F486758

General Info

Members Datasets Scaffolds Average Seq Length
957 286 1914 182

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100225153|Ga0070680_1002251532
Length 220
Sequence LSCLTLAQLDAALWFPLHYGTPSSTVIHSGFQRDLLIVAIKIENQVDRKLPADTIAQIEDAFDNLPREHTRGIERIRLVEFISDPRLKGIPQASELPGLYHPRQGPKGSWLEVAIGVLLPSNKPIHKRIVPRMSFKGNLAAIIFSLVGQHYHLTLRHSLKKTQLEPAVRLYTEKQLKAWNEKKHTFRARLFKPIQPTLERWAKGLQKRAAAEKKKSAATR

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
232 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
233 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
244 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
245 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
246 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
247 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
248 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
249 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
250 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
251 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
252 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
253 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
254 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
255 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
256 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
257 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
260 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
261 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
262 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
263 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
264 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
265 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
266 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
267 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
270 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
271 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
272 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
273 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
274 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
275 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
276 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
277 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.15
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 26.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100225153 3300005336 Bacteria 1583
2 MRS1b_contig_6674846 2162886011 Bacteria 873
3 MBSR1b_contig_11571009 2162886012 Bacteria 1207
4 CNAas_1000869 3300000532 Bacteria 2847
5 JGI24748J21848_1000003 3300002074 Bacteria 323921
6 JGI24034J26672_10000005 3300002239 Bacteria 404185
7 JGI24751J29686_10000033 3300002459 Bacteria 87652
8 JGI25406J46586_10008071 3300003203 Bacteria 4779
9 rootH2_10229866 3300003320 Bacteria 1115
10 rootL2_10158938 3300003322 Unclassified 1421
11 rootH1_10265298 3300003323 Bacteria 1192
12 Ga0065714_10064444 3300005288 Bacteria 94227
13 Ga0065704_10021175 3300005289 Unclassified 1776
14 Ga0065712_10006950 3300005290 Bacteria 6750
15 Ga0065712_10067736 3300005290 Bacteria 94196
16 Ga0065712_10256067 3300005290 Bacteria 948
17 Ga0065715_10008808 3300005293 Bacteria 2831
18 Ga0065715_10024859 3300005293 Bacteria 1550
19 Ga0065715_10030092 3300005293 Bacteria 1415
20 Ga0065715_10033645 3300005293 Bacteria 1222
21 Ga0065715_10045465 3300005293 Bacteria 1097
22 Ga0065715_10090002 3300005293 Bacteria 7905
23 Ga0065715_10091138 3300005293 Bacteria 6074
24 Ga0065715_10094034 3300005293 Bacteria 4464
25 Ga0065715_10127997 3300005293 Bacteria 2075
26 Ga0065715_10148342 3300005293 Bacteria 1758
27 Ga0065707_10001442 3300005295 Bacteria 10003
28 Ga0065707_10172728 3300005295 Bacteria 1473
29 Ga0065707_10230806 3300005295 Bacteria 1189
30 Ga0065707_10481442 3300005295 Bacteria 746
31 Ga0065707_10608064 3300005295 Bacteria 625
32 Ga0070676_10032215 3300005328 Bacteria 3002
33 Ga0070690_100000817 3300005330 Bacteria 15787
34 Ga0070690_100048410 3300005330 Bacteria 2707
35 Ga0070690_100102003 3300005330 Bacteria 1904
36 Ga0070690_100790248 3300005330 Unclassified 735
37 Ga0070670_100000142 3300005331 Bacteria 67444
38 Ga0070670_100006153 3300005331 Bacteria 10144
39 Ga0070670_100098739 3300005331 Bacteria 2513
40 Ga0070670_100278421 3300005331 Unclassified 1461
41 Ga0070670_100288918 3300005331 Unclassified 1433
42 Ga0070670_100445333 3300005331 Unclassified 1147
43 Ga0070670_101172313 3300005331 Unclassified 702
44 Ga0070670_101540431 3300005331 Unclassified 611
45 Ga0070677_10545481 3300005333 Archaea 635
46 Ga0068869_100005669 3300005334 Bacteria 7872
47 Ga0068869_100069452 3300005334 Bacteria 2605
48 Ga0068869_100070101 3300005334 Bacteria 2593
49 Ga0068869_100426129 3300005334 Unclassified 1095
50 Ga0068869_100504041 3300005334 Unclassified 1011
51 Ga0068869_100536642 3300005334 Bacteria 981
52 Ga0068869_100950054 3300005334 Bacteria 746
53 Ga0068869_101139463 3300005334 Unclassified 684
54 Ga0070680_100002408 3300005336 Bacteria 13849
55 Ga0070680_100137513 3300005336 Bacteria 2047
56 Ga0070680_100206144 3300005336 Bacteria 1658
57 Ga0070680_100679737 3300005336 Unclassified 885
58 Ga0070682_100013810 3300005337 Bacteria 4656
59 Ga0068868_100013176 3300005338 Bacteria 6057
60 Ga0068868_100020616 3300005338 Bacteria 4956
61 Ga0068868_100180272 3300005338 Bacteria 1752
62 Ga0068868_100908261 3300005338 Unclassified 801
63 Ga0070660_100015879 3300005339 Bacteria 5451
64 Ga0070660_100550635 3300005339 Unclassified 962
65 Ga0070689_100002620 3300005340 Bacteria 11783
66 Ga0070689_100048941 3300005340 Bacteria 3261
67 Ga0070689_100290801 3300005340 Unclassified 1358
68 Ga0070689_100570502 3300005340 Unclassified 977
69 Ga0070687_100006624 3300005343 Bacteria 4760
70 Ga0070687_100189549 3300005343 Bacteria 1238
71 Ga0070687_100402979 3300005343 Unclassified 897
72 Ga0070687_100467735 3300005343 Bacteria 842
73 Ga0070687_100565354 3300005343 Bacteria 776
74 Ga0070661_100077563 3300005344 Bacteria 2450
75 Ga0070692_10012645 3300005345 Bacteria 3915
76 Ga0070692_10082600 3300005345 Bacteria 1733
77 Ga0070692_10185877 3300005345 Bacteria 1207
78 Ga0070692_10342116 3300005345 Bacteria 927
79 Ga0070668_100004093 3300005347 Bacteria 10800
80 Ga0070669_100008291 3300005353 Bacteria 7420
81 Ga0070669_100044896 3300005353 Bacteria 3219
82 Ga0070669_100120373 3300005353 Bacteria 2002
83 Ga0070669_100373727 3300005353 Bacteria 1161
84 Ga0070675_100638237 3300005354 Unclassified 967
85 Ga0070671_100001580 3300005355 Bacteria 17138
86 Ga0070671_100332284 3300005355 Bacteria 1296
87 Ga0070674_100030870 3300005356 Bacteria 3545
88 Ga0070673_100011790 3300005364 Bacteria 5980
89 Ga0070673_100023045 3300005364 Bacteria 4544
90 Ga0070673_100231029 3300005364 Bacteria 1604
91 Ga0070673_100680203 3300005364 Unclassified 944
92 Ga0070673_100711311 3300005364 Unclassified 923
93 Ga0070673_101507361 3300005364 Unclassified 634
94 Ga0070688_100007597 3300005365 Bacteria 5852
95 Ga0070659_100024585 3300005366 Bacteria 4618
96 Ga0070659_100120922 3300005366 Bacteria 2121
97 Ga0070659_100153750 3300005366 Bacteria 1878
98 Ga0070659_100627880 3300005366 Bacteria 925
99 Ga0070659_100667689 3300005366 Archaea 897
100 Ga0070667_100926728 3300005367 Unclassified 811
101 Ga0070703_10003365 3300005406 Bacteria 4561
102 Ga0070703_10216295 3300005406 Unclassified 760
103 Ga0070709_10285382 3300005434 Bacteria 1201
104 Ga0070701_10007401 3300005438 Bacteria 4689
105 Ga0070701_10101335 3300005438 Bacteria 1595
106 Ga0070701_10141777 3300005438 Bacteria 1375
107 Ga0070701_10283973 3300005438 Bacteria 1012
108 Ga0070701_10354342 3300005438 Bacteria 918
109 Ga0070705_100006983 3300005440 Bacteria 5552
110 Ga0070705_100063402 3300005440 Bacteria 2204
111 Ga0070705_100329168 3300005440 Bacteria 1106
112 Ga0070700_100000238 3300005441 Bacteria 30146
113 Ga0070700_100019390 3300005441 Bacteria 3925
114 Ga0070700_100042126 3300005441 Bacteria 2802
115 Ga0070700_100098352 3300005441 Bacteria 1924
116 Ga0070700_100221783 3300005441 Unclassified 1340
117 Ga0070700_100402341 3300005441 Bacteria 1030
118 Ga0070700_100429957 3300005441 Bacteria 1000
119 Ga0070694_100006926 3300005444 Bacteria 6891
120 Ga0070694_100007458 3300005444 Bacteria 6667
121 Ga0070694_100009509 3300005444 Bacteria 5963
122 Ga0070694_100015795 3300005444 Bacteria 4749
123 Ga0070694_100071355 3300005444 Bacteria 2394
124 Ga0070694_100150586 3300005444 Bacteria 1699
125 Ga0070694_100190266 3300005444 Unclassified 1524
126 Ga0070694_100355039 3300005444 Bacteria 1137
127 Ga0070694_100601205 3300005444 Bacteria 886
128 Ga0070694_100822816 3300005444 Unclassified 763
129 Ga0070708_100322306 3300005445 Unclassified 1456
130 Ga0070678_100060217 3300005456 Bacteria 2794
131 Ga0070678_100932032 3300005456 Bacteria 795
132 Ga0070662_100094683 3300005457 Bacteria 2249
133 Ga0070662_100517224 3300005457 Bacteria 997
134 Ga0070662_100575907 3300005457 Bacteria 945
135 Ga0070681_10000100 3300005458 Bacteria 63828
136 Ga0070681_10000986 3300005458 Bacteria 24077
137 Ga0070681_10041236 3300005458 Bacteria 4625
138 Ga0070681_10417810 3300005458 Bacteria 1253
139 Ga0068867_100024849 3300005459 Bacteria 4295
140 Ga0068867_100068727 3300005459 Bacteria 2644
141 Ga0068867_100155585 3300005459 Bacteria 1799
142 Ga0068867_100276751 3300005459 Bacteria 1375
143 Ga0068867_100343735 3300005459 Bacteria 1243
144 Ga0070685_10380277 3300005466 Archaea 973
145 Ga0070706_100000002 3300005467 Bacteria 326510
146 Ga0070706_100180334 3300005467 Bacteria 1972
147 Ga0070706_100258172 3300005467 Bacteria 1627
148 Ga0070706_100639305 3300005467 Bacteria 988
149 Ga0070706_100649343 3300005467 Unclassified 980
150 Ga0070707_100000562 3300005468 Bacteria 37302
151 Ga0070707_100008628 3300005468 Bacteria 9460
152 Ga0070707_100050836 3300005468 Bacteria 3973
153 Ga0070707_100239229 3300005468 Bacteria 1767
154 Ga0070698_100009059 3300005471 Bacteria 10700
155 Ga0070698_100020732 3300005471 Bacteria 6890
156 Ga0070698_100034361 3300005471 Bacteria 5248
157 Ga0070698_100063342 3300005471 Bacteria 3729
158 Ga0070698_100066837 3300005471 Bacteria 3616
159 Ga0070698_100588687 3300005471 Bacteria 1052
160 Ga0070698_100753880 3300005471 Bacteria 917
161 Ga0070699_100000980 3300005518 Bacteria 26618
162 Ga0070699_100004102 3300005518 Bacteria 12872
163 Ga0070699_100038390 3300005518 Plasmid 4147
164 Ga0070699_100162285 3300005518 Unclassified 1978
165 Ga0070699_100345571 3300005518 Bacteria 1339
166 Ga0070699_101258131 3300005518 Bacteria 679
167 Ga0070679_100000819 3300005530 Bacteria 26989
168 Ga0070679_101508047 3300005530 Unclassified 619
169 Ga0070684_100355930 3300005535 Bacteria 1347
170 Ga0070697_100000184 3300005536 Bacteria 51536
171 Ga0070697_100000379 3300005536 Bacteria 34815
172 Ga0070697_100144047 3300005536 Bacteria 2005
173 Ga0070697_100207412 3300005536 Bacteria 1667
174 Ga0070697_100339563 3300005536 Bacteria 1296
175 Ga0070697_100399308 3300005536 Bacteria 1193
176 Ga0070697_100554251 3300005536 Bacteria 1008
177 Ga0070697_100786123 3300005536 Unclassified 842
178 Ga0070697_101069703 3300005536 Unclassified 718
179 Ga0068853_100063797 3300005539 Bacteria 3191
180 Ga0068853_100129052 3300005539 Bacteria 2261
181 Ga0068853_100340318 3300005539 Bacteria 1394
182 Ga0068853_100589858 3300005539 Bacteria 1055
183 Ga0070672_100123700 3300005543 Bacteria 2120
184 Ga0070672_100125200 3300005543 Bacteria 2107
185 Ga0070672_100260208 3300005543 Bacteria 1463
186 Ga0070672_100274167 3300005543 Bacteria 1425
187 Ga0070672_101300969 3300005543 Bacteria 649
188 Ga0070686_100012452 3300005544 Bacteria 4847
189 Ga0070686_100031759 3300005544 Bacteria 3232
190 Ga0070686_100076856 3300005544 Bacteria 2200
191 Ga0070695_100040072 3300005545 Bacteria 2964
192 Ga0070695_100048497 3300005545 Bacteria 2716
193 Ga0070695_100104550 3300005545 Bacteria 1912
194 Ga0070695_100118768 3300005545 Bacteria 1806
195 Ga0070695_100133237 3300005545 Bacteria 1715
196 Ga0070695_100157837 3300005545 Unclassified 1589
197 Ga0070695_100157840 3300005545 Bacteria 1589
198 Ga0070695_100202780 3300005545 Bacteria 1418
199 Ga0070695_100475659 3300005545 Unclassified 962
200 Ga0070695_100516735 3300005545 Unclassified 926
201 Ga0070695_100568060 3300005545 Unclassified 886
202 Ga0070695_101009985 3300005545 Unclassified 677
203 Ga0070696_100031372 3300005546 Bacteria 3641
204 Ga0070696_100122084 3300005546 Bacteria 1886
205 Ga0070696_100192872 3300005546 Bacteria 1517
206 Ga0070696_100238124 3300005546 Unclassified 1371
207 Ga0070696_100300846 3300005546 Bacteria 1229
208 Ga0070696_100329018 3300005546 Bacteria 1178
209 Ga0070696_100485247 3300005546 Unclassified 981
210 Ga0070696_100651788 3300005546 Unclassified 854
211 Ga0070693_100080251 3300005547 Bacteria 1943
212 Ga0070693_100127427 3300005547 Unclassified 1587
213 Ga0070693_100174432 3300005547 Bacteria 1379
214 Ga0070693_100182162 3300005547 Bacteria 1353
215 Ga0070693_100324355 3300005547 Bacteria 1046
216 Ga0070665_101038882 3300005548 Unclassified 831
217 Ga0070704_100010701 3300005549 Bacteria 5587
218 Ga0070704_100010965 3300005549 Bacteria 5528
219 Ga0070704_100105652 3300005549 Bacteria 2132
220 Ga0070704_100124189 3300005549 Bacteria 1988
221 Ga0070704_100177607 3300005549 Unclassified 1700
222 Ga0070704_100189743 3300005549 Bacteria 1651
223 Ga0070704_100224723 3300005549 Bacteria 1528
224 Ga0070704_100231390 3300005549 Bacteria 1508
225 Ga0070704_100313692 3300005549 Bacteria 1311
226 Ga0070704_100489016 3300005549 Bacteria 1066
227 Ga0070704_100835761 3300005549 Unclassified 825
228 Ga0070664_100011274 3300005564 Bacteria 7250
229 Ga0068857_100019415 3300005577 Bacteria 5967
230 Ga0068857_100187430 3300005577 Bacteria 1884
231 Ga0068857_100614994 3300005577 Bacteria 1028
232 Ga0068857_100680346 3300005577 Unclassified 976
233 Ga0068857_100801424 3300005577 Unclassified 899
234 Ga0068854_100024594 3300005578 Bacteria 4126
235 Ga0068854_100076809 3300005578 Bacteria 2456
236 Ga0068854_100271691 3300005578 Bacteria 1361
237 Ga0068854_100344096 3300005578 Bacteria 1219
238 Ga0068854_100358589 3300005578 Unclassified 1195
239 Ga0068854_100800128 3300005578 Unclassified 822
240 Ga0068856_100974276 3300005614 Unclassified 866
241 Ga0070702_100018094 3300005615 Bacteria 3648
242 Ga0070702_100025366 3300005615 Bacteria 3176
243 Ga0070702_100032786 3300005615 Bacteria 2852
244 Ga0070702_100048390 3300005615 Unclassified 2420
245 Ga0070702_100172311 3300005615 Bacteria 1409
246 Ga0070702_100179893 3300005615 Unclassified 1383
247 Ga0070702_100238574 3300005615 Bacteria 1226
248 Ga0068852_100247212 3300005616 Bacteria 1707
249 Ga0068852_100498669 3300005616 Bacteria 1212
250 Ga0068859_100007022 3300005617 Bacteria 11432
251 Ga0068859_100029694 3300005617 Bacteria 5486
252 Ga0068859_100056650 3300005617 Bacteria 3946
253 Ga0068859_100057911 3300005617 Bacteria 3903
254 Ga0068859_100064797 3300005617 Bacteria 3687
255 Ga0068859_100072553 3300005617 Bacteria 3479
256 Ga0068859_100138905 3300005617 Bacteria 2503
257 Ga0068859_100143008 3300005617 Bacteria 2466
258 Ga0068859_100153435 3300005617 Bacteria 2379
259 Ga0068859_100174596 3300005617 Bacteria 2231
260 Ga0068859_100190651 3300005617 Bacteria 2134
261 Ga0068859_100234474 3300005617 Bacteria 1924
262 Ga0068859_100418182 3300005617 Bacteria 1437
263 Ga0068859_100458223 3300005617 Bacteria 1371
264 Ga0068859_100644441 3300005617 Bacteria 1151
265 Ga0068859_100652398 3300005617 Bacteria 1144
266 Ga0068859_100715470 3300005617 Unclassified 1091
267 Ga0068864_100004220 3300005618 Bacteria 11826
268 Ga0068864_100010017 3300005618 Bacteria 7824
269 Ga0068864_100025101 3300005618 Bacteria 5018
270 Ga0068864_100080646 3300005618 Bacteria 2851
271 Ga0068864_100212159 3300005618 Bacteria 1783
272 Ga0068864_100452140 3300005618 Bacteria 1228
273 Ga0068864_100928740 3300005618 Unclassified 860
274 Ga0068864_101251616 3300005618 Unclassified 741
275 Ga0068866_10001848 3300005718 Bacteria 8876
276 Ga0068866_10042419 3300005718 Bacteria 2264
277 Ga0068861_100006098 3300005719 Bacteria 8201
278 Ga0068861_100024337 3300005719 Bacteria 4378
279 Ga0068861_100077494 3300005719 Bacteria 2593
280 Ga0068861_100214798 3300005719 Bacteria 1622
281 Ga0068861_100384425 3300005719 Unclassified 1241
282 Ga0068861_101018987 3300005719 Unclassified 791
283 Ga0068861_101334318 3300005719 Unclassified 698
284 Ga0068851_10007431 3300005834 Bacteria 5031
285 Ga0068851_10160619 3300005834 Bacteria 1234
286 Ga0068870_10061753 3300005840 Bacteria 2015
287 Ga0068870_10334629 3300005840 Bacteria 966
288 Ga0068863_100037389 3300005841 Bacteria 4622
289 Ga0068863_100039428 3300005841 Bacteria 4494
290 Ga0068863_100054451 3300005841 Bacteria 3790
291 Ga0068863_100226630 3300005841 Unclassified 1802
292 Ga0068863_100468624 3300005841 Bacteria 1238
293 Ga0068858_100000134 3300005842 Bacteria 77566
294 Ga0068858_100063016 3300005842 Bacteria 3429
295 Ga0068858_100155249 3300005842 Bacteria 2153
296 Ga0068858_100244669 3300005842 Bacteria 1703
297 Ga0068858_100287913 3300005842 Unclassified 1565
298 Ga0068858_100306234 3300005842 Bacteria 1516
299 Ga0068858_100355541 3300005842 Bacteria 1403
300 Ga0068858_100377862 3300005842 Bacteria 1359
301 Ga0068858_100440552 3300005842 Unclassified 1255
302 Ga0068858_100545049 3300005842 Bacteria 1123
303 Ga0068860_100006307 3300005843 Bacteria 11911
304 Ga0068860_100049231 3300005843 Bacteria 4014
305 Ga0068860_100056486 3300005843 Bacteria 3731
306 Ga0068860_100084954 3300005843 Bacteria 3010
307 Ga0068860_100134736 3300005843 Bacteria 2372
308 Ga0068860_100418619 3300005843 Bacteria 1328
309 Ga0068862_100014383 3300005844 Bacteria 6565
310 Ga0068862_100029312 3300005844 Bacteria 4637
311 Ga0081455_10053041 3300005937 Bacteria 3467
312 Ga0081455_10099679 3300005937 Bacteria 2336
313 Ga0081539_10000508 3300005985 Bacteria 80945
314 Ga0081539_10000731 3300005985 Bacteria 65764
315 Ga0081539_10001267 3300005985 Bacteria 44584
316 Ga0081539_10009109 3300005985 Bacteria 8399
317 Ga0081539_10119914 3300005985 Unclassified 1308
318 Ga0070716_100038099 3300006173 Bacteria 2660
319 Ga0097621_100008887 3300006237 Bacteria 7261
320 Ga0097621_100065970 3300006237 Bacteria 2980
321 Ga0097621_100099710 3300006237 Bacteria 2442
322 Ga0068871_100006263 3300006358 Bacteria 8394
323 Ga0068871_100008816 3300006358 Bacteria 7265
324 Ga0068871_100021420 3300006358 Bacteria 4967
325 Ga0068871_100372437 3300006358 Bacteria 1267
326 Ga0075428_100312176 3300006844 Bacteria 1690
327 Ga0075430_100053895 3300006846 Bacteria 3385
328 Ga0075431_100067859 3300006847 Bacteria 3681
329 Ga0075431_100090543 3300006847 Bacteria 3157
330 Ga0075431_100246344 3300006847 Bacteria 1817
331 Ga0075431_100266054 3300006847 Bacteria 1739
332 Ga0075433_10036452 3300006852 Bacteria 4237
333 Ga0075433_10062368 3300006852 Bacteria 3264
334 Ga0075433_10580575 3300006852 Unclassified 984
335 Ga0075433_10855434 3300006852 Unclassified 794
336 Ga0075434_100062330 3300006871 Bacteria 3712
337 Ga0075434_100152095 3300006871 Bacteria 2334
338 Ga0075434_100353897 3300006871 Bacteria 1489
339 Ga0075434_100467436 3300006871 Unclassified 1282
340 Ga0075429_100074934 3300006880 Bacteria 2948
341 Ga0075429_100373289 3300006880 Unclassified 1249
342 Ga0068865_100009196 3300006881 Bacteria 6116
343 Ga0068865_100999671 3300006881 Unclassified 732
344 Ga0075436_100826426 3300006914 Unclassified 691
345 Ga0097620_100007022 3300006931 Bacteria 11432
346 Ga0097620_100029692 3300006931 Bacteria 5486
347 Ga0097620_100056651 3300006931 Bacteria 3946
348 Ga0097620_100057909 3300006931 Bacteria 3903
349 Ga0097620_100064796 3300006931 Bacteria 3687
350 Ga0097620_100072556 3300006931 Bacteria 3479
351 Ga0097620_100138904 3300006931 Bacteria 2503
352 Ga0097620_100143012 3300006931 Bacteria 2466
353 Ga0097620_100153438 3300006931 Bacteria 2379
354 Ga0097620_100174610 3300006931 Bacteria 2231
355 Ga0097620_100190654 3300006931 Bacteria 2134
356 Ga0097620_100234484 3300006931 Bacteria 1924
357 Ga0097620_100418147 3300006931 Bacteria 1437
358 Ga0097620_100644402 3300006931 Bacteria 1151
359 Ga0097620_100652402 3300006931 Bacteria 1144
360 Ga0097620_100715423 3300006931 Unclassified 1091
361 Ga0075435_100273599 3300007076 Bacteria 1441
362 Ga0099795_10068027 3300007788 Bacteria 1338
363 Ga0105251_10157369 3300009011 Unclassified 1025
364 Ga0105240_10042198 3300009093 Bacteria 5815
365 Ga0105240_10511825 3300009093 Bacteria 1333
366 Ga0111539_10004239 3300009094 Bacteria 18799
367 Ga0111539_10005862 3300009094 Bacteria 15868
368 Ga0111539_10228922 3300009094 Bacteria 2165
369 Ga0111539_10298790 3300009094 Bacteria 1874
370 Ga0111539_10450977 3300009094 Bacteria 1498
371 Ga0111539_10616488 3300009094 Unclassified 1264
372 Ga0111539_11189515 3300009094 Unclassified 885
373 Ga0111539_11585050 3300009094 Unclassified 759
374 Ga0105245_10031318 3300009098 Bacteria 4706
375 Ga0105245_10242185 3300009098 Bacteria 1749
376 Ga0105245_10413750 3300009098 Unclassified 1350
377 Ga0105245_10596461 3300009098 Bacteria 1131
378 Ga0105245_11237566 3300009098 Unclassified 795
379 Ga0105245_11755185 3300009098 Unclassified 673
380 Ga0105247_10000022 3300009101 Bacteria 219796
381 Ga0105247_10000940 3300009101 Bacteria 21955
382 Ga0105247_10167471 3300009101 Unclassified 1459
383 Ga0105247_10700375 3300009101 Unclassified 762
384 Ga0105247_10735739 3300009101 Unclassified 746
385 Ga0105247_10774580 3300009101 Unclassified 729
386 Ga0105247_10927543 3300009101 Unclassified 674
387 Ga0114129_10002234 3300009147 Bacteria 26722
388 Ga0114129_10014519 3300009147 Bacteria 11225
389 Ga0114129_10052100 3300009147 Bacteria 5744
390 Ga0114129_10163448 3300009147 Bacteria 3040
391 Ga0114129_10173647 3300009147 Bacteria 2937
392 Ga0114129_10457174 3300009147 Bacteria 1673
393 Ga0114129_10467945 3300009147 Unclassified 1651
394 Ga0114129_10734971 3300009147 Bacteria 1265
395 Ga0114129_10824790 3300009147 Bacteria 1181
396 Ga0114129_10846836 3300009147 Bacteria 1163
397 Ga0105243_10000207 3300009148 Bacteria 68914
398 Ga0105243_10010199 3300009148 Bacteria 7142
399 Ga0105243_10091815 3300009148 Bacteria 2501
400 Ga0105243_10162976 3300009148 Unclassified 1924
401 Ga0105243_10223067 3300009148 Unclassified 1667
402 Ga0105243_10302440 3300009148 Unclassified 1450
403 Ga0105243_10391710 3300009148 Bacteria 1288
404 Ga0105243_10456979 3300009148 Bacteria 1200
405 Ga0105243_10744145 3300009148 Unclassified 960
406 Ga0105243_10831056 3300009148 Unclassified 913
407 Ga0105243_10838201 3300009148 Bacteria 909
408 Ga0105243_10918687 3300009148 Unclassified 872
409 Ga0105243_11192177 3300009148 Unclassified 774
410 Ga0105243_11534336 3300009148 Unclassified 691
411 Ga0105241_10070433 3300009174 Bacteria 2713
412 Ga0105241_10072606 3300009174 Bacteria 2675
413 Ga0105241_10135613 3300009174 Bacteria 1998
414 Ga0105241_10258072 3300009174 Bacteria 1480
415 Ga0105241_10312566 3300009174 Unclassified 1352
416 Ga0105241_10981288 3300009174 Unclassified 789
417 Ga0105241_11401424 3300009174 Unclassified 669
418 Ga0105242_10001183 3300009176 Bacteria 20547
419 Ga0105242_10001619 3300009176 Bacteria 17740
420 Ga0105242_10005056 3300009176 Bacteria 10185
421 Ga0105242_10088792 3300009176 Bacteria 2597
422 Ga0105242_10330978 3300009176 Bacteria 1400
423 Ga0105242_10569339 3300009176 Unclassified 1089
424 Ga0105242_10665701 3300009176 Bacteria 1014
425 Ga0105242_10842469 3300009176 Archaea 912
426 Ga0105242_11049628 3300009176 Bacteria 826
427 Ga0105242_12268148 3300009176 Unclassified 589
428 Ga0105248_10002980 3300009177 Bacteria 18768
429 Ga0105248_10004578 3300009177 Bacteria 15313
430 Ga0105248_10039245 3300009177 Bacteria 5302
431 Ga0105248_10118675 3300009177 Bacteria 2984
432 Ga0105248_10123388 3300009177 Bacteria 2922
433 Ga0105248_10149134 3300009177 Bacteria 2639
434 Ga0105248_10155036 3300009177 Bacteria 2584
435 Ga0105248_10257247 3300009177 Bacteria 1965
436 Ga0105248_10663841 3300009177 Bacteria 1176
437 Ga0105248_10863190 3300009177 Bacteria 1022
438 Ga0105248_10885816 3300009177 Bacteria 1008
439 Ga0105248_11395378 3300009177 Bacteria 793
440 Ga0105237_10000889 3300009545 Bacteria 40291
441 Ga0105237_10379550 3300009545 Bacteria 1418
442 Ga0105238_10014107 3300009551 Bacteria 8080
443 Ga0105238_11355751 3300009551 Unclassified 738
444 Ga0105249_10000288 3300009553 Bacteria 51931
445 Ga0105249_10034881 3300009553 Bacteria 4560
446 Ga0105249_10041639 3300009553 Bacteria 4176
447 Ga0105249_10141115 3300009553 Unclassified 2311
448 Ga0105249_11095406 3300009553 Unclassified 867
449 Ga0105249_11775487 3300009553 Unclassified 689
450 Ga0105249_12275949 3300009553 Unclassified 615
451 Ga0105239_10453090 3300010375 Bacteria 1456
452 Ga0105239_10893203 3300010375 Bacteria 1020
453 Ga0105239_10912890 3300010375 Unclassified 1008
454 Ga0105239_10938583 3300010375 Bacteria 994
455 Ga0105239_10987723 3300010375 Bacteria 968
456 Ga0105239_11073932 3300010375 Unclassified 926
457 Ga0105239_11137957 3300010375 Unclassified 899
458 Ga0105239_11262156 3300010375 Unclassified 852
459 Ga0105239_11692322 3300010375 Unclassified 732
460 Ga0105239_11848728 3300010375 Unclassified 700
461 Ga0105246_10019038 3300011119 Bacteria 4380
462 Ga0105246_10250657 3300011119 Bacteria 1405
463 Ga0105246_10381931 3300011119 Unclassified 1164
464 Ga0105246_10440453 3300011119 Bacteria 1092
465 Ga0105246_10517571 3300011119 Bacteria 1016
466 Ga0157373_10003789 3300013100 Bacteria 11435
467 Ga0157373_10021163 3300013100 Bacteria 4721
468 Ga0157373_10086941 3300013100 Bacteria 2203
469 Ga0157373_10398833 3300013100 Unclassified 986
470 Ga0157373_10642149 3300013100 Bacteria 775
471 Ga0157373_10671146 3300013100 Unclassified 758
472 Ga0157371_10455127 3300013102 Unclassified 941
473 Ga0157374_10056975 3300013296 Bacteria 3649
474 Ga0157374_10262237 3300013296 Bacteria 1702
475 Ga0157374_10667272 3300013296 Bacteria 1052
476 Ga0157378_10000191 3300013297 Bacteria 59071
477 Ga0157378_10001421 3300013297 Bacteria 21532
478 Ga0157378_10002587 3300013297 Bacteria 16102
479 Ga0157378_10008810 3300013297 Bacteria 8783
480 Ga0157378_10047689 3300013297 Bacteria 3809
481 Ga0157378_10161136 3300013297 Bacteria 2098
482 Ga0157378_10172869 3300013297 Bacteria 2027
483 Ga0157378_10194769 3300013297 Bacteria 1914
484 Ga0157378_10257220 3300013297 Bacteria 1674
485 Ga0157378_10333683 3300013297 Bacteria 1476
486 Ga0157378_10386155 3300013297 Unclassified 1376
487 Ga0157378_10528305 3300013297 Unclassified 1182
488 Ga0157378_10714214 3300013297 Bacteria 1023
489 Ga0157378_11147434 3300013297 Unclassified 815
490 Ga0163162_10000211 3300013306 Bacteria 54106
491 Ga0163162_10005668 3300013306 Bacteria 12065
492 Ga0163162_10010770 3300013306 Bacteria 8896
493 Ga0163162_10016674 3300013306 Bacteria 7181
494 Ga0163162_10045971 3300013306 Bacteria 4376
495 Ga0163162_10099061 3300013306 Bacteria 3005
496 Ga0163162_10124342 3300013306 Bacteria 2685
497 Ga0163162_10144803 3300013306 Bacteria 2491
498 Ga0163162_10186620 3300013306 Bacteria 2201
499 Ga0163162_10278682 3300013306 Bacteria 1804
500 Ga0163162_10739503 3300013306 Bacteria 1103
501 Ga0163162_10768472 3300013306 Bacteria 1082
502 Ga0163162_10875101 3300013306 Bacteria 1013
503 Ga0157372_10059465 3300013307 Bacteria 4274
504 Ga0157372_10060392 3300013307 Bacteria 4242
505 Ga0157372_10201332 3300013307 Bacteria 2306
506 Ga0157372_10231996 3300013307 Unclassified 2140
507 Ga0157372_10612413 3300013307 Archaea 1269
508 Ga0157372_10736006 3300013307 Bacteria 1147
509 Ga0157372_10994771 3300013307 Unclassified 971
510 Ga0157372_11039107 3300013307 Unclassified 948
511 Ga0157375_10001748 3300013308 Bacteria 18645
512 Ga0157375_10066797 3300013308 Bacteria 3591
513 Ga0157375_10163283 3300013308 Bacteria 2371
514 Ga0157375_10207426 3300013308 Bacteria 2116
515 Ga0157375_10474034 3300013308 Bacteria 1417
516 Ga0157375_10491044 3300013308 Bacteria 1392
517 Ga0157375_10786099 3300013308 Bacteria 1101
518 Ga0163163_10000333 3300014325 Bacteria 45333
519 Ga0163163_10018597 3300014325 Bacteria 6509
520 Ga0163163_10024482 3300014325 Bacteria 5746
521 Ga0163163_10042730 3300014325 Bacteria 4440
522 Ga0163163_10043458 3300014325 Bacteria 4406
523 Ga0163163_10097008 3300014325 Bacteria 2968
524 Ga0163163_10109945 3300014325 Bacteria 2784
525 Ga0163163_10242478 3300014325 Bacteria 1852
526 Ga0163163_10324365 3300014325 Bacteria 1594
527 Ga0157380_10042170 3300014326 Bacteria 3566
528 Ga0157380_10055423 3300014326 Bacteria 3149
529 Ga0157380_10160524 3300014326 Bacteria 1953
530 Ga0157380_10227883 3300014326 Bacteria 1671
531 Ga0157380_10654063 3300014326 Unclassified 1049
532 Ga0157380_10701978 3300014326 Bacteria 1017
533 Ga0157380_10836368 3300014326 Unclassified 941
534 Ga0157377_10085640 3300014745 Unclassified 1851
535 Ga0157377_10630341 3300014745 Unclassified 769
536 Ga0157377_10721377 3300014745 Bacteria 726
537 Ga0157377_10816471 3300014745 Unclassified 689
538 Ga0157377_10855371 3300014745 Unclassified 676
539 Ga0157379_10073742 3300014968 Bacteria 3055
540 Ga0157379_10096357 3300014968 Bacteria 2655
541 Ga0157379_10348521 3300014968 Unclassified 1355
542 Ga0157379_10519976 3300014968 Bacteria 1105
543 Ga0157376_10023169 3300014969 Bacteria 4855
544 Ga0157376_10107203 3300014969 Bacteria 2452
545 Ga0182007_10054637 3300015262 Bacteria 1313
546 Ga0182007_10061132 3300015262 Unclassified 1235
547 Ga0163161_10010034 3300017792 Bacteria 6557
548 Ga0207672_1000082 3300025223 Bacteria 12518
549 Ga0207697_10304909 3300025315 Unclassified 706
550 Ga0207653_10001183 3300025885 Bacteria 8518
551 Ga0207682_10230328 3300025893 Bacteria 859
552 Ga0207642_10002875 3300025899 Bacteria 5384
553 Ga0207642_10270717 3300025899 Unclassified 973
554 Ga0207710_10000001 3300025900 Bacteria 1797433
555 Ga0207710_10001369 3300025900 Bacteria 12235
556 Ga0207688_10183662 3300025901 Bacteria 1248
557 Ga0207688_10350157 3300025901 Unclassified 910
558 Ga0207680_10014597 3300025903 Bacteria 4073
559 Ga0207680_10335499 3300025903 Bacteria 1060
560 Ga0207647_10032362 3300025904 Bacteria 3361
561 Ga0207647_10216121 3300025904 Bacteria 1106
562 Ga0207647_10375782 3300025904 Unclassified 803
563 Ga0207685_10000068 3300025905 Bacteria 27372
564 Ga0207645_10015459 3300025907 Bacteria 5068
565 Ga0207645_10507856 3300025907 Unclassified 816
566 Ga0207645_10756428 3300025907 Unclassified 661
567 Ga0207643_10001673 3300025908 Bacteria 12441
568 Ga0207643_10036446 3300025908 Bacteria 2758
569 Ga0207643_10072726 3300025908 Bacteria 1981
570 Ga0207643_10348556 3300025908 Bacteria 929
571 Ga0207684_10000065 3300025910 Bacteria 194463
572 Ga0207684_10004172 3300025910 Bacteria 13729
573 Ga0207684_10016010 3300025910 Bacteria 6440
574 Ga0207684_10016926 3300025910 Bacteria 6262
575 Ga0207684_10021254 3300025910 Bacteria 5541
576 Ga0207684_10639136 3300025910 Unclassified 907
577 Ga0207654_10163842 3300025911 Unclassified 1438
578 Ga0207654_10450288 3300025911 Unclassified 903
579 Ga0207654_10612011 3300025911 Unclassified 778
580 Ga0207707_10000028 3300025912 Bacteria 167115
581 Ga0207695_10053394 3300025913 Bacteria 4227
582 Ga0207695_11135198 3300025913 Unclassified 661
583 Ga0207671_10005350 3300025914 Bacteria 11877
584 Ga0207671_10990312 3300025914 Unclassified 663
585 Ga0207660_10006116 3300025917 Bacteria 7811
586 Ga0207660_10097002 3300025917 Bacteria 2196
587 Ga0207662_10008108 3300025918 Bacteria 5739
588 Ga0207662_10017704 3300025918 Bacteria 4033
589 Ga0207662_10266882 3300025918 Unclassified 1128
590 Ga0207662_10303790 3300025918 Bacteria 1061
591 Ga0207662_10378475 3300025918 Bacteria 956
592 Ga0207662_10412845 3300025918 Bacteria 917
593 Ga0207657_10052099 3300025919 Bacteria 3554
594 Ga0207657_10763337 3300025919 Unclassified 749
595 Ga0207649_10126714 3300025920 Bacteria 1729
596 Ga0207652_10000443 3300025921 Bacteria 42831
597 Ga0207646_10004429 3300025922 Bacteria 15249
598 Ga0207646_10032101 3300025922 Bacteria 4752
599 Ga0207646_10096152 3300025922 Bacteria 2653
600 Ga0207646_10203510 3300025922 Unclassified 1788
601 Ga0207646_10241438 3300025922 Bacteria 1632
602 Ga0207681_10000729 3300025923 Bacteria 21525
603 Ga0207681_10011656 3300025923 Bacteria 5405
604 Ga0207681_10020953 3300025923 Bacteria 4149
605 Ga0207681_10028279 3300025923 Bacteria 3631
606 Ga0207681_10028782 3300025923 Bacteria 3602
607 Ga0207694_10007517 3300025924 Bacteria 8260
608 Ga0207650_10000046 3300025925 Bacteria 178190
609 Ga0207650_10014146 3300025925 Bacteria 5542
610 Ga0207650_10181222 3300025925 Bacteria 1678
611 Ga0207650_10396794 3300025925 Bacteria 1141
612 Ga0207650_10437782 3300025925 Unclassified 1086
613 Ga0207650_10597055 3300025925 Bacteria 928
614 Ga0207650_10995197 3300025925 Bacteria 713
615 Ga0207659_10525991 3300025926 Bacteria 1003
616 Ga0207687_10024975 3300025927 Bacteria 3997
617 Ga0207687_10443041 3300025927 Unclassified 1076
618 Ga0207687_10784073 3300025927 Bacteria 812
619 Ga0207644_10014406 3300025931 Bacteria 5290
620 Ga0207644_10106793 3300025931 Bacteria 2111
621 Ga0207644_10580006 3300025931 Unclassified 930
622 Ga0207690_10055370 3300025932 Bacteria 2671
623 Ga0207690_10099174 3300025932 Bacteria 2076
624 Ga0207690_10252634 3300025932 Unclassified 1362
625 Ga0207690_10566082 3300025932 Bacteria 925
626 Ga0207706_10333437 3300025933 Unclassified 1320
627 Ga0207706_10375695 3300025933 Bacteria 1234
628 Ga0207686_10000373 3300025934 Bacteria 31299
629 Ga0207686_10000820 3300025934 Bacteria 18978
630 Ga0207686_10022755 3300025934 Bacteria 3612
631 Ga0207686_10033605 3300025934 Bacteria 3063
632 Ga0207686_10410519 3300025934 Bacteria 1034
633 Ga0207709_10001161 3300025935 Bacteria 19155
634 Ga0207709_10060464 3300025935 Bacteria 2362
635 Ga0207709_10452618 3300025935 Unclassified 993
636 Ga0207709_10558923 3300025935 Bacteria 901
637 Ga0207709_10756594 3300025935 Bacteria 781
638 Ga0207709_11163975 3300025935 Unclassified 635
639 Ga0207709_11325148 3300025935 Unclassified 595
640 Ga0207670_10000322 3300025936 Bacteria 28637
641 Ga0207670_10436201 3300025936 Bacteria 1054
642 Ga0207704_10090158 3300025938 Bacteria 2011
643 Ga0207704_10192385 3300025938 Bacteria 1485
644 Ga0207665_10000083 3300025939 Bacteria 61629
645 Ga0207665_10320094 3300025939 Bacteria 1164
646 Ga0207691_10001701 3300025940 Bacteria 21735
647 Ga0207691_10262998 3300025940 Bacteria 1487
648 Ga0207691_10549452 3300025940 Bacteria 979
649 Ga0207711_10001639 3300025941 Bacteria 20644
650 Ga0207711_10011584 3300025941 Bacteria 7330
651 Ga0207711_10219007 3300025941 Bacteria 1740
652 Ga0207711_10326908 3300025941 Bacteria 1418
653 Ga0207711_10347452 3300025941 Bacteria 1373
654 Ga0207711_10584634 3300025941 Unclassified 1042
655 Ga0207711_10636261 3300025941 Unclassified 995
656 Ga0207711_10898993 3300025941 Bacteria 823
657 Ga0207689_10003706 3300025942 Bacteria 13935
658 Ga0207689_10009911 3300025942 Bacteria 8215
659 Ga0207689_10149654 3300025942 Bacteria 1924
660 Ga0207689_10194291 3300025942 Bacteria 1674
661 Ga0207689_10324396 3300025942 Bacteria 1278
662 Ga0207689_10364970 3300025942 Bacteria 1201
663 Ga0207689_10508557 3300025942 Bacteria 1010
664 Ga0207689_10537246 3300025942 Unclassified 981
665 Ga0207689_10921038 3300025942 Unclassified 737
666 Ga0207689_10932151 3300025942 Unclassified 733
667 Ga0207679_10200205 3300025945 Bacteria 1667
668 Ga0207679_10321396 3300025945 Bacteria 1340
669 Ga0207679_10493169 3300025945 Unclassified 1092
670 Ga0207679_10545689 3300025945 Bacteria 1039
671 Ga0207667_10314303 3300025949 Bacteria 1600
672 Ga0207651_10059446 3300025960 Bacteria 2648
673 Ga0207651_10168667 3300025960 Unclassified 1724
674 Ga0207651_10369336 3300025960 Bacteria 1213
675 Ga0207651_10394115 3300025960 Unclassified 1176
676 Ga0207712_10000180 3300025961 Bacteria 65420
677 Ga0207712_10583253 3300025961 Unclassified 965
678 Ga0207668_10014786 3300025972 Unclassified 4837
679 Ga0207668_10454649 3300025972 Bacteria 1094
680 Ga0207640_10704588 3300025981 Unclassified 866
681 Ga0207640_11241784 3300025981 Unclassified 664
682 Ga0207658_10111351 3300025986 Bacteria 2165
683 Ga0207658_11079439 3300025986 Viruses 733
684 Ga0207677_10036820 3300026023 Bacteria 3192
685 Ga0207677_10048529 3300026023 Bacteria 2859
686 Ga0207677_10132243 3300026023 Bacteria 1897
687 Ga0207677_10662553 3300026023 Bacteria 922
688 Ga0207703_10000481 3300026035 Bacteria 41719
689 Ga0207703_10010674 3300026035 Bacteria 7174
690 Ga0207703_10165221 3300026035 Bacteria 1942
691 Ga0207703_10331982 3300026035 Unclassified 1395
692 Ga0207703_10407325 3300026035 Bacteria 1263
693 Ga0207703_10572733 3300026035 Bacteria 1066
694 Ga0207703_10613174 3300026035 Bacteria 1030
695 Ga0207703_11291904 3300026035 Unclassified 702
696 Ga0207703_11315093 3300026035 Unclassified 695
697 Ga0207639_10052991 3300026041 Bacteria 3094
698 Ga0207639_10287674 3300026041 Bacteria 1448
699 Ga0207639_11174308 3300026041 Unclassified 720
700 Ga0207708_10000133 3300026075 Bacteria 58317
701 Ga0207708_10035005 3300026075 Bacteria 3821
702 Ga0207708_10036570 3300026075 Bacteria 3739
703 Ga0207708_10077768 3300026075 Bacteria 2547
704 Ga0207708_10129725 3300026075 Bacteria 1970
705 Ga0207708_10270771 3300026075 Bacteria 1374
706 Ga0207708_10422029 3300026075 Bacteria 1106
707 Ga0207708_10689833 3300026075 Bacteria 872
708 Ga0207708_11299541 3300026075 Unclassified 637
709 Ga0207641_10053414 3300026088 Bacteria 3425
710 Ga0207641_10075378 3300026088 Bacteria 2913
711 Ga0207641_10102462 3300026088 Bacteria 2524
712 Ga0207641_10114554 3300026088 Bacteria 2396
713 Ga0207641_10174723 3300026088 Bacteria 1963
714 Ga0207641_10301670 3300026088 Bacteria 1513
715 Ga0207641_10430609 3300026088 Bacteria 1272
716 Ga0207641_10706624 3300026088 Unclassified 993
717 Ga0207648_10056273 3300026089 Bacteria 3433
718 Ga0207648_10097769 3300026089 Bacteria 2569
719 Ga0207648_10106665 3300026089 Bacteria 2458
720 Ga0207648_10401820 3300026089 Bacteria 1241
721 Ga0207648_10590659 3300026089 Unclassified 1023
722 Ga0207648_10897474 3300026089 Bacteria 828
723 Ga0207676_10018008 3300026095 Bacteria 5128
724 Ga0207676_10031122 3300026095 Bacteria 4011
725 Ga0207676_10084507 3300026095 Bacteria 2587
726 Ga0207676_10131523 3300026095 Bacteria 2128
727 Ga0207676_10179898 3300026095 Bacteria 1850
728 Ga0207676_10337215 3300026095 Unclassified 1390
729 Ga0207676_10535047 3300026095 Unclassified 1117
730 Ga0207676_11025189 3300026095 Bacteria 814
731 Ga0207676_11496683 3300026095 Bacteria 672
732 Ga0207674_10002025 3300026116 Bacteria 25725
733 Ga0207674_10039964 3300026116 Unclassified 4860
734 Ga0207674_10042739 3300026116 Bacteria 4678
735 Ga0207674_10504676 3300026116 Unclassified 1168
736 Ga0207674_10621492 3300026116 Bacteria 1043
737 Ga0207674_10730423 3300026116 Unclassified 956
738 Ga0207674_11243734 3300026116 Unclassified 714
739 Ga0207674_11280623 3300026116 Bacteria 703
740 Ga0207675_100006381 3300026118 Bacteria 11176
741 Ga0207675_100008376 3300026118 Bacteria 9745
742 Ga0207675_100052371 3300026118 Bacteria 3809
743 Ga0207675_100092374 3300026118 Bacteria 2846
744 Ga0207675_100525524 3300026118 Unclassified 1180
745 Ga0207683_10066395 3300026121 Bacteria 3181
746 Ga0207683_10460550 3300026121 Bacteria 1173
747 Ga0207683_11056806 3300026121 Bacteria 753
748 Ga0207698_10288633 3300026142 Bacteria 1521
749 Ga0207698_10410961 3300026142 Bacteria 1296
750 Ga0207698_10971198 3300026142 Unclassified 859
751 Ga0207428_10061421 3300027907 Bacteria 2975
752 Ga0207428_10062946 3300027907 Bacteria 2932
753 Ga0207428_10082670 3300027907 Bacteria 2506
754 Ga0268266_11207440 3300028379 Unclassified 731
755 Ga0268265_10190613 3300028380 Bacteria 1770
756 Ga0268265_10251467 3300028380 Bacteria 1566
757 Ga0268265_10636575 3300028380 Bacteria 1023
758 Ga0268265_11036422 3300028380 Unclassified 812
759 Ga0268264_10149136 3300028381 Bacteria 2095
760 Ga0268264_10196598 3300028381 Bacteria 1842
761 Ga0268264_10200058 3300028381 Bacteria 1827
762 Ga0268264_10284478 3300028381 Bacteria 1550
763 Ga0268264_10366323 3300028381 Bacteria 1376
764 Ga0268264_10483580 3300028381 Unclassified 1205
765 Ga0268264_10743732 3300028381 Unclassified 976
766 Ga0268264_11327601 3300028381 Unclassified 729
767 Ga0268264_11424692 3300028381 Unclassified 703
768 Ga0307408_100741992 3300031548 Unclassified 886
769 Ga0307405_10001250 3300031731 Bacteria 10583
770 Ga0307405_10595661 3300031731 Unclassified 901
771 Ga0307413_10162438 3300031824 Bacteria 1571
772 Ga0307413_10169920 3300031824 Unclassified 1542
773 Ga0307410_10000784 3300031852 Bacteria 13396
774 Ga0307410_10423130 3300031852 Unclassified 1081
775 Ga0307406_10019764 3300031901 Bacteria 3957
776 Ga0307407_10090076 3300031903 Bacteria 1878
777 Ga0307412_10086616 3300031911 Bacteria 2180
778 Ga0307412_10208802 3300031911 Bacteria 1488
779 Ga0307409_100090538 3300031995 Bacteria 2505
780 Ga0307416_100007007 3300032002 Bacteria 7110
781 Ga0307416_100050841 3300032002 Bacteria 3306
782 Ga0307416_100195986 3300032002 Bacteria 1911
783 Ga0307416_100703092 3300032002 Unclassified 1100
784 Ga0307416_100803576 3300032002 Bacteria 1036
785 Ga0307416_100866137 3300032002 Unclassified 1002
786 Ga0307416_100936390 3300032002 Bacteria 968
787 Ga0307416_102527026 3300032002 Bacteria 612
788 Ga0307414_10267859 3300032004 Bacteria 1429
789 Ga0307414_10351944 3300032004 Unclassified 1264
790 Ga0307414_10946434 3300032004 Unclassified 791
791 Ga0307411_10071544 3300032005 Bacteria 2351
792 Ga0307411_10101533 3300032005 Bacteria 2036
793 Ga0307411_10614482 3300032005 Unclassified 936
794 Ga0307415_100001321 3300032126 Bacteria 11735
795 Ga0307415_100189808 3300032126 Bacteria 1620
796 Ga0373930_0093832 3300034816 Bacteria 707
797 Ga0373940_0042346 3300035088 Bacteria 1255
798 Ga0373949_0007134 3300035090 Bacteria 2450
799 Ga0373951_0005735 3300035091 Bacteria 2871
800 Ga0373951_0183267 3300035091 Archaea 602
801 Ga0373939_0179581 3300035114 Unclassified 789
802 Ga0373961_0069440 3300035241 Unclassified 1087
803 Ga0373937_1104487 3300036401 Unclassified 742
804 Ga0395900_0097549 3300037418 Bacteria 3020
805 Ga0395900_0696470 3300037418 Bacteria 950
806 Ga0395898_0054223 3300037466 Bacteria 3913
807 Ga0395898_0470602 3300037466 Unclassified 1196
808 Ga0395905_0370806 3300037471 Bacteria 1325
809 Ga0395901_0188839 3300038443 Bacteria 2161
810 Ga0242420_027007 3300038996 Unclassified 1050
811 Ga0242420_069892 3300038996 Unclassified 712
812 Ga0436365_0789093 3300039437 Bacteria 4233
813 Ga0450892_019785 3300042130 Bacteria 655
814 Ga0439458_0020070 3300042157 Bacteria 1542
815 Ga0451576_0301272 3300045051 Bacteria 1677
816 Ga0451576_0394580 3300045051 Bacteria 1451
817 Ga0495580_0417439 3300046472 Unclassified 903
818 Ga0495632_0080157 3300046519 Bacteria 1558
819 Ga0495663_0000891 3300046525 Bacteria 10055
820 Ga0495640_0356745 3300046533 Bacteria 902
821 Ga0495598_0000764 3300046537 Bacteria 6122
822 Ga0495621_0000016 3300046539 Bacteria 34269
823 Ga0495621_0024488 3300046539 Bacteria 2017
824 Ga0495668_0081774 3300046616 Bacteria 1772
825 Ga0495668_0346155 3300046616 Unclassified 816
826 Ga0495658_0073232 3300046683 Bacteria 1994
827 Ga0495636_0021587 3300047318 Bacteria 2600
828 Ga0495684_0185145 3300047471 Bacteria 1542
829 Ga0496103_0597868 3300048906 Unclassified 703
830 Ga0496104_0729866 3300048907 Unclassified 898
831 Ga0496104_0905451 3300048907 Unclassified 787
832 Ga0496106_0020516 3300048909 Bacteria 4905
833 Ga0496106_0026558 3300048909 Bacteria 4312
834 Ga0496106_0352608 3300048909 Bacteria 1182
835 Ga0496108_0037751 3300048911 Bacteria 4025
836 Ga0496108_0268904 3300048911 Bacteria 1484
837 Ga0496112_1185164 3300048915 Bacteria 681
838 Ga0496113_0174346 3300048916 Bacteria 1704
839 Ga0496113_1201362 3300048916 Unclassified 592
840 Ga0501292_001073 3300049515 Bacteria 3341
841 Ga0501292_004416 3300049515 Bacteria 1925
842 Ga0501292_028406 3300049515 Unclassified 931
843 Ga0501296_005275 3300049519 Bacteria 1436
844 Ga0501297_010981 3300049520 Unclassified 1033
845 Ga0501298_000849 3300049521 Bacteria 4308
846 Ga0501298_009255 3300049521 Bacteria 1672
847 Ga0501298_030331 3300049521 Bacteria 1058
848 Ga0501299_013322 3300049522 Bacteria 1417
849 Ga0501300_041500 3300049523 Unclassified 694
850 Ga0501031_0159623 3300049568 Archaea 1474
851 Ga0501036_0586925 3300049572 Bacteria 925
852 Ga0501038_0022901 3300049574 Bacteria 5592
853 Ga0501040_0275485 3300049576 Archaea 1202
854 Ga0501072_0545758 3300049588 Unclassified 916
855 Ga0501076_0443467 3300049592 Bacteria 1069
856 Ga0501198_039968 3300049649 Unclassified 810
857 Ga0501202_016901 3300049652 Bacteria 1420
858 Ga0501202_081653 3300049652 Unclassified 760
859 Ga0501206_013972 3300049653 Unclassified 1100
860 Ga0501207_008814 3300049654 Bacteria 1464
861 Ga0501207_046199 3300049654 Unclassified 768
862 Ga0501216_001003 3300049660 Bacteria 3635
863 Ga0501216_084908 3300049660 Unclassified 675
864 Ga0501217_000261 3300049661 Bacteria 8189
865 Ga0501217_021013 3300049661 Bacteria 1538
866 Ga0501223_003502 3300049663 Bacteria 3409
867 Ga0501223_014933 3300049663 Bacteria 1539
868 Ga0501223_032948 3300049663 Bacteria 1007
869 Ga0501223_067293 3300049663 Unclassified 704
870 Ga0501224_029550 3300049664 Unclassified 820
871 Ga0501224_034572 3300049664 Unclassified 759
872 Ga0501227_000224 3300049665 Bacteria 11441
873 Ga0501227_097147 3300049665 Unclassified 781
874 Ga0501227_105908 3300049665 Unclassified 750
875 Ga0501233_001991 3300049668 Bacteria 3561
876 Ga0501233_013694 3300049668 Bacteria 1648
877 Ga0501233_033821 3300049668 Unclassified 1170
878 Ga0501235_000213 3300049669 Bacteria 10407
879 Ga0501235_003502 3300049669 Bacteria 3400
880 Ga0501235_017358 3300049669 Bacteria 1593
881 Ga0501235_022659 3300049669 Bacteria 1397
882 Ga0501239_034779 3300049672 Unclassified 675
883 Ga0501242_033125 3300049674 Unclassified 707
884 Ga0501243_001571 3300049675 Bacteria 3277
885 Ga0501243_022556 3300049675 Unclassified 1043
886 Ga0501247_055830 3300049677 Unclassified 596
887 Ga0501249_090057 3300049679 Unclassified 727
888 Ga0501253_022770 3300049683 Bacteria 1119
889 Ga0501253_045134 3300049683 Bacteria 904
890 Ga0501257_096602 3300049686 Unclassified 772
891 Ga0501257_121279 3300049686 Unclassified 700
892 Ga0501259_024714 3300049688 Unclassified 1096
893 Ga0501259_065102 3300049688 Unclassified 770
894 Ga0501260_020581 3300049689 Unclassified 713
895 Ga0501261_004827 3300049690 Bacteria 1681
896 Ga0501219_012714 3300049703 Unclassified 655
897 Ga0501221_021808 3300049704 Bacteria 1264
898 Ga0501221_036300 3300049704 Unclassified 1055
899 Ga0501221_065347 3300049704 Unclassified 849
900 Ga0501225_0117117 3300049705 Unclassified 789
901 Ga0501225_0139918 3300049705 Bacteria 731
902 Ga0501234_004415 3300049707 Bacteria 2212
903 Ga0501079_0174402 3300049741 Bacteria 1677
904 Ga0501241_033376 3300049758 Unclassified 978
905 Ga0501266_006017 3300049763 Unclassified 1507
906 Ga0501268_010129 3300049765 Unclassified 1462
907 Ga0501272_016181 3300049769 Unclassified 872
908 Ga0501273_008737 3300049770 Bacteria 1217
909 Ga0501273_016122 3300049770 Bacteria 976
910 Ga0501279_007853 3300049775 Bacteria 1419
911 Ga0501283_000552 3300049779 Bacteria 4942
912 Ga0501283_012075 3300049779 Unclassified 1294
913 Ga0501283_062179 3300049779 Unclassified 676
914 Ga0501212_006202 3300049851 Bacteria 1606
915 Ga0501212_032467 3300049851 Unclassified 845
916 Ga0501212_039129 3300049851 Unclassified 780
917 Ga0501226_000157 3300049853 Bacteria 12014
918 nmdc:mga05p37_1115641_c1 3300050507 Unclassified 824
919 nmdc:mga05p37_1166994_c1 3300050507 Unclassified 799
920 nmdc:mga05p37_174771_c1 3300050507 Bacteria 2617
921 nmdc:mga05p37_386829_c1 3300050507 Unclassified 1637
922 nmdc:mga05p37_423591_c1 3300050507 Bacteria 1548
923 nmdc:mga05p37_452769_c1 3300050507 Bacteria 1485
924 nmdc:mga05p37_544429_c1 3300050507 Unclassified 1323
925 nmdc:mga05p37_608002_c1 3300050507 Unclassified 1233
926 nmdc:mga05p37_677906_c1 3300050507 Bacteria 1149
927 nmdc:mga05p37_772228_c1 3300050507 Bacteria 1056
928 nmdc:mga05p37_841088_c1 3300050507 Unclassified 998
929 nmdc:mga05p37_91917_c1 3300050507 Bacteria 3739
930 nmdc:mga09592_107233_c1 3300050508 Bacteria 2396
931 nmdc:mga09592_1135009_c1 3300050508 Unclassified 648
932 nmdc:mga09592_285496_c1 3300050508 Bacteria 1431
933 nmdc:mga0qj67_234185_c1 3300050509 Bacteria 1490
934 nmdc:mga0qj67_56399_c1 3300050509 Bacteria 3114
935 nmdc:mga06r32_225788_c1 3300050510 Bacteria 1861
936 nmdc:mga06r32_283216_c1 3300050510 Bacteria 1644
937 nmdc:mga06r32_375996_c1 3300050510 Bacteria 1404
938 nmdc:mga06r32_428987_c1 3300050510 Bacteria 1303
939 nmdc:mga08y16_1172535_c1 3300050511 Unclassified 740
940 nmdc:mga08y16_148128_c1 3300050511 Bacteria 2440
941 nmdc:mga08y16_245832_c1 3300050511 Bacteria 1849
942 nmdc:mga08y16_501711_c1 3300050511 Bacteria 1233
943 nmdc:mga08y16_8295_c1 3300050511 Bacteria 10872
944 nmdc:mga0n895_151046_c1 3300050512 Bacteria 2353
945 nmdc:mga0n895_154749_c1 3300050512 Bacteria 2323
946 nmdc:mga0n895_315174_c1 3300050512 Unclassified 1585
947 nmdc:mga0n895_547011_c1 3300050512 Bacteria 1164
948 nmdc:mga0n895_642562_c1 3300050512 Bacteria 1060
949 nmdc:mga0n895_727295_c1 3300050512 Unclassified 987
950 nmdc:mga0rr50_1253427_c1 3300050513 Bacteria 629
951 nmdc:mga0a205_1033380_c1 3300050515 Unclassified 669
952 nmdc:mga0a205_12842_c1 3300050515 Bacteria 7769
953 nmdc:mga0a205_133596_c1 3300050515 Bacteria 2382
954 nmdc:mga0a205_338121_c1 3300050515 Unclassified 1374
955 nmdc:mga0a205_416548_c1 3300050515 Bacteria 1206
956 nmdc:mga0a205_584393_c1 3300050515 Bacteria 971
957 Ga0501084_0953280 3300054114 Archaea 721
958 Ga0070680_100225153
959 MRS1b_contig_6674846
960 MBSR1b_contig_11571009
961 CNAas_1000869
962 JGI24748J21848_1000003
963 JGI24034J26672_10000005
964 JGI24751J29686_10000033
965 JGI25406J46586_10008071
966 rootH2_10229866
967 rootL2_10158938
968 rootH1_10265298
969 Ga0065714_10064444
970 Ga0065704_10021175
971 Ga0065712_10006950
972 Ga0065712_10067736
973 Ga0065712_10256067
974 Ga0065715_10008808
975 Ga0065715_10024859
976 Ga0065715_10030092
977 Ga0065715_10033645
978 Ga0065715_10045465
979 Ga0065715_10090002
980 Ga0065715_10091138
981 Ga0065715_10094034
982 Ga0065715_10127997
983 Ga0065715_10148342
984 Ga0065707_10001442
985 Ga0065707_10172728
986 Ga0065707_10230806
987 Ga0065707_10481442
988 Ga0065707_10608064
989 Ga0070676_10032215
990 Ga0070690_100000817
991 Ga0070690_100048410
992 Ga0070690_100102003
993 Ga0070690_100790248
994 Ga0070670_100000142
995 Ga0070670_100006153
996 Ga0070670_100098739
997 Ga0070670_100278421
998 Ga0070670_100288918
999 Ga0070670_100445333
1000 Ga0070670_101172313
1001 Ga0070670_101540431
1002 Ga0070677_10545481
1003 Ga0068869_100005669
1004 Ga0068869_100069452
1005 Ga0068869_100070101
1006 Ga0068869_100426129
1007 Ga0068869_100504041
1008 Ga0068869_100536642
1009 Ga0068869_100950054
1010 Ga0068869_101139463
1011 Ga0070680_100002408
1012 Ga0070680_100137513
1013 Ga0070680_100206144
1014 Ga0070680_100679737
1015 Ga0070682_100013810
1016 Ga0068868_100013176
1017 Ga0068868_100020616
1018 Ga0068868_100180272
1019 Ga0068868_100908261
1020 Ga0070660_100015879
1021 Ga0070660_100550635
1022 Ga0070689_100002620
1023 Ga0070689_100048941
1024 Ga0070689_100290801
1025 Ga0070689_100570502
1026 Ga0070687_100006624
1027 Ga0070687_100189549
1028 Ga0070687_100402979
1029 Ga0070687_100467735
1030 Ga0070687_100565354
1031 Ga0070661_100077563
1032 Ga0070692_10012645
1033 Ga0070692_10082600
1034 Ga0070692_10185877
1035 Ga0070692_10342116
1036 Ga0070668_100004093
1037 Ga0070669_100008291
1038 Ga0070669_100044896
1039 Ga0070669_100120373
1040 Ga0070669_100373727
1041 Ga0070675_100638237
1042 Ga0070671_100001580
1043 Ga0070671_100332284
1044 Ga0070674_100030870
1045 Ga0070673_100011790
1046 Ga0070673_100023045
1047 Ga0070673_100231029
1048 Ga0070673_100680203
1049 Ga0070673_100711311
1050 Ga0070673_101507361
1051 Ga0070688_100007597
1052 Ga0070659_100024585
1053 Ga0070659_100120922
1054 Ga0070659_100153750
1055 Ga0070659_100627880
1056 Ga0070659_100667689
1057 Ga0070667_100926728
1058 Ga0070703_10003365
1059 Ga0070703_10216295
1060 Ga0070709_10285382
1061 Ga0070701_10007401
1062 Ga0070701_10101335
1063 Ga0070701_10141777
1064 Ga0070701_10283973
1065 Ga0070701_10354342
1066 Ga0070705_100006983
1067 Ga0070705_100063402
1068 Ga0070705_100329168
1069 Ga0070700_100000238
1070 Ga0070700_100019390
1071 Ga0070700_100042126
1072 Ga0070700_100098352
1073 Ga0070700_100221783
1074 Ga0070700_100402341
1075 Ga0070700_100429957
1076 Ga0070694_100006926
1077 Ga0070694_100007458
1078 Ga0070694_100009509
1079 Ga0070694_100015795
1080 Ga0070694_100071355
1081 Ga0070694_100150586
1082 Ga0070694_100190266
1083 Ga0070694_100355039
1084 Ga0070694_100601205
1085 Ga0070694_100822816
1086 Ga0070708_100322306
1087 Ga0070678_100060217
1088 Ga0070678_100932032
1089 Ga0070662_100094683
1090 Ga0070662_100517224
1091 Ga0070662_100575907
1092 Ga0070681_10000100
1093 Ga0070681_10000986
1094 Ga0070681_10041236
1095 Ga0070681_10417810
1096 Ga0068867_100024849
1097 Ga0068867_100068727
1098 Ga0068867_100155585
1099 Ga0068867_100276751
1100 Ga0068867_100343735
1101 Ga0070685_10380277
1102 Ga0070706_100000002
1103 Ga0070706_100180334
1104 Ga0070706_100258172
1105 Ga0070706_100639305
1106 Ga0070706_100649343
1107 Ga0070707_100000562
1108 Ga0070707_100008628
1109 Ga0070707_100050836
1110 Ga0070707_100239229
1111 Ga0070698_100009059
1112 Ga0070698_100020732
1113 Ga0070698_100034361
1114 Ga0070698_100063342
1115 Ga0070698_100066837
1116 Ga0070698_100588687
1117 Ga0070698_100753880
1118 Ga0070699_100000980
1119 Ga0070699_100004102
1120 Ga0070699_100038390
1121 Ga0070699_100162285
1122 Ga0070699_100345571
1123 Ga0070699_101258131
1124 Ga0070679_100000819
1125 Ga0070679_101508047
1126 Ga0070684_100355930
1127 Ga0070697_100000184
1128 Ga0070697_100000379
1129 Ga0070697_100144047
1130 Ga0070697_100207412
1131 Ga0070697_100339563
1132 Ga0070697_100399308
1133 Ga0070697_100554251
1134 Ga0070697_100786123
1135 Ga0070697_101069703
1136 Ga0068853_100063797
1137 Ga0068853_100129052
1138 Ga0068853_100340318
1139 Ga0068853_100589858
1140 Ga0070672_100123700
1141 Ga0070672_100125200
1142 Ga0070672_100260208
1143 Ga0070672_100274167
1144 Ga0070672_101300969
1145 Ga0070686_100012452
1146 Ga0070686_100031759
1147 Ga0070686_100076856
1148 Ga0070695_100040072
1149 Ga0070695_100048497
1150 Ga0070695_100104550
1151 Ga0070695_100118768
1152 Ga0070695_100133237
1153 Ga0070695_100157837
1154 Ga0070695_100157840
1155 Ga0070695_100202780
1156 Ga0070695_100475659
1157 Ga0070695_100516735
1158 Ga0070695_100568060
1159 Ga0070695_101009985
1160 Ga0070696_100031372
1161 Ga0070696_100122084
1162 Ga0070696_100192872
1163 Ga0070696_100238124
1164 Ga0070696_100300846
1165 Ga0070696_100329018
1166 Ga0070696_100485247
1167 Ga0070696_100651788
1168 Ga0070693_100080251
1169 Ga0070693_100127427
1170 Ga0070693_100174432
1171 Ga0070693_100182162
1172 Ga0070693_100324355
1173 Ga0070665_101038882
1174 Ga0070704_100010701
1175 Ga0070704_100010965
1176 Ga0070704_100105652
1177 Ga0070704_100124189
1178 Ga0070704_100177607
1179 Ga0070704_100189743
1180 Ga0070704_100224723
1181 Ga0070704_100231390
1182 Ga0070704_100313692
1183 Ga0070704_100489016
1184 Ga0070704_100835761
1185 Ga0070664_100011274
1186 Ga0068857_100019415
1187 Ga0068857_100187430
1188 Ga0068857_100614994
1189 Ga0068857_100680346
1190 Ga0068857_100801424
1191 Ga0068854_100024594
1192 Ga0068854_100076809
1193 Ga0068854_100271691
1194 Ga0068854_100344096
1195 Ga0068854_100358589
1196 Ga0068854_100800128
1197 Ga0068856_100974276
1198 Ga0070702_100018094
1199 Ga0070702_100025366
1200 Ga0070702_100032786
1201 Ga0070702_100048390
1202 Ga0070702_100172311
1203 Ga0070702_100179893
1204 Ga0070702_100238574
1205 Ga0068852_100247212
1206 Ga0068852_100498669
1207 Ga0068859_100007022
1208 Ga0068859_100029694
1209 Ga0068859_100056650
1210 Ga0068859_100057911
1211 Ga0068859_100064797
1212 Ga0068859_100072553
1213 Ga0068859_100138905
1214 Ga0068859_100143008
1215 Ga0068859_100153435
1216 Ga0068859_100174596
1217 Ga0068859_100190651
1218 Ga0068859_100234474
1219 Ga0068859_100418182
1220 Ga0068859_100458223
1221 Ga0068859_100644441
1222 Ga0068859_100652398
1223 Ga0068859_100715470
1224 Ga0068864_100004220
1225 Ga0068864_100010017
1226 Ga0068864_100025101
1227 Ga0068864_100080646
1228 Ga0068864_100212159
1229 Ga0068864_100452140
1230 Ga0068864_100928740
1231 Ga0068864_101251616
1232 Ga0068866_10001848
1233 Ga0068866_10042419
1234 Ga0068861_100006098
1235 Ga0068861_100024337
1236 Ga0068861_100077494
1237 Ga0068861_100214798
1238 Ga0068861_100384425
1239 Ga0068861_101018987
1240 Ga0068861_101334318
1241 Ga0068851_10007431
1242 Ga0068851_10160619
1243 Ga0068870_10061753
1244 Ga0068870_10334629
1245 Ga0068863_100037389
1246 Ga0068863_100039428
1247 Ga0068863_100054451
1248 Ga0068863_100226630
1249 Ga0068863_100468624
1250 Ga0068858_100000134
1251 Ga0068858_100063016
1252 Ga0068858_100155249
1253 Ga0068858_100244669
1254 Ga0068858_100287913
1255 Ga0068858_100306234
1256 Ga0068858_100355541
1257 Ga0068858_100377862
1258 Ga0068858_100440552
1259 Ga0068858_100545049
1260 Ga0068860_100006307
1261 Ga0068860_100049231
1262 Ga0068860_100056486
1263 Ga0068860_100084954
1264 Ga0068860_100134736
1265 Ga0068860_100418619
1266 Ga0068862_100014383
1267 Ga0068862_100029312
1268 Ga0081455_10053041
1269 Ga0081455_10099679
1270 Ga0081539_10000508
1271 Ga0081539_10000731
1272 Ga0081539_10001267
1273 Ga0081539_10009109
1274 Ga0081539_10119914
1275 Ga0070716_100038099
1276 Ga0097621_100008887
1277 Ga0097621_100065970
1278 Ga0097621_100099710
1279 Ga0068871_100006263
1280 Ga0068871_100008816
1281 Ga0068871_100021420
1282 Ga0068871_100372437
1283 Ga0075428_100312176
1284 Ga0075430_100053895
1285 Ga0075431_100067859
1286 Ga0075431_100090543
1287 Ga0075431_100246344
1288 Ga0075431_100266054
1289 Ga0075433_10036452
1290 Ga0075433_10062368
1291 Ga0075433_10580575
1292 Ga0075433_10855434
1293 Ga0075434_100062330
1294 Ga0075434_100152095
1295 Ga0075434_100353897
1296 Ga0075434_100467436
1297 Ga0075429_100074934
1298 Ga0075429_100373289
1299 Ga0068865_100009196
1300 Ga0068865_100999671
1301 Ga0075436_100826426
1302 Ga0097620_100007022
1303 Ga0097620_100029692
1304 Ga0097620_100056651
1305 Ga0097620_100057909
1306 Ga0097620_100064796
1307 Ga0097620_100072556
1308 Ga0097620_100138904
1309 Ga0097620_100143012
1310 Ga0097620_100153438
1311 Ga0097620_100174610
1312 Ga0097620_100190654
1313 Ga0097620_100234484
1314 Ga0097620_100418147
1315 Ga0097620_100644402
1316 Ga0097620_100652402
1317 Ga0097620_100715423
1318 Ga0075435_100273599
1319 Ga0099795_10068027
1320 Ga0105251_10157369
1321 Ga0105240_10042198
1322 Ga0105240_10511825
1323 Ga0111539_10004239
1324 Ga0111539_10005862
1325 Ga0111539_10228922
1326 Ga0111539_10298790
1327 Ga0111539_10450977
1328 Ga0111539_10616488
1329 Ga0111539_11189515
1330 Ga0111539_11585050
1331 Ga0105245_10031318
1332 Ga0105245_10242185
1333 Ga0105245_10413750
1334 Ga0105245_10596461
1335 Ga0105245_11237566
1336 Ga0105245_11755185
1337 Ga0105247_10000022
1338 Ga0105247_10000940
1339 Ga0105247_10167471
1340 Ga0105247_10700375
1341 Ga0105247_10735739
1342 Ga0105247_10774580
1343 Ga0105247_10927543
1344 Ga0114129_10002234
1345 Ga0114129_10014519
1346 Ga0114129_10052100
1347 Ga0114129_10163448
1348 Ga0114129_10173647
1349 Ga0114129_10457174
1350 Ga0114129_10467945
1351 Ga0114129_10734971
1352 Ga0114129_10824790
1353 Ga0114129_10846836
1354 Ga0105243_10000207
1355 Ga0105243_10010199
1356 Ga0105243_10091815
1357 Ga0105243_10162976
1358 Ga0105243_10223067
1359 Ga0105243_10302440
1360 Ga0105243_10391710
1361 Ga0105243_10456979
1362 Ga0105243_10744145
1363 Ga0105243_10831056
1364 Ga0105243_10838201
1365 Ga0105243_10918687
1366 Ga0105243_11192177
1367 Ga0105243_11534336
1368 Ga0105241_10070433
1369 Ga0105241_10072606
1370 Ga0105241_10135613
1371 Ga0105241_10258072
1372 Ga0105241_10312566
1373 Ga0105241_10981288
1374 Ga0105241_11401424
1375 Ga0105242_10001183
1376 Ga0105242_10001619
1377 Ga0105242_10005056
1378 Ga0105242_10088792
1379 Ga0105242_10330978
1380 Ga0105242_10569339
1381 Ga0105242_10665701
1382 Ga0105242_10842469
1383 Ga0105242_11049628
1384 Ga0105242_12268148
1385 Ga0105248_10002980
1386 Ga0105248_10004578
1387 Ga0105248_10039245
1388 Ga0105248_10118675
1389 Ga0105248_10123388
1390 Ga0105248_10149134
1391 Ga0105248_10155036
1392 Ga0105248_10257247
1393 Ga0105248_10663841
1394 Ga0105248_10863190
1395 Ga0105248_10885816
1396 Ga0105248_11395378
1397 Ga0105237_10000889
1398 Ga0105237_10379550
1399 Ga0105238_10014107
1400 Ga0105238_11355751
1401 Ga0105249_10000288
1402 Ga0105249_10034881
1403 Ga0105249_10041639
1404 Ga0105249_10141115
1405 Ga0105249_11095406
1406 Ga0105249_11775487
1407 Ga0105249_12275949
1408 Ga0105239_10453090
1409 Ga0105239_10893203
1410 Ga0105239_10912890
1411 Ga0105239_10938583
1412 Ga0105239_10987723
1413 Ga0105239_11073932
1414 Ga0105239_11137957
1415 Ga0105239_11262156
1416 Ga0105239_11692322
1417 Ga0105239_11848728
1418 Ga0105246_10019038
1419 Ga0105246_10250657
1420 Ga0105246_10381931
1421 Ga0105246_10440453
1422 Ga0105246_10517571
1423 Ga0157373_10003789
1424 Ga0157373_10021163
1425 Ga0157373_10086941
1426 Ga0157373_10398833
1427 Ga0157373_10642149
1428 Ga0157373_10671146
1429 Ga0157371_10455127
1430 Ga0157374_10056975
1431 Ga0157374_10262237
1432 Ga0157374_10667272
1433 Ga0157378_10000191
1434 Ga0157378_10001421
1435 Ga0157378_10002587
1436 Ga0157378_10008810
1437 Ga0157378_10047689
1438 Ga0157378_10161136
1439 Ga0157378_10172869
1440 Ga0157378_10194769
1441 Ga0157378_10257220
1442 Ga0157378_10333683
1443 Ga0157378_10386155
1444 Ga0157378_10528305
1445 Ga0157378_10714214
1446 Ga0157378_11147434
1447 Ga0163162_10000211
1448 Ga0163162_10005668
1449 Ga0163162_10010770
1450 Ga0163162_10016674
1451 Ga0163162_10045971
1452 Ga0163162_10099061
1453 Ga0163162_10124342
1454 Ga0163162_10144803
1455 Ga0163162_10186620
1456 Ga0163162_10278682
1457 Ga0163162_10739503
1458 Ga0163162_10768472
1459 Ga0163162_10875101
1460 Ga0157372_10059465
1461 Ga0157372_10060392
1462 Ga0157372_10201332
1463 Ga0157372_10231996
1464 Ga0157372_10612413
1465 Ga0157372_10736006
1466 Ga0157372_10994771
1467 Ga0157372_11039107
1468 Ga0157375_10001748
1469 Ga0157375_10066797
1470 Ga0157375_10163283
1471 Ga0157375_10207426
1472 Ga0157375_10474034
1473 Ga0157375_10491044
1474 Ga0157375_10786099
1475 Ga0163163_10000333
1476 Ga0163163_10018597
1477 Ga0163163_10024482
1478 Ga0163163_10042730
1479 Ga0163163_10043458
1480 Ga0163163_10097008
1481 Ga0163163_10109945
1482 Ga0163163_10242478
1483 Ga0163163_10324365
1484 Ga0157380_10042170
1485 Ga0157380_10055423
1486 Ga0157380_10160524
1487 Ga0157380_10227883
1488 Ga0157380_10654063
1489 Ga0157380_10701978
1490 Ga0157380_10836368
1491 Ga0157377_10085640
1492 Ga0157377_10630341
1493 Ga0157377_10721377
1494 Ga0157377_10816471
1495 Ga0157377_10855371
1496 Ga0157379_10073742
1497 Ga0157379_10096357
1498 Ga0157379_10348521
1499 Ga0157379_10519976
1500 Ga0157376_10023169
1501 Ga0157376_10107203
1502 Ga0182007_10054637
1503 Ga0182007_10061132
1504 Ga0163161_10010034
1505 Ga0207672_1000082
1506 Ga0207697_10304909
1507 Ga0207653_10001183
1508 Ga0207682_10230328
1509 Ga0207642_10002875
1510 Ga0207642_10270717
1511 Ga0207710_10000001
1512 Ga0207710_10001369
1513 Ga0207688_10183662
1514 Ga0207688_10350157
1515 Ga0207680_10014597
1516 Ga0207680_10335499
1517 Ga0207647_10032362
1518 Ga0207647_10216121
1519 Ga0207647_10375782
1520 Ga0207685_10000068
1521 Ga0207645_10015459
1522 Ga0207645_10507856
1523 Ga0207645_10756428
1524 Ga0207643_10001673
1525 Ga0207643_10036446
1526 Ga0207643_10072726
1527 Ga0207643_10348556
1528 Ga0207684_10000065
1529 Ga0207684_10004172
1530 Ga0207684_10016010
1531 Ga0207684_10016926
1532 Ga0207684_10021254
1533 Ga0207684_10639136
1534 Ga0207654_10163842
1535 Ga0207654_10450288
1536 Ga0207654_10612011
1537 Ga0207707_10000028
1538 Ga0207695_10053394
1539 Ga0207695_11135198
1540 Ga0207671_10005350
1541 Ga0207671_10990312
1542 Ga0207660_10006116
1543 Ga0207660_10097002
1544 Ga0207662_10008108
1545 Ga0207662_10017704
1546 Ga0207662_10266882
1547 Ga0207662_10303790
1548 Ga0207662_10378475
1549 Ga0207662_10412845
1550 Ga0207657_10052099
1551 Ga0207657_10763337
1552 Ga0207649_10126714
1553 Ga0207652_10000443
1554 Ga0207646_10004429
1555 Ga0207646_10032101
1556 Ga0207646_10096152
1557 Ga0207646_10203510
1558 Ga0207646_10241438
1559 Ga0207681_10000729
1560 Ga0207681_10011656
1561 Ga0207681_10020953
1562 Ga0207681_10028279
1563 Ga0207681_10028782
1564 Ga0207694_10007517
1565 Ga0207650_10000046
1566 Ga0207650_10014146
1567 Ga0207650_10181222
1568 Ga0207650_10396794
1569 Ga0207650_10437782
1570 Ga0207650_10597055
1571 Ga0207650_10995197
1572 Ga0207659_10525991
1573 Ga0207687_10024975
1574 Ga0207687_10443041
1575 Ga0207687_10784073
1576 Ga0207644_10014406
1577 Ga0207644_10106793
1578 Ga0207644_10580006
1579 Ga0207690_10055370
1580 Ga0207690_10099174
1581 Ga0207690_10252634
1582 Ga0207690_10566082
1583 Ga0207706_10333437
1584 Ga0207706_10375695
1585 Ga0207686_10000373
1586 Ga0207686_10000820
1587 Ga0207686_10022755
1588 Ga0207686_10033605
1589 Ga0207686_10410519
1590 Ga0207709_10001161
1591 Ga0207709_10060464
1592 Ga0207709_10452618
1593 Ga0207709_10558923
1594 Ga0207709_10756594
1595 Ga0207709_11163975
1596 Ga0207709_11325148
1597 Ga0207670_10000322
1598 Ga0207670_10436201
1599 Ga0207704_10090158
1600 Ga0207704_10192385
1601 Ga0207665_10000083
1602 Ga0207665_10320094
1603 Ga0207691_10001701
1604 Ga0207691_10262998
1605 Ga0207691_10549452
1606 Ga0207711_10001639
1607 Ga0207711_10011584
1608 Ga0207711_10219007
1609 Ga0207711_10326908
1610 Ga0207711_10347452
1611 Ga0207711_10584634
1612 Ga0207711_10636261
1613 Ga0207711_10898993
1614 Ga0207689_10003706
1615 Ga0207689_10009911
1616 Ga0207689_10149654
1617 Ga0207689_10194291
1618 Ga0207689_10324396
1619 Ga0207689_10364970
1620 Ga0207689_10508557
1621 Ga0207689_10537246
1622 Ga0207689_10921038
1623 Ga0207689_10932151
1624 Ga0207679_10200205
1625 Ga0207679_10321396
1626 Ga0207679_10493169
1627 Ga0207679_10545689
1628 Ga0207667_10314303
1629 Ga0207651_10059446
1630 Ga0207651_10168667
1631 Ga0207651_10369336
1632 Ga0207651_10394115
1633 Ga0207712_10000180
1634 Ga0207712_10583253
1635 Ga0207668_10014786
1636 Ga0207668_10454649
1637 Ga0207640_10704588
1638 Ga0207640_11241784
1639 Ga0207658_10111351
1640 Ga0207658_11079439
1641 Ga0207677_10036820
1642 Ga0207677_10048529
1643 Ga0207677_10132243
1644 Ga0207677_10662553
1645 Ga0207703_10000481
1646 Ga0207703_10010674
1647 Ga0207703_10165221
1648 Ga0207703_10331982
1649 Ga0207703_10407325
1650 Ga0207703_10572733
1651 Ga0207703_10613174
1652 Ga0207703_11291904
1653 Ga0207703_11315093
1654 Ga0207639_10052991
1655 Ga0207639_10287674
1656 Ga0207639_11174308
1657 Ga0207708_10000133
1658 Ga0207708_10035005
1659 Ga0207708_10036570
1660 Ga0207708_10077768
1661 Ga0207708_10129725
1662 Ga0207708_10270771
1663 Ga0207708_10422029
1664 Ga0207708_10689833
1665 Ga0207708_11299541
1666 Ga0207641_10053414
1667 Ga0207641_10075378
1668 Ga0207641_10102462
1669 Ga0207641_10114554
1670 Ga0207641_10174723
1671 Ga0207641_10301670
1672 Ga0207641_10430609
1673 Ga0207641_10706624
1674 Ga0207648_10056273
1675 Ga0207648_10097769
1676 Ga0207648_10106665
1677 Ga0207648_10401820
1678 Ga0207648_10590659
1679 Ga0207648_10897474
1680 Ga0207676_10018008
1681 Ga0207676_10031122
1682 Ga0207676_10084507
1683 Ga0207676_10131523
1684 Ga0207676_10179898
1685 Ga0207676_10337215
1686 Ga0207676_10535047
1687 Ga0207676_11025189
1688 Ga0207676_11496683
1689 Ga0207674_10002025
1690 Ga0207674_10039964
1691 Ga0207674_10042739
1692 Ga0207674_10504676
1693 Ga0207674_10621492
1694 Ga0207674_10730423
1695 Ga0207674_11243734
1696 Ga0207674_11280623
1697 Ga0207675_100006381
1698 Ga0207675_100008376
1699 Ga0207675_100052371
1700 Ga0207675_100092374
1701 Ga0207675_100525524
1702 Ga0207683_10066395
1703 Ga0207683_10460550
1704 Ga0207683_11056806
1705 Ga0207698_10288633
1706 Ga0207698_10410961
1707 Ga0207698_10971198
1708 Ga0207428_10061421
1709 Ga0207428_10062946
1710 Ga0207428_10082670
1711 Ga0268266_11207440
1712 Ga0268265_10190613
1713 Ga0268265_10251467
1714 Ga0268265_10636575
1715 Ga0268265_11036422
1716 Ga0268264_10149136
1717 Ga0268264_10196598
1718 Ga0268264_10200058
1719 Ga0268264_10284478
1720 Ga0268264_10366323
1721 Ga0268264_10483580
1722 Ga0268264_10743732
1723 Ga0268264_11327601
1724 Ga0268264_11424692
1725 Ga0307408_100741992
1726 Ga0307405_10001250
1727 Ga0307405_10595661
1728 Ga0307413_10162438
1729 Ga0307413_10169920
1730 Ga0307410_10000784
1731 Ga0307410_10423130
1732 Ga0307406_10019764
1733 Ga0307407_10090076
1734 Ga0307412_10086616
1735 Ga0307412_10208802
1736 Ga0307409_100090538
1737 Ga0307416_100007007
1738 Ga0307416_100050841
1739 Ga0307416_100195986
1740 Ga0307416_100703092
1741 Ga0307416_100803576
1742 Ga0307416_100866137
1743 Ga0307416_100936390
1744 Ga0307416_102527026
1745 Ga0307414_10267859
1746 Ga0307414_10351944
1747 Ga0307414_10946434
1748 Ga0307411_10071544
1749 Ga0307411_10101533
1750 Ga0307411_10614482
1751 Ga0307415_100001321
1752 Ga0307415_100189808
1753 Ga0373930_0093832
1754 Ga0373940_0042346
1755 Ga0373949_0007134
1756 Ga0373951_0005735
1757 Ga0373951_0183267
1758 Ga0373939_0179581
1759 Ga0373961_0069440
1760 Ga0373937_1104487
1761 Ga0395900_0097549
1762 Ga0395900_0696470
1763 Ga0395898_0054223
1764 Ga0395898_0470602
1765 Ga0395905_0370806
1766 Ga0395901_0188839
1767 Ga0242420_027007
1768 Ga0242420_069892
1769 Ga0436365_0789093
1770 Ga0450892_019785
1771 Ga0439458_0020070
1772 Ga0451576_0301272
1773 Ga0451576_0394580
1774 Ga0495580_0417439
1775 Ga0495632_0080157
1776 Ga0495663_0000891
1777 Ga0495640_0356745
1778 Ga0495598_0000764
1779 Ga0495621_0000016
1780 Ga0495621_0024488
1781 Ga0495668_0081774
1782 Ga0495668_0346155
1783 Ga0495658_0073232
1784 Ga0495636_0021587
1785 Ga0495684_0185145
1786 Ga0496103_0597868
1787 Ga0496104_0729866
1788 Ga0496104_0905451
1789 Ga0496106_0020516
1790 Ga0496106_0026558
1791 Ga0496106_0352608
1792 Ga0496108_0037751
1793 Ga0496108_0268904
1794 Ga0496112_1185164
1795 Ga0496113_0174346
1796 Ga0496113_1201362
1797 Ga0501292_001073
1798 Ga0501292_004416
1799 Ga0501292_028406
1800 Ga0501296_005275
1801 Ga0501297_010981
1802 Ga0501298_000849
1803 Ga0501298_009255
1804 Ga0501298_030331
1805 Ga0501299_013322
1806 Ga0501300_041500
1807 Ga0501031_0159623
1808 Ga0501036_0586925
1809 Ga0501038_0022901
1810 Ga0501040_0275485
1811 Ga0501072_0545758
1812 Ga0501076_0443467
1813 Ga0501198_039968
1814 Ga0501202_016901
1815 Ga0501202_081653
1816 Ga0501206_013972
1817 Ga0501207_008814
1818 Ga0501207_046199
1819 Ga0501216_001003
1820 Ga0501216_084908
1821 Ga0501217_000261
1822 Ga0501217_021013
1823 Ga0501223_003502
1824 Ga0501223_014933
1825 Ga0501223_032948
1826 Ga0501223_067293
1827 Ga0501224_029550
1828 Ga0501224_034572
1829 Ga0501227_000224
1830 Ga0501227_097147
1831 Ga0501227_105908
1832 Ga0501233_001991
1833 Ga0501233_013694
1834 Ga0501233_033821
1835 Ga0501235_000213
1836 Ga0501235_003502
1837 Ga0501235_017358
1838 Ga0501235_022659
1839 Ga0501239_034779
1840 Ga0501242_033125
1841 Ga0501243_001571
1842 Ga0501243_022556
1843 Ga0501247_055830
1844 Ga0501249_090057
1845 Ga0501253_022770
1846 Ga0501253_045134
1847 Ga0501257_096602
1848 Ga0501257_121279
1849 Ga0501259_024714
1850 Ga0501259_065102
1851 Ga0501260_020581
1852 Ga0501261_004827
1853 Ga0501219_012714
1854 Ga0501221_021808
1855 Ga0501221_036300
1856 Ga0501221_065347
1857 Ga0501225_0117117
1858 Ga0501225_0139918
1859 Ga0501234_004415
1860 Ga0501079_0174402
1861 Ga0501241_033376
1862 Ga0501266_006017
1863 Ga0501268_010129
1864 Ga0501272_016181
1865 Ga0501273_008737
1866 Ga0501273_016122
1867 Ga0501279_007853
1868 Ga0501283_000552
1869 Ga0501283_012075
1870 Ga0501283_062179
1871 Ga0501212_006202
1872 Ga0501212_032467
1873 Ga0501212_039129
1874 Ga0501226_000157
1875 nmdc:mga05p37_1115641_c1
1876 nmdc:mga05p37_1166994_c1
1877 nmdc:mga05p37_174771_c1
1878 nmdc:mga05p37_386829_c1
1879 nmdc:mga05p37_423591_c1
1880 nmdc:mga05p37_452769_c1
1881 nmdc:mga05p37_544429_c1
1882 nmdc:mga05p37_608002_c1
1883 nmdc:mga05p37_677906_c1
1884 nmdc:mga05p37_772228_c1
1885 nmdc:mga05p37_841088_c1
1886 nmdc:mga05p37_91917_c1
1887 nmdc:mga09592_107233_c1
1888 nmdc:mga09592_1135009_c1
1889 nmdc:mga09592_285496_c1
1890 nmdc:mga0qj67_234185_c1
1891 nmdc:mga0qj67_56399_c1
1892 nmdc:mga06r32_225788_c1
1893 nmdc:mga06r32_283216_c1
1894 nmdc:mga06r32_375996_c1
1895 nmdc:mga06r32_428987_c1
1896 nmdc:mga08y16_1172535_c1
1897 nmdc:mga08y16_148128_c1
1898 nmdc:mga08y16_245832_c1
1899 nmdc:mga08y16_501711_c1
1900 nmdc:mga08y16_8295_c1
1901 nmdc:mga0n895_151046_c1
1902 nmdc:mga0n895_154749_c1
1903 nmdc:mga0n895_315174_c1
1904 nmdc:mga0n895_547011_c1
1905 nmdc:mga0n895_642562_c1
1906 nmdc:mga0n895_727295_c1
1907 nmdc:mga0rr50_1253427_c1
1908 nmdc:mga0a205_1033380_c1
1909 nmdc:mga0a205_12842_c1
1910 nmdc:mga0a205_133596_c1
1911 nmdc:mga0a205_338121_c1
1912 nmdc:mga0a205_416548_c1
1913 nmdc:mga0a205_584393_c1
1914 Ga0501084_0953280

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7udi-assembly1.cif.gz_B full-length dimer of dna-damage response protein c from deinococcus radiodurans 0.6835 99 147
6qm9-assembly1.cif.gz_B cryo-em structure of calcium-bound nhtmem16 lipid scramblase in nanodisc (open state) 0.6661 94 139
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.6456 2 142
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.5927 2 142
7kaq-assembly1.cif.gz_A cryo-em structure of the sec complex from s. cerevisiae, sec61 pore mutant, class with sec62, conformation 2 (c2) 0.5683 78 142
ID Description Score Start End Superfamily
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.5503 1 152 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.5404 3 140 3.40.390.30
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.5361 9 129 3.30.2010.20
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.5251 3 140 3.40.390.30
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.5214 9 129 3.30.2010.20
ID Description Score Start End GO Terms
AF-A0A7Y2GHS4-F1-model_v4 Uncharacterized protein 0.8296 3 172
AF-A0A0B6WXB6-F1-model_v4 Uncharacterized protein 0.8151 2 180
AF-A0A2V8S589-F1-model_v4 Transposase IS200-like domain-containing protein 0.8124 25 178
AF-M1YJ30-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.8115 3 167
AF-A0A7Y4UEC0-F1-model_v4 Uncharacterized protein 0.807 1 179

Map