010 Ga0500611_000010_128490_129848 451
907 3300060353 Ga0501082_0001933 Ga0501082_0001933_15255_16616 451
908 iso_pu_bacteria 2818991442 2819571932 451
909 2162886007 SwRhRL2b_contig_1203094 SwRhRL2b_0835.00000930 452
910 3300003323 rootH1_10066896 rootH1_100668963 452
911 3300003784 Ga0055534_1007919 Ga0055534_10079192 452
912 3300005289 Ga0065704_10002179 Ga0065704_1000217911 452
913 3300005289 Ga0065704_10076736 Ga0065704_100767361 452
914 3300005337 Ga0070682_100000095 Ga0070682_10000009564 452
915 3300009036 Ga0105244_10000018 Ga0105244_1000001880 452
916 3300009148 Ga0105243_10000089 Ga0105243_100000892 452
917 3300009553 Ga0105249_10039631 Ga0105249_100396314 452
918 3300013104 Ga0157370_10005025 Ga0157370_1000502510 452
919 3300015261 Ga0182006_1000079 Ga0182006_100007958 452
920 3300025291 Ga0209675_1000159 Ga0209675_10001593 452
921 3300025728 Ga0207655_1000058 Ga0207655_1000058186 452
922 3300025935 Ga0207709_10000136 Ga0207709_100001366 452
923 3300025961 Ga0207712_10024280 Ga0207712_100242804 452
924 3300031911 Ga0307412_10000140 Ga0307412_1000014023 452
925 3300032002 Ga0307416_100000020 Ga0307416_100000020128 452
926 3300044658 Ga0466972_0000143 Ga0466972_0000143_52338_53702 452
927 3300046453 Ga0495627_000029 Ga0495627_000029_83163_84521 452
928 3300046460 Ga0495638_0044598 Ga0495638_0044598_502_1860 452
929 3300046500 Ga0495596_0000410 Ga0495596_0000410_16803_18161 452
930 3300046512 Ga0495610_0000001 Ga0495610_0000001_68095_69453 452
931 3300046522 Ga0495643_0025161 Ga0495643_0025161_187_1545 452
932 3300046525 Ga0495663_0001260 Ga0495663_0001260_4679_6037 452
933 3300046530 Ga0495654_0000008 Ga0495654_0000008_313477_314835 452
934 3300046558 Ga0495633_0000048 Ga0495633_0000048_148629_149987 452
935 3300047472 Ga0495686_0000153 Ga0495686_0000153_74582_75940 452
936 3300047472 Ga0495686_0004393 Ga0495686_0004393_1888_3246 452
937 3300048905 Ga0496102_0014102 Ga0496102_0014102_1800_3158 452
938 3300048906 Ga0496103_0016341 Ga0496103_0016341_1163_2521 452
939 3300048907 Ga0496104_0241239 Ga0496104_0241239_339_1697 452
940 3300048916 Ga0496113_0069442 Ga0496113_0069442_907_2265 452
941 3300048919 Ga0496116_0000037 Ga0496116_0000037_70934_72292 452
942 3300048920 Ga0496117_0000086 Ga0496117_0000086_70820_72178 452
943 3300048921 Ga0496118_0000284 Ga0496118_0000284_16790_18148 452
944 3300048922 Ga0496119_0000037 Ga0496119_0000037_70869_72227 452
945 3300048925 Ga0496122_0000510 Ga0496122_0000510_72465_73823 452
946 3300048925 Ga0496122_0000602 Ga0496122_0000602_35517_36875 452
947 3300048925 Ga0496122_0003432 Ga0496122_0003432_18677_20035 452
948 3300048925 Ga0496122_0003771 Ga0496122_0003771_14976_16334 452
949 3300048925 Ga0496122_0057511 Ga0496122_0057511_575_1933 452
950 3300048926 Ga0496123_0013079 Ga0496123_0013079_4518_5876 452
951 3300048926 Ga0496123_0014595 Ga0496123_0014595_4591_5949 452
952 3300048926 Ga0496123_0019833 Ga0496123_0019833_833_2191 452
953 3300048927 Ga0496124_0000555 Ga0496124_0000555_29498_30856 452
954 3300048928 Ga0496125_0012093 Ga0496125_0012093_2587_3945 452
955 3300048928 Ga0496125_0023772 Ga0496125_0023772_3560_4918 452
956 3300048929 Ga0496126_0008259 Ga0496126_0008259_6831_8189 452
957 3300048929 Ga0496126_0097741 Ga0496126_0097741_450_1808 452
958 3300053086 Ga0500578_0000296 Ga0500578_0000296_27189_28553 452
959 iso_pu_bacteria 2739367874 2740060709 452

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01512

Complex1_51K

Respiratory-chain NADH dehydrogenase 51 Kd subunit

46

213

0.97

PF10589

NADH_4Fe-4S

NADH-ubiquinone oxidoreductase-F iron-sulfur binding region

336

420

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gym-assembly1.cif.gz_v1 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9015 5 428
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.8997 2 427
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.8986 2 427
6vw7-assembly1.cif.gz_B formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.8983 2 422
7ard-assembly1.cif.gz_F cryo-em structure of polytomella complex-i (complete composition) 0.8952 5 427
ID Description Score Start End Superfamily
2fugA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.8842 50 220 3.40.50.11540
af_O94500_78_261_3.40.50.11540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.8706 50 221 3.40.50.11540
2fugA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.8427 50 220 3.40.50.11540
af_P9WIV7_336_431_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.8351 337 428 1.20.1440.230
af_A1ZAW7_585_680_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.8329 338 428 1.20.1440.230
ID Description Score Start End GO Terms
AF-A0A7X9KPD5-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9813 1 161 GO:0016491
GO:0046872
GO:0051539
AF-A0A7X9KPD5-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9753 1 161 GO:0016491
GO:0046872
GO:0051539
AF-A0A6B3C9I9-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9605 9 142 GO:0016491
GO:0046872
GO:0048038
GO:0051539
AF-A0A3N9NRM1-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9581 17 148 GO:0016491
GO:0046872
GO:0048038
GO:0051539
AF-A0A4Q3Q8W7-F1-model_v4 deleted 0.9576 1 171

Feature Viewer

pLDDT pTM Quality
82.11 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map