F486823
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 959 | 400 | 895 | 450 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10090626|Ga0307516_100906262 |
| Length | 448 |
| Sequence | MGRKLLLEKANVEGIRGYDVYRREGGYRSVEKALKTMTPDQVTDEVKKSGLRGRGGAGFPTGMKWSFLAKPEGVPRYLVCNADESEPGTFKDRYLMEFIPHLLIEGLIVSSYALGSHATYIYIRGEYAWIPDILEQAVEEAKAANILGTGYDLEIYVHRGAGAYICGEETALIESLEGKRGNPRIKPPFPAVKGVWDCPTVVNNVETLAAVVPIINNGGEDYSKIGVGKSTGTKLLSACGNINKPGVYEIDMTISVEEFIYSDEYCGGIPNGKRLKACIPGGSSVPILPANLLLKTAKGETRMMNYESLSDGGFAKGSMMGSGGFIVLDEDQCVVRHTLTLARFYRHESCGQCSPCREGTGWMEKILKNIEYGKGKSSDIDLLWDIQRKIEGNTICPLGDAAAWPVAAAIRHFRDEFEWHVANPQESQGRNYGLANYADPLPLAPTPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 4 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 5 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 6 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 7 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 8 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 9 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 10 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 11 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 12 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 13 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 14 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 15 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 16 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 17 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 18 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 19 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 20 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 21 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 22 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 23 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 24 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 25 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 26 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 27 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 28 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 29 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 30 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 31 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 32 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 33 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 34 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 35 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 36 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 37 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 38 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 39 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 40 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 41 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 42 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 43 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 44 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 45 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 46 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 47 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 48 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 49 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 50 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 51 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 52 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 53 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 54 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 55 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 56 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 57 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 58 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 59 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 60 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 61 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 62 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 63 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 64 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 65 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 66 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 67 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 69 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 70 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 71 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 72 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 82 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 89 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 93 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 105 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 114 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 125 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 127 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 128 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 129 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 130 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 131 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 132 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 133 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 134 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 135 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 136 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 137 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 138 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 139 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 140 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 141 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 143 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 144 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 145 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 146 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 147 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 148 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 176 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 180 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 181 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 183 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 250 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 251 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 252 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 253 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 254 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 255 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 272 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 273 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 274 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 275 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 276 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 277 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 280 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 281 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 286 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 287 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 356 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 357 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 358 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 361 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 362 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 364 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 365 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 367 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 368 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 372 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 373 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 374 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 375 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 387 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 389 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 393 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 396 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 397 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 398 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.22 |
| Metatranscriptomes | 0 |
| Isolates | 6.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 5.01 |
| Nodule | 0.1 |
| Rhizoplane | 0.94 |
| Rhizosphere | 86.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1203094 | 2162886007 | Bacteria | 2513 |
| 2 | SwRhRL2b_contig_3262938 | 2162886007 | Bacteria | 1997 |
| 3 | SwRhRL2b_contig_677025 | 2162886007 | Bacteria | 181955 |
| 4 | JGI24737J22298_10007402 | 3300001990 | Bacteria | 3706 |
| 5 | JGI25406J46586_10003552 | 3300003203 | Bacteria | 7306 |
| 6 | JGI25153J46596_10015999 | 3300003215 | Bacteria | 3028 |
| 7 | rootH2_10000933 | 3300003320 | Bacteria | 60850 |
| 8 | rootH2_10012714 | 3300003320 | Bacteria | 66260 |
| 9 | rootH2_10027208 | 3300003320 | Bacteria | 3894 |
| 10 | rootH2_10065769 | 3300003320 | Bacteria | 9761 |
| 11 | rootH2_10073988 | 3300003320 | Bacteria | 4230 |
| 12 | rootH1_10009896 | 3300003316 | Bacteria | 1485 |
| 13 | rootH1_10009896 | 3300003323 | Bacteria | 7746 |
| 14 | rootH1_10066896 | 3300003323 | Bacteria | 4568 |
| 15 | rootH1_10101281 | 3300003323 | Bacteria | 2750 |
| 16 | JGI25160J50197_1002225 | 3300003354 | Bacteria | 9104 |
| 17 | JGI25160J50197_1007805 | 3300003354 | Bacteria | 4144 |
| 18 | JGI25160J50197_1009408 | 3300003354 | Bacteria | 3626 |
| 19 | Ga0055542_1004849 | 3300003762 | Bacteria | 3152 |
| 20 | Ga0055526_1009867 | 3300003771 | Bacteria | 4529 |
| 21 | Ga0055534_1007919 | 3300003784 | Bacteria | 2468 |
| 22 | Ga0055528_1001384 | 3300003790 | Bacteria | 14897 |
| 23 | Ga0055530_10000584 | 3300003791 | Bacteria | 31522 |
| 24 | Ga0055531_10000132 | 3300003794 | Bacteria | 85251 |
| 25 | Ga0055531_10029285 | 3300003794 | Bacteria | 1878 |
| 26 | Ga0065165_1000914 | 3300005262 | Bacteria | 38063 |
| 27 | Ga0065165_1028630 | 3300005262 | Bacteria | 1796 |
| 28 | Ga0065714_10064700 | 3300005288 | Bacteria | 22656 |
| 29 | Ga0065704_10002179 | 3300005289 | Bacteria | 9547 |
| 30 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 31 | Ga0065704_10071654 | 3300005289 | Bacteria | 10363 |
| 32 | Ga0065704_10076736 | 3300005289 | Bacteria | 4983 |
| 33 | Ga0065712_10072974 | 3300005290 | Bacteria | 4496 |
| 34 | Ga0065712_10074656 | 3300005290 | Bacteria | 4042 |
| 35 | Ga0070658_10011839 | 3300005327 | Bacteria | 7002 |
| 36 | Ga0070658_10021983 | 3300005327 | Bacteria | 5115 |
| 37 | Ga0070658_10101610 | 3300005327 | Bacteria | 2377 |
| 38 | Ga0070676_10000113 | 3300005328 | Bacteria | 29666 |
| 39 | Ga0070676_10001094 | 3300005328 | Bacteria | 13533 |
| 40 | Ga0070676_10005256 | 3300005328 | Bacteria | 6883 |
| 41 | Ga0070683_100000553 | 3300005329 | Bacteria | 26515 |
| 42 | Ga0070683_100002523 | 3300005329 | Bacteria | 14587 |
| 43 | Ga0070683_100004195 | 3300005329 | Bacteria | 11821 |
| 44 | Ga0070683_100005141 | 3300005329 | Bacteria | 10883 |
| 45 | Ga0070683_100045229 | 3300005329 | Bacteria | 4063 |
| 46 | Ga0070683_100081489 | 3300005329 | Bacteria | 3030 |
| 47 | Ga0070683_100156917 | 3300005329 | Bacteria | 2158 |
| 48 | Ga0070690_100016610 | 3300005330 | Bacteria | 4413 |
| 49 | Ga0070690_100021267 | 3300005330 | Bacteria | 3959 |
| 50 | Ga0070690_100128920 | 3300005330 | Bacteria | 1706 |
| 51 | Ga0070670_100032098 | 3300005331 | Bacteria | 4522 |
| 52 | Ga0070670_100091270 | 3300005331 | Bacteria | 2619 |
| 53 | Ga0070670_100100003 | 3300005331 | Bacteria | 2496 |
| 54 | Ga0070670_100109275 | 3300005331 | Bacteria | 2383 |
| 55 | Ga0070670_100243744 | 3300005331 | Bacteria | 1565 |
| 56 | Ga0070677_10028216 | 3300005333 | Bacteria | 2119 |
| 57 | Ga0070677_10038879 | 3300005333 | Bacteria | 1864 |
| 58 | Ga0068869_100003465 | 3300005334 | Bacteria | 9646 |
| 59 | Ga0068869_100006312 | 3300005334 | Bacteria | 7504 |
| 60 | Ga0068869_100025796 | 3300005334 | Bacteria | 4085 |
| 61 | Ga0068869_100064509 | 3300005334 | Bacteria | 2694 |
| 62 | Ga0070666_10000019 | 3300005335 | Bacteria | 185877 |
| 63 | Ga0070666_10003803 | 3300005335 | Bacteria | 9154 |
| 64 | Ga0070666_10011816 | 3300005335 | Bacteria | 5490 |
| 65 | Ga0070666_10046115 | 3300005335 | Bacteria | 2923 |
| 66 | Ga0070680_100003171 | 3300005336 | Bacteria | 12221 |
| 67 | Ga0070680_100101249 | 3300005336 | Bacteria | 2391 |
| 68 | Ga0070680_100182096 | 3300005336 | Bacteria | 1770 |
| 69 | Ga0070682_100000095 | 3300005337 | Bacteria | 80688 |
| 70 | Ga0070682_100000129 | 3300005337 | Bacteria | 64098 |
| 71 | Ga0070682_100002730 | 3300005337 | Bacteria | 9779 |
| 72 | Ga0070682_100021389 | 3300005337 | Bacteria | 3817 |
| 73 | Ga0068868_100001431 | 3300005338 | Bacteria | 16462 |
| 74 | Ga0068868_100006616 | 3300005338 | Bacteria | 8217 |
| 75 | Ga0068868_100023995 | 3300005338 | Bacteria | 4622 |
| 76 | Ga0068868_100057848 | 3300005338 | Bacteria | 3064 |
| 77 | Ga0068868_100179953 | 3300005338 | Bacteria | 1753 |
| 78 | Ga0070660_100001175 | 3300005339 | Bacteria | 17707 |
| 79 | Ga0070660_100022055 | 3300005339 | Bacteria | 4705 |
| 80 | Ga0070660_100123168 | 3300005339 | Bacteria | 2070 |
| 81 | Ga0070660_100133547 | 3300005339 | Bacteria | 1987 |
| 82 | Ga0070689_100041636 | 3300005340 | Bacteria | 3526 |
| 83 | Ga0070689_100053033 | 3300005340 | Bacteria | 3138 |
| 84 | Ga0070689_100130139 | 3300005340 | Bacteria | 2018 |
| 85 | Ga0070691_10000858 | 3300005341 | Bacteria | 12290 |
| 86 | Ga0070687_100062734 | 3300005343 | Bacteria | 1969 |
| 87 | Ga0070661_100000179 | 3300005344 | Bacteria | 52306 |
| 88 | Ga0070661_100077158 | 3300005344 | Bacteria | 2456 |
| 89 | Ga0070668_100001636 | 3300005347 | Bacteria | 16228 |
| 90 | Ga0070668_100036105 | 3300005347 | Bacteria | 3771 |
| 91 | Ga0070669_100006616 | 3300005353 | Bacteria | 8344 |
| 92 | Ga0070669_100085507 | 3300005353 | Bacteria | 2355 |
| 93 | Ga0070675_100208513 | 3300005354 | Bacteria | 1698 |
| 94 | Ga0070671_100022897 | 3300005355 | Bacteria | 5106 |
| 95 | Ga0070671_100090702 | 3300005355 | Bacteria | 2559 |
| 96 | Ga0070671_100131533 | 3300005355 | Bacteria | 2107 |
| 97 | Ga0070671_100219718 | 3300005355 | Bacteria | 1612 |
| 98 | Ga0070674_100004529 | 3300005356 | Bacteria | 7935 |
| 99 | Ga0070673_100035374 | 3300005364 | Bacteria | 3787 |
| 100 | Ga0070673_100048895 | 3300005364 | Bacteria | 3299 |
| 101 | Ga0070673_100129050 | 3300005364 | Bacteria | 2119 |
| 102 | Ga0070673_100135041 | 3300005364 | Bacteria | 2075 |
| 103 | Ga0070673_100145283 | 3300005364 | Bacteria | 2005 |
| 104 | Ga0070673_100147895 | 3300005364 | Bacteria | 1987 |
| 105 | Ga0070688_100002588 | 3300005365 | Bacteria | 9164 |
| 106 | Ga0070688_100011134 | 3300005365 | Bacteria | 4993 |
| 107 | Ga0070659_100001588 | 3300005366 | Bacteria | 16376 |
| 108 | Ga0070659_100017521 | 3300005366 | Bacteria | 5394 |
| 109 | Ga0070659_100021878 | 3300005366 | Bacteria | 4878 |
| 110 | Ga0070659_100092731 | 3300005366 | Bacteria | 2422 |
| 111 | Ga0070659_100096396 | 3300005366 | Bacteria | 2376 |
| 112 | Ga0070667_100001113 | 3300005367 | Bacteria | 24519 |
| 113 | Ga0070667_100002121 | 3300005367 | Bacteria | 17485 |
| 114 | Ga0070667_100066412 | 3300005367 | Bacteria | 3065 |
| 115 | Ga0070667_100073882 | 3300005367 | Bacteria | 2908 |
| 116 | Ga0070667_100100035 | 3300005367 | Bacteria | 2503 |
| 117 | Ga0070667_100168373 | 3300005367 | Bacteria | 1933 |
| 118 | Ga0070701_10026249 | 3300005438 | Bacteria | 2839 |
| 119 | Ga0070700_100091756 | 3300005441 | Bacteria | 1984 |
| 120 | Ga0070663_100109185 | 3300005455 | Bacteria | 2076 |
| 121 | Ga0070678_100000905 | 3300005456 | Bacteria | 15223 |
| 122 | Ga0070678_100003904 | 3300005456 | Bacteria | 8381 |
| 123 | Ga0070678_100009316 | 3300005456 | Bacteria | 5941 |
| 124 | Ga0070662_100006914 | 3300005457 | Bacteria | 7344 |
| 125 | Ga0070662_100013751 | 3300005457 | Bacteria | 5390 |
| 126 | Ga0070662_100036378 | 3300005457 | Bacteria | 3482 |
| 127 | Ga0070662_100053128 | 3300005457 | Bacteria | 2932 |
| 128 | Ga0070662_100095908 | 3300005457 | Bacteria | 2237 |
| 129 | Ga0070662_100129292 | 3300005457 | Bacteria | 1945 |
| 130 | Ga0070681_10048862 | 3300005458 | Bacteria | 4226 |
| 131 | Ga0070681_10066593 | 3300005458 | Bacteria | 3571 |
| 132 | Ga0070681_10094284 | 3300005458 | Bacteria | 2942 |
| 133 | Ga0068867_100003787 | 3300005459 | Bacteria | 10644 |
| 134 | Ga0068867_100016216 | 3300005459 | Bacteria | 5291 |
| 135 | Ga0068867_100023112 | 3300005459 | Bacteria | 4450 |
| 136 | Ga0068867_100061101 | 3300005459 | Bacteria | 2797 |
| 137 | Ga0068867_100165642 | 3300005459 | Bacteria | 1746 |
| 138 | Ga0070685_10079666 | 3300005466 | Bacteria | 1960 |
| 139 | Ga0070698_100003913 | 3300005471 | Bacteria | 16377 |
| 140 | Ga0070698_100009186 | 3300005471 | Bacteria | 10609 |
| 141 | Ga0070698_100169495 | 3300005471 | Bacteria | 2125 |
| 142 | Ga0070698_100171722 | 3300005471 | Bacteria | 2109 |
| 143 | Ga0070699_100060944 | 3300005518 | Bacteria | 3270 |
| 144 | Ga0070679_100001926 | 3300005530 | Bacteria | 18645 |
| 145 | Ga0070679_100010564 | 3300005530 | Bacteria | 8758 |
| 146 | Ga0070679_100019927 | 3300005530 | Bacteria | 6533 |
| 147 | Ga0070679_100056362 | 3300005530 | Bacteria | 3915 |
| 148 | Ga0070679_100110417 | 3300005530 | Bacteria | 2736 |
| 149 | Ga0070679_100253010 | 3300005530 | Bacteria | 1717 |
| 150 | Ga0070684_100001469 | 3300005535 | Bacteria | 17002 |
| 151 | Ga0070684_100011020 | 3300005535 | Bacteria | 7191 |
| 152 | Ga0070684_100011625 | 3300005535 | Bacteria | 7016 |
| 153 | Ga0070684_100042255 | 3300005535 | Bacteria | 3934 |
| 154 | Ga0068853_100001537 | 3300005539 | Bacteria | 16786 |
| 155 | Ga0068853_100021044 | 3300005539 | Bacteria | 5430 |
| 156 | Ga0068853_100024340 | 3300005539 | Bacteria | 5075 |
| 157 | Ga0068853_100032462 | 3300005539 | Bacteria | 4423 |
| 158 | Ga0068853_100041673 | 3300005539 | Bacteria | 3924 |
| 159 | Ga0068853_100084041 | 3300005539 | Bacteria | 2789 |
| 160 | Ga0070672_100001082 | 3300005543 | Bacteria | 16598 |
| 161 | Ga0070672_100004444 | 3300005543 | Bacteria | 9178 |
| 162 | Ga0070672_100069759 | 3300005543 | Bacteria | 2792 |
| 163 | Ga0070672_100073243 | 3300005543 | Bacteria | 2730 |
| 164 | Ga0070693_100074587 | 3300005547 | Bacteria | 2007 |
| 165 | Ga0070665_100000094 | 3300005548 | Bacteria | 171072 |
| 166 | Ga0070665_100004249 | 3300005548 | Bacteria | 15068 |
| 167 | Ga0070665_100005115 | 3300005548 | Bacteria | 13603 |
| 168 | Ga0070665_100031963 | 3300005548 | Bacteria | 5298 |
| 169 | Ga0070665_100117865 | 3300005548 | Bacteria | 2658 |
| 170 | Ga0070704_100051890 | 3300005549 | Bacteria | 2891 |
| 171 | Ga0068855_100000399 | 3300005563 | Bacteria | 53597 |
| 172 | Ga0068855_100009093 | 3300005563 | Bacteria | 12007 |
| 173 | Ga0068855_100027369 | 3300005563 | Bacteria | 6820 |
| 174 | Ga0068855_100036378 | 3300005563 | Bacteria | 5860 |
| 175 | Ga0068855_100068908 | 3300005563 | Bacteria | 4117 |
| 176 | Ga0068855_100113157 | 3300005563 | Bacteria | 3114 |
| 177 | Ga0068855_100208823 | 3300005563 | Bacteria | 2195 |
| 178 | Ga0068855_100248059 | 3300005563 | Bacteria | 1987 |
| 179 | Ga0068855_100248143 | 3300005563 | Bacteria | 1986 |
| 180 | Ga0068855_100279633 | 3300005563 | Bacteria | 1854 |
| 181 | Ga0070664_100001077 | 3300005564 | Bacteria | 21494 |
| 182 | Ga0070664_100001338 | 3300005564 | Bacteria | 19647 |
| 183 | Ga0070664_100004250 | 3300005564 | Bacteria | 11518 |
| 184 | Ga0070664_100250991 | 3300005564 | Bacteria | 1590 |
| 185 | Ga0068857_100011099 | 3300005577 | Bacteria | 7837 |
| 186 | Ga0068857_100022387 | 3300005577 | Bacteria | 5560 |
| 187 | Ga0068857_100032063 | 3300005577 | Bacteria | 4645 |
| 188 | Ga0068857_100057307 | 3300005577 | Bacteria | 3458 |
| 189 | Ga0068854_100007104 | 3300005578 | Bacteria | 7149 |
| 190 | Ga0068856_100006224 | 3300005614 | Bacteria | 11711 |
| 191 | Ga0068856_100039390 | 3300005614 | Bacteria | 4640 |
| 192 | Ga0068856_100074039 | 3300005614 | Bacteria | 3371 |
| 193 | Ga0068852_100001228 | 3300005616 | Bacteria | 17072 |
| 194 | Ga0068852_100020168 | 3300005616 | Bacteria | 5296 |
| 195 | Ga0068852_100026592 | 3300005616 | Bacteria | 4706 |
| 196 | Ga0068852_100027173 | 3300005616 | Bacteria | 4661 |
| 197 | Ga0068852_100044678 | 3300005616 | Bacteria | 3765 |
| 198 | Ga0068852_100127635 | 3300005616 | Bacteria | 2338 |
| 199 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 200 | Ga0068859_100009898 | 3300005617 | Bacteria | 9629 |
| 201 | Ga0068859_100010935 | 3300005617 | Bacteria | 9136 |
| 202 | Ga0068859_100032552 | 3300005617 | Bacteria | 5237 |
| 203 | Ga0068859_100048393 | 3300005617 | Bacteria | 4271 |
| 204 | Ga0068859_100057532 | 3300005617 | Bacteria | 3916 |
| 205 | Ga0068859_100098912 | 3300005617 | Bacteria | 2972 |
| 206 | Ga0068859_100173554 | 3300005617 | Bacteria | 2237 |
| 207 | Ga0068859_100227010 | 3300005617 | Bacteria | 1955 |
| 208 | Ga0068859_100243764 | 3300005617 | Bacteria | 1887 |
| 209 | Ga0068859_100279643 | 3300005617 | Bacteria | 1761 |
| 210 | Ga0068864_100023214 | 3300005618 | Bacteria | 5207 |
| 211 | Ga0068864_100030528 | 3300005618 | Bacteria | 4568 |
| 212 | Ga0068866_10081356 | 3300005718 | Bacteria | 1740 |
| 213 | Ga0068861_100000312 | 3300005719 | Bacteria | 27173 |
| 214 | Ga0068861_100001193 | 3300005719 | Bacteria | 16169 |
| 215 | Ga0068861_100061833 | 3300005719 | Bacteria | 2875 |
| 216 | Ga0068870_10028139 | 3300005840 | Bacteria | 2819 |
| 217 | Ga0068863_100014098 | 3300005841 | Bacteria | 7700 |
| 218 | Ga0068863_100027191 | 3300005841 | Bacteria | 5455 |
| 219 | Ga0068863_100063235 | 3300005841 | Bacteria | 3500 |
| 220 | Ga0068863_100068572 | 3300005841 | Bacteria | 3355 |
| 221 | Ga0068858_100001874 | 3300005842 | Bacteria | 21456 |
| 222 | Ga0068858_100027822 | 3300005842 | Bacteria | 5252 |
| 223 | Ga0068858_100030456 | 3300005842 | Bacteria | 5010 |
| 224 | Ga0068858_100094319 | 3300005842 | Bacteria | 2788 |
| 225 | Ga0068858_100118933 | 3300005842 | Bacteria | 2470 |
| 226 | Ga0068860_100000052 | 3300005843 | Bacteria | 207351 |
| 227 | Ga0068860_100006756 | 3300005843 | Bacteria | 11507 |
| 228 | Ga0068860_100013335 | 3300005843 | Bacteria | 8058 |
| 229 | Ga0068860_100038399 | 3300005843 | Bacteria | 4580 |
| 230 | Ga0068860_100056184 | 3300005843 | Bacteria | 3743 |
| 231 | Ga0068860_100190834 | 3300005843 | Bacteria | 1983 |
| 232 | Ga0068860_100201020 | 3300005843 | Bacteria | 1931 |
| 233 | Ga0068862_100004828 | 3300005844 | Bacteria | 11355 |
| 234 | Ga0068862_100283256 | 3300005844 | Bacteria | 1520 |
| 235 | Ga0081539_10000418 | 3300005985 | Bacteria | 90493 |
| 236 | Ga0070716_100011309 | 3300006173 | Bacteria | 4494 |
| 237 | Ga0097621_100000015 | 3300006237 | Bacteria | 92182 |
| 238 | Ga0097621_100000611 | 3300006237 | Bacteria | 25252 |
| 239 | Ga0097621_100004099 | 3300006237 | Bacteria | 10109 |
| 240 | Ga0097621_100012278 | 3300006237 | Bacteria | 6340 |
| 241 | Ga0097621_100019146 | 3300006237 | Bacteria | 5248 |
| 242 | Ga0097621_100246296 | 3300006237 | Bacteria | 1564 |
| 243 | Ga0068871_100000051 | 3300006358 | Bacteria | 64844 |
| 244 | Ga0068871_100000634 | 3300006358 | Bacteria | 24163 |
| 245 | Ga0068871_100002800 | 3300006358 | Bacteria | 11923 |
| 246 | Ga0068871_100020463 | 3300006358 | Bacteria | 5070 |
| 247 | Ga0068871_100045310 | 3300006358 | Bacteria | 3540 |
| 248 | Ga0068871_100063228 | 3300006358 | Bacteria | 3026 |
| 249 | Ga0068871_100063902 | 3300006358 | Bacteria | 3011 |
| 250 | Ga0068871_100100867 | 3300006358 | Bacteria | 2418 |
| 251 | Ga0068871_100229903 | 3300006358 | Bacteria | 1609 |
| 252 | Ga0068871_100253906 | 3300006358 | Bacteria | 1532 |
| 253 | Ga0075428_100005379 | 3300006844 | Bacteria | 14236 |
| 254 | Ga0075428_100071519 | 3300006844 | Bacteria | 3791 |
| 255 | Ga0075428_100091050 | 3300006844 | Bacteria | 3327 |
| 256 | Ga0075430_100034421 | 3300006846 | Bacteria | 4299 |
| 257 | Ga0075431_100016396 | 3300006847 | Bacteria | 7520 |
| 258 | Ga0075429_100001571 | 3300006880 | Bacteria | 18757 |
| 259 | Ga0068865_100096438 | 3300006881 | Bacteria | 2156 |
| 260 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 261 | Ga0097620_100009898 | 3300006931 | Bacteria | 9629 |
| 262 | Ga0097620_100010935 | 3300006931 | Bacteria | 9136 |
| 263 | Ga0097620_100032554 | 3300006931 | Bacteria | 5237 |
| 264 | Ga0097620_100048393 | 3300006931 | Bacteria | 4271 |
| 265 | Ga0097620_100057536 | 3300006931 | Bacteria | 3916 |
| 266 | Ga0097620_100098915 | 3300006931 | Bacteria | 2972 |
| 267 | Ga0097620_100173555 | 3300006931 | Bacteria | 2237 |
| 268 | Ga0097620_100227012 | 3300006931 | Bacteria | 1955 |
| 269 | Ga0097620_100243780 | 3300006931 | Bacteria | 1887 |
| 270 | Ga0097620_100279634 | 3300006931 | Bacteria | 1761 |
| 271 | Ga0105244_10000018 | 3300009036 | Bacteria | 244992 |
| 272 | Ga0105250_10010960 | 3300009092 | Bacteria | 3769 |
| 273 | Ga0105240_10000066 | 3300009093 | Bacteria | 212612 |
| 274 | Ga0105240_10004785 | 3300009093 | Bacteria | 20422 |
| 275 | Ga0105240_10006482 | 3300009093 | Bacteria | 17189 |
| 276 | Ga0105240_10006663 | 3300009093 | Bacteria | 16935 |
| 277 | Ga0105240_10024475 | 3300009093 | Bacteria | 7956 |
| 278 | Ga0105240_10035148 | 3300009093 | Bacteria | 6461 |
| 279 | Ga0105240_10037888 | 3300009093 | Bacteria | 6192 |
| 280 | Ga0105240_10043248 | 3300009093 | Bacteria | 5733 |
| 281 | Ga0105240_10075976 | 3300009093 | Bacteria | 4143 |
| 282 | Ga0105240_10199358 | 3300009093 | Bacteria | 2347 |
| 283 | Ga0111539_10003295 | 3300009094 | Bacteria | 21340 |
| 284 | Ga0111539_10112694 | 3300009094 | Bacteria | 3191 |
| 285 | Ga0105245_10136931 | 3300009098 | Bacteria | 2302 |
| 286 | Ga0105247_10002997 | 3300009101 | Bacteria | 11192 |
| 287 | Ga0105247_10013814 | 3300009101 | Bacteria | 4841 |
| 288 | Ga0114129_10021024 | 3300009147 | Bacteria | 9269 |
| 289 | Ga0114129_10153551 | 3300009147 | Bacteria | 3150 |
| 290 | Ga0105243_10000003 | 3300009148 | Bacteria | 712931 |
| 291 | Ga0105243_10000089 | 3300009148 | Bacteria | 103761 |
| 292 | Ga0105243_10255070 | 3300009148 | Unclassified | 1568 |
| 293 | Ga0105241_10001659 | 3300009174 | Bacteria | 16968 |
| 294 | Ga0105241_10022955 | 3300009174 | Bacteria | 4625 |
| 295 | Ga0105241_10026514 | 3300009174 | Bacteria | 4313 |
| 296 | Ga0105241_10099075 | 3300009174 | Bacteria | 2314 |
| 297 | Ga0105241_10112978 | 3300009174 | Bacteria | 2177 |
| 298 | Ga0105242_10029088 | 3300009176 | Bacteria | 4404 |
| 299 | Ga0105242_10088408 | 3300009176 | Bacteria | 2603 |
| 300 | Ga0105248_10051086 | 3300009177 | Bacteria | 4639 |
| 301 | Ga0105237_10000474 | 3300009545 | Bacteria | 57006 |
| 302 | Ga0105237_10001895 | 3300009545 | Bacteria | 26705 |
| 303 | Ga0105237_10002029 | 3300009545 | Bacteria | 25756 |
| 304 | Ga0105237_10052853 | 3300009545 | Bacteria | 4076 |
| 305 | Ga0105237_10087162 | 3300009545 | Bacteria | 3111 |
| 306 | Ga0105249_10000679 | 3300009553 | Bacteria | 30951 |
| 307 | Ga0105249_10007529 | 3300009553 | Bacteria | 9498 |
| 308 | Ga0105249_10039631 | 3300009553 | Bacteria | 4278 |
| 309 | Ga0105249_10064934 | 3300009553 | Bacteria | 3356 |
| 310 | Ga0105249_10090960 | 3300009553 | Bacteria | 2854 |
| 311 | Ga0105249_10248929 | 3300009553 | Bacteria | 1761 |
| 312 | Ga0105239_10000935 | 3300010375 | Bacteria | 41237 |
| 313 | Ga0105239_10002278 | 3300010375 | Bacteria | 24496 |
| 314 | Ga0105239_10004572 | 3300010375 | Bacteria | 16497 |
| 315 | Ga0105239_10020118 | 3300010375 | Bacteria | 7364 |
| 316 | Ga0105239_10023061 | 3300010375 | Bacteria | 6862 |
| 317 | Ga0105239_10043427 | 3300010375 | Bacteria | 4927 |
| 318 | Ga0105239_10072896 | 3300010375 | Bacteria | 3776 |
| 319 | Ga0105239_10096879 | 3300010375 | Bacteria | 3259 |
| 320 | Ga0105246_10013343 | 3300011119 | Bacteria | 5150 |
| 321 | Ga0105246_10132829 | 3300011119 | Bacteria | 1862 |
| 322 | Ga0157373_10000006 | 3300013100 | Bacteria | 261768 |
| 323 | Ga0157373_10000678 | 3300013100 | Bacteria | 26681 |
| 324 | Ga0157373_10011301 | 3300013100 | Bacteria | 6565 |
| 325 | Ga0157373_10018289 | 3300013100 | Bacteria | 5104 |
| 326 | Ga0157373_10032325 | 3300013100 | Bacteria | 3766 |
| 327 | Ga0157373_10070171 | 3300013100 | Bacteria | 2476 |
| 328 | Ga0157373_10077735 | 3300013100 | Bacteria | 2341 |
| 329 | Ga0157371_10000012 | 3300013102 | Bacteria | 355318 |
| 330 | Ga0157371_10000107 | 3300013102 | Bacteria | 126477 |
| 331 | Ga0157371_10000168 | 3300013102 | Bacteria | 95185 |
| 332 | Ga0157371_10001199 | 3300013102 | Bacteria | 27770 |
| 333 | Ga0157371_10001473 | 3300013102 | Bacteria | 24412 |
| 334 | Ga0157371_10011618 | 3300013102 | Bacteria | 6769 |
| 335 | Ga0157371_10012460 | 3300013102 | Bacteria | 6497 |
| 336 | Ga0157371_10012519 | 3300013102 | Bacteria | 6483 |
| 337 | Ga0157371_10024544 | 3300013102 | Bacteria | 4400 |
| 338 | Ga0157371_10052714 | 3300013102 | Bacteria | 2888 |
| 339 | Ga0157371_10079833 | 3300013102 | Bacteria | 2317 |
| 340 | Ga0157371_10106640 | 3300013102 | Bacteria | 1988 |
| 341 | Ga0157370_10000817 | 3300013104 | Bacteria | 39404 |
| 342 | Ga0157370_10001336 | 3300013104 | Bacteria | 30640 |
| 343 | Ga0157370_10001929 | 3300013104 | Bacteria | 25519 |
| 344 | Ga0157370_10005025 | 3300013104 | Bacteria | 14939 |
| 345 | Ga0157370_10007905 | 3300013104 | Bacteria | 11520 |
| 346 | Ga0157370_10009760 | 3300013104 | Bacteria | 10190 |
| 347 | Ga0157370_10010241 | 3300013104 | Bacteria | 9900 |
| 348 | Ga0157370_10042422 | 3300013104 | Bacteria | 4385 |
| 349 | Ga0157370_10070057 | 3300013104 | Bacteria | 3311 |
| 350 | Ga0157369_10002537 | 3300013105 | Bacteria | 21826 |
| 351 | Ga0157369_10020179 | 3300013105 | Bacteria | 7452 |
| 352 | Ga0157369_10030384 | 3300013105 | Bacteria | 5958 |
| 353 | Ga0157369_10057853 | 3300013105 | Bacteria | 4181 |
| 354 | Ga0157369_10067961 | 3300013105 | Bacteria | 3829 |
| 355 | Ga0157369_10079828 | 3300013105 | Bacteria | 3504 |
| 356 | Ga0157369_10085509 | 3300013105 | Bacteria | 3370 |
| 357 | Ga0157374_10000024 | 3300013296 | Bacteria | 265166 |
| 358 | Ga0157374_10000237 | 3300013296 | Bacteria | 51331 |
| 359 | Ga0157374_10001665 | 3300013296 | Bacteria | 18606 |
| 360 | Ga0157374_10002410 | 3300013296 | Bacteria | 15774 |
| 361 | Ga0157374_10031205 | 3300013296 | Bacteria | 4842 |
| 362 | Ga0157374_10063424 | 3300013296 | Bacteria | 3465 |
| 363 | Ga0157374_10088985 | 3300013296 | Bacteria | 2941 |
| 364 | Ga0157374_10186839 | 3300013296 | Bacteria | 2026 |
| 365 | Ga0157378_10014757 | 3300013297 | Bacteria | 6845 |
| 366 | Ga0157378_10016099 | 3300013297 | Bacteria | 6548 |
| 367 | Ga0157378_10025398 | 3300013297 | Bacteria | 5217 |
| 368 | Ga0157378_10034022 | 3300013297 | Bacteria | 4508 |
| 369 | Ga0157378_10216788 | 3300013297 | Bacteria | 1818 |
| 370 | Ga0163162_10000595 | 3300013306 | Bacteria | 33576 |
| 371 | Ga0163162_10001161 | 3300013306 | Bacteria | 24561 |
| 372 | Ga0163162_10001403 | 3300013306 | Bacteria | 22418 |
| 373 | Ga0163162_10001696 | 3300013306 | Bacteria | 20664 |
| 374 | Ga0163162_10002066 | 3300013306 | Bacteria | 18872 |
| 375 | Ga0163162_10003454 | 3300013306 | Bacteria | 15092 |
| 376 | Ga0163162_10010491 | 3300013306 | Bacteria | 9009 |
| 377 | Ga0163162_10017686 | 3300013306 | Bacteria | 6976 |
| 378 | Ga0163162_10158083 | 3300013306 | Bacteria | 2387 |
| 379 | Ga0163162_10198371 | 3300013306 | Bacteria | 2136 |
| 380 | Ga0163162_10216044 | 3300013306 | Bacteria | 2048 |
| 381 | Ga0163162_10235290 | 3300013306 | Bacteria | 1962 |
| 382 | Ga0157372_10000238 | 3300013307 | Bacteria | 60988 |
| 383 | Ga0157372_10006195 | 3300013307 | Bacteria | 12716 |
| 384 | Ga0157372_10012017 | 3300013307 | Bacteria | 9219 |
| 385 | Ga0157372_10052990 | 3300013307 | Bacteria | 4520 |
| 386 | Ga0157372_10112855 | 3300013307 | Bacteria | 3114 |
| 387 | Ga0157372_10116638 | 3300013307 | Bacteria | 3062 |
| 388 | Ga0157372_10150825 | 3300013307 | Bacteria | 2683 |
| 389 | Ga0157372_10210026 | 3300013307 | Bacteria | 2256 |
| 390 | Ga0157372_10237648 | 3300013307 | Bacteria | 2114 |
| 391 | Ga0157372_10288161 | 3300013307 | Bacteria | 1909 |
| 392 | Ga0157372_10472485 | 3300013307 | Bacteria | 1462 |
| 393 | Ga0157375_10000614 | 3300013308 | Bacteria | 31619 |
| 394 | Ga0157375_10002275 | 3300013308 | Bacteria | 16614 |
| 395 | Ga0157375_10005435 | 3300013308 | Bacteria | 11076 |
| 396 | Ga0157375_10076250 | 3300013308 | Bacteria | 3379 |
| 397 | Ga0157375_10226897 | 3300013308 | Bacteria | 2026 |
| 398 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 399 | Ga0163163_10000352 | 3300014325 | Bacteria | 44290 |
| 400 | Ga0163163_10001835 | 3300014325 | Bacteria | 17927 |
| 401 | Ga0163163_10005167 | 3300014325 | Bacteria | 11258 |
| 402 | Ga0163163_10071074 | 3300014325 | Bacteria | 3467 |
| 403 | Ga0157380_10007323 | 3300014326 | Bacteria | 7834 |
| 404 | Ga0157380_10059143 | 3300014326 | Bacteria | 3057 |
| 405 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 406 | Ga0157377_10000354 | 3300014745 | Bacteria | 20420 |
| 407 | Ga0157377_10002113 | 3300014745 | Bacteria | 8736 |
| 408 | Ga0157379_10025131 | 3300014968 | Bacteria | 5288 |
| 409 | Ga0157379_10136218 | 3300014968 | Bacteria | 2212 |
| 410 | Ga0157379_10225420 | 3300014968 | Bacteria | 1699 |
| 411 | Ga0157376_10004780 | 3300014969 | Bacteria | 9427 |
| 412 | Ga0157376_10011668 | 3300014969 | Bacteria | 6487 |
| 413 | Ga0157376_10016249 | 3300014969 | Bacteria | 5644 |
| 414 | Ga0157376_10024787 | 3300014969 | Bacteria | 4716 |
| 415 | Ga0157376_10066517 | 3300014969 | Bacteria | 3046 |
| 416 | Ga0157376_10115554 | 3300014969 | Bacteria | 2369 |
| 417 | Ga0157376_10224255 | 3300014969 | Bacteria | 1742 |
| 418 | Ga0182006_1000079 | 3300015261 | Bacteria | 122553 |
| 419 | Ga0182006_1005760 | 3300015261 | Bacteria | 5847 |
| 420 | Ga0182005_1000116 | 3300015265 | Bacteria | 57638 |
| 421 | Ga0163161_10000620 | 3300017792 | Bacteria | 28471 |
| 422 | Ga0163161_10000869 | 3300017792 | Bacteria | 23538 |
| 423 | Ga0163161_10000968 | 3300017792 | Bacteria | 21949 |
| 424 | Ga0163161_10045614 | 3300017792 | Bacteria | 3161 |
| 425 | Ga0163161_10092342 | 3300017792 | Bacteria | 2241 |
| 426 | Ga0163161_10149168 | 3300017792 | Bacteria | 1776 |
| 427 | Ga0213876_10004817 | 3300021384 | Bacteria | 7489 |
| 428 | Ga0209436_104595 | 3300025208 | Bacteria | 3379 |
| 429 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 430 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 431 | Ga0209646_1001140 | 3300025246 | Bacteria | 7798 |
| 432 | Ga0209026_1000149 | 3300025250 | Bacteria | 111200 |
| 433 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 434 | Ga0209233_1001271 | 3300025261 | Bacteria | 10114 |
| 435 | Ga0209233_1011529 | 3300025261 | Bacteria | 2601 |
| 436 | Ga0209673_1000242 | 3300025273 | Bacteria | 104669 |
| 437 | Ga0209130_1005269 | 3300025284 | Bacteria | 4550 |
| 438 | Ga0209675_1000159 | 3300025291 | Bacteria | 87316 |
| 439 | Ga0209758_1000795 | 3300025297 | Bacteria | 44872 |
| 440 | Ga0209050_1000298 | 3300025298 | Bacteria | 104315 |
| 441 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 442 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 443 | Ga0207426_1000262 | 3300025302 | Bacteria | 111889 |
| 444 | Ga0207426_1004443 | 3300025302 | Bacteria | 6840 |
| 445 | Ga0209051_1033315 | 3300025303 | Bacteria | 1950 |
| 446 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 447 | Ga0209257_1002372 | 3300025304 | Bacteria | 18883 |
| 448 | Ga0207655_1000058 | 3300025728 | Bacteria | 267656 |
| 449 | Ga0207682_10031373 | 3300025893 | Bacteria | 2132 |
| 450 | Ga0207710_10001252 | 3300025900 | Bacteria | 12863 |
| 451 | Ga0207710_10008013 | 3300025900 | Bacteria | 4466 |
| 452 | Ga0207680_10000586 | 3300025903 | Bacteria | 17176 |
| 453 | Ga0207680_10017371 | 3300025903 | Bacteria | 3800 |
| 454 | Ga0207647_10000061 | 3300025904 | Bacteria | 83985 |
| 455 | Ga0207647_10000071 | 3300025904 | Bacteria | 79170 |
| 456 | Ga0207647_10026087 | 3300025904 | Bacteria | 3826 |
| 457 | Ga0207647_10035144 | 3300025904 | Bacteria | 3195 |
| 458 | Ga0207647_10041369 | 3300025904 | Bacteria | 2898 |
| 459 | Ga0207645_10000229 | 3300025907 | Bacteria | 46502 |
| 460 | Ga0207645_10000847 | 3300025907 | Bacteria | 25517 |
| 461 | Ga0207645_10002256 | 3300025907 | Bacteria | 15330 |
| 462 | Ga0207645_10021982 | 3300025907 | Bacteria | 4155 |
| 463 | Ga0207643_10060920 | 3300025908 | Bacteria | 2155 |
| 464 | Ga0207643_10065139 | 3300025908 | Bacteria | 2087 |
| 465 | Ga0207705_10008664 | 3300025909 | Bacteria | 7412 |
| 466 | Ga0207705_10009177 | 3300025909 | Bacteria | 7204 |
| 467 | Ga0207705_10122670 | 3300025909 | Bacteria | 1929 |
| 468 | Ga0207654_10000850 | 3300025911 | Bacteria | 16860 |
| 469 | Ga0207707_10000879 | 3300025912 | Bacteria | 29399 |
| 470 | Ga0207707_10251356 | 3300025912 | Bacteria | 1536 |
| 471 | Ga0207695_10000078 | 3300025913 | Bacteria | 297378 |
| 472 | Ga0207695_10000135 | 3300025913 | Bacteria | 217822 |
| 473 | Ga0207695_10000702 | 3300025913 | Bacteria | 65628 |
| 474 | Ga0207695_10000894 | 3300025913 | Bacteria | 54057 |
| 475 | Ga0207695_10002580 | 3300025913 | Bacteria | 26577 |
| 476 | Ga0207695_10016392 | 3300025913 | Bacteria | 8669 |
| 477 | Ga0207695_10022744 | 3300025913 | Bacteria | 7103 |
| 478 | Ga0207695_10030088 | 3300025913 | Bacteria | 5984 |
| 479 | Ga0207695_10069174 | 3300025913 | Bacteria | 3614 |
| 480 | Ga0207695_10082557 | 3300025913 | Bacteria | 3248 |
| 481 | Ga0207695_10133955 | 3300025913 | Bacteria | 2433 |
| 482 | Ga0207695_10272784 | 3300025913 | Bacteria | 1587 |
| 483 | Ga0207671_10000067 | 3300025914 | Bacteria | 162184 |
| 484 | Ga0207671_10000721 | 3300025914 | Bacteria | 42150 |
| 485 | Ga0207671_10026732 | 3300025914 | Bacteria | 4320 |
| 486 | Ga0207671_10105705 | 3300025914 | Bacteria | 2136 |
| 487 | Ga0207660_10005360 | 3300025917 | Bacteria | 8328 |
| 488 | Ga0207662_10040436 | 3300025918 | Bacteria | 2741 |
| 489 | Ga0207662_10067219 | 3300025918 | Bacteria | 2161 |
| 490 | Ga0207657_10001900 | 3300025919 | Bacteria | 22572 |
| 491 | Ga0207657_10004379 | 3300025919 | Bacteria | 14946 |
| 492 | Ga0207657_10016216 | 3300025919 | Bacteria | 7191 |
| 493 | Ga0207657_10026674 | 3300025919 | Bacteria | 5303 |
| 494 | Ga0207649_10005271 | 3300025920 | Bacteria | 6994 |
| 495 | Ga0207649_10044523 | 3300025920 | Bacteria | 2717 |
| 496 | Ga0207649_10122395 | 3300025920 | Bacteria | 1756 |
| 497 | Ga0207652_10000181 | 3300025921 | Bacteria | 66711 |
| 498 | Ga0207652_10000397 | 3300025921 | Bacteria | 45365 |
| 499 | Ga0207652_10002067 | 3300025921 | Bacteria | 17274 |
| 500 | Ga0207652_10002811 | 3300025921 | Bacteria | 14612 |
| 501 | Ga0207652_10186653 | 3300025921 | Bacteria | 1864 |
| 502 | Ga0207681_10013609 | 3300025923 | Bacteria | 5037 |
| 503 | Ga0207681_10030055 | 3300025923 | Bacteria | 3538 |
| 504 | Ga0207694_10068792 | 3300025924 | Bacteria | 2765 |
| 505 | Ga0207694_10206540 | 3300025924 | Bacteria | 1599 |
| 506 | Ga0207650_10009308 | 3300025925 | Bacteria | 6714 |
| 507 | Ga0207650_10052389 | 3300025925 | Bacteria | 3023 |
| 508 | Ga0207650_10082949 | 3300025925 | Bacteria | 2434 |
| 509 | Ga0207650_10121697 | 3300025925 | Bacteria | 2033 |
| 510 | Ga0207650_10142590 | 3300025925 | Bacteria | 1885 |
| 511 | Ga0207650_10244773 | 3300025925 | Bacteria | 1450 |
| 512 | Ga0207659_10010641 | 3300025926 | Bacteria | 5784 |
| 513 | Ga0207659_10025932 | 3300025926 | Bacteria | 3948 |
| 514 | Ga0207659_10058056 | 3300025926 | Bacteria | 2777 |
| 515 | Ga0207659_10106238 | 3300025926 | Bacteria | 2125 |
| 516 | Ga0207644_10050893 | 3300025931 | Bacteria | 2971 |
| 517 | Ga0207644_10065862 | 3300025931 | Bacteria | 2636 |
| 518 | Ga0207644_10101979 | 3300025931 | Bacteria | 2157 |
| 519 | Ga0207644_10127237 | 3300025931 | Bacteria | 1946 |
| 520 | Ga0207690_10001688 | 3300025932 | Bacteria | 13606 |
| 521 | Ga0207690_10004290 | 3300025932 | Bacteria | 8416 |
| 522 | Ga0207690_10044953 | 3300025932 | Bacteria | 2914 |
| 523 | Ga0207690_10071439 | 3300025932 | Bacteria | 2394 |
| 524 | Ga0207690_10084322 | 3300025932 | Bacteria | 2227 |
| 525 | Ga0207706_10006199 | 3300025933 | Bacteria | 11111 |
| 526 | Ga0207706_10010295 | 3300025933 | Bacteria | 8551 |
| 527 | Ga0207706_10011398 | 3300025933 | Bacteria | 8099 |
| 528 | Ga0207706_10072073 | 3300025933 | Bacteria | 3039 |
| 529 | Ga0207706_10089603 | 3300025933 | Bacteria | 2704 |
| 530 | Ga0207706_10147152 | 3300025933 | Bacteria | 2072 |
| 531 | Ga0207686_10004707 | 3300025934 | Bacteria | 7317 |
| 532 | Ga0207686_10045182 | 3300025934 | Bacteria | 2709 |
| 533 | Ga0207709_10000008 | 3300025935 | Bacteria | 713099 |
| 534 | Ga0207709_10000136 | 3300025935 | Bacteria | 106728 |
| 535 | Ga0207670_10082900 | 3300025936 | Bacteria | 2248 |
| 536 | Ga0207669_10093408 | 3300025937 | Bacteria | 1966 |
| 537 | Ga0207669_10095388 | 3300025937 | Bacteria | 1950 |
| 538 | Ga0207691_10010199 | 3300025940 | Bacteria | 9012 |
| 539 | Ga0207691_10014922 | 3300025940 | Bacteria | 7402 |
| 540 | Ga0207691_10018630 | 3300025940 | Bacteria | 6577 |
| 541 | Ga0207691_10184076 | 3300025940 | Bacteria | 1824 |
| 542 | Ga0207689_10010987 | 3300025942 | Bacteria | 7784 |
| 543 | Ga0207689_10023114 | 3300025942 | Bacteria | 5221 |
| 544 | Ga0207689_10025266 | 3300025942 | Bacteria | 4977 |
| 545 | Ga0207689_10035495 | 3300025942 | Bacteria | 4142 |
| 546 | Ga0207689_10043144 | 3300025942 | Bacteria | 3728 |
| 547 | Ga0207689_10109636 | 3300025942 | Bacteria | 2268 |
| 548 | Ga0207661_10007444 | 3300025944 | Bacteria | 7791 |
| 549 | Ga0207661_10018216 | 3300025944 | Bacteria | 5215 |
| 550 | Ga0207661_10024898 | 3300025944 | Bacteria | 4543 |
| 551 | Ga0207679_10001674 | 3300025945 | Bacteria | 13809 |
| 552 | Ga0207679_10005671 | 3300025945 | Bacteria | 7828 |
| 553 | Ga0207679_10011911 | 3300025945 | Bacteria | 5651 |
| 554 | Ga0207679_10162210 | 3300025945 | Bacteria | 1831 |
| 555 | Ga0207667_10000312 | 3300025949 | Bacteria | 67340 |
| 556 | Ga0207667_10016081 | 3300025949 | Bacteria | 8470 |
| 557 | Ga0207667_10019147 | 3300025949 | Bacteria | 7655 |
| 558 | Ga0207667_10027229 | 3300025949 | Bacteria | 6228 |
| 559 | Ga0207667_10028216 | 3300025949 | Bacteria | 6098 |
| 560 | Ga0207667_10052423 | 3300025949 | Bacteria | 4296 |
| 561 | Ga0207667_10211469 | 3300025949 | Bacteria | 1988 |
| 562 | Ga0207651_10010529 | 3300025960 | Bacteria | 5130 |
| 563 | Ga0207651_10115991 | 3300025960 | Bacteria | 2021 |
| 564 | Ga0207712_10010819 | 3300025961 | Bacteria | 5805 |
| 565 | Ga0207712_10016873 | 3300025961 | Bacteria | 4734 |
| 566 | Ga0207712_10024280 | 3300025961 | Bacteria | 4012 |
| 567 | Ga0207712_10068240 | 3300025961 | Bacteria | 2547 |
| 568 | Ga0207712_10090344 | 3300025961 | Bacteria | 2253 |
| 569 | Ga0207668_10000671 | 3300025972 | Bacteria | 21040 |
| 570 | Ga0207640_10075141 | 3300025981 | Bacteria | 2289 |
| 571 | Ga0207658_10004178 | 3300025986 | Bacteria | 10062 |
| 572 | Ga0207658_10012058 | 3300025986 | Bacteria | 5896 |
| 573 | Ga0207658_10078762 | 3300025986 | Bacteria | 2519 |
| 574 | Ga0207658_10208019 | 3300025986 | Bacteria | 1638 |
| 575 | Ga0207677_10001780 | 3300026023 | Bacteria | 11373 |
| 576 | Ga0207677_10006265 | 3300026023 | Bacteria | 6508 |
| 577 | Ga0207677_10009458 | 3300026023 | Bacteria | 5485 |
| 578 | Ga0207677_10057408 | 3300026023 | Bacteria | 2673 |
| 579 | Ga0207677_10108806 | 3300026023 | Bacteria | 2059 |
| 580 | Ga0207703_10002553 | 3300026035 | Bacteria | 15723 |
| 581 | Ga0207703_10019532 | 3300026035 | Bacteria | 5295 |
| 582 | Ga0207639_10009275 | 3300026041 | Bacteria | 6786 |
| 583 | Ga0207639_10026751 | 3300026041 | Bacteria | 4194 |
| 584 | Ga0207639_10074097 | 3300026041 | Bacteria | 2672 |
| 585 | Ga0207639_10246351 | 3300026041 | Bacteria | 1556 |
| 586 | Ga0207702_10045324 | 3300026078 | Bacteria | 3699 |
| 587 | Ga0207702_10126034 | 3300026078 | Bacteria | 2299 |
| 588 | Ga0207641_10000448 | 3300026088 | Bacteria | 47082 |
| 589 | Ga0207641_10001077 | 3300026088 | Bacteria | 27465 |
| 590 | Ga0207641_10005547 | 3300026088 | Bacteria | 10755 |
| 591 | Ga0207641_10012106 | 3300026088 | Bacteria | 7076 |
| 592 | Ga0207641_10018916 | 3300026088 | Bacteria | 5650 |
| 593 | Ga0207641_10042014 | 3300026088 | Bacteria | 3834 |
| 594 | Ga0207648_10003051 | 3300026089 | Bacteria | 17707 |
| 595 | Ga0207648_10005010 | 3300026089 | Bacteria | 13450 |
| 596 | Ga0207648_10007503 | 3300026089 | Bacteria | 10713 |
| 597 | Ga0207648_10007532 | 3300026089 | Bacteria | 10685 |
| 598 | Ga0207648_10015948 | 3300026089 | Bacteria | 6885 |
| 599 | Ga0207648_10057688 | 3300026089 | Bacteria | 3388 |
| 600 | Ga0207648_10064155 | 3300026089 | Bacteria | 3201 |
| 601 | Ga0207648_10075557 | 3300026089 | Bacteria | 2937 |
| 602 | Ga0207676_10012325 | 3300026095 | Bacteria | 6122 |
| 603 | Ga0207676_10047330 | 3300026095 | Bacteria | 3332 |
| 604 | Ga0207674_10000894 | 3300026116 | Bacteria | 38957 |
| 605 | Ga0207674_10013334 | 3300026116 | Bacteria | 9127 |
| 606 | Ga0207674_10022378 | 3300026116 | Bacteria | 6788 |
| 607 | Ga0207674_10062038 | 3300026116 | Bacteria | 3776 |
| 608 | Ga0207674_10067960 | 3300026116 | Bacteria | 3587 |
| 609 | Ga0207674_10137689 | 3300026116 | Bacteria | 2402 |
| 610 | Ga0207674_10142389 | 3300026116 | Bacteria | 2357 |
| 611 | Ga0207675_100002842 | 3300026118 | Bacteria | 17034 |
| 612 | Ga0207675_100006844 | 3300026118 | Bacteria | 10795 |
| 613 | Ga0207675_100018407 | 3300026118 | Bacteria | 6513 |
| 614 | Ga0207675_100119273 | 3300026118 | Bacteria | 2495 |
| 615 | Ga0207683_10002182 | 3300026121 | Bacteria | 17194 |
| 616 | Ga0207683_10023462 | 3300026121 | Bacteria | 5308 |
| 617 | Ga0207683_10026793 | 3300026121 | Bacteria | 4979 |
| 618 | Ga0207683_10028008 | 3300026121 | Bacteria | 4870 |
| 619 | Ga0207683_10056112 | 3300026121 | Bacteria | 3455 |
| 620 | Ga0207698_10002660 | 3300026142 | Bacteria | 10625 |
| 621 | Ga0207698_10008350 | 3300026142 | Bacteria | 6543 |
| 622 | Ga0207698_10040670 | 3300026142 | Bacteria | 3458 |
| 623 | Ga0207698_10061636 | 3300026142 | Bacteria | 2924 |
| 624 | Ga0207698_10135625 | 3300026142 | Bacteria | 2111 |
| 625 | Ga0268266_10000057 | 3300028379 | Bacteria | 284777 |
| 626 | Ga0268266_10007008 | 3300028379 | Bacteria | 10236 |
| 627 | Ga0268266_10040113 | 3300028379 | Bacteria | 3990 |
| 628 | Ga0268265_10079511 | 3300028380 | Bacteria | 2582 |
| 629 | Ga0268265_10282075 | 3300028380 | Bacteria | 1487 |
| 630 | Ga0268264_10000143 | 3300028381 | Bacteria | 170031 |
| 631 | Ga0268264_10002805 | 3300028381 | Bacteria | 15217 |
| 632 | Ga0268264_10007161 | 3300028381 | Bacteria | 9346 |
| 633 | Ga0268264_10046627 | 3300028381 | Bacteria | 3600 |
| 634 | Ga0268264_10047127 | 3300028381 | Bacteria | 3582 |
| 635 | Ga0268264_10118696 | 3300028381 | Bacteria | 2328 |
| 636 | Ga0307517_10014190 | 3300028786 | Bacteria | 10733 |
| 637 | Ga0307515_10000455 | 3300028794 | Bacteria | 97670 |
| 638 | Ga0307511_10000439 | 3300030521 | Bacteria | 44490 |
| 639 | Ga0316176_1026201 | 3300030732 | Bacteria | 12822 |
| 640 | Ga0316183_1106482 | 3300030742 | Bacteria | 31361 |
| 641 | Ga0316181_1039179 | 3300030744 | Bacteria | 5421 |
| 642 | Ga0265320_10045317 | 3300031240 | Bacteria | 2162 |
| 643 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 644 | Ga0265327_10000073 | 3300031251 | Bacteria | 214772 |
| 645 | Ga0265327_10000256 | 3300031251 | Bacteria | 105748 |
| 646 | Ga0265327_10000421 | 3300031251 | Bacteria | 77515 |
| 647 | Ga0265327_10002290 | 3300031251 | Bacteria | 20531 |
| 648 | Ga0265327_10006644 | 3300031251 | Bacteria | 9186 |
| 649 | Ga0307509_10056935 | 3300031507 | Bacteria | 4147 |
| 650 | Ga0307508_10002437 | 3300031616 | Bacteria | 19616 |
| 651 | Ga0307516_10000310 | 3300031730 | Bacteria | 63335 |
| 652 | Ga0307516_10090626 | 3300031730 | Bacteria | 2886 |
| 653 | Ga0307412_10000140 | 3300031911 | Bacteria | 52924 |
| 654 | Ga0307412_10000292 | 3300031911 | Bacteria | 31826 |
| 655 | Ga0307416_100000020 | 3300032002 | Bacteria | 192862 |
| 656 | Ga0307414_10000049 | 3300032004 | Bacteria | 130090 |
| 657 | Ga0307414_10011763 | 3300032004 | Bacteria | 5148 |
| 658 | Ga0307414_10060464 | 3300032004 | Bacteria | 2679 |
| 659 | Ga0307415_100007390 | 3300032126 | Bacteria | 6008 |
| 660 | Ga0307415_100165537 | 3300032126 | Bacteria | 1719 |
| 661 | Ga0373937_0109307 | 3300036401 | Bacteria | 2571 |
| 662 | Ga0395899_0000064 | 3300037312 | Bacteria | 207082 |
| 663 | Ga0395899_0000811 | 3300037312 | Bacteria | 30415 |
| 664 | Ga0395899_0000959 | 3300037312 | Bacteria | 26821 |
| 665 | Ga0395899_0002874 | 3300037312 | Bacteria | 13842 |
| 666 | Ga0395899_0043474 | 3300037312 | Bacteria | 3351 |
| 667 | Ga0395899_0101062 | 3300037312 | Bacteria | 2081 |
| 668 | Ga0395899_0175619 | 3300037312 | Bacteria | 1506 |
| 669 | Ga0395900_0000275 | 3300037418 | Bacteria | 78207 |
| 670 | Ga0395900_0001963 | 3300037418 | Bacteria | 23228 |
| 671 | Ga0395900_0012661 | 3300037418 | Bacteria | 8623 |
| 672 | Ga0395900_0012681 | 3300037418 | Bacteria | 8618 |
| 673 | Ga0395900_0068341 | 3300037418 | Bacteria | 3651 |
| 674 | Ga0395900_0147364 | 3300037418 | Bacteria | 2406 |
| 675 | Ga0395900_0150338 | 3300037418 | Bacteria | 2379 |
| 676 | Ga0395900_0161590 | 3300037418 | Bacteria | 2284 |
| 677 | Ga0395900_0276443 | 3300037418 | Bacteria | 1673 |
| 678 | Ga0395898_0003579 | 3300037466 | Bacteria | 17316 |
| 679 | Ga0395898_0005476 | 3300037466 | Bacteria | 13714 |
| 680 | Ga0395898_0009566 | 3300037466 | Bacteria | 10183 |
| 681 | Ga0395898_0049897 | 3300037466 | Bacteria | 4098 |
| 682 | Ga0395898_0098621 | 3300037466 | Bacteria | 2805 |
| 683 | Ga0395905_0000051 | 3300037471 | Bacteria | 223416 |
| 684 | Ga0395905_0000248 | 3300037471 | Bacteria | 81042 |
| 685 | Ga0395905_0026233 | 3300037471 | Bacteria | 5494 |
| 686 | Ga0395905_0028897 | 3300037471 | Bacteria | 5226 |
| 687 | Ga0395905_0067152 | 3300037471 | Bacteria | 3359 |
| 688 | Ga0395901_0000595 | 3300038443 | Bacteria | 42132 |
| 689 | Ga0395901_0005557 | 3300038443 | Bacteria | 12756 |
| 690 | Ga0395901_0010392 | 3300038443 | Bacteria | 9428 |
| 691 | Ga0395901_0050730 | 3300038443 | Bacteria | 4310 |
| 692 | Ga0395901_0068548 | 3300038443 | Bacteria | 3695 |
| 693 | Ga0436365_0557230 | 3300039437 | Bacteria | 3487 |
| 694 | Ga0436365_1740763 | 3300039437 | Bacteria | 18760 |
| 695 | Ga0436365_1888183 | 3300039437 | Bacteria | 4960 |
| 696 | Ga0439465_0000035 | 3300041413 | Bacteria | 27339 |
| 697 | Ga0439465_0016026 | 3300041413 | Bacteria | 2337 |
| 698 | Ga0451853_2153551 | 3300041512 | Bacteria | 2068 |
| 699 | Ga0439431_0000062 | 3300041997 | Bacteria | 16970 |
| 700 | Ga0439442_006659 | 3300042002 | Bacteria | 2321 |
| 701 | Ga0439445_0000094 | 3300042004 | Bacteria | 14134 |
| 702 | Ga0439448_0002912 | 3300042005 | Bacteria | 4690 |
| 703 | Ga0439457_002934 | 3300042014 | Bacteria | 4742 |
| 704 | Ga0451577_0000015 | 3300042876 | Bacteria | 538333 |
| 705 | Ga0451577_0006314 | 3300042876 | Bacteria | 11859 |
| 706 | Ga0451577_0026339 | 3300042876 | Bacteria | 5268 |
| 707 | Ga0451577_0043978 | 3300042876 | Bacteria | 3998 |
| 708 | Ga0466969_0000847 | 3300044656 | Bacteria | 16571 |
| 709 | Ga0466969_0029848 | 3300044656 | Bacteria | 2782 |
| 710 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 711 | Ga0466972_0000143 | 3300044658 | Bacteria | 58694 |
| 712 | Ga0466972_0001431 | 3300044658 | Bacteria | 11583 |
| 713 | Ga0466972_0034173 | 3300044658 | Bacteria | 2493 |
| 714 | Ga0453683_0000509 | 3300044673 | Bacteria | 43999 |
| 715 | Ga0453683_0028064 | 3300044673 | Bacteria | 3565 |
| 716 | Ga0466966_0000176 | 3300044684 | Bacteria | 42093 |
| 717 | Ga0466961_0037351 | 3300044693 | Bacteria | 3116 |
| 718 | Ga0453684_0000081 | 3300044712 | Bacteria | 402985 |
| 719 | Ga0453684_0063668 | 3300044712 | Bacteria | 4715 |
| 720 | Ga0466971_0033117 | 3300044719 | Bacteria | 2316 |
| 721 | Ga0466968_0070229 | 3300044735 | Bacteria | 1523 |
| 722 | Ga0466970_0000471 | 3300044765 | Bacteria | 19964 |
| 723 | Ga0466957_0000372 | 3300044842 | Bacteria | 21993 |
| 724 | Ga0466959_0000016 | 3300045049 | Bacteria | 144600 |
| 725 | Ga0466959_0044930 | 3300045049 | Bacteria | 3254 |
| 726 | Ga0466959_0148750 | 3300045049 | Bacteria | 1652 |
| 727 | Ga0451576_0000294 | 3300045051 | Bacteria | 122276 |
| 728 | Ga0451576_0008161 | 3300045051 | Bacteria | 12328 |
| 729 | Ga0451576_0025171 | 3300045051 | Bacteria | 6415 |
| 730 | Ga0451576_0073880 | 3300045051 | Bacteria | 3548 |
| 731 | Ga0495627_000029 | 3300046453 | Bacteria | 232349 |
| 732 | Ga0495592_0075150 | 3300046454 | Bacteria | 2454 |
| 733 | Ga0495592_0159165 | 3300046454 | Bacteria | 1555 |
| 734 | Ga0495590_0003056 | 3300046457 | Bacteria | 6857 |
| 735 | Ga0495638_0019391 | 3300046460 | Bacteria | 4501 |
| 736 | Ga0495638_0044598 | 3300046460 | Bacteria | 2793 |
| 737 | Ga0495580_0105669 | 3300046472 | Bacteria | 1956 |
| 738 | Ga0495596_0000410 | 3300046500 | Bacteria | 27433 |
| 739 | Ga0495606_0037730 | 3300046507 | Bacteria | 3278 |
| 740 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 741 | Ga0495628_0018695 | 3300046516 | Bacteria | 5735 |
| 742 | Ga0495630_0009753 | 3300046517 | Bacteria | 6909 |
| 743 | Ga0495632_0006333 | 3300046519 | Bacteria | 7635 |
| 744 | Ga0495643_0025161 | 3300046522 | Bacteria | 3371 |
| 745 | Ga0495648_0003590 | 3300046524 | Bacteria | 13568 |
| 746 | Ga0495663_0000021 | 3300046525 | Bacteria | 114041 |
| 747 | Ga0495663_0001260 | 3300046525 | Bacteria | 8045 |
| 748 | Ga0495652_0114033 | 3300046529 | Bacteria | 2169 |
| 749 | Ga0495652_0130545 | 3300046529 | Bacteria | 1990 |
| 750 | Ga0495654_0000008 | 3300046530 | Bacteria | 398340 |
| 751 | Ga0495609_0000010 | 3300046538 | Bacteria | 342605 |
| 752 | Ga0495645_0144519 | 3300046543 | Bacteria | 1657 |
| 753 | Ga0495633_0000022 | 3300046558 | Bacteria | 226582 |
| 754 | Ga0495633_0000048 | 3300046558 | Bacteria | 158166 |
| 755 | Ga0495633_0009165 | 3300046558 | Bacteria | 5494 |
| 756 | Ga0495668_0000321 | 3300046616 | Bacteria | 65700 |
| 757 | Ga0495668_0000450 | 3300046616 | Bacteria | 52543 |
| 758 | Ga0495668_0007476 | 3300046616 | Bacteria | 6979 |
| 759 | Ga0495634_0071154 | 3300046642 | Bacteria | 2291 |
| 760 | Ga0495634_0080033 | 3300046642 | Bacteria | 2139 |
| 761 | Ga0495611_0000081 | 3300046648 | Bacteria | 67738 |
| 762 | Ga0495625_0000658 | 3300046660 | Bacteria | 49342 |
| 763 | Ga0495625_0042194 | 3300046660 | Bacteria | 3317 |
| 764 | Ga0495635_0026484 | 3300046663 | Bacteria | 4034 |
| 765 | Ga0495599_0032634 | 3300046678 | Bacteria | 3269 |
| 766 | Ga0495658_0011871 | 3300046683 | Bacteria | 4394 |
| 767 | Ga0495674_0007992 | 3300047319 | Bacteria | 10097 |
| 768 | Ga0495672_0016760 | 3300047320 | Bacteria | 4919 |
| 769 | Ga0495672_0018029 | 3300047320 | Bacteria | 4702 |
| 770 | Ga0495672_0053737 | 3300047320 | Bacteria | 2358 |
| 771 | Ga0495687_000111 | 3300047443 | Bacteria | 124789 |
| 772 | Ga0495684_0089071 | 3300047471 | Bacteria | 2338 |
| 773 | Ga0495686_0000153 | 3300047472 | Bacteria | 133256 |
| 774 | Ga0495686_0000814 | 3300047472 | Bacteria | 40340 |
| 775 | Ga0495686_0001267 | 3300047472 | Bacteria | 28612 |
| 776 | Ga0495686_0004393 | 3300047472 | Bacteria | 11617 |
| 777 | Ga0495686_0017600 | 3300047472 | Bacteria | 4809 |
| 778 | Ga0496102_0014102 | 3300048905 | Bacteria | 6944 |
| 779 | Ga0496103_0016341 | 3300048906 | Bacteria | 4429 |
| 780 | Ga0496104_0096952 | 3300048907 | Bacteria | 2822 |
| 781 | Ga0496104_0241239 | 3300048907 | Bacteria | 1720 |
| 782 | Ga0496110_0087547 | 3300048913 | Bacteria | 2782 |
| 783 | Ga0496110_0097470 | 3300048913 | Bacteria | 2635 |
| 784 | Ga0496113_0069442 | 3300048916 | Bacteria | 2676 |
| 785 | Ga0496114_0001046 | 3300048917 | Bacteria | 20795 |
| 786 | Ga0496115_0020666 | 3300048918 | Bacteria | 5079 |
| 787 | Ga0496116_0000037 | 3300048919 | Bacteria | 374675 |
| 788 | Ga0496117_0000086 | 3300048920 | Bacteria | 212331 |
| 789 | Ga0496118_0000284 | 3300048921 | Bacteria | 88966 |
| 790 | Ga0496119_0000037 | 3300048922 | Bacteria | 210912 |
| 791 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 792 | Ga0496122_0000510 | 3300048925 | Bacteria | 80239 |
| 793 | Ga0496122_0000602 | 3300048925 | Bacteria | 73995 |
| 794 | Ga0496122_0003432 | 3300048925 | Bacteria | 20849 |
| 795 | Ga0496122_0003771 | 3300048925 | Bacteria | 19539 |
| 796 | Ga0496122_0057511 | 3300048925 | Bacteria | 2887 |
| 797 | Ga0496123_0013079 | 3300048926 | Bacteria | 7003 |
| 798 | Ga0496123_0014595 | 3300048926 | Bacteria | 6497 |
| 799 | Ga0496123_0019833 | 3300048926 | Bacteria | 5279 |
| 800 | Ga0496124_0000555 | 3300048927 | Bacteria | 63173 |
| 801 | Ga0496125_0012093 | 3300048928 | Bacteria | 8587 |
| 802 | Ga0496125_0023772 | 3300048928 | Bacteria | 5650 |
| 803 | Ga0496126_0008259 | 3300048929 | Bacteria | 11243 |
| 804 | Ga0496126_0014044 | 3300048929 | Bacteria | 8116 |
| 805 | Ga0496126_0097741 | 3300048929 | Bacteria | 2573 |
| 806 | Ga0501031_0090921 | 3300049568 | Bacteria | 1990 |
| 807 | Ga0501032_0039116 | 3300049569 | Bacteria | 3227 |
| 808 | Ga0501033_0053360 | 3300049570 | Bacteria | 2994 |
| 809 | Ga0501034_0002046 | 3300049571 | Bacteria | 25324 |
| 810 | Ga0501034_0005253 | 3300049571 | Bacteria | 14211 |
| 811 | Ga0501034_0013642 | 3300049571 | Bacteria | 8357 |
| 812 | Ga0501034_0037459 | 3300049571 | Bacteria | 4911 |
| 813 | Ga0501034_0083677 | 3300049571 | Bacteria | 3192 |
| 814 | Ga0501036_0016492 | 3300049572 | Bacteria | 6170 |
| 815 | Ga0501036_0049405 | 3300049572 | Bacteria | 3562 |
| 816 | Ga0501037_0004853 | 3300049573 | Bacteria | 9785 |
| 817 | Ga0501037_0029791 | 3300049573 | Bacteria | 4033 |
| 818 | Ga0501038_0001508 | 3300049574 | Bacteria | 21425 |
| 819 | Ga0501039_0046550 | 3300049575 | Bacteria | 3351 |
| 820 | Ga0501039_0110242 | 3300049575 | Bacteria | 2151 |
| 821 | Ga0501043_0021821 | 3300049579 | Bacteria | 5021 |
| 822 | Ga0501043_0037281 | 3300049579 | Bacteria | 3824 |
| 823 | Ga0501043_0051583 | 3300049579 | Bacteria | 3232 |
| 824 | Ga0501043_0117212 | 3300049579 | Bacteria | 2089 |
| 825 | Ga0501046_0033569 | 3300049580 | Bacteria | 4144 |
| 826 | Ga0501046_0066426 | 3300049580 | Bacteria | 2811 |
| 827 | Ga0501047_0007339 | 3300049581 | Bacteria | 10367 |
| 828 | Ga0501047_0043636 | 3300049581 | Bacteria | 4331 |
| 829 | Ga0501047_0061998 | 3300049581 | Bacteria | 3608 |
| 830 | Ga0501048_0123886 | 3300049582 | Bacteria | 1827 |
| 831 | Ga0501068_0030821 | 3300049584 | Bacteria | 3184 |
| 832 | Ga0501069_0015946 | 3300049585 | Bacteria | 4029 |
| 833 | Ga0501070_0014791 | 3300049586 | Bacteria | 6566 |
| 834 | Ga0501074_0002906 | 3300049590 | Bacteria | 12018 |
| 835 | Ga0501074_0016810 | 3300049590 | Bacteria | 5309 |
| 836 | Ga0501202_005262 | 3300049652 | Bacteria | 2291 |
| 837 | Ga0501217_000087 | 3300049661 | Bacteria | 11212 |
| 838 | Ga0501222_000205 | 3300049662 | Bacteria | 10436 |
| 839 | Ga0501223_000153 | 3300049663 | Bacteria | 18205 |
| 840 | Ga0501223_001264 | 3300049663 | Bacteria | 5887 |
| 841 | Ga0501235_000089 | 3300049669 | Bacteria | 14364 |
| 842 | Ga0501240_000041 | 3300049673 | Bacteria | 8075 |
| 843 | Ga0501250_002354 | 3300049680 | Bacteria | 1705 |
| 844 | Ga0501251_003300 | 3300049681 | Bacteria | 1605 |
| 845 | Ga0501253_000098 | 3300049683 | Bacteria | 6183 |
| 846 | Ga0501259_000111 | 3300049688 | Bacteria | 11954 |
| 847 | Ga0501259_000789 | 3300049688 | Bacteria | 5179 |
| 848 | Ga0501261_000274 | 3300049690 | Bacteria | 7107 |
| 849 | Ga0501219_000023 | 3300049703 | Bacteria | 24183 |
| 850 | Ga0501221_000942 | 3300049704 | Bacteria | 4771 |
| 851 | Ga0501225_0000583 | 3300049705 | Bacteria | 11406 |
| 852 | Ga0501225_0007025 | 3300049705 | Bacteria | 3276 |
| 853 | Ga0501234_003714 | 3300049707 | Bacteria | 2400 |
| 854 | Ga0501080_0046393 | 3300049742 | Bacteria | 4045 |
| 855 | Ga0501080_0179844 | 3300049742 | Bacteria | 1947 |
| 856 | Ga0501241_000009 | 3300049758 | Bacteria | 128695 |
| 857 | Ga0501266_001126 | 3300049763 | Bacteria | 3436 |
| 858 | Ga0501269_000025 | 3300049766 | Bacteria | 51990 |
| 859 | Ga0501280_003927 | 3300049776 | Bacteria | 2229 |
| 860 | Ga0501035_0015729 | 3300049822 | Bacteria | 6983 |
| 861 | Ga0501035_0052200 | 3300049822 | Bacteria | 3659 |
| 862 | Ga0501044_0001663 | 3300049823 | Bacteria | 26095 |
| 863 | Ga0501044_0012930 | 3300049823 | Bacteria | 9035 |
| 864 | Ga0501044_0019648 | 3300049823 | Bacteria | 7221 |
| 865 | Ga0501044_0023918 | 3300049823 | Bacteria | 6493 |
| 866 | Ga0501044_0054411 | 3300049823 | Bacteria | 4114 |
| 867 | Ga0501044_0064559 | 3300049823 | Bacteria | 3737 |
| 868 | Ga0501044_0264979 | 3300049823 | Bacteria | 1656 |
| 869 | Ga0501284_00005 | 3300050005 | Bacteria | 164758 |
| 870 | nmdc:mga05p37_177095_c1 | 3300050507 | Bacteria | 2597 |
| 871 | nmdc:mga05p37_3495_c1 | 3300050507 | Bacteria | 6617 |
| 872 | nmdc:mga09592_8712_c2 | 3300050508 | Bacteria | 4067 |
| 873 | nmdc:mga0qj67_50085_c1 | 3300050509 | Bacteria | 3302 |
| 874 | nmdc:mga06r32_205023_c1 | 3300050510 | Bacteria | 1960 |
| 875 | nmdc:mga08y16_104496_c1 | 3300050511 | Bacteria | 2948 |
| 876 | Ga0495619_0097480 | 3300053085 | Bacteria | 1998 |
| 877 | Ga0500578_0000296 | 3300053086 | Bacteria | 61614 |
| 878 | Ga0500644_0000078 | 3300053088 | Bacteria | 59447 |
| 879 | Ga0500583_0000037 | 3300053092 | Bacteria | 92466 |
| 880 | Ga0500583_0015568 | 3300053092 | Bacteria | 3012 |
| 881 | Ga0500562_000032 | 3300053108 | Bacteria | 89989 |
| 882 | Ga0500607_090211 | 3300053121 | Bacteria | 1544 |
| 883 | Ga0500658_0002864 | 3300053134 | Bacteria | 6618 |
| 884 | Ga0500559_0033293 | 3300053136 | Bacteria | 2218 |
| 885 | Ga0500568_0000863 | 3300053139 | Bacteria | 21288 |
| 886 | Ga0500577_0018098 | 3300053142 | Bacteria | 2258 |
| 887 | Ga0500590_077471 | 3300053148 | Bacteria | 1640 |
| 888 | Ga0500616_0021358 | 3300053153 | Bacteria | 3632 |
| 889 | Ga0500622_0000445 | 3300053156 | Bacteria | 39381 |
| 890 | Ga0500622_0000497 | 3300053156 | Bacteria | 36689 |
| 891 | Ga0500622_0000568 | 3300053156 | Bacteria | 33817 |
| 892 | Ga0500633_0001791 | 3300053160 | Bacteria | 4204 |
| 893 | Ga0500639_083027 | 3300053163 | Bacteria | 1611 |
| 894 | Ga0500611_000010 | 3300053727 | Bacteria | 165151 |
| 895 | Ga0501082_0001933 | 3300060353 | Bacteria | 18233 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049742 | Ga0501080_0179844 | Ga0501080_0179844_27_1199 | 390 |
| 2 | 3300053121 | Ga0500607_090211 | Ga0500607_090211_344_1522 | 390 |
| 3 | 3300049569 | Ga0501032_0039116 | Ga0501032_0039116_47_1294 | 415 |
| 4 | 3300046472 | Ga0495580_0105669 | Ga0495580_0105669_645_1895 | 416 |
| 5 | 3300046529 | Ga0495652_0130545 | Ga0495652_0130545_709_1959 | 416 |
| 6 | 3300053085 | Ga0495619_0097480 | Ga0495619_0097480_716_1966 | 416 |
| 7 | 3300013102 | Ga0157371_10000012 | Ga0157371_1000001262 | 422 |
| 8 | 3300031251 | Ga0265327_10006644 | Ga0265327_100066448 | 422 |
| 9 | 3300013297 | Ga0157378_10216788 | Ga0157378_102167882 | 423 |
| 10 | 3300037312 | Ga0395899_0000064 | Ga0395899_0000064_58750_60090 | 428 |
| 11 | 3300037418 | Ga0395900_0012681 | Ga0395900_0012681_1302_2642 | 428 |
| 12 | 3300037312 | Ga0395899_0000811 | Ga0395899_0000811_13775_15136 | 429 |
| 13 | 3300037418 | Ga0395900_0000275 | Ga0395900_0000275_34137_35498 | 429 |
| 14 | 3300037466 | Ga0395898_0009566 | Ga0395898_0009566_424_1785 | 429 |
| 15 | 3300037471 | Ga0395905_0000248 | Ga0395905_0000248_14411_15772 | 429 |
| 16 | 3300038443 | Ga0395901_0000595 | Ga0395901_0000595_13702_15063 | 429 |
| 17 | 3300001990 | JGI24737J22298_10007402 | JGI24737J22298_100074023 | 432 |
| 18 | 3300013100 | Ga0157373_10000678 | Ga0157373_1000067827 | 432 |
| 19 | 3300013102 | Ga0157371_10000107 | Ga0157371_1000010734 | 432 |
| 20 | 3300013307 | Ga0157372_10000238 | Ga0157372_1000023822 | 432 |
| 21 | 3300038443 | Ga0395901_0050730 | Ga0395901_0050730_1719_3092 | 432 |
| 22 | 3300005366 | Ga0070659_100001588 | Ga0070659_10000158822 | 433 |
| 23 | 3300005577 | Ga0068857_100032063 | Ga0068857_1000320633 | 433 |
| 24 | 3300025261 | Ga0209233_1001271 | Ga0209233_100127110 | 433 |
| 25 | 3300025904 | Ga0207647_10000071 | Ga0207647_1000007148 | 433 |
| 26 | 3300025932 | Ga0207690_10001688 | Ga0207690_1000168810 | 433 |
| 27 | 3300026116 | Ga0207674_10067960 | Ga0207674_100679604 | 433 |
| 28 | 3300042876 | Ga0451577_0000015 | Ga0451577_0000015_514205_515509 | 433 |
| 29 | 3300044712 | Ga0453684_0000081 | Ga0453684_0000081_331699_333003 | 433 |
| 30 | 3300045051 | Ga0451576_0000294 | Ga0451576_0000294_71979_73283 | 433 |
| 31 | 3300005614 | Ga0068856_100074039 | Ga0068856_1000740391 | 439 |
| 32 | 3300037471 | Ga0395905_0000051 | Ga0395905_0000051_167082_168419 | 441 |
| 33 | 3300005336 | Ga0070680_100182096 | Ga0070680_1001820961 | 442 |
| 34 | 3300005458 | Ga0070681_10066593 | Ga0070681_100665933 | 442 |
| 35 | 3300005530 | Ga0070679_100056362 | Ga0070679_1000563623 | 442 |
| 36 | 3300005563 | Ga0068855_100248143 | Ga0068855_1002481433 | 442 |
| 37 | 3300013102 | Ga0157371_10000168 | Ga0157371_1000016833 | 442 |
| 38 | 3300013102 | Ga0157371_10012460 | Ga0157371_100124602 | 442 |
| 39 | 3300013104 | Ga0157370_10000817 | Ga0157370_1000081728 | 442 |
| 40 | 3300037312 | Ga0395899_0002874 | Ga0395899_0002874_7373_8725 | 442 |
| 41 | 3300037312 | Ga0395899_0101062 | Ga0395899_0101062_584_1936 | 442 |
| 42 | 3300037312 | Ga0395899_0175619 | Ga0395899_0175619_94_1446 | 442 |
| 43 | 3300037418 | Ga0395900_0001963 | Ga0395900_0001963_16887_18239 | 442 |
| 44 | 3300037418 | Ga0395900_0147364 | Ga0395900_0147364_865_2217 | 442 |
| 45 | 3300037466 | Ga0395898_0005476 | Ga0395898_0005476_4990_6342 | 442 |
| 46 | 3300037466 | Ga0395898_0098621 | Ga0395898_0098621_317_1669 | 442 |
| 47 | 3300037471 | Ga0395905_0028897 | Ga0395905_0028897_3230_4582 | 442 |
| 48 | 3300038443 | Ga0395901_0010392 | Ga0395901_0010392_4670_6022 | 442 |
| 49 | 3300038443 | Ga0395901_0068548 | Ga0395901_0068548_1479_2831 | 442 |
| 50 | iso_pu_bacteria | 2839989709 | 2839991743 | 442 |
| 51 | iso_pu_bacteria | 2896317667 | 2896320617 | 442 |
| 52 | 3300031240 | Ga0265320_10045317 | Ga0265320_100453172 | 443 |
| 53 | 3300042876 | Ga0451577_0006314 | Ga0451577_0006314_9848_11182 | 443 |
| 54 | 3300042876 | Ga0451577_0043978 | Ga0451577_0043978_2373_3707 | 443 |
| 55 | 3300044673 | Ga0453683_0000509 | Ga0453683_0000509_10624_11958 | 443 |
| 56 | 3300044673 | Ga0453683_0028064 | Ga0453683_0028064_184_1518 | 443 |
| 57 | 3300045051 | Ga0451576_0025171 | Ga0451576_0025171_2048_3382 | 443 |
| 58 | 3300045051 | Ga0451576_0073880 | Ga0451576_0073880_2048_3382 | 443 |
| 59 | 3300046454 | Ga0495592_0075150 | Ga0495592_0075150_981_2321 | 443 |
| 60 | iso_pu_bacteria | 2890737413 | 2890738860 | 443 |
| 61 | 3300005327 | Ga0070658_10021983 | Ga0070658_100219834 | 444 |
| 62 | 3300005328 | Ga0070676_10001094 | Ga0070676_1000109410 | 444 |
| 63 | 3300005347 | Ga0070668_100001636 | Ga0070668_10000163616 | 444 |
| 64 | 3300005367 | Ga0070667_100002121 | Ga0070667_10000212115 | 444 |
| 65 | 3300005456 | Ga0070678_100009316 | Ga0070678_1000093167 | 444 |
| 66 | 3300005459 | Ga0068867_100016216 | Ga0068867_1000162164 | 444 |
| 67 | 3300005543 | Ga0070672_100001082 | Ga0070672_1000010829 | 444 |
| 68 | 3300005548 | Ga0070665_100031963 | Ga0070665_1000319632 | 444 |
| 69 | 3300005618 | Ga0068864_100023214 | Ga0068864_1000232142 | 444 |
| 70 | 3300005719 | Ga0068861_100061833 | Ga0068861_1000618333 | 444 |
| 71 | 3300005842 | Ga0068858_100030456 | Ga0068858_1000304562 | 444 |
| 72 | 3300006237 | Ga0097621_100019146 | Ga0097621_1000191462 | 444 |
| 73 | 3300025261 | Ga0209233_1011529 | Ga0209233_10115292 | 444 |
| 74 | 3300025933 | Ga0207706_10089603 | Ga0207706_100896032 | 444 |
| 75 | 3300025949 | Ga0207667_10027229 | Ga0207667_100272295 | 444 |
| 76 | 3300025972 | Ga0207668_10000671 | Ga0207668_1000067114 | 444 |
| 77 | 3300025986 | Ga0207658_10004178 | Ga0207658_100041787 | 444 |
| 78 | 3300026023 | Ga0207677_10006265 | Ga0207677_100062653 | 444 |
| 79 | 3300026089 | Ga0207648_10015948 | Ga0207648_100159488 | 444 |
| 80 | 3300028381 | Ga0268264_10046627 | Ga0268264_100466272 | 444 |
| 81 | 3300031251 | Ga0265327_10002290 | Ga0265327_1000229011 | 444 |
| 82 | iso_pu_bacteria | 2842903701 | 2842904796 | 444 |
| 83 | iso_pu_bacteria | 3003233435 | 3003235836 | 444 |
| 84 | iso_pu_bacteria | 8055588893 | 8055592071 | 444 |
| 85 | 3300006173 | Ga0070716_100011309 | Ga0070716_1000113093 | 445 |
| 86 | 3300025904 | Ga0207647_10041369 | Ga0207647_100413692 | 445 |
| 87 | 3300025913 | Ga0207695_10133955 | Ga0207695_101339552 | 445 |
| 88 | 3300026078 | Ga0207702_10045324 | Ga0207702_100453242 | 445 |
| 89 | 3300049663 | Ga0501223_000153 | Ga0501223_000153_7487_8830 | 445 |
| 90 | iso_pu_bacteria | 2523533629 | 2524005745 | 445 |
| 91 | iso_pu_bacteria | 2818991444 | 2819590369 | 445 |
| 92 | iso_pu_bacteria | 2881955468 | 2881956895 | 445 |
| 93 | iso_pu_bacteria | 2896344016 | 2896345418 | 445 |
| 94 | iso_pu_bacteria | 2898713307 | 2898714494 | 445 |
| 95 | iso_pu_bacteria | 2929154850 | 2929158426 | 445 |
| 96 | 3300031251 | Ga0265327_10000073 | Ga0265327_1000007346 | 446 |
| 97 | 3300031730 | Ga0307516_10090626 | Ga0307516_100906262 | 446 |
| 98 | iso_pu_bacteria | 2585428061 | 2587753621 | 446 |
| 99 | iso_pu_bacteria | 2585428187 | 2588230994 | 446 |
| 100 | iso_pu_bacteria | 2738541278 | 2738726106 | 446 |
| 101 | iso_pu_bacteria | 2775506739 | 2775674078 | 446 |
| 102 | iso_pu_bacteria | 2919097161 | 2919099966 | 446 |
| 103 | iso_pu_bacteria | 2984572630 | 2984574726 | 446 |
| 104 | iso_pu_bacteria | 2984606641 | 2984608177 | 446 |
| 105 | iso_pu_bacteria | 2993372514 | 2993374819 | 446 |
| 106 | iso_pu_bacteria | 2993480792 | 2993481675 | 446 |
| 107 | 3300003320 | rootH2_10012714 | rootH2_1001271442 | 447 |
| 108 | 3300003320 | rootH2_10073988 | rootH2_100739883 | 447 |
| 109 | 3300005328 | Ga0070676_10000113 | Ga0070676_1000011325 | 447 |
| 110 | 3300005459 | Ga0068867_100003787 | Ga0068867_10000378711 | 447 |
| 111 | 3300005616 | Ga0068852_100020168 | Ga0068852_1000201687 | 447 |
| 112 | 3300006237 | Ga0097621_100000015 | Ga0097621_10000001583 | 447 |
| 113 | 3300006358 | Ga0068871_100000051 | Ga0068871_10000005166 | 447 |
| 114 | 3300009545 | Ga0105237_10001895 | Ga0105237_1000189524 | 447 |
| 115 | 3300013296 | Ga0157374_10001665 | Ga0157374_100016659 | 447 |
| 116 | 3300017792 | Ga0163161_10149168 | Ga0163161_101491682 | 447 |
| 117 | 3300025907 | Ga0207645_10000229 | Ga0207645_1000022932 | 447 |
| 118 | 3300025924 | Ga0207694_10068792 | Ga0207694_100687921 | 447 |
| 119 | 3300025960 | Ga0207651_10010529 | Ga0207651_100105297 | 447 |
| 120 | 3300026041 | Ga0207639_10009275 | Ga0207639_100092755 | 447 |
| 121 | 3300026089 | Ga0207648_10007503 | Ga0207648_1000750311 | 447 |
| 122 | 3300026121 | Ga0207683_10023462 | Ga0207683_100234625 | 447 |
| 123 | 3300042005 | Ga0439448_0002912 | Ga0439448_0002912_1678_3039 | 447 |
| 124 | 3300046616 | Ga0495668_0000450 | Ga0495668_0000450_42404_43747 | 447 |
| 125 | 3300048918 | Ga0496115_0020666 | Ga0496115_0020666_2671_4014 | 447 |
| 126 | 3300049573 | Ga0501037_0029791 | Ga0501037_0029791_2385_3740 | 447 |
| 127 | 3300053153 | Ga0500616_0021358 | Ga0500616_0021358_760_2103 | 447 |
| 128 | iso_pu_bacteria | 2585428095 | 2587868476 | 447 |
| 129 | iso_pu_bacteria | 2818991460 | 2819677705 | 447 |
| 130 | iso_pu_bacteria | 2821136567 | 2821141824 | 447 |
| 131 | iso_pu_bacteria | 2883068021 | 2883070483 | 447 |
| 132 | iso_pu_bacteria | 2884791551 | 2884797647 | 447 |
| 133 | iso_pu_bacteria | 2896085136 | 2896087342 | 447 |
| 134 | iso_pu_bacteria | 2896109856 | 2896114669 | 447 |
| 135 | iso_pu_bacteria | 2904467357 | 2904469761 | 447 |
| 136 | iso_pu_bacteria | 2929177148 | 2929183303 | 447 |
| 137 | iso_pu_bacteria | 2929239360 | 2929245421 | 447 |
| 138 | iso_pu_bacteria | 2929921140 | 2929927688 | 447 |
| 139 | iso_pu_bacteria | 2945924605 | 2945928654 | 447 |
| 140 | iso_pu_bacteria | 2945977869 | 2945979263 | 447 |
| 141 | iso_pu_bacteria | 2946013367 | 2946014866 | 447 |
| 142 | 3300005366 | Ga0070659_100096396 | Ga0070659_1000963962 | 448 |
| 143 | 3300005367 | Ga0070667_100168373 | Ga0070667_1001683732 | 448 |
| 144 | 3300005843 | Ga0068860_100038399 | Ga0068860_1000383994 | 448 |
| 145 | 3300010375 | Ga0105239_10043427 | Ga0105239_100434275 | 448 |
| 146 | 3300013104 | Ga0157370_10001336 | Ga0157370_1000133629 | 448 |
| 147 | 3300013104 | Ga0157370_10042422 | Ga0157370_100424224 | 448 |
| 148 | 3300021384 | Ga0213876_10004817 | Ga0213876_100048173 | 448 |
| 149 | 3300025932 | Ga0207690_10071439 | Ga0207690_100714392 | 448 |
| 150 | 3300030732 | Ga0316176_1026201 | Ga0316176_10262018 | 448 |
| 151 | 3300030742 | Ga0316183_1106482 | Ga0316183_110648226 | 448 |
| 152 | 3300030744 | Ga0316181_1039179 | Ga0316181_10391792 | 448 |
| 153 | 3300031251 | Ga0265327_10000256 | Ga0265327_1000025616 | 448 |
| 154 | 3300032004 | Ga0307414_10060464 | Ga0307414_100604643 | 448 |
| 155 | 3300039437 | Ga0436365_1740763 | Ga0436365_1740763_5455_6801 | 448 |
| 156 | 3300044842 | Ga0466957_0000372 | Ga0466957_0000372_856_2220 | 448 |
| 157 | 3300045051 | Ga0451576_0008161 | Ga0451576_0008161_7190_8542 | 448 |
| 158 | 3300047472 | Ga0495686_0000814 | Ga0495686_0000814_9889_11235 | 448 |
| 159 | iso_pu_bacteria | 2511231000 | 2511233955 | 448 |
| 160 | iso_pu_bacteria | 2582581278 | 2585142433 | 448 |
| 161 | iso_pu_bacteria | 2582581281 | 2585156965 | 448 |
| 162 | iso_pu_bacteria | 2582581282 | 2585161484 | 448 |
| 163 | iso_pu_bacteria | 2582581873 | 2585426652 | 448 |
| 164 | iso_pu_bacteria | 2585428045 | 2587681188 | 448 |
| 165 | iso_pu_bacteria | 2585428060 | 2587748904 | 448 |
| 166 | iso_pu_bacteria | 2585428115 | 2587942510 | 448 |
| 167 | iso_pu_bacteria | 2585428182 | 2588211767 | 448 |
| 168 | iso_pu_bacteria | 2585428183 | 2588216570 | 448 |
| 169 | iso_pu_bacteria | 2585428184 | 2588220646 | 448 |
| 170 | iso_pu_bacteria | 2585428185 | 2588225935 | 448 |
| 171 | iso_pu_bacteria | 2588253712 | 2588447840 | 448 |
| 172 | iso_pu_bacteria | 2588254255 | 2590603600 | 448 |
| 173 | iso_pu_bacteria | 2588254257 | 2590610484 | 448 |
| 174 | iso_pu_bacteria | 2728369107 | 2729202478 | 448 |
| 175 | iso_pu_bacteria | 2738541273 | 2738699965 | 448 |
| 176 | iso_pu_bacteria | 2738543014 | 2739253714 | 448 |
| 177 | iso_pu_bacteria | 2751185877 | 2753674964 | 448 |
| 178 | iso_pu_bacteria | 2765235839 | 2765575977 | 448 |
| 179 | iso_pu_bacteria | 2772190705 | 2772607401 | 448 |
| 180 | iso_pu_bacteria | 2816332188 | 2816875679 | 448 |
| 181 | iso_pu_bacteria | 2842083920 | 2842087836 | 448 |
| 182 | iso_pu_bacteria | 2871720351 | 2871724769 | 448 |
| 183 | iso_pu_bacteria | 2889290771 | 2889293531 | 448 |
| 184 | iso_pu_bacteria | 2905999023 | 2906002080 | 448 |
| 185 | iso_pu_bacteria | 2919399522 | 2919403491 | 448 |
| 186 | iso_pu_bacteria | 2977243572 | 2977247490 | 448 |
| 187 | 2162886007 | SwRhRL2b_contig_677025 | SwRhRL2b_0927.00002140 | 449 |
| 188 | 3300003203 | JGI25406J46586_10003552 | JGI25406J46586_100035523 | 449 |
| 189 | 3300003320 | rootH2_10065769 | rootH2_100657698 | 449 |
| 190 | 3300003323 | rootH1_10101281 | rootH1_101012812 | 449 |
| 191 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133275 | 449 |
| 192 | 3300005290 | Ga0065712_10072974 | Ga0065712_100729743 | 449 |
| 193 | 3300005328 | Ga0070676_10005256 | Ga0070676_100052566 | 449 |
| 194 | 3300005329 | Ga0070683_100000553 | Ga0070683_10000055314 | 449 |
| 195 | 3300005329 | Ga0070683_100045229 | Ga0070683_1000452293 | 449 |
| 196 | 3300005329 | Ga0070683_100081489 | Ga0070683_1000814892 | 449 |
| 197 | 3300005330 | Ga0070690_100021267 | Ga0070690_1000212673 | 449 |
| 198 | 3300005330 | Ga0070690_100128920 | Ga0070690_1001289201 | 449 |
| 199 | 3300005331 | Ga0070670_100100003 | Ga0070670_1001000031 | 449 |
| 200 | 3300005334 | Ga0068869_100025796 | Ga0068869_1000257964 | 449 |
| 201 | 3300005335 | Ga0070666_10000019 | Ga0070666_10000019165 | 449 |
| 202 | 3300005335 | Ga0070666_10046115 | Ga0070666_100461155 | 449 |
| 203 | 3300005337 | Ga0070682_100021389 | Ga0070682_1000213894 | 449 |
| 204 | 3300005338 | Ga0068868_100023995 | Ga0068868_1000239959 | 449 |
| 205 | 3300005338 | Ga0068868_100179953 | Ga0068868_1001799532 | 449 |
| 206 | 3300005339 | Ga0070660_100133547 | Ga0070660_1001335472 | 449 |
| 207 | 3300005340 | Ga0070689_100130139 | Ga0070689_1001301392 | 449 |
| 208 | 3300005343 | Ga0070687_100062734 | Ga0070687_1000627343 | 449 |
| 209 | 3300005344 | Ga0070661_100000179 | Ga0070661_10000017911 | 449 |
| 210 | 3300005344 | Ga0070661_100077158 | Ga0070661_1000771584 | 449 |
| 211 | 3300005354 | Ga0070675_100208513 | Ga0070675_1002085131 | 449 |
| 212 | 3300005355 | Ga0070671_100022897 | Ga0070671_1000228974 | 449 |
| 213 | 3300005355 | Ga0070671_100131533 | Ga0070671_1001315332 | 449 |
| 214 | 3300005355 | Ga0070671_100219718 | Ga0070671_1002197181 | 449 |
| 215 | 3300005356 | Ga0070674_100004529 | Ga0070674_1000045297 | 449 |
| 216 | 3300005364 | Ga0070673_100135041 | Ga0070673_1001350412 | 449 |
| 217 | 3300005364 | Ga0070673_100145283 | Ga0070673_1001452832 | 449 |
| 218 | 3300005365 | Ga0070688_100011134 | Ga0070688_1000111344 | 449 |
| 219 | 3300005366 | Ga0070659_100017521 | Ga0070659_1000175214 | 449 |
| 220 | 3300005366 | Ga0070659_100021878 | Ga0070659_1000218786 | 449 |
| 221 | 3300005441 | Ga0070700_100091756 | Ga0070700_1000917562 | 449 |
| 222 | 3300005457 | Ga0070662_100006914 | Ga0070662_1000069142 | 449 |
| 223 | 3300005457 | Ga0070662_100013751 | Ga0070662_1000137514 | 449 |
| 224 | 3300005457 | Ga0070662_100095908 | Ga0070662_1000959083 | 449 |
| 225 | 3300005457 | Ga0070662_100129292 | Ga0070662_1001292923 | 449 |
| 226 | 3300005458 | Ga0070681_10094284 | Ga0070681_100942843 | 449 |
| 227 | 3300005459 | Ga0068867_100061101 | Ga0068867_1000611012 | 449 |
| 228 | 3300005471 | Ga0070698_100003913 | Ga0070698_1000039137 | 449 |
| 229 | 3300005471 | Ga0070698_100009186 | Ga0070698_1000091864 | 449 |
| 230 | 3300005471 | Ga0070698_100169495 | Ga0070698_1001694952 | 449 |
| 231 | 3300005530 | Ga0070679_100010564 | Ga0070679_1000105648 | 449 |
| 232 | 3300005530 | Ga0070679_100110417 | Ga0070679_1001104173 | 449 |
| 233 | 3300005535 | Ga0070684_100001469 | Ga0070684_1000014699 | 449 |
| 234 | 3300005535 | Ga0070684_100042255 | Ga0070684_1000422552 | 449 |
| 235 | 3300005539 | Ga0068853_100001537 | Ga0068853_10000153719 | 449 |
| 236 | 3300005539 | Ga0068853_100024340 | Ga0068853_1000243401 | 449 |
| 237 | 3300005539 | Ga0068853_100032462 | Ga0068853_1000324622 | 449 |
| 238 | 3300005543 | Ga0070672_100073243 | Ga0070672_1000732431 | 449 |
| 239 | 3300005547 | Ga0070693_100074587 | Ga0070693_1000745873 | 449 |
| 240 | 3300005549 | Ga0070704_100051890 | Ga0070704_1000518902 | 449 |
| 241 | 3300005563 | Ga0068855_100068908 | Ga0068855_1000689081 | 449 |
| 242 | 3300005563 | Ga0068855_100208823 | Ga0068855_1002088233 | 449 |
| 243 | 3300005563 | Ga0068855_100279633 | Ga0068855_1002796331 | 449 |
| 244 | 3300005564 | Ga0070664_100001077 | Ga0070664_1000010775 | 449 |
| 245 | 3300005564 | Ga0070664_100004250 | Ga0070664_1000042508 | 449 |
| 246 | 3300005564 | Ga0070664_100250991 | Ga0070664_1002509911 | 449 |
| 247 | 3300005577 | Ga0068857_100022387 | Ga0068857_1000223875 | 449 |
| 248 | 3300005578 | Ga0068854_100007104 | Ga0068854_1000071043 | 449 |
| 249 | 3300005614 | Ga0068856_100039390 | Ga0068856_1000393902 | 449 |
| 250 | 3300005616 | Ga0068852_100027173 | Ga0068852_1000271733 | 449 |
| 251 | 3300005616 | Ga0068852_100044678 | Ga0068852_1000446782 | 449 |
| 252 | 3300005616 | Ga0068852_100127635 | Ga0068852_1001276353 | 449 |
| 253 | 3300005617 | Ga0068859_100098912 | Ga0068859_1000989123 | 449 |
| 254 | 3300005617 | Ga0068859_100173554 | Ga0068859_1001735542 | 449 |
| 255 | 3300005617 | Ga0068859_100227010 | Ga0068859_1002270102 | 449 |
| 256 | 3300005617 | Ga0068859_100243764 | Ga0068859_1002437642 | 449 |
| 257 | 3300005617 | Ga0068859_100279643 | Ga0068859_1002796432 | 449 |
| 258 | 3300005618 | Ga0068864_100030528 | Ga0068864_1000305286 | 449 |
| 259 | 3300005719 | Ga0068861_100000312 | Ga0068861_10000031213 | 449 |
| 260 | 3300005840 | Ga0068870_10028139 | Ga0068870_100281391 | 449 |
| 261 | 3300005841 | Ga0068863_100014098 | Ga0068863_1000140984 | 449 |
| 262 | 3300005841 | Ga0068863_100063235 | Ga0068863_1000632354 | 449 |
| 263 | 3300005842 | Ga0068858_100027822 | Ga0068858_1000278223 | 449 |
| 264 | 3300005842 | Ga0068858_100094319 | Ga0068858_1000943194 | 449 |
| 265 | 3300005844 | Ga0068862_100283256 | Ga0068862_1002832562 | 449 |
| 266 | 3300005985 | Ga0081539_10000418 | Ga0081539_1000041844 | 449 |
| 267 | 3300006237 | Ga0097621_100000611 | Ga0097621_1000006119 | 449 |
| 268 | 3300006237 | Ga0097621_100004099 | Ga0097621_1000040999 | 449 |
| 269 | 3300006237 | Ga0097621_100246296 | Ga0097621_1002462962 | 449 |
| 270 | 3300006358 | Ga0068871_100000634 | Ga0068871_1000006344 | 449 |
| 271 | 3300006358 | Ga0068871_100063228 | Ga0068871_1000632282 | 449 |
| 272 | 3300006358 | Ga0068871_100063902 | Ga0068871_1000639024 | 449 |
| 273 | 3300006358 | Ga0068871_100229903 | Ga0068871_1002299031 | 449 |
| 274 | 3300006844 | Ga0075428_100071519 | Ga0075428_1000715192 | 449 |
| 275 | 3300006844 | Ga0075428_100091050 | Ga0075428_1000910503 | 449 |
| 276 | 3300006846 | Ga0075430_100034421 | Ga0075430_1000344213 | 449 |
| 277 | 3300006847 | Ga0075431_100016396 | Ga0075431_1000163968 | 449 |
| 278 | 3300006881 | Ga0068865_100096438 | Ga0068865_1000964382 | 449 |
| 279 | 3300006931 | Ga0097620_100098915 | Ga0097620_1000989152 | 449 |
| 280 | 3300006931 | Ga0097620_100173555 | Ga0097620_1001735552 | 449 |
| 281 | 3300006931 | Ga0097620_100227012 | Ga0097620_1002270122 | 449 |
| 282 | 3300006931 | Ga0097620_100243780 | Ga0097620_1002437801 | 449 |
| 283 | 3300006931 | Ga0097620_100279634 | Ga0097620_1002796342 | 449 |
| 284 | 3300009093 | Ga0105240_10024475 | Ga0105240_100244757 | 449 |
| 285 | 3300009094 | Ga0111539_10112694 | Ga0111539_101126943 | 449 |
| 286 | 3300009101 | Ga0105247_10002997 | Ga0105247_100029978 | 449 |
| 287 | 3300009147 | Ga0114129_10153551 | Ga0114129_101535514 | 449 |
| 288 | 3300009148 | Ga0105243_10000003 | Ga0105243_1000000358 | 449 |
| 289 | 3300009176 | Ga0105242_10029088 | Ga0105242_100290882 | 449 |
| 290 | 3300009177 | Ga0105248_10051086 | Ga0105248_100510866 | 449 |
| 291 | 3300009545 | Ga0105237_10052853 | Ga0105237_100528534 | 449 |
| 292 | 3300009553 | Ga0105249_10000679 | Ga0105249_1000067936 | 449 |
| 293 | 3300009553 | Ga0105249_10007529 | Ga0105249_100075291 | 449 |
| 294 | 3300009553 | Ga0105249_10064934 | Ga0105249_100649343 | 449 |
| 295 | 3300009553 | Ga0105249_10090960 | Ga0105249_100909603 | 449 |
| 296 | 3300009553 | Ga0105249_10248929 | Ga0105249_102489292 | 449 |
| 297 | 3300013100 | Ga0157373_10011301 | Ga0157373_100113012 | 449 |
| 298 | 3300013100 | Ga0157373_10032325 | Ga0157373_100323257 | 449 |
| 299 | 3300013100 | Ga0157373_10070171 | Ga0157373_100701712 | 449 |
| 300 | 3300013100 | Ga0157373_10077735 | Ga0157373_100777353 | 449 |
| 301 | 3300013102 | Ga0157371_10001199 | Ga0157371_1000119923 | 449 |
| 302 | 3300013104 | Ga0157370_10010241 | Ga0157370_100102415 | 449 |
| 303 | 3300013105 | Ga0157369_10030384 | Ga0157369_100303847 | 449 |
| 304 | 3300013105 | Ga0157369_10067961 | Ga0157369_100679613 | 449 |
| 305 | 3300013105 | Ga0157369_10079828 | Ga0157369_100798282 | 449 |
| 306 | 3300013296 | Ga0157374_10063424 | Ga0157374_100634242 | 449 |
| 307 | 3300013297 | Ga0157378_10014757 | Ga0157378_100147573 | 449 |
| 308 | 3300013297 | Ga0157378_10025398 | Ga0157378_100253986 | 449 |
| 309 | 3300013306 | Ga0163162_10000595 | Ga0163162_1000059522 | 449 |
| 310 | 3300013306 | Ga0163162_10001161 | Ga0163162_1000116125 | 449 |
| 311 | 3300013306 | Ga0163162_10002066 | Ga0163162_1000206615 | 449 |
| 312 | 3300013306 | Ga0163162_10010491 | Ga0163162_100104913 | 449 |
| 313 | 3300013306 | Ga0163162_10158083 | Ga0163162_101580832 | 449 |
| 314 | 3300013306 | Ga0163162_10216044 | Ga0163162_102160442 | 449 |
| 315 | 3300013307 | Ga0157372_10052990 | Ga0157372_100529904 | 449 |
| 316 | 3300013307 | Ga0157372_10116638 | Ga0157372_101166384 | 449 |
| 317 | 3300013307 | Ga0157372_10237648 | Ga0157372_102376483 | 449 |
| 318 | 3300013308 | Ga0157375_10000614 | Ga0157375_1000061417 | 449 |
| 319 | 3300013308 | Ga0157375_10226897 | Ga0157375_102268972 | 449 |
| 320 | 3300014325 | Ga0163163_10000352 | Ga0163163_1000035232 | 449 |
| 321 | 3300014326 | Ga0157380_10059143 | Ga0157380_100591433 | 449 |
| 322 | 3300014968 | Ga0157379_10025131 | Ga0157379_100251312 | 449 |
| 323 | 3300014969 | Ga0157376_10004780 | Ga0157376_100047804 | 449 |
| 324 | 3300014969 | Ga0157376_10024787 | Ga0157376_100247874 | 449 |
| 325 | 3300014969 | Ga0157376_10224255 | Ga0157376_102242552 | 449 |
| 326 | 3300015261 | Ga0182006_1005760 | Ga0182006_10057602 | 449 |
| 327 | 3300017792 | Ga0163161_10000968 | Ga0163161_1000096823 | 449 |
| 328 | 3300017792 | Ga0163161_10045614 | Ga0163161_100456142 | 449 |
| 329 | 3300017792 | Ga0163161_10092342 | Ga0163161_100923422 | 449 |
| 330 | 3300025900 | Ga0207710_10001252 | Ga0207710_100012529 | 449 |
| 331 | 3300025903 | Ga0207680_10000586 | Ga0207680_1000058610 | 449 |
| 332 | 3300025907 | Ga0207645_10021982 | Ga0207645_100219823 | 449 |
| 333 | 3300025908 | Ga0207643_10060920 | Ga0207643_100609202 | 449 |
| 334 | 3300025908 | Ga0207643_10065139 | Ga0207643_100651392 | 449 |
| 335 | 3300025909 | Ga0207705_10122670 | Ga0207705_101226702 | 449 |
| 336 | 3300025913 | Ga0207695_10016392 | Ga0207695_100163924 | 449 |
| 337 | 3300025914 | Ga0207671_10000721 | Ga0207671_1000072144 | 449 |
| 338 | 3300025914 | Ga0207671_10105705 | Ga0207671_101057051 | 449 |
| 339 | 3300025918 | Ga0207662_10040436 | Ga0207662_100404362 | 449 |
| 340 | 3300025919 | Ga0207657_10001900 | Ga0207657_100019002 | 449 |
| 341 | 3300025920 | Ga0207649_10005271 | Ga0207649_100052716 | 449 |
| 342 | 3300025920 | Ga0207649_10044523 | Ga0207649_100445234 | 449 |
| 343 | 3300025921 | Ga0207652_10186653 | Ga0207652_101866531 | 449 |
| 344 | 3300025926 | Ga0207659_10058056 | Ga0207659_100580562 | 449 |
| 345 | 3300025926 | Ga0207659_10106238 | Ga0207659_101062381 | 449 |
| 346 | 3300025931 | Ga0207644_10065862 | Ga0207644_100658621 | 449 |
| 347 | 3300025931 | Ga0207644_10101979 | Ga0207644_101019793 | 449 |
| 348 | 3300025932 | Ga0207690_10004290 | Ga0207690_100042906 | 449 |
| 349 | 3300025933 | Ga0207706_10006199 | Ga0207706_100061996 | 449 |
| 350 | 3300025933 | Ga0207706_10011398 | Ga0207706_100113988 | 449 |
| 351 | 3300025933 | Ga0207706_10072073 | Ga0207706_100720733 | 449 |
| 352 | 3300025934 | Ga0207686_10004707 | Ga0207686_100047076 | 449 |
| 353 | 3300025935 | Ga0207709_10000008 | Ga0207709_10000008516 | 449 |
| 354 | 3300025937 | Ga0207669_10095388 | Ga0207669_100953882 | 449 |
| 355 | 3300025940 | Ga0207691_10018630 | Ga0207691_100186301 | 449 |
| 356 | 3300025940 | Ga0207691_10184076 | Ga0207691_101840762 | 449 |
| 357 | 3300025942 | Ga0207689_10010987 | Ga0207689_1001098710 | 449 |
| 358 | 3300025942 | Ga0207689_10035495 | Ga0207689_100354952 | 449 |
| 359 | 3300025944 | Ga0207661_10024898 | Ga0207661_100248982 | 449 |
| 360 | 3300025945 | Ga0207679_10001674 | Ga0207679_1000167410 | 449 |
| 361 | 3300025945 | Ga0207679_10162210 | Ga0207679_101622102 | 449 |
| 362 | 3300025961 | Ga0207712_10010819 | Ga0207712_100108194 | 449 |
| 363 | 3300025961 | Ga0207712_10016873 | Ga0207712_100168735 | 449 |
| 364 | 3300025961 | Ga0207712_10068240 | Ga0207712_100682403 | 449 |
| 365 | 3300025961 | Ga0207712_10090344 | Ga0207712_100903442 | 449 |
| 366 | 3300025981 | Ga0207640_10075141 | Ga0207640_100751411 | 449 |
| 367 | 3300025986 | Ga0207658_10208019 | Ga0207658_102080191 | 449 |
| 368 | 3300026023 | Ga0207677_10001780 | Ga0207677_1000178013 | 449 |
| 369 | 3300026035 | Ga0207703_10019532 | Ga0207703_100195323 | 449 |
| 370 | 3300026041 | Ga0207639_10026751 | Ga0207639_100267513 | 449 |
| 371 | 3300026041 | Ga0207639_10246351 | Ga0207639_102463511 | 449 |
| 372 | 3300026078 | Ga0207702_10126034 | Ga0207702_101260342 | 449 |
| 373 | 3300026088 | Ga0207641_10000448 | Ga0207641_1000044834 | 449 |
| 374 | 3300026088 | Ga0207641_10001077 | Ga0207641_1000107719 | 449 |
| 375 | 3300026088 | Ga0207641_10012106 | Ga0207641_100121066 | 449 |
| 376 | 3300026088 | Ga0207641_10018916 | Ga0207641_100189165 | 449 |
| 377 | 3300026089 | Ga0207648_10005010 | Ga0207648_1000501015 | 449 |
| 378 | 3300026089 | Ga0207648_10007532 | Ga0207648_100075328 | 449 |
| 379 | 3300026089 | Ga0207648_10057688 | Ga0207648_100576883 | 449 |
| 380 | 3300026089 | Ga0207648_10064155 | Ga0207648_100641552 | 449 |
| 381 | 3300026095 | Ga0207676_10012325 | Ga0207676_100123252 | 449 |
| 382 | 3300026116 | Ga0207674_10000894 | Ga0207674_1000089426 | 449 |
| 383 | 3300026118 | Ga0207675_100002842 | Ga0207675_1000028425 | 449 |
| 384 | 3300026121 | Ga0207683_10056112 | Ga0207683_100561122 | 449 |
| 385 | 3300026142 | Ga0207698_10040670 | Ga0207698_100406703 | 449 |
| 386 | 3300026142 | Ga0207698_10135625 | Ga0207698_101356251 | 449 |
| 387 | 3300028381 | Ga0268264_10002805 | Ga0268264_100028053 | 449 |
| 388 | 3300031251 | Ga0265327_10000006 | Ga0265327_10000006387 | 449 |
| 389 | 3300032004 | Ga0307414_10011763 | Ga0307414_100117632 | 449 |
| 390 | 3300041413 | Ga0439465_0016026 | Ga0439465_0016026_932_2284 | 449 |
| 391 | 3300046454 | Ga0495592_0159165 | Ga0495592_0159165_123_1472 | 449 |
| 392 | 3300046516 | Ga0495628_0018695 | Ga0495628_0018695_2975_4324 | 449 |
| 393 | 3300046517 | Ga0495630_0009753 | Ga0495630_0009753_261_1610 | 449 |
| 394 | 3300046529 | Ga0495652_0114033 | Ga0495652_0114033_789_2138 | 449 |
| 395 | 3300046543 | Ga0495645_0144519 | Ga0495645_0144519_148_1500 | 449 |
| 396 | 3300046642 | Ga0495634_0071154 | Ga0495634_0071154_915_2264 | 449 |
| 397 | 3300046678 | Ga0495599_0032634 | Ga0495599_0032634_968_2317 | 449 |
| 398 | 3300047471 | Ga0495684_0089071 | Ga0495684_0089071_192_1541 | 449 |
| 399 | 3300048907 | Ga0496104_0096952 | Ga0496104_0096952_1375_2727 | 449 |
| 400 | 3300048913 | Ga0496110_0087547 | Ga0496110_0087547_1068_2417 | 449 |
| 401 | 3300048913 | Ga0496110_0097470 | Ga0496110_0097470_1212_2564 | 449 |
| 402 | 3300048917 | Ga0496114_0001046 | Ga0496114_0001046_15294_16643 | 449 |
| 403 | 3300049571 | Ga0501034_0005253 | Ga0501034_0005253_6439_7791 | 449 |
| 404 | 3300049571 | Ga0501034_0013642 | Ga0501034_0013642_6434_7783 | 449 |
| 405 | 3300049572 | Ga0501036_0049405 | Ga0501036_0049405_1941_3293 | 449 |
| 406 | 3300049580 | Ga0501046_0033569 | Ga0501046_0033569_914_2266 | 449 |
| 407 | 3300049581 | Ga0501047_0043636 | Ga0501047_0043636_1949_3301 | 449 |
| 408 | 3300049822 | Ga0501035_0052200 | Ga0501035_0052200_2200_3552 | 449 |
| 409 | 3300049823 | Ga0501044_0001663 | Ga0501044_0001663_8534_9886 | 449 |
| 410 | 3300049823 | Ga0501044_0023918 | Ga0501044_0023918_1897_3249 | 449 |
| 411 | 3300050507 | nmdc:mga05p37_177095_c1 | nmdc:mga05p37_177095_c1_1080_2432 | 449 |
| 412 | 3300050509 | nmdc:mga0qj67_50085_c1 | nmdc:mga0qj67_50085_c1_1818_3227 | 449 |
| 413 | 3300050511 | nmdc:mga08y16_104496_c1 | nmdc:mga08y16_104496_c1_543_1895 | 449 |
| 414 | 3300053139 | Ga0500568_0000863 | Ga0500568_0000863_13583_14935 | 449 |
| 415 | 3300053156 | Ga0500622_0000568 | Ga0500622_0000568_31192_32544 | 449 |
| 416 | 3300003323 | rootH1_10009896 | rootH1_100098964 | 450 |
| 417 | 3300005290 | Ga0065712_10074656 | Ga0065712_100746564 | 450 |
| 418 | 3300005327 | Ga0070658_10011839 | Ga0070658_100118392 | 450 |
| 419 | 3300005329 | Ga0070683_100002523 | Ga0070683_1000025239 | 450 |
| 420 | 3300005329 | Ga0070683_100004195 | Ga0070683_1000041959 | 450 |
| 421 | 3300005329 | Ga0070683_100005141 | Ga0070683_10000514110 | 450 |
| 422 | 3300005329 | Ga0070683_100156917 | Ga0070683_1001569172 | 450 |
| 423 | 3300005330 | Ga0070690_100016610 | Ga0070690_1000166104 | 450 |
| 424 | 3300005331 | Ga0070670_100032098 | Ga0070670_1000320984 | 450 |
| 425 | 3300005331 | Ga0070670_100091270 | Ga0070670_1000912703 | 450 |
| 426 | 3300005331 | Ga0070670_100109275 | Ga0070670_1001092751 | 450 |
| 427 | 3300005331 | Ga0070670_100243744 | Ga0070670_1002437441 | 450 |
| 428 | 3300005333 | Ga0070677_10028216 | Ga0070677_100282162 | 450 |
| 429 | 3300005334 | Ga0068869_100003465 | Ga0068869_1000034652 | 450 |
| 430 | 3300005334 | Ga0068869_100006312 | Ga0068869_1000063126 | 450 |
| 431 | 3300005335 | Ga0070666_10003803 | Ga0070666_100038039 | 450 |
| 432 | 3300005335 | Ga0070666_10011816 | Ga0070666_100118162 | 450 |
| 433 | 3300005336 | Ga0070680_100101249 | Ga0070680_1001012492 | 450 |
| 434 | 3300005337 | Ga0070682_100000129 | Ga0070682_10000012913 | 450 |
| 435 | 3300005338 | Ga0068868_100006616 | Ga0068868_1000066167 | 450 |
| 436 | 3300005338 | Ga0068868_100057848 | Ga0068868_1000578483 | 450 |
| 437 | 3300005339 | Ga0070660_100123168 | Ga0070660_1001231682 | 450 |
| 438 | 3300005340 | Ga0070689_100041636 | Ga0070689_1000416363 | 450 |
| 439 | 3300005340 | Ga0070689_100053033 | Ga0070689_1000530332 | 450 |
| 440 | 3300005347 | Ga0070668_100036105 | Ga0070668_1000361053 | 450 |
| 441 | 3300005353 | Ga0070669_100006616 | Ga0070669_1000066164 | 450 |
| 442 | 3300005353 | Ga0070669_100085507 | Ga0070669_1000855072 | 450 |
| 443 | 3300005364 | Ga0070673_100048895 | Ga0070673_1000488953 | 450 |
| 444 | 3300005364 | Ga0070673_100129050 | Ga0070673_1001290502 | 450 |
| 445 | 3300005364 | Ga0070673_100147895 | Ga0070673_1001478951 | 450 |
| 446 | 3300005365 | Ga0070688_100002588 | Ga0070688_1000025887 | 450 |
| 447 | 3300005366 | Ga0070659_100092731 | Ga0070659_1000927312 | 450 |
| 448 | 3300005367 | Ga0070667_100073882 | Ga0070667_1000738823 | 450 |
| 449 | 3300005367 | Ga0070667_100100035 | Ga0070667_1001000353 | 450 |
| 450 | 3300005438 | Ga0070701_10026249 | Ga0070701_100262492 | 450 |
| 451 | 3300005455 | Ga0070663_100109185 | Ga0070663_1001091852 | 450 |
| 452 | 3300005456 | Ga0070678_100000905 | Ga0070678_10000090512 | 450 |
| 453 | 3300005456 | Ga0070678_100003904 | Ga0070678_1000039049 | 450 |
| 454 | 3300005457 | Ga0070662_100036378 | Ga0070662_1000363783 | 450 |
| 455 | 3300005457 | Ga0070662_100053128 | Ga0070662_1000531283 | 450 |
| 456 | 3300005459 | Ga0068867_100165642 | Ga0068867_1001656421 | 450 |
| 457 | 3300005466 | Ga0070685_10079666 | Ga0070685_100796662 | 450 |
| 458 | 3300005471 | Ga0070698_100171722 | Ga0070698_1001717222 | 450 |
| 459 | 3300005518 | Ga0070699_100060944 | Ga0070699_1000609441 | 450 |
| 460 | 3300005530 | Ga0070679_100019927 | Ga0070679_1000199276 | 450 |
| 461 | 3300005530 | Ga0070679_100253010 | Ga0070679_1002530102 | 450 |
| 462 | 3300005535 | Ga0070684_100011020 | Ga0070684_1000110202 | 450 |
| 463 | 3300005535 | Ga0070684_100011625 | Ga0070684_1000116258 | 450 |
| 464 | 3300005539 | Ga0068853_100041673 | Ga0068853_1000416734 | 450 |
| 465 | 3300005543 | Ga0070672_100004444 | Ga0070672_1000044444 | 450 |
| 466 | 3300005548 | Ga0070665_100000094 | Ga0070665_100000094128 | 450 |
| 467 | 3300005548 | Ga0070665_100005115 | Ga0070665_1000051159 | 450 |
| 468 | 3300005548 | Ga0070665_100117865 | Ga0070665_1001178652 | 450 |
| 469 | 3300005563 | Ga0068855_100000399 | Ga0068855_10000039931 | 450 |
| 470 | 3300005563 | Ga0068855_100009093 | Ga0068855_1000090933 | 450 |
| 471 | 3300005563 | Ga0068855_100027369 | Ga0068855_1000273695 | 450 |
| 472 | 3300005563 | Ga0068855_100248059 | Ga0068855_1002480592 | 450 |
| 473 | 3300005564 | Ga0070664_100001338 | Ga0070664_1000013389 | 450 |
| 474 | 3300005577 | Ga0068857_100011099 | Ga0068857_1000110998 | 450 |
| 475 | 3300005577 | Ga0068857_100057307 | Ga0068857_1000573074 | 450 |
| 476 | 3300005616 | Ga0068852_100001228 | Ga0068852_10000122816 | 450 |
| 477 | 3300005617 | Ga0068859_100032552 | Ga0068859_1000325524 | 450 |
| 478 | 3300005617 | Ga0068859_100057532 | Ga0068859_1000575322 | 450 |
| 479 | 3300005718 | Ga0068866_10081356 | Ga0068866_100813561 | 450 |
| 480 | 3300005719 | Ga0068861_100001193 | Ga0068861_1000011932 | 450 |
| 481 | 3300005841 | Ga0068863_100068572 | Ga0068863_1000685722 | 450 |
| 482 | 3300005842 | Ga0068858_100118933 | Ga0068858_1001189333 | 450 |
| 483 | 3300005843 | Ga0068860_100000052 | Ga0068860_100000052130 | 450 |
| 484 | 3300005843 | Ga0068860_100013335 | Ga0068860_1000133355 | 450 |
| 485 | 3300005843 | Ga0068860_100056184 | Ga0068860_1000561844 | 450 |
| 486 | 3300005843 | Ga0068860_100190834 | Ga0068860_1001908342 | 450 |
| 487 | 3300006237 | Ga0097621_100012278 | Ga0097621_1000122785 | 450 |
| 488 | 3300006358 | Ga0068871_100020463 | Ga0068871_1000204633 | 450 |
| 489 | 3300006358 | Ga0068871_100045310 | Ga0068871_1000453105 | 450 |
| 490 | 3300006358 | Ga0068871_100253906 | Ga0068871_1002539061 | 450 |
| 491 | 3300006844 | Ga0075428_100005379 | Ga0075428_10000537911 | 450 |
| 492 | 3300006880 | Ga0075429_100001571 | Ga0075429_1000015719 | 450 |
| 493 | 3300006931 | Ga0097620_100032554 | Ga0097620_1000325544 | 450 |
| 494 | 3300006931 | Ga0097620_100057536 | Ga0097620_1000575362 | 450 |
| 495 | 3300009093 | Ga0105240_10035148 | Ga0105240_100351486 | 450 |
| 496 | 3300009093 | Ga0105240_10037888 | Ga0105240_100378887 | 450 |
| 497 | 3300009093 | Ga0105240_10043248 | Ga0105240_100432482 | 450 |
| 498 | 3300009094 | Ga0111539_10003295 | Ga0111539_1000329515 | 450 |
| 499 | 3300009098 | Ga0105245_10136931 | Ga0105245_101369311 | 450 |
| 500 | 3300009148 | Ga0105243_10255070 | Ga0105243_102550702 | 450 |
| 501 | 3300009174 | Ga0105241_10026514 | Ga0105241_100265143 | 450 |
| 502 | 3300009176 | Ga0105242_10088408 | Ga0105242_100884082 | 450 |
| 503 | 3300010375 | Ga0105239_10000935 | Ga0105239_1000093535 | 450 |
| 504 | 3300010375 | Ga0105239_10020118 | Ga0105239_100201183 | 450 |
| 505 | 3300010375 | Ga0105239_10023061 | Ga0105239_100230615 | 450 |
| 506 | 3300011119 | Ga0105246_10013343 | Ga0105246_100133435 | 450 |
| 507 | 3300013100 | Ga0157373_10018289 | Ga0157373_100182894 | 450 |
| 508 | 3300013102 | Ga0157371_10001473 | Ga0157371_1000147313 | 450 |
| 509 | 3300013102 | Ga0157371_10011618 | Ga0157371_100116187 | 450 |
| 510 | 3300013102 | Ga0157371_10012519 | Ga0157371_100125195 | 450 |
| 511 | 3300013102 | Ga0157371_10024544 | Ga0157371_100245441 | 450 |
| 512 | 3300013102 | Ga0157371_10106640 | Ga0157371_101066402 | 450 |
| 513 | 3300013104 | Ga0157370_10009760 | Ga0157370_100097608 | 450 |
| 514 | 3300013104 | Ga0157370_10070057 | Ga0157370_100700572 | 450 |
| 515 | 3300013105 | Ga0157369_10002537 | Ga0157369_1000253722 | 450 |
| 516 | 3300013105 | Ga0157369_10020179 | Ga0157369_100201798 | 450 |
| 517 | 3300013105 | Ga0157369_10057853 | Ga0157369_100578533 | 450 |
| 518 | 3300013105 | Ga0157369_10085509 | Ga0157369_100855092 | 450 |
| 519 | 3300013296 | Ga0157374_10000237 | Ga0157374_1000023756 | 450 |
| 520 | 3300013296 | Ga0157374_10002410 | Ga0157374_1000241014 | 450 |
| 521 | 3300013296 | Ga0157374_10031205 | Ga0157374_100312053 | 450 |
| 522 | 3300013297 | Ga0157378_10034022 | Ga0157378_100340225 | 450 |
| 523 | 3300013306 | Ga0163162_10001696 | Ga0163162_1000169617 | 450 |
| 524 | 3300013306 | Ga0163162_10003454 | Ga0163162_100034543 | 450 |
| 525 | 3300013306 | Ga0163162_10017686 | Ga0163162_100176863 | 450 |
| 526 | 3300013306 | Ga0163162_10235290 | Ga0163162_102352903 | 450 |
| 527 | 3300013307 | Ga0157372_10006195 | Ga0157372_100061956 | 450 |
| 528 | 3300013307 | Ga0157372_10012017 | Ga0157372_100120176 | 450 |
| 529 | 3300013307 | Ga0157372_10150825 | Ga0157372_101508252 | 450 |
| 530 | 3300013307 | Ga0157372_10288161 | Ga0157372_102881612 | 450 |
| 531 | 3300013307 | Ga0157372_10472485 | Ga0157372_104724851 | 450 |
| 532 | 3300013308 | Ga0157375_10002275 | Ga0157375_100022753 | 450 |
| 533 | 3300013308 | Ga0157375_10005435 | Ga0157375_1000543513 | 450 |
| 534 | 3300013308 | Ga0157375_10076250 | Ga0157375_100762503 | 450 |
| 535 | 3300014325 | Ga0163163_10000088 | Ga0163163_1000008819 | 450 |
| 536 | 3300014325 | Ga0163163_10001835 | Ga0163163_1000183516 | 450 |
| 537 | 3300014325 | Ga0163163_10005167 | Ga0163163_1000516714 | 450 |
| 538 | 3300014326 | Ga0157380_10007323 | Ga0157380_100073233 | 450 |
| 539 | 3300014745 | Ga0157377_10000354 | Ga0157377_1000035415 | 450 |
| 540 | 3300014745 | Ga0157377_10002113 | Ga0157377_100021134 | 450 |
| 541 | 3300014968 | Ga0157379_10225420 | Ga0157379_102254201 | 450 |
| 542 | 3300025246 | Ga0209646_1001140 | Ga0209646_10011405 | 450 |
| 543 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059298 | 450 |
| 544 | 3300025893 | Ga0207682_10031373 | Ga0207682_100313732 | 450 |
| 545 | 3300025903 | Ga0207680_10017371 | Ga0207680_100173711 | 450 |
| 546 | 3300025904 | Ga0207647_10000061 | Ga0207647_1000006116 | 450 |
| 547 | 3300025904 | Ga0207647_10035144 | Ga0207647_100351444 | 450 |
| 548 | 3300025907 | Ga0207645_10000847 | Ga0207645_1000084710 | 450 |
| 549 | 3300025907 | Ga0207645_10002256 | Ga0207645_1000225610 | 450 |
| 550 | 3300025909 | Ga0207705_10008664 | Ga0207705_100086642 | 450 |
| 551 | 3300025909 | Ga0207705_10009177 | Ga0207705_100091778 | 450 |
| 552 | 3300025912 | Ga0207707_10251356 | Ga0207707_102513561 | 450 |
| 553 | 3300025913 | Ga0207695_10000702 | Ga0207695_1000070211 | 450 |
| 554 | 3300025913 | Ga0207695_10000894 | Ga0207695_100008947 | 450 |
| 555 | 3300025913 | Ga0207695_10030088 | Ga0207695_100300887 | 450 |
| 556 | 3300025914 | Ga0207671_10026732 | Ga0207671_100267323 | 450 |
| 557 | 3300025917 | Ga0207660_10005360 | Ga0207660_100053603 | 450 |
| 558 | 3300025918 | Ga0207662_10067219 | Ga0207662_100672192 | 450 |
| 559 | 3300025919 | Ga0207657_10016216 | Ga0207657_100162163 | 450 |
| 560 | 3300025920 | Ga0207649_10122395 | Ga0207649_101223951 | 450 |
| 561 | 3300025921 | Ga0207652_10000181 | Ga0207652_1000018117 | 450 |
| 562 | 3300025921 | Ga0207652_10002067 | Ga0207652_100020675 | 450 |
| 563 | 3300025923 | Ga0207681_10013609 | Ga0207681_100136092 | 450 |
| 564 | 3300025923 | Ga0207681_10030055 | Ga0207681_100300555 | 450 |
| 565 | 3300025924 | Ga0207694_10206540 | Ga0207694_102065401 | 450 |
| 566 | 3300025925 | Ga0207650_10009308 | Ga0207650_100093082 | 450 |
| 567 | 3300025925 | Ga0207650_10052389 | Ga0207650_100523892 | 450 |
| 568 | 3300025925 | Ga0207650_10142590 | Ga0207650_101425901 | 450 |
| 569 | 3300025925 | Ga0207650_10244773 | Ga0207650_102447731 | 450 |
| 570 | 3300025926 | Ga0207659_10010641 | Ga0207659_100106416 | 450 |
| 571 | 3300025926 | Ga0207659_10025932 | Ga0207659_100259322 | 450 |
| 572 | 3300025932 | Ga0207690_10044953 | Ga0207690_100449532 | 450 |
| 573 | 3300025932 | Ga0207690_10084322 | Ga0207690_100843222 | 450 |
| 574 | 3300025933 | Ga0207706_10010295 | Ga0207706_100102958 | 450 |
| 575 | 3300025933 | Ga0207706_10147152 | Ga0207706_101471522 | 450 |
| 576 | 3300025934 | Ga0207686_10045182 | Ga0207686_100451822 | 450 |
| 577 | 3300025937 | Ga0207669_10093408 | Ga0207669_100934082 | 450 |
| 578 | 3300025940 | Ga0207691_10010199 | Ga0207691_100101995 | 450 |
| 579 | 3300025940 | Ga0207691_10014922 | Ga0207691_100149226 | 450 |
| 580 | 3300025942 | Ga0207689_10023114 | Ga0207689_100231146 | 450 |
| 581 | 3300025942 | Ga0207689_10025266 | Ga0207689_100252664 | 450 |
| 582 | 3300025942 | Ga0207689_10043144 | Ga0207689_100431442 | 450 |
| 583 | 3300025942 | Ga0207689_10109636 | Ga0207689_101096361 | 450 |
| 584 | 3300025944 | Ga0207661_10007444 | Ga0207661_100074446 | 450 |
| 585 | 3300025944 | Ga0207661_10018216 | Ga0207661_100182165 | 450 |
| 586 | 3300025945 | Ga0207679_10005671 | Ga0207679_100056719 | 450 |
| 587 | 3300025945 | Ga0207679_10011911 | Ga0207679_100119112 | 450 |
| 588 | 3300025949 | Ga0207667_10000312 | Ga0207667_1000031247 | 450 |
| 589 | 3300025949 | Ga0207667_10019147 | Ga0207667_100191471 | 450 |
| 590 | 3300025949 | Ga0207667_10028216 | Ga0207667_100282166 | 450 |
| 591 | 3300025949 | Ga0207667_10052423 | Ga0207667_100524233 | 450 |
| 592 | 3300025949 | Ga0207667_10211469 | Ga0207667_102114691 | 450 |
| 593 | 3300025986 | Ga0207658_10078762 | Ga0207658_100787623 | 450 |
| 594 | 3300026023 | Ga0207677_10009458 | Ga0207677_100094586 | 450 |
| 595 | 3300026023 | Ga0207677_10108806 | Ga0207677_101088062 | 450 |
| 596 | 3300026041 | Ga0207639_10074097 | Ga0207639_100740972 | 450 |
| 597 | 3300026088 | Ga0207641_10005547 | Ga0207641_100055473 | 450 |
| 598 | 3300026089 | Ga0207648_10003051 | Ga0207648_1000305110 | 450 |
| 599 | 3300026095 | Ga0207676_10047330 | Ga0207676_100473302 | 450 |
| 600 | 3300026116 | Ga0207674_10013334 | Ga0207674_100133349 | 450 |
| 601 | 3300026116 | Ga0207674_10022378 | Ga0207674_100223784 | 450 |
| 602 | 3300026116 | Ga0207674_10062038 | Ga0207674_100620382 | 450 |
| 603 | 3300026116 | Ga0207674_10137689 | Ga0207674_101376893 | 450 |
| 604 | 3300026116 | Ga0207674_10142389 | Ga0207674_101423893 | 450 |
| 605 | 3300026118 | Ga0207675_100006844 | Ga0207675_1000068444 | 450 |
| 606 | 3300026118 | Ga0207675_100018407 | Ga0207675_1000184073 | 450 |
| 607 | 3300026118 | Ga0207675_100119273 | Ga0207675_1001192732 | 450 |
| 608 | 3300026121 | Ga0207683_10002182 | Ga0207683_100021829 | 450 |
| 609 | 3300026121 | Ga0207683_10026793 | Ga0207683_100267933 | 450 |
| 610 | 3300026142 | Ga0207698_10002660 | Ga0207698_100026602 | 450 |
| 611 | 3300026142 | Ga0207698_10061636 | Ga0207698_100616362 | 450 |
| 612 | 3300028379 | Ga0268266_10000057 | Ga0268266_1000005745 | 450 |
| 613 | 3300028379 | Ga0268266_10040113 | Ga0268266_100401133 | 450 |
| 614 | 3300028380 | Ga0268265_10282075 | Ga0268265_102820751 | 450 |
| 615 | 3300028381 | Ga0268264_10000143 | Ga0268264_1000014347 | 450 |
| 616 | 3300028381 | Ga0268264_10047127 | Ga0268264_100471273 | 450 |
| 617 | 3300028381 | Ga0268264_10118696 | Ga0268264_101186962 | 450 |
| 618 | 3300030521 | Ga0307511_10000439 | Ga0307511_1000043923 | 450 |
| 619 | 3300031911 | Ga0307412_10000292 | Ga0307412_1000029231 | 450 |
| 620 | 3300032126 | Ga0307415_100007390 | Ga0307415_1000073903 | 450 |
| 621 | 3300032126 | Ga0307415_100165537 | Ga0307415_1001655372 | 450 |
| 622 | 3300037312 | Ga0395899_0000959 | Ga0395899_0000959_15239_16591 | 450 |
| 623 | 3300037312 | Ga0395899_0043474 | Ga0395899_0043474_658_2010 | 450 |
| 624 | 3300037418 | Ga0395900_0012661 | Ga0395900_0012661_315_1667 | 450 |
| 625 | 3300037418 | Ga0395900_0068341 | Ga0395900_0068341_843_2195 | 450 |
| 626 | 3300037418 | Ga0395900_0150338 | Ga0395900_0150338_574_1926 | 450 |
| 627 | 3300037418 | Ga0395900_0161590 | Ga0395900_0161590_80_1432 | 450 |
| 628 | 3300037418 | Ga0395900_0276443 | Ga0395900_0276443_187_1539 | 450 |
| 629 | 3300037466 | Ga0395898_0003579 | Ga0395898_0003579_9218_10570 | 450 |
| 630 | 3300037466 | Ga0395898_0049897 | Ga0395898_0049897_1420_2772 | 450 |
| 631 | 3300037471 | Ga0395905_0026233 | Ga0395905_0026233_3053_4405 | 450 |
| 632 | 3300037471 | Ga0395905_0067152 | Ga0395905_0067152_1579_2931 | 450 |
| 633 | 3300038443 | Ga0395901_0005557 | Ga0395901_0005557_343_1695 | 450 |
| 634 | 3300039437 | Ga0436365_0557230 | Ga0436365_0557230_314_1681 | 450 |
| 635 | 3300039437 | Ga0436365_1888183 | Ga0436365_1888183_149_1504 | 450 |
| 636 | 3300041413 | Ga0439465_0000035 | Ga0439465_0000035_18773_20125 | 450 |
| 637 | 3300041512 | Ga0451853_2153551 | Ga0451853_2153551_353_1708 | 450 |
| 638 | 3300042004 | Ga0439445_0000094 | Ga0439445_0000094_12770_14122 | 450 |
| 639 | 3300044658 | Ga0466972_0000010 | Ga0466972_0000010_89978_91333 | 450 |
| 640 | 3300044658 | Ga0466972_0001431 | Ga0466972_0001431_1673_3028 | 450 |
| 641 | 3300044658 | Ga0466972_0034173 | Ga0466972_0034173_201_1559 | 450 |
| 642 | 3300044735 | Ga0466968_0070229 | Ga0466968_0070229_57_1415 | 450 |
| 643 | 3300044765 | Ga0466970_0000471 | Ga0466970_0000471_10584_11939 | 450 |
| 644 | 3300045049 | Ga0466959_0148750 | Ga0466959_0148750_223_1575 | 450 |
| 645 | 3300046460 | Ga0495638_0019391 | Ga0495638_0019391_2361_3719 | 450 |
| 646 | 3300046519 | Ga0495632_0006333 | Ga0495632_0006333_3188_4540 | 450 |
| 647 | 3300046524 | Ga0495648_0003590 | Ga0495648_0003590_562_1917 | 450 |
| 648 | 3300046558 | Ga0495633_0009165 | Ga0495633_0009165_3632_4984 | 450 |
| 649 | 3300046648 | Ga0495611_0000081 | Ga0495611_0000081_55640_56995 | 450 |
| 650 | 3300046660 | Ga0495625_0000658 | Ga0495625_0000658_35033_36385 | 450 |
| 651 | 3300047320 | Ga0495672_0016760 | Ga0495672_0016760_1068_2423 | 450 |
| 652 | 3300047320 | Ga0495672_0018029 | Ga0495672_0018029_2304_3659 | 450 |
| 653 | 3300047443 | Ga0495687_000111 | Ga0495687_000111_18411_19766 | 450 |
| 654 | 3300049570 | Ga0501033_0053360 | Ga0501033_0053360_1075_2427 | 450 |
| 655 | 3300049571 | Ga0501034_0002046 | Ga0501034_0002046_1414_2766 | 450 |
| 656 | 3300049571 | Ga0501034_0037459 | Ga0501034_0037459_2561_3913 | 450 |
| 657 | 3300049573 | Ga0501037_0004853 | Ga0501037_0004853_5426_6778 | 450 |
| 658 | 3300049575 | Ga0501039_0046550 | Ga0501039_0046550_1127_2479 | 450 |
| 659 | 3300049579 | Ga0501043_0037281 | Ga0501043_0037281_1322_2674 | 450 |
| 660 | 3300049579 | Ga0501043_0051583 | Ga0501043_0051583_1211_2563 | 450 |
| 661 | 3300049579 | Ga0501043_0117212 | Ga0501043_0117212_59_1411 | 450 |
| 662 | 3300049581 | Ga0501047_0007339 | Ga0501047_0007339_187_1539 | 450 |
| 663 | 3300049652 | Ga0501202_005262 | Ga0501202_005262_86_1438 | 450 |
| 664 | 3300049661 | Ga0501217_000087 | Ga0501217_000087_184_1536 | 450 |
| 665 | 3300049662 | Ga0501222_000205 | Ga0501222_000205_5080_6432 | 450 |
| 666 | 3300049663 | Ga0501223_001264 | Ga0501223_001264_277_1629 | 450 |
| 667 | 3300049669 | Ga0501235_000089 | Ga0501235_000089_8441_9793 | 450 |
| 668 | 3300049673 | Ga0501240_000041 | Ga0501240_000041_3946_5298 | 450 |
| 669 | 3300049680 | Ga0501250_002354 | Ga0501250_002354_235_1587 | 450 |
| 670 | 3300049681 | Ga0501251_003300 | Ga0501251_003300_239_1591 | 450 |
| 671 | 3300049683 | Ga0501253_000098 | Ga0501253_000098_1859_3211 | 450 |
| 672 | 3300049688 | Ga0501259_000111 | Ga0501259_000111_5528_6880 | 450 |
| 673 | 3300049688 | Ga0501259_000789 | Ga0501259_000789_3701_5053 | 450 |
| 674 | 3300049690 | Ga0501261_000274 | Ga0501261_000274_3483_4835 | 450 |
| 675 | 3300049704 | Ga0501221_000942 | Ga0501221_000942_617_1969 | 450 |
| 676 | 3300049705 | Ga0501225_0000583 | Ga0501225_0000583_9677_11029 | 450 |
| 677 | 3300049705 | Ga0501225_0007025 | Ga0501225_0007025_788_2152 | 450 |
| 678 | 3300049707 | Ga0501234_003714 | Ga0501234_003714_432_1784 | 450 |
| 679 | 3300049758 | Ga0501241_000009 | Ga0501241_000009_65867_67219 | 450 |
| 680 | 3300049763 | Ga0501266_001126 | Ga0501266_001126_1947_3299 | 450 |
| 681 | 3300049766 | Ga0501269_000025 | Ga0501269_000025_9037_10389 | 450 |
| 682 | 3300049776 | Ga0501280_003927 | Ga0501280_003927_480_1832 | 450 |
| 683 | 3300049822 | Ga0501035_0015729 | Ga0501035_0015729_4608_5960 | 450 |
| 684 | 3300049823 | Ga0501044_0012930 | Ga0501044_0012930_1185_2549 | 450 |
| 685 | 3300049823 | Ga0501044_0019648 | Ga0501044_0019648_2944_4296 | 450 |
| 686 | 3300050508 | nmdc:mga09592_8712_c2 | nmdc:mga09592_8712_c2_523_1878 | 450 |
| 687 | 3300050510 | nmdc:mga06r32_205023_c1 | nmdc:mga06r32_205023_c1_343_1695 | 450 |
| 688 | 3300053092 | Ga0500583_0015568 | Ga0500583_0015568_1207_2562 | 450 |
| 689 | 3300053108 | Ga0500562_000032 | Ga0500562_000032_5972_7327 | 450 |
| 690 | 3300053156 | Ga0500622_0000445 | Ga0500622_0000445_15987_17342 | 450 |
| 691 | 2162886007 | SwRhRL2b_contig_3262938 | SwRhRL2b_0905.00002540 | 451 |
| 692 | 3300003215 | JGI25153J46596_10015999 | JGI25153J46596_100159992 | 451 |
| 693 | 3300003320 | rootH2_10000933 | rootH2_1000093334 | 451 |
| 694 | 3300003320 | rootH2_10027208 | rootH2_100272085 | 451 |
| 695 | 3300003354 | JGI25160J50197_1002225 | JGI25160J50197_10022256 | 451 |
| 696 | 3300003354 | JGI25160J50197_1007805 | JGI25160J50197_10078053 | 451 |
| 697 | 3300003354 | JGI25160J50197_1009408 | JGI25160J50197_10094083 | 451 |
| 698 | 3300003762 | Ga0055542_1004849 | Ga0055542_10048493 | 451 |
| 699 | 3300003771 | Ga0055526_1009867 | Ga0055526_10098672 | 451 |
| 700 | 3300003790 | Ga0055528_1001384 | Ga0055528_100138410 | 451 |
| 701 | 3300003791 | Ga0055530_10000584 | Ga0055530_100005849 | 451 |
| 702 | 3300003794 | Ga0055531_10000132 | Ga0055531_1000013268 | 451 |
| 703 | 3300003794 | Ga0055531_10029285 | Ga0055531_100292852 | 451 |
| 704 | 3300005262 | Ga0065165_1000914 | Ga0065165_100091424 | 451 |
| 705 | 3300005262 | Ga0065165_1028630 | Ga0065165_10286302 | 451 |
| 706 | 3300005288 | Ga0065714_10064700 | Ga0065714_1006470022 | 451 |
| 707 | 3300005289 | Ga0065704_10071654 | Ga0065704_1007165410 | 451 |
| 708 | 3300005327 | Ga0070658_10101610 | Ga0070658_101016102 | 451 |
| 709 | 3300005333 | Ga0070677_10038879 | Ga0070677_100388791 | 451 |
| 710 | 3300005334 | Ga0068869_100064509 | Ga0068869_1000645092 | 451 |
| 711 | 3300005336 | Ga0070680_100003171 | Ga0070680_1000031715 | 451 |
| 712 | 3300005337 | Ga0070682_100002730 | Ga0070682_1000027306 | 451 |
| 713 | 3300005338 | Ga0068868_100001431 | Ga0068868_1000014316 | 451 |
| 714 | 3300005339 | Ga0070660_100001175 | Ga0070660_1000011759 | 451 |
| 715 | 3300005339 | Ga0070660_100022055 | Ga0070660_1000220552 | 451 |
| 716 | 3300005341 | Ga0070691_10000858 | Ga0070691_100008587 | 451 |
| 717 | 3300005355 | Ga0070671_100090702 | Ga0070671_1000907021 | 451 |
| 718 | 3300005364 | Ga0070673_100035374 | Ga0070673_1000353741 | 451 |
| 719 | 3300005367 | Ga0070667_100001113 | Ga0070667_10000111311 | 451 |
| 720 | 3300005367 | Ga0070667_100066412 | Ga0070667_1000664123 | 451 |
| 721 | 3300005458 | Ga0070681_10048862 | Ga0070681_100488624 | 451 |
| 722 | 3300005459 | Ga0068867_100023112 | Ga0068867_1000231123 | 451 |
| 723 | 3300005530 | Ga0070679_100001926 | Ga0070679_10000192612 | 451 |
| 724 | 3300005539 | Ga0068853_100021044 | Ga0068853_1000210445 | 451 |
| 725 | 3300005539 | Ga0068853_100084041 | Ga0068853_1000840413 | 451 |
| 726 | 3300005543 | Ga0070672_100069759 | Ga0070672_1000697594 | 451 |
| 727 | 3300005548 | Ga0070665_100004249 | Ga0070665_10000424910 | 451 |
| 728 | 3300005563 | Ga0068855_100036378 | Ga0068855_1000363786 | 451 |
| 729 | 3300005563 | Ga0068855_100113157 | Ga0068855_1001131572 | 451 |
| 730 | 3300005614 | Ga0068856_100006224 | Ga0068856_10000622411 | 451 |
| 731 | 3300005616 | Ga0068852_100026592 | Ga0068852_1000265922 | 451 |
| 732 | 3300005617 | Ga0068859_100000013 | Ga0068859_100000013200 | 451 |
| 733 | 3300005617 | Ga0068859_100009898 | Ga0068859_1000098986 | 451 |
| 734 | 3300005617 | Ga0068859_100010935 | Ga0068859_1000109353 | 451 |
| 735 | 3300005617 | Ga0068859_100048393 | Ga0068859_1000483935 | 451 |
| 736 | 3300005841 | Ga0068863_100027191 | Ga0068863_1000271916 | 451 |
| 737 | 3300005842 | Ga0068858_100001874 | Ga0068858_10000187415 | 451 |
| 738 | 3300005843 | Ga0068860_100006756 | Ga0068860_1000067564 | 451 |
| 739 | 3300005843 | Ga0068860_100201020 | Ga0068860_1002010203 | 451 |
| 740 | 3300005844 | Ga0068862_100004828 | Ga0068862_1000048287 | 451 |
| 741 | 3300006358 | Ga0068871_100002800 | Ga0068871_1000028002 | 451 |
| 742 | 3300006358 | Ga0068871_100100867 | Ga0068871_1001008672 | 451 |
| 743 | 3300006931 | Ga0097620_100000013 | Ga0097620_100000013200 | 451 |
| 744 | 3300006931 | Ga0097620_100009898 | Ga0097620_1000098988 | 451 |
| 745 | 3300006931 | Ga0097620_100010935 | Ga0097620_1000109353 | 451 |
| 746 | 3300006931 | Ga0097620_100048393 | Ga0097620_1000483935 | 451 |
| 747 | 3300009092 | Ga0105250_10010960 | Ga0105250_100109602 | 451 |
| 748 | 3300009093 | Ga0105240_10000066 | Ga0105240_1000006622 | 451 |
| 749 | 3300009093 | Ga0105240_10004785 | Ga0105240_1000478517 | 451 |
| 750 | 3300009093 | Ga0105240_10006482 | Ga0105240_1000648210 | 451 |
| 751 | 3300009093 | Ga0105240_10006663 | Ga0105240_100066637 | 451 |
| 752 | 3300009093 | Ga0105240_10075976 | Ga0105240_100759764 | 451 |
| 753 | 3300009093 | Ga0105240_10199358 | Ga0105240_101993583 | 451 |
| 754 | 3300009101 | Ga0105247_10013814 | Ga0105247_100138145 | 451 |
| 755 | 3300009147 | Ga0114129_10021024 | Ga0114129_100210243 | 451 |
| 756 | 3300009174 | Ga0105241_10001659 | Ga0105241_1000165911 | 451 |
| 757 | 3300009174 | Ga0105241_10022955 | Ga0105241_100229552 | 451 |
| 758 | 3300009174 | Ga0105241_10099075 | Ga0105241_100990752 | 451 |
| 759 | 3300009174 | Ga0105241_10112978 | Ga0105241_101129782 | 451 |
| 760 | 3300009545 | Ga0105237_10000474 | Ga0105237_1000047410 | 451 |
| 761 | 3300009545 | Ga0105237_10002029 | Ga0105237_1000202921 | 451 |
| 762 | 3300009545 | Ga0105237_10087162 | Ga0105237_100871622 | 451 |
| 763 | 3300010375 | Ga0105239_10002278 | Ga0105239_1000227812 | 451 |
| 764 | 3300010375 | Ga0105239_10004572 | Ga0105239_1000457214 | 451 |
| 765 | 3300010375 | Ga0105239_10072896 | Ga0105239_100728962 | 451 |
| 766 | 3300010375 | Ga0105239_10096879 | Ga0105239_100968793 | 451 |
| 767 | 3300011119 | Ga0105246_10132829 | Ga0105246_101328292 | 451 |
| 768 | 3300013100 | Ga0157373_10000006 | Ga0157373_10000006177 | 451 |
| 769 | 3300013102 | Ga0157371_10052714 | Ga0157371_100527142 | 451 |
| 770 | 3300013102 | Ga0157371_10079833 | Ga0157371_100798332 | 451 |
| 771 | 3300013104 | Ga0157370_10001929 | Ga0157370_1000192911 | 451 |
| 772 | 3300013104 | Ga0157370_10007905 | Ga0157370_100079056 | 451 |
| 773 | 3300013296 | Ga0157374_10000024 | Ga0157374_10000024149 | 451 |
| 774 | 3300013296 | Ga0157374_10088985 | Ga0157374_100889852 | 451 |
| 775 | 3300013296 | Ga0157374_10186839 | Ga0157374_101868392 | 451 |
| 776 | 3300013297 | Ga0157378_10016099 | Ga0157378_100160993 | 451 |
| 777 | 3300013306 | Ga0163162_10001403 | Ga0163162_1000140311 | 451 |
| 778 | 3300013306 | Ga0163162_10198371 | Ga0163162_101983712 | 451 |
| 779 | 3300013307 | Ga0157372_10112855 | Ga0157372_101128552 | 451 |
| 780 | 3300013307 | Ga0157372_10210026 | Ga0157372_102100262 | 451 |
| 781 | 3300014325 | Ga0163163_10071074 | Ga0163163_100710742 | 451 |
| 782 | 3300014497 | Ga0182008_10000003 | Ga0182008_10000003353 | 451 |
| 783 | 3300014968 | Ga0157379_10136218 | Ga0157379_101362181 | 451 |
| 784 | 3300014969 | Ga0157376_10011668 | Ga0157376_100116683 | 451 |
| 785 | 3300014969 | Ga0157376_10016249 | Ga0157376_100162492 | 451 |
| 786 | 3300014969 | Ga0157376_10066517 | Ga0157376_100665174 | 451 |
| 787 | 3300014969 | Ga0157376_10115554 | Ga0157376_101155542 | 451 |
| 788 | 3300015265 | Ga0182005_1000116 | Ga0182005_100011620 | 451 |
| 789 | 3300017792 | Ga0163161_10000620 | Ga0163161_1000062026 | 451 |
| 790 | 3300017792 | Ga0163161_10000869 | Ga0163161_1000086924 | 451 |
| 791 | 3300025208 | Ga0209436_104595 | Ga0209436_1045953 | 451 |
| 792 | 3300025242 | Ga0209258_100075 | Ga0209258_10007584 | 451 |
| 793 | 3300025246 | Ga0209646_1000005 | Ga0209646_1000005487 | 451 |
| 794 | 3300025250 | Ga0209026_1000149 | Ga0209026_100014920 | 451 |
| 795 | 3300025254 | Ga0209148_1000085 | Ga0209148_1000085145 | 451 |
| 796 | 3300025273 | Ga0209673_1000242 | Ga0209673_100024283 | 451 |
| 797 | 3300025284 | Ga0209130_1005269 | Ga0209130_10052693 | 451 |
| 798 | 3300025297 | Ga0209758_1000795 | Ga0209758_100079537 | 451 |
| 799 | 3300025298 | Ga0209050_1000298 | Ga0209050_10002989 | 451 |
| 800 | 3300025302 | Ga0207426_1000057 | Ga0207426_100005750 | 451 |
| 801 | 3300025302 | Ga0207426_1000262 | Ga0207426_100026243 | 451 |
| 802 | 3300025302 | Ga0207426_1004443 | Ga0207426_10044437 | 451 |
| 803 | 3300025303 | Ga0209051_1033315 | Ga0209051_10333152 | 451 |
| 804 | 3300025304 | Ga0209257_1000004 | Ga0209257_10000041088 | 451 |
| 805 | 3300025304 | Ga0209257_1002372 | Ga0209257_100237215 | 451 |
| 806 | 3300025900 | Ga0207710_10008013 | Ga0207710_100080134 | 451 |
| 807 | 3300025904 | Ga0207647_10026087 | Ga0207647_100260872 | 451 |
| 808 | 3300025911 | Ga0207654_10000850 | Ga0207654_100008503 | 451 |
| 809 | 3300025912 | Ga0207707_10000879 | Ga0207707_1000087915 | 451 |
| 810 | 3300025913 | Ga0207695_10000078 | Ga0207695_10000078224 | 451 |
| 811 | 3300025913 | Ga0207695_10000135 | Ga0207695_10000135148 | 451 |
| 812 | 3300025913 | Ga0207695_10002580 | Ga0207695_1000258019 | 451 |
| 813 | 3300025913 | Ga0207695_10022744 | Ga0207695_100227444 | 451 |
| 814 | 3300025913 | Ga0207695_10069174 | Ga0207695_100691743 | 451 |
| 815 | 3300025913 | Ga0207695_10082557 | Ga0207695_100825573 | 451 |
| 816 | 3300025913 | Ga0207695_10272784 | Ga0207695_102727841 | 451 |
| 817 | 3300025914 | Ga0207671_10000067 | Ga0207671_1000006799 | 451 |
| 818 | 3300025919 | Ga0207657_10004379 | Ga0207657_100043796 | 451 |
| 819 | 3300025919 | Ga0207657_10026674 | Ga0207657_100266742 | 451 |
| 820 | 3300025921 | Ga0207652_10000397 | Ga0207652_1000039730 | 451 |
| 821 | 3300025921 | Ga0207652_10002811 | Ga0207652_1000281110 | 451 |
| 822 | 3300025925 | Ga0207650_10082949 | Ga0207650_100829493 | 451 |
| 823 | 3300025925 | Ga0207650_10121697 | Ga0207650_101216972 | 451 |
| 824 | 3300025931 | Ga0207644_10050893 | Ga0207644_100508935 | 451 |
| 825 | 3300025931 | Ga0207644_10127237 | Ga0207644_101272372 | 451 |
| 826 | 3300025936 | Ga0207670_10082900 | Ga0207670_100829002 | 451 |
| 827 | 3300025949 | Ga0207667_10016081 | Ga0207667_100160813 | 451 |
| 828 | 3300025960 | Ga0207651_10115991 | Ga0207651_101159912 | 451 |
| 829 | 3300025986 | Ga0207658_10012058 | Ga0207658_100120587 | 451 |
| 830 | 3300026023 | Ga0207677_10057408 | Ga0207677_100574082 | 451 |
| 831 | 3300026035 | Ga0207703_10002553 | Ga0207703_100025532 | 451 |
| 832 | 3300026088 | Ga0207641_10042014 | Ga0207641_100420145 | 451 |
| 833 | 3300026089 | Ga0207648_10075557 | Ga0207648_100755575 | 451 |
| 834 | 3300026121 | Ga0207683_10028008 | Ga0207683_100280082 | 451 |
| 835 | 3300026142 | Ga0207698_10008350 | Ga0207698_100083502 | 451 |
| 836 | 3300028379 | Ga0268266_10007008 | Ga0268266_100070088 | 451 |
| 837 | 3300028380 | Ga0268265_10079511 | Ga0268265_100795114 | 451 |
| 838 | 3300028381 | Ga0268264_10007161 | Ga0268264_100071619 | 451 |
| 839 | 3300028786 | Ga0307517_10014190 | Ga0307517_100141902 | 451 |
| 840 | 3300028794 | Ga0307515_10000455 | Ga0307515_100004557 | 451 |
| 841 | 3300031251 | Ga0265327_10000421 | Ga0265327_1000042166 | 451 |
| 842 | 3300031507 | Ga0307509_10056935 | Ga0307509_100569354 | 451 |
| 843 | 3300031616 | Ga0307508_10002437 | Ga0307508_1000243711 | 451 |
| 844 | 3300031730 | Ga0307516_10000310 | Ga0307516_100003102 | 451 |
| 845 | 3300032004 | Ga0307414_10000049 | Ga0307414_10000049109 | 451 |
| 846 | 3300036401 | Ga0373937_0109307 | Ga0373937_0109307_253_1611 | 451 |
| 847 | 3300041997 | Ga0439431_0000062 | Ga0439431_0000062_1827_3188 | 451 |
| 848 | 3300042002 | Ga0439442_006659 | Ga0439442_006659_189_1550 | 451 |
| 849 | 3300042014 | Ga0439457_002934 | Ga0439457_002934_561_1922 | 451 |
| 850 | 3300042876 | Ga0451577_0026339 | Ga0451577_0026339_2803_4161 | 451 |
| 851 | 3300044656 | Ga0466969_0000847 | Ga0466969_0000847_9551_10909 | 451 |
| 852 | 3300044656 | Ga0466969_0029848 | Ga0466969_0029848_967_2331 | 451 |
| 853 | 3300044684 | Ga0466966_0000176 | Ga0466966_0000176_28167_29525 | 451 |
| 854 | 3300044693 | Ga0466961_0037351 | Ga0466961_0037351_1161_2519 | 451 |
| 855 | 3300044712 | Ga0453684_0063668 | Ga0453684_0063668_702_2060 | 451 |
| 856 | 3300044719 | Ga0466971_0033117 | Ga0466971_0033117_364_1722 | 451 |
| 857 | 3300045049 | Ga0466959_0000016 | Ga0466959_0000016_76670_78028 | 451 |
| 858 | 3300045049 | Ga0466959_0044930 | Ga0466959_0044930_1768_3126 | 451 |
| 859 | 3300046457 | Ga0495590_0003056 | Ga0495590_0003056_1691_3046 | 451 |
| 860 | 3300046507 | Ga0495606_0037730 | Ga0495606_0037730_598_1956 | 451 |
| 861 | 3300046525 | Ga0495663_0000021 | Ga0495663_0000021_110083_111438 | 451 |
| 862 | 3300046538 | Ga0495609_0000010 | Ga0495609_0000010_85752_87107 | 451 |
| 863 | 3300046558 | Ga0495633_0000022 | Ga0495633_0000022_74049_75413 | 451 |
| 864 | 3300046616 | Ga0495668_0000321 | Ga0495668_0000321_63892_65247 | 451 |
| 865 | 3300046616 | Ga0495668_0007476 | Ga0495668_0007476_5388_6746 | 451 |
| 866 | 3300046642 | Ga0495634_0080033 | Ga0495634_0080033_448_1806 | 451 |
| 867 | 3300046660 | Ga0495625_0042194 | Ga0495625_0042194_826_2181 | 451 |
| 868 | 3300046663 | Ga0495635_0026484 | Ga0495635_0026484_2431_3789 | 451 |
| 869 | 3300046683 | Ga0495658_0011871 | Ga0495658_0011871_2278_3636 | 451 |
| 870 | 3300047319 | Ga0495674_0007992 | Ga0495674_0007992_4847_6205 | 451 |
| 871 | 3300047320 | Ga0495672_0053737 | Ga0495672_0053737_205_1560 | 451 |
| 872 | 3300047472 | Ga0495686_0001267 | Ga0495686_0001267_19849_21207 | 451 |
| 873 | 3300047472 | Ga0495686_0017600 | Ga0495686_0017600_1959_3317 | 451 |
| 874 | 3300048924 | Ga0496121_0000010 | Ga0496121_0000010_184819_186183 | 451 |
| 875 | 3300048929 | Ga0496126_0014044 | Ga0496126_0014044_4496_5860 | 451 |
| 876 | 3300049568 | Ga0501031_0090921 | Ga0501031_0090921_215_1573 | 451 |
| 877 | 3300049571 | Ga0501034_0083677 | Ga0501034_0083677_952_2325 | 451 |
| 878 | 3300049572 | Ga0501036_0016492 | Ga0501036_0016492_4288_5646 | 451 |
| 879 | 3300049574 | Ga0501038_0001508 | Ga0501038_0001508_4087_5445 | 451 |
| 880 | 3300049575 | Ga0501039_0110242 | Ga0501039_0110242_339_1697 | 451 |
| 881 | 3300049579 | Ga0501043_0021821 | Ga0501043_0021821_3534_4892 | 451 |
| 882 | 3300049580 | Ga0501046_0066426 | Ga0501046_0066426_647_2005 | 451 |
| 883 | 3300049581 | Ga0501047_0061998 | Ga0501047_0061998_517_1875 | 451 |
| 884 | 3300049582 | Ga0501048_0123886 | Ga0501048_0123886_157_1530 | 451 |
| 885 | 3300049584 | Ga0501068_0030821 | Ga0501068_0030821_1077_2438 | 451 |
| 886 | 3300049585 | Ga0501069_0015946 | Ga0501069_0015946_490_1851 | 451 |
| 887 | 3300049586 | Ga0501070_0014791 | Ga0501070_0014791_999_2360 | 451 |
| 888 | 3300049590 | Ga0501074_0002906 | Ga0501074_0002906_2591_3952 | 451 |
| 889 | 3300049590 | Ga0501074_0016810 | Ga0501074_0016810_2771_4144 | 451 |
| 890 | 3300049703 | Ga0501219_000023 | Ga0501219_000023_9703_11061 | 451 |
| 891 | 3300049742 | Ga0501080_0046393 | Ga0501080_0046393_2547_3908 | 451 |
| 892 | 3300049823 | Ga0501044_0054411 | Ga0501044_0054411_2406_3767 | 451 |
| 893 | 3300049823 | Ga0501044_0064559 | Ga0501044_0064559_170_1528 | 451 |
| 894 | 3300049823 | Ga0501044_0264979 | Ga0501044_0264979_149_1504 | 451 |
| 895 | 3300050005 | Ga0501284_00005 | Ga0501284_00005_136127_137485 | 451 |
| 896 | 3300050507 | nmdc:mga05p37_3495_c1 | nmdc:mga05p37_3495_c1_1862_3220 | 451 |
| 897 | 3300053088 | Ga0500644_0000078 | Ga0500644_0000078_9584_10945 | 451 |
| 898 | 3300053092 | Ga0500583_0000037 | Ga0500583_0000037_62380_63738 | 451 |
| 899 | 3300053134 | Ga0500658_0002864 | Ga0500658_0002864_2461_3822 | 451 |
| 900 | 3300053136 | Ga0500559_0033293 | Ga0500559_0033293_631_1992 | 451 |
| 901 | 3300053142 | Ga0500577_0018098 | Ga0500577_0018098_119_1480 | 451 |
| 902 | 3300053148 | Ga0500590_077471 | Ga0500590_077471_173_1534 | 451 |
| 903 | 3300053156 | Ga0500622_0000497 | Ga0500622_0000497_29866_31230 | 451 |
| 904 | 3300053160 | Ga0500633_0001791 | Ga0500633_0001791_552_1913 | 451 |
| 905 | 3300053163 | Ga0500639_083027 | Ga0500639_083027_149_1507 | 451 |
| 906 | 3300053727 | Ga0500611_000010 | Ga0500611_000010_128490_129848 | 451 |
| 907 | 3300060353 | Ga0501082_0001933 | Ga0501082_0001933_15255_16616 | 451 |
| 908 | iso_pu_bacteria | 2818991442 | 2819571932 | 451 |
| 909 | 2162886007 | SwRhRL2b_contig_1203094 | SwRhRL2b_0835.00000930 | 452 |
| 910 | 3300003323 | rootH1_10066896 | rootH1_100668963 | 452 |
| 911 | 3300003784 | Ga0055534_1007919 | Ga0055534_10079192 | 452 |
| 912 | 3300005289 | Ga0065704_10002179 | Ga0065704_1000217911 | 452 |
| 913 | 3300005289 | Ga0065704_10076736 | Ga0065704_100767361 | 452 |
| 914 | 3300005337 | Ga0070682_100000095 | Ga0070682_10000009564 | 452 |
| 915 | 3300009036 | Ga0105244_10000018 | Ga0105244_1000001880 | 452 |
| 916 | 3300009148 | Ga0105243_10000089 | Ga0105243_100000892 | 452 |
| 917 | 3300009553 | Ga0105249_10039631 | Ga0105249_100396314 | 452 |
| 918 | 3300013104 | Ga0157370_10005025 | Ga0157370_1000502510 | 452 |
| 919 | 3300015261 | Ga0182006_1000079 | Ga0182006_100007958 | 452 |
| 920 | 3300025291 | Ga0209675_1000159 | Ga0209675_10001593 | 452 |
| 921 | 3300025728 | Ga0207655_1000058 | Ga0207655_1000058186 | 452 |
| 922 | 3300025935 | Ga0207709_10000136 | Ga0207709_100001366 | 452 |
| 923 | 3300025961 | Ga0207712_10024280 | Ga0207712_100242804 | 452 |
| 924 | 3300031911 | Ga0307412_10000140 | Ga0307412_1000014023 | 452 |
| 925 | 3300032002 | Ga0307416_100000020 | Ga0307416_100000020128 | 452 |
| 926 | 3300044658 | Ga0466972_0000143 | Ga0466972_0000143_52338_53702 | 452 |
| 927 | 3300046453 | Ga0495627_000029 | Ga0495627_000029_83163_84521 | 452 |
| 928 | 3300046460 | Ga0495638_0044598 | Ga0495638_0044598_502_1860 | 452 |
| 929 | 3300046500 | Ga0495596_0000410 | Ga0495596_0000410_16803_18161 | 452 |
| 930 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_68095_69453 | 452 |
| 931 | 3300046522 | Ga0495643_0025161 | Ga0495643_0025161_187_1545 | 452 |
| 932 | 3300046525 | Ga0495663_0001260 | Ga0495663_0001260_4679_6037 | 452 |
| 933 | 3300046530 | Ga0495654_0000008 | Ga0495654_0000008_313477_314835 | 452 |
| 934 | 3300046558 | Ga0495633_0000048 | Ga0495633_0000048_148629_149987 | 452 |
| 935 | 3300047472 | Ga0495686_0000153 | Ga0495686_0000153_74582_75940 | 452 |
| 936 | 3300047472 | Ga0495686_0004393 | Ga0495686_0004393_1888_3246 | 452 |
| 937 | 3300048905 | Ga0496102_0014102 | Ga0496102_0014102_1800_3158 | 452 |
| 938 | 3300048906 | Ga0496103_0016341 | Ga0496103_0016341_1163_2521 | 452 |
| 939 | 3300048907 | Ga0496104_0241239 | Ga0496104_0241239_339_1697 | 452 |
| 940 | 3300048916 | Ga0496113_0069442 | Ga0496113_0069442_907_2265 | 452 |
| 941 | 3300048919 | Ga0496116_0000037 | Ga0496116_0000037_70934_72292 | 452 |
| 942 | 3300048920 | Ga0496117_0000086 | Ga0496117_0000086_70820_72178 | 452 |
| 943 | 3300048921 | Ga0496118_0000284 | Ga0496118_0000284_16790_18148 | 452 |
| 944 | 3300048922 | Ga0496119_0000037 | Ga0496119_0000037_70869_72227 | 452 |
| 945 | 3300048925 | Ga0496122_0000510 | Ga0496122_0000510_72465_73823 | 452 |
| 946 | 3300048925 | Ga0496122_0000602 | Ga0496122_0000602_35517_36875 | 452 |
| 947 | 3300048925 | Ga0496122_0003432 | Ga0496122_0003432_18677_20035 | 452 |
| 948 | 3300048925 | Ga0496122_0003771 | Ga0496122_0003771_14976_16334 | 452 |
| 949 | 3300048925 | Ga0496122_0057511 | Ga0496122_0057511_575_1933 | 452 |
| 950 | 3300048926 | Ga0496123_0013079 | Ga0496123_0013079_4518_5876 | 452 |
| 951 | 3300048926 | Ga0496123_0014595 | Ga0496123_0014595_4591_5949 | 452 |
| 952 | 3300048926 | Ga0496123_0019833 | Ga0496123_0019833_833_2191 | 452 |
| 953 | 3300048927 | Ga0496124_0000555 | Ga0496124_0000555_29498_30856 | 452 |
| 954 | 3300048928 | Ga0496125_0012093 | Ga0496125_0012093_2587_3945 | 452 |
| 955 | 3300048928 | Ga0496125_0023772 | Ga0496125_0023772_3560_4918 | 452 |
| 956 | 3300048929 | Ga0496126_0008259 | Ga0496126_0008259_6831_8189 | 452 |
| 957 | 3300048929 | Ga0496126_0097741 | Ga0496126_0097741_450_1808 | 452 |
| 958 | 3300053086 | Ga0500578_0000296 | Ga0500578_0000296_27189_28553 | 452 |
| 959 | iso_pu_bacteria | 2739367874 | 2740060709 | 452 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gym-assembly1.cif.gz_v1 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.9015 | 5 | 428 |
| 7p92-assembly1.cif.gz_B | tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up | 0.8997 | 2 | 427 |
| 7p5h-assembly1.cif.gz_b | tmhydabc- d2 map | 0.8986 | 2 | 427 |
| 6vw7-assembly1.cif.gz_B | formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound | 0.8983 | 2 | 422 |
| 7ard-assembly1.cif.gz_F | cryo-em structure of polytomella complex-i (complete composition) | 0.8952 | 5 | 427 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fugA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit | 0.8842 | 50 | 220 | 3.40.50.11540 |
| af_O94500_78_261_3.40.50.11540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit | 0.8706 | 50 | 221 | 3.40.50.11540 |
| 2fugA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit | 0.8427 | 50 | 220 | 3.40.50.11540 |
| af_P9WIV7_336_431_1.20.1440.230 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain | 0.8351 | 337 | 428 | 1.20.1440.230 |
| af_A1ZAW7_585_680_1.20.1440.230 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain | 0.8329 | 338 | 428 | 1.20.1440.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9KPD5-F1-model_v4 | NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) | 0.9813 | 1 | 161 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-A0A7X9KPD5-F1-model_v4 | NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) | 0.9753 | 1 | 161 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-A0A6B3C9I9-F1-model_v4 | NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) | 0.9605 | 9 | 142 |
GO:0016491
GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A3N9NRM1-F1-model_v4 | NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) | 0.9581 | 17 | 148 |
GO:0016491
GO:0046872 GO:0048038 GO:0051539 |
| AF-A0A4Q3Q8W7-F1-model_v4 | deleted | 0.9576 | 1 | 171 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar