F486758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 957 | 286 | 1914 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100225153|Ga0070680_1002251532 |
| Length | 220 |
| Sequence | LSCLTLAQLDAALWFPLHYGTPSSTVIHSGFQRDLLIVAIKIENQVDRKLPADTIAQIEDAFDNLPREHTRGIERIRLVEFISDPRLKGIPQASELPGLYHPRQGPKGSWLEVAIGVLLPSNKPIHKRIVPRMSFKGNLAAIIFSLVGQHYHLTLRHSLKKTQLEPAVRLYTEKQLKAWNEKKHTFRARLFKPIQPTLERWAKGLQKRAAAEKKKSAATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 213 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 232 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 234 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 235 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 236 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 244 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 245 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 246 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 247 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 248 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 249 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 256 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 257 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 258 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 260 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 265 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 266 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 270 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 271 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 274 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 276 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 277 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.15 |
| Rhizosphere | 98.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100225153 | 3300005336 | Bacteria | 1583 |
| 2 | MRS1b_contig_6674846 | 2162886011 | Bacteria | 873 |
| 3 | MBSR1b_contig_11571009 | 2162886012 | Bacteria | 1207 |
| 4 | CNAas_1000869 | 3300000532 | Bacteria | 2847 |
| 5 | JGI24748J21848_1000003 | 3300002074 | Bacteria | 323921 |
| 6 | JGI24034J26672_10000005 | 3300002239 | Bacteria | 404185 |
| 7 | JGI24751J29686_10000033 | 3300002459 | Bacteria | 87652 |
| 8 | JGI25406J46586_10008071 | 3300003203 | Bacteria | 4779 |
| 9 | rootH2_10229866 | 3300003320 | Bacteria | 1115 |
| 10 | rootL2_10158938 | 3300003322 | Unclassified | 1421 |
| 11 | rootH1_10265298 | 3300003323 | Bacteria | 1192 |
| 12 | Ga0065714_10064444 | 3300005288 | Bacteria | 94227 |
| 13 | Ga0065704_10021175 | 3300005289 | Unclassified | 1776 |
| 14 | Ga0065712_10006950 | 3300005290 | Bacteria | 6750 |
| 15 | Ga0065712_10067736 | 3300005290 | Bacteria | 94196 |
| 16 | Ga0065712_10256067 | 3300005290 | Bacteria | 948 |
| 17 | Ga0065715_10008808 | 3300005293 | Bacteria | 2831 |
| 18 | Ga0065715_10024859 | 3300005293 | Bacteria | 1550 |
| 19 | Ga0065715_10030092 | 3300005293 | Bacteria | 1415 |
| 20 | Ga0065715_10033645 | 3300005293 | Bacteria | 1222 |
| 21 | Ga0065715_10045465 | 3300005293 | Bacteria | 1097 |
| 22 | Ga0065715_10090002 | 3300005293 | Bacteria | 7905 |
| 23 | Ga0065715_10091138 | 3300005293 | Bacteria | 6074 |
| 24 | Ga0065715_10094034 | 3300005293 | Bacteria | 4464 |
| 25 | Ga0065715_10127997 | 3300005293 | Bacteria | 2075 |
| 26 | Ga0065715_10148342 | 3300005293 | Bacteria | 1758 |
| 27 | Ga0065707_10001442 | 3300005295 | Bacteria | 10003 |
| 28 | Ga0065707_10172728 | 3300005295 | Bacteria | 1473 |
| 29 | Ga0065707_10230806 | 3300005295 | Bacteria | 1189 |
| 30 | Ga0065707_10481442 | 3300005295 | Bacteria | 746 |
| 31 | Ga0065707_10608064 | 3300005295 | Bacteria | 625 |
| 32 | Ga0070676_10032215 | 3300005328 | Bacteria | 3002 |
| 33 | Ga0070690_100000817 | 3300005330 | Bacteria | 15787 |
| 34 | Ga0070690_100048410 | 3300005330 | Bacteria | 2707 |
| 35 | Ga0070690_100102003 | 3300005330 | Bacteria | 1904 |
| 36 | Ga0070690_100790248 | 3300005330 | Unclassified | 735 |
| 37 | Ga0070670_100000142 | 3300005331 | Bacteria | 67444 |
| 38 | Ga0070670_100006153 | 3300005331 | Bacteria | 10144 |
| 39 | Ga0070670_100098739 | 3300005331 | Bacteria | 2513 |
| 40 | Ga0070670_100278421 | 3300005331 | Unclassified | 1461 |
| 41 | Ga0070670_100288918 | 3300005331 | Unclassified | 1433 |
| 42 | Ga0070670_100445333 | 3300005331 | Unclassified | 1147 |
| 43 | Ga0070670_101172313 | 3300005331 | Unclassified | 702 |
| 44 | Ga0070670_101540431 | 3300005331 | Unclassified | 611 |
| 45 | Ga0070677_10545481 | 3300005333 | Archaea | 635 |
| 46 | Ga0068869_100005669 | 3300005334 | Bacteria | 7872 |
| 47 | Ga0068869_100069452 | 3300005334 | Bacteria | 2605 |
| 48 | Ga0068869_100070101 | 3300005334 | Bacteria | 2593 |
| 49 | Ga0068869_100426129 | 3300005334 | Unclassified | 1095 |
| 50 | Ga0068869_100504041 | 3300005334 | Unclassified | 1011 |
| 51 | Ga0068869_100536642 | 3300005334 | Bacteria | 981 |
| 52 | Ga0068869_100950054 | 3300005334 | Bacteria | 746 |
| 53 | Ga0068869_101139463 | 3300005334 | Unclassified | 684 |
| 54 | Ga0070680_100002408 | 3300005336 | Bacteria | 13849 |
| 55 | Ga0070680_100137513 | 3300005336 | Bacteria | 2047 |
| 56 | Ga0070680_100206144 | 3300005336 | Bacteria | 1658 |
| 57 | Ga0070680_100679737 | 3300005336 | Unclassified | 885 |
| 58 | Ga0070682_100013810 | 3300005337 | Bacteria | 4656 |
| 59 | Ga0068868_100013176 | 3300005338 | Bacteria | 6057 |
| 60 | Ga0068868_100020616 | 3300005338 | Bacteria | 4956 |
| 61 | Ga0068868_100180272 | 3300005338 | Bacteria | 1752 |
| 62 | Ga0068868_100908261 | 3300005338 | Unclassified | 801 |
| 63 | Ga0070660_100015879 | 3300005339 | Bacteria | 5451 |
| 64 | Ga0070660_100550635 | 3300005339 | Unclassified | 962 |
| 65 | Ga0070689_100002620 | 3300005340 | Bacteria | 11783 |
| 66 | Ga0070689_100048941 | 3300005340 | Bacteria | 3261 |
| 67 | Ga0070689_100290801 | 3300005340 | Unclassified | 1358 |
| 68 | Ga0070689_100570502 | 3300005340 | Unclassified | 977 |
| 69 | Ga0070687_100006624 | 3300005343 | Bacteria | 4760 |
| 70 | Ga0070687_100189549 | 3300005343 | Bacteria | 1238 |
| 71 | Ga0070687_100402979 | 3300005343 | Unclassified | 897 |
| 72 | Ga0070687_100467735 | 3300005343 | Bacteria | 842 |
| 73 | Ga0070687_100565354 | 3300005343 | Bacteria | 776 |
| 74 | Ga0070661_100077563 | 3300005344 | Bacteria | 2450 |
| 75 | Ga0070692_10012645 | 3300005345 | Bacteria | 3915 |
| 76 | Ga0070692_10082600 | 3300005345 | Bacteria | 1733 |
| 77 | Ga0070692_10185877 | 3300005345 | Bacteria | 1207 |
| 78 | Ga0070692_10342116 | 3300005345 | Bacteria | 927 |
| 79 | Ga0070668_100004093 | 3300005347 | Bacteria | 10800 |
| 80 | Ga0070669_100008291 | 3300005353 | Bacteria | 7420 |
| 81 | Ga0070669_100044896 | 3300005353 | Bacteria | 3219 |
| 82 | Ga0070669_100120373 | 3300005353 | Bacteria | 2002 |
| 83 | Ga0070669_100373727 | 3300005353 | Bacteria | 1161 |
| 84 | Ga0070675_100638237 | 3300005354 | Unclassified | 967 |
| 85 | Ga0070671_100001580 | 3300005355 | Bacteria | 17138 |
| 86 | Ga0070671_100332284 | 3300005355 | Bacteria | 1296 |
| 87 | Ga0070674_100030870 | 3300005356 | Bacteria | 3545 |
| 88 | Ga0070673_100011790 | 3300005364 | Bacteria | 5980 |
| 89 | Ga0070673_100023045 | 3300005364 | Bacteria | 4544 |
| 90 | Ga0070673_100231029 | 3300005364 | Bacteria | 1604 |
| 91 | Ga0070673_100680203 | 3300005364 | Unclassified | 944 |
| 92 | Ga0070673_100711311 | 3300005364 | Unclassified | 923 |
| 93 | Ga0070673_101507361 | 3300005364 | Unclassified | 634 |
| 94 | Ga0070688_100007597 | 3300005365 | Bacteria | 5852 |
| 95 | Ga0070659_100024585 | 3300005366 | Bacteria | 4618 |
| 96 | Ga0070659_100120922 | 3300005366 | Bacteria | 2121 |
| 97 | Ga0070659_100153750 | 3300005366 | Bacteria | 1878 |
| 98 | Ga0070659_100627880 | 3300005366 | Bacteria | 925 |
| 99 | Ga0070659_100667689 | 3300005366 | Archaea | 897 |
| 100 | Ga0070667_100926728 | 3300005367 | Unclassified | 811 |
| 101 | Ga0070703_10003365 | 3300005406 | Bacteria | 4561 |
| 102 | Ga0070703_10216295 | 3300005406 | Unclassified | 760 |
| 103 | Ga0070709_10285382 | 3300005434 | Bacteria | 1201 |
| 104 | Ga0070701_10007401 | 3300005438 | Bacteria | 4689 |
| 105 | Ga0070701_10101335 | 3300005438 | Bacteria | 1595 |
| 106 | Ga0070701_10141777 | 3300005438 | Bacteria | 1375 |
| 107 | Ga0070701_10283973 | 3300005438 | Bacteria | 1012 |
| 108 | Ga0070701_10354342 | 3300005438 | Bacteria | 918 |
| 109 | Ga0070705_100006983 | 3300005440 | Bacteria | 5552 |
| 110 | Ga0070705_100063402 | 3300005440 | Bacteria | 2204 |
| 111 | Ga0070705_100329168 | 3300005440 | Bacteria | 1106 |
| 112 | Ga0070700_100000238 | 3300005441 | Bacteria | 30146 |
| 113 | Ga0070700_100019390 | 3300005441 | Bacteria | 3925 |
| 114 | Ga0070700_100042126 | 3300005441 | Bacteria | 2802 |
| 115 | Ga0070700_100098352 | 3300005441 | Bacteria | 1924 |
| 116 | Ga0070700_100221783 | 3300005441 | Unclassified | 1340 |
| 117 | Ga0070700_100402341 | 3300005441 | Bacteria | 1030 |
| 118 | Ga0070700_100429957 | 3300005441 | Bacteria | 1000 |
| 119 | Ga0070694_100006926 | 3300005444 | Bacteria | 6891 |
| 120 | Ga0070694_100007458 | 3300005444 | Bacteria | 6667 |
| 121 | Ga0070694_100009509 | 3300005444 | Bacteria | 5963 |
| 122 | Ga0070694_100015795 | 3300005444 | Bacteria | 4749 |
| 123 | Ga0070694_100071355 | 3300005444 | Bacteria | 2394 |
| 124 | Ga0070694_100150586 | 3300005444 | Bacteria | 1699 |
| 125 | Ga0070694_100190266 | 3300005444 | Unclassified | 1524 |
| 126 | Ga0070694_100355039 | 3300005444 | Bacteria | 1137 |
| 127 | Ga0070694_100601205 | 3300005444 | Bacteria | 886 |
| 128 | Ga0070694_100822816 | 3300005444 | Unclassified | 763 |
| 129 | Ga0070708_100322306 | 3300005445 | Unclassified | 1456 |
| 130 | Ga0070678_100060217 | 3300005456 | Bacteria | 2794 |
| 131 | Ga0070678_100932032 | 3300005456 | Bacteria | 795 |
| 132 | Ga0070662_100094683 | 3300005457 | Bacteria | 2249 |
| 133 | Ga0070662_100517224 | 3300005457 | Bacteria | 997 |
| 134 | Ga0070662_100575907 | 3300005457 | Bacteria | 945 |
| 135 | Ga0070681_10000100 | 3300005458 | Bacteria | 63828 |
| 136 | Ga0070681_10000986 | 3300005458 | Bacteria | 24077 |
| 137 | Ga0070681_10041236 | 3300005458 | Bacteria | 4625 |
| 138 | Ga0070681_10417810 | 3300005458 | Bacteria | 1253 |
| 139 | Ga0068867_100024849 | 3300005459 | Bacteria | 4295 |
| 140 | Ga0068867_100068727 | 3300005459 | Bacteria | 2644 |
| 141 | Ga0068867_100155585 | 3300005459 | Bacteria | 1799 |
| 142 | Ga0068867_100276751 | 3300005459 | Bacteria | 1375 |
| 143 | Ga0068867_100343735 | 3300005459 | Bacteria | 1243 |
| 144 | Ga0070685_10380277 | 3300005466 | Archaea | 973 |
| 145 | Ga0070706_100000002 | 3300005467 | Bacteria | 326510 |
| 146 | Ga0070706_100180334 | 3300005467 | Bacteria | 1972 |
| 147 | Ga0070706_100258172 | 3300005467 | Bacteria | 1627 |
| 148 | Ga0070706_100639305 | 3300005467 | Bacteria | 988 |
| 149 | Ga0070706_100649343 | 3300005467 | Unclassified | 980 |
| 150 | Ga0070707_100000562 | 3300005468 | Bacteria | 37302 |
| 151 | Ga0070707_100008628 | 3300005468 | Bacteria | 9460 |
| 152 | Ga0070707_100050836 | 3300005468 | Bacteria | 3973 |
| 153 | Ga0070707_100239229 | 3300005468 | Bacteria | 1767 |
| 154 | Ga0070698_100009059 | 3300005471 | Bacteria | 10700 |
| 155 | Ga0070698_100020732 | 3300005471 | Bacteria | 6890 |
| 156 | Ga0070698_100034361 | 3300005471 | Bacteria | 5248 |
| 157 | Ga0070698_100063342 | 3300005471 | Bacteria | 3729 |
| 158 | Ga0070698_100066837 | 3300005471 | Bacteria | 3616 |
| 159 | Ga0070698_100588687 | 3300005471 | Bacteria | 1052 |
| 160 | Ga0070698_100753880 | 3300005471 | Bacteria | 917 |
| 161 | Ga0070699_100000980 | 3300005518 | Bacteria | 26618 |
| 162 | Ga0070699_100004102 | 3300005518 | Bacteria | 12872 |
| 163 | Ga0070699_100038390 | 3300005518 | Plasmid | 4147 |
| 164 | Ga0070699_100162285 | 3300005518 | Unclassified | 1978 |
| 165 | Ga0070699_100345571 | 3300005518 | Bacteria | 1339 |
| 166 | Ga0070699_101258131 | 3300005518 | Bacteria | 679 |
| 167 | Ga0070679_100000819 | 3300005530 | Bacteria | 26989 |
| 168 | Ga0070679_101508047 | 3300005530 | Unclassified | 619 |
| 169 | Ga0070684_100355930 | 3300005535 | Bacteria | 1347 |
| 170 | Ga0070697_100000184 | 3300005536 | Bacteria | 51536 |
| 171 | Ga0070697_100000379 | 3300005536 | Bacteria | 34815 |
| 172 | Ga0070697_100144047 | 3300005536 | Bacteria | 2005 |
| 173 | Ga0070697_100207412 | 3300005536 | Bacteria | 1667 |
| 174 | Ga0070697_100339563 | 3300005536 | Bacteria | 1296 |
| 175 | Ga0070697_100399308 | 3300005536 | Bacteria | 1193 |
| 176 | Ga0070697_100554251 | 3300005536 | Bacteria | 1008 |
| 177 | Ga0070697_100786123 | 3300005536 | Unclassified | 842 |
| 178 | Ga0070697_101069703 | 3300005536 | Unclassified | 718 |
| 179 | Ga0068853_100063797 | 3300005539 | Bacteria | 3191 |
| 180 | Ga0068853_100129052 | 3300005539 | Bacteria | 2261 |
| 181 | Ga0068853_100340318 | 3300005539 | Bacteria | 1394 |
| 182 | Ga0068853_100589858 | 3300005539 | Bacteria | 1055 |
| 183 | Ga0070672_100123700 | 3300005543 | Bacteria | 2120 |
| 184 | Ga0070672_100125200 | 3300005543 | Bacteria | 2107 |
| 185 | Ga0070672_100260208 | 3300005543 | Bacteria | 1463 |
| 186 | Ga0070672_100274167 | 3300005543 | Bacteria | 1425 |
| 187 | Ga0070672_101300969 | 3300005543 | Bacteria | 649 |
| 188 | Ga0070686_100012452 | 3300005544 | Bacteria | 4847 |
| 189 | Ga0070686_100031759 | 3300005544 | Bacteria | 3232 |
| 190 | Ga0070686_100076856 | 3300005544 | Bacteria | 2200 |
| 191 | Ga0070695_100040072 | 3300005545 | Bacteria | 2964 |
| 192 | Ga0070695_100048497 | 3300005545 | Bacteria | 2716 |
| 193 | Ga0070695_100104550 | 3300005545 | Bacteria | 1912 |
| 194 | Ga0070695_100118768 | 3300005545 | Bacteria | 1806 |
| 195 | Ga0070695_100133237 | 3300005545 | Bacteria | 1715 |
| 196 | Ga0070695_100157837 | 3300005545 | Unclassified | 1589 |
| 197 | Ga0070695_100157840 | 3300005545 | Bacteria | 1589 |
| 198 | Ga0070695_100202780 | 3300005545 | Bacteria | 1418 |
| 199 | Ga0070695_100475659 | 3300005545 | Unclassified | 962 |
| 200 | Ga0070695_100516735 | 3300005545 | Unclassified | 926 |
| 201 | Ga0070695_100568060 | 3300005545 | Unclassified | 886 |
| 202 | Ga0070695_101009985 | 3300005545 | Unclassified | 677 |
| 203 | Ga0070696_100031372 | 3300005546 | Bacteria | 3641 |
| 204 | Ga0070696_100122084 | 3300005546 | Bacteria | 1886 |
| 205 | Ga0070696_100192872 | 3300005546 | Bacteria | 1517 |
| 206 | Ga0070696_100238124 | 3300005546 | Unclassified | 1371 |
| 207 | Ga0070696_100300846 | 3300005546 | Bacteria | 1229 |
| 208 | Ga0070696_100329018 | 3300005546 | Bacteria | 1178 |
| 209 | Ga0070696_100485247 | 3300005546 | Unclassified | 981 |
| 210 | Ga0070696_100651788 | 3300005546 | Unclassified | 854 |
| 211 | Ga0070693_100080251 | 3300005547 | Bacteria | 1943 |
| 212 | Ga0070693_100127427 | 3300005547 | Unclassified | 1587 |
| 213 | Ga0070693_100174432 | 3300005547 | Bacteria | 1379 |
| 214 | Ga0070693_100182162 | 3300005547 | Bacteria | 1353 |
| 215 | Ga0070693_100324355 | 3300005547 | Bacteria | 1046 |
| 216 | Ga0070665_101038882 | 3300005548 | Unclassified | 831 |
| 217 | Ga0070704_100010701 | 3300005549 | Bacteria | 5587 |
| 218 | Ga0070704_100010965 | 3300005549 | Bacteria | 5528 |
| 219 | Ga0070704_100105652 | 3300005549 | Bacteria | 2132 |
| 220 | Ga0070704_100124189 | 3300005549 | Bacteria | 1988 |
| 221 | Ga0070704_100177607 | 3300005549 | Unclassified | 1700 |
| 222 | Ga0070704_100189743 | 3300005549 | Bacteria | 1651 |
| 223 | Ga0070704_100224723 | 3300005549 | Bacteria | 1528 |
| 224 | Ga0070704_100231390 | 3300005549 | Bacteria | 1508 |
| 225 | Ga0070704_100313692 | 3300005549 | Bacteria | 1311 |
| 226 | Ga0070704_100489016 | 3300005549 | Bacteria | 1066 |
| 227 | Ga0070704_100835761 | 3300005549 | Unclassified | 825 |
| 228 | Ga0070664_100011274 | 3300005564 | Bacteria | 7250 |
| 229 | Ga0068857_100019415 | 3300005577 | Bacteria | 5967 |
| 230 | Ga0068857_100187430 | 3300005577 | Bacteria | 1884 |
| 231 | Ga0068857_100614994 | 3300005577 | Bacteria | 1028 |
| 232 | Ga0068857_100680346 | 3300005577 | Unclassified | 976 |
| 233 | Ga0068857_100801424 | 3300005577 | Unclassified | 899 |
| 234 | Ga0068854_100024594 | 3300005578 | Bacteria | 4126 |
| 235 | Ga0068854_100076809 | 3300005578 | Bacteria | 2456 |
| 236 | Ga0068854_100271691 | 3300005578 | Bacteria | 1361 |
| 237 | Ga0068854_100344096 | 3300005578 | Bacteria | 1219 |
| 238 | Ga0068854_100358589 | 3300005578 | Unclassified | 1195 |
| 239 | Ga0068854_100800128 | 3300005578 | Unclassified | 822 |
| 240 | Ga0068856_100974276 | 3300005614 | Unclassified | 866 |
| 241 | Ga0070702_100018094 | 3300005615 | Bacteria | 3648 |
| 242 | Ga0070702_100025366 | 3300005615 | Bacteria | 3176 |
| 243 | Ga0070702_100032786 | 3300005615 | Bacteria | 2852 |
| 244 | Ga0070702_100048390 | 3300005615 | Unclassified | 2420 |
| 245 | Ga0070702_100172311 | 3300005615 | Bacteria | 1409 |
| 246 | Ga0070702_100179893 | 3300005615 | Unclassified | 1383 |
| 247 | Ga0070702_100238574 | 3300005615 | Bacteria | 1226 |
| 248 | Ga0068852_100247212 | 3300005616 | Bacteria | 1707 |
| 249 | Ga0068852_100498669 | 3300005616 | Bacteria | 1212 |
| 250 | Ga0068859_100007022 | 3300005617 | Bacteria | 11432 |
| 251 | Ga0068859_100029694 | 3300005617 | Bacteria | 5486 |
| 252 | Ga0068859_100056650 | 3300005617 | Bacteria | 3946 |
| 253 | Ga0068859_100057911 | 3300005617 | Bacteria | 3903 |
| 254 | Ga0068859_100064797 | 3300005617 | Bacteria | 3687 |
| 255 | Ga0068859_100072553 | 3300005617 | Bacteria | 3479 |
| 256 | Ga0068859_100138905 | 3300005617 | Bacteria | 2503 |
| 257 | Ga0068859_100143008 | 3300005617 | Bacteria | 2466 |
| 258 | Ga0068859_100153435 | 3300005617 | Bacteria | 2379 |
| 259 | Ga0068859_100174596 | 3300005617 | Bacteria | 2231 |
| 260 | Ga0068859_100190651 | 3300005617 | Bacteria | 2134 |
| 261 | Ga0068859_100234474 | 3300005617 | Bacteria | 1924 |
| 262 | Ga0068859_100418182 | 3300005617 | Bacteria | 1437 |
| 263 | Ga0068859_100458223 | 3300005617 | Bacteria | 1371 |
| 264 | Ga0068859_100644441 | 3300005617 | Bacteria | 1151 |
| 265 | Ga0068859_100652398 | 3300005617 | Bacteria | 1144 |
| 266 | Ga0068859_100715470 | 3300005617 | Unclassified | 1091 |
| 267 | Ga0068864_100004220 | 3300005618 | Bacteria | 11826 |
| 268 | Ga0068864_100010017 | 3300005618 | Bacteria | 7824 |
| 269 | Ga0068864_100025101 | 3300005618 | Bacteria | 5018 |
| 270 | Ga0068864_100080646 | 3300005618 | Bacteria | 2851 |
| 271 | Ga0068864_100212159 | 3300005618 | Bacteria | 1783 |
| 272 | Ga0068864_100452140 | 3300005618 | Bacteria | 1228 |
| 273 | Ga0068864_100928740 | 3300005618 | Unclassified | 860 |
| 274 | Ga0068864_101251616 | 3300005618 | Unclassified | 741 |
| 275 | Ga0068866_10001848 | 3300005718 | Bacteria | 8876 |
| 276 | Ga0068866_10042419 | 3300005718 | Bacteria | 2264 |
| 277 | Ga0068861_100006098 | 3300005719 | Bacteria | 8201 |
| 278 | Ga0068861_100024337 | 3300005719 | Bacteria | 4378 |
| 279 | Ga0068861_100077494 | 3300005719 | Bacteria | 2593 |
| 280 | Ga0068861_100214798 | 3300005719 | Bacteria | 1622 |
| 281 | Ga0068861_100384425 | 3300005719 | Unclassified | 1241 |
| 282 | Ga0068861_101018987 | 3300005719 | Unclassified | 791 |
| 283 | Ga0068861_101334318 | 3300005719 | Unclassified | 698 |
| 284 | Ga0068851_10007431 | 3300005834 | Bacteria | 5031 |
| 285 | Ga0068851_10160619 | 3300005834 | Bacteria | 1234 |
| 286 | Ga0068870_10061753 | 3300005840 | Bacteria | 2015 |
| 287 | Ga0068870_10334629 | 3300005840 | Bacteria | 966 |
| 288 | Ga0068863_100037389 | 3300005841 | Bacteria | 4622 |
| 289 | Ga0068863_100039428 | 3300005841 | Bacteria | 4494 |
| 290 | Ga0068863_100054451 | 3300005841 | Bacteria | 3790 |
| 291 | Ga0068863_100226630 | 3300005841 | Unclassified | 1802 |
| 292 | Ga0068863_100468624 | 3300005841 | Bacteria | 1238 |
| 293 | Ga0068858_100000134 | 3300005842 | Bacteria | 77566 |
| 294 | Ga0068858_100063016 | 3300005842 | Bacteria | 3429 |
| 295 | Ga0068858_100155249 | 3300005842 | Bacteria | 2153 |
| 296 | Ga0068858_100244669 | 3300005842 | Bacteria | 1703 |
| 297 | Ga0068858_100287913 | 3300005842 | Unclassified | 1565 |
| 298 | Ga0068858_100306234 | 3300005842 | Bacteria | 1516 |
| 299 | Ga0068858_100355541 | 3300005842 | Bacteria | 1403 |
| 300 | Ga0068858_100377862 | 3300005842 | Bacteria | 1359 |
| 301 | Ga0068858_100440552 | 3300005842 | Unclassified | 1255 |
| 302 | Ga0068858_100545049 | 3300005842 | Bacteria | 1123 |
| 303 | Ga0068860_100006307 | 3300005843 | Bacteria | 11911 |
| 304 | Ga0068860_100049231 | 3300005843 | Bacteria | 4014 |
| 305 | Ga0068860_100056486 | 3300005843 | Bacteria | 3731 |
| 306 | Ga0068860_100084954 | 3300005843 | Bacteria | 3010 |
| 307 | Ga0068860_100134736 | 3300005843 | Bacteria | 2372 |
| 308 | Ga0068860_100418619 | 3300005843 | Bacteria | 1328 |
| 309 | Ga0068862_100014383 | 3300005844 | Bacteria | 6565 |
| 310 | Ga0068862_100029312 | 3300005844 | Bacteria | 4637 |
| 311 | Ga0081455_10053041 | 3300005937 | Bacteria | 3467 |
| 312 | Ga0081455_10099679 | 3300005937 | Bacteria | 2336 |
| 313 | Ga0081539_10000508 | 3300005985 | Bacteria | 80945 |
| 314 | Ga0081539_10000731 | 3300005985 | Bacteria | 65764 |
| 315 | Ga0081539_10001267 | 3300005985 | Bacteria | 44584 |
| 316 | Ga0081539_10009109 | 3300005985 | Bacteria | 8399 |
| 317 | Ga0081539_10119914 | 3300005985 | Unclassified | 1308 |
| 318 | Ga0070716_100038099 | 3300006173 | Bacteria | 2660 |
| 319 | Ga0097621_100008887 | 3300006237 | Bacteria | 7261 |
| 320 | Ga0097621_100065970 | 3300006237 | Bacteria | 2980 |
| 321 | Ga0097621_100099710 | 3300006237 | Bacteria | 2442 |
| 322 | Ga0068871_100006263 | 3300006358 | Bacteria | 8394 |
| 323 | Ga0068871_100008816 | 3300006358 | Bacteria | 7265 |
| 324 | Ga0068871_100021420 | 3300006358 | Bacteria | 4967 |
| 325 | Ga0068871_100372437 | 3300006358 | Bacteria | 1267 |
| 326 | Ga0075428_100312176 | 3300006844 | Bacteria | 1690 |
| 327 | Ga0075430_100053895 | 3300006846 | Bacteria | 3385 |
| 328 | Ga0075431_100067859 | 3300006847 | Bacteria | 3681 |
| 329 | Ga0075431_100090543 | 3300006847 | Bacteria | 3157 |
| 330 | Ga0075431_100246344 | 3300006847 | Bacteria | 1817 |
| 331 | Ga0075431_100266054 | 3300006847 | Bacteria | 1739 |
| 332 | Ga0075433_10036452 | 3300006852 | Bacteria | 4237 |
| 333 | Ga0075433_10062368 | 3300006852 | Bacteria | 3264 |
| 334 | Ga0075433_10580575 | 3300006852 | Unclassified | 984 |
| 335 | Ga0075433_10855434 | 3300006852 | Unclassified | 794 |
| 336 | Ga0075434_100062330 | 3300006871 | Bacteria | 3712 |
| 337 | Ga0075434_100152095 | 3300006871 | Bacteria | 2334 |
| 338 | Ga0075434_100353897 | 3300006871 | Bacteria | 1489 |
| 339 | Ga0075434_100467436 | 3300006871 | Unclassified | 1282 |
| 340 | Ga0075429_100074934 | 3300006880 | Bacteria | 2948 |
| 341 | Ga0075429_100373289 | 3300006880 | Unclassified | 1249 |
| 342 | Ga0068865_100009196 | 3300006881 | Bacteria | 6116 |
| 343 | Ga0068865_100999671 | 3300006881 | Unclassified | 732 |
| 344 | Ga0075436_100826426 | 3300006914 | Unclassified | 691 |
| 345 | Ga0097620_100007022 | 3300006931 | Bacteria | 11432 |
| 346 | Ga0097620_100029692 | 3300006931 | Bacteria | 5486 |
| 347 | Ga0097620_100056651 | 3300006931 | Bacteria | 3946 |
| 348 | Ga0097620_100057909 | 3300006931 | Bacteria | 3903 |
| 349 | Ga0097620_100064796 | 3300006931 | Bacteria | 3687 |
| 350 | Ga0097620_100072556 | 3300006931 | Bacteria | 3479 |
| 351 | Ga0097620_100138904 | 3300006931 | Bacteria | 2503 |
| 352 | Ga0097620_100143012 | 3300006931 | Bacteria | 2466 |
| 353 | Ga0097620_100153438 | 3300006931 | Bacteria | 2379 |
| 354 | Ga0097620_100174610 | 3300006931 | Bacteria | 2231 |
| 355 | Ga0097620_100190654 | 3300006931 | Bacteria | 2134 |
| 356 | Ga0097620_100234484 | 3300006931 | Bacteria | 1924 |
| 357 | Ga0097620_100418147 | 3300006931 | Bacteria | 1437 |
| 358 | Ga0097620_100644402 | 3300006931 | Bacteria | 1151 |
| 359 | Ga0097620_100652402 | 3300006931 | Bacteria | 1144 |
| 360 | Ga0097620_100715423 | 3300006931 | Unclassified | 1091 |
| 361 | Ga0075435_100273599 | 3300007076 | Bacteria | 1441 |
| 362 | Ga0099795_10068027 | 3300007788 | Bacteria | 1338 |
| 363 | Ga0105251_10157369 | 3300009011 | Unclassified | 1025 |
| 364 | Ga0105240_10042198 | 3300009093 | Bacteria | 5815 |
| 365 | Ga0105240_10511825 | 3300009093 | Bacteria | 1333 |
| 366 | Ga0111539_10004239 | 3300009094 | Bacteria | 18799 |
| 367 | Ga0111539_10005862 | 3300009094 | Bacteria | 15868 |
| 368 | Ga0111539_10228922 | 3300009094 | Bacteria | 2165 |
| 369 | Ga0111539_10298790 | 3300009094 | Bacteria | 1874 |
| 370 | Ga0111539_10450977 | 3300009094 | Bacteria | 1498 |
| 371 | Ga0111539_10616488 | 3300009094 | Unclassified | 1264 |
| 372 | Ga0111539_11189515 | 3300009094 | Unclassified | 885 |
| 373 | Ga0111539_11585050 | 3300009094 | Unclassified | 759 |
| 374 | Ga0105245_10031318 | 3300009098 | Bacteria | 4706 |
| 375 | Ga0105245_10242185 | 3300009098 | Bacteria | 1749 |
| 376 | Ga0105245_10413750 | 3300009098 | Unclassified | 1350 |
| 377 | Ga0105245_10596461 | 3300009098 | Bacteria | 1131 |
| 378 | Ga0105245_11237566 | 3300009098 | Unclassified | 795 |
| 379 | Ga0105245_11755185 | 3300009098 | Unclassified | 673 |
| 380 | Ga0105247_10000022 | 3300009101 | Bacteria | 219796 |
| 381 | Ga0105247_10000940 | 3300009101 | Bacteria | 21955 |
| 382 | Ga0105247_10167471 | 3300009101 | Unclassified | 1459 |
| 383 | Ga0105247_10700375 | 3300009101 | Unclassified | 762 |
| 384 | Ga0105247_10735739 | 3300009101 | Unclassified | 746 |
| 385 | Ga0105247_10774580 | 3300009101 | Unclassified | 729 |
| 386 | Ga0105247_10927543 | 3300009101 | Unclassified | 674 |
| 387 | Ga0114129_10002234 | 3300009147 | Bacteria | 26722 |
| 388 | Ga0114129_10014519 | 3300009147 | Bacteria | 11225 |
| 389 | Ga0114129_10052100 | 3300009147 | Bacteria | 5744 |
| 390 | Ga0114129_10163448 | 3300009147 | Bacteria | 3040 |
| 391 | Ga0114129_10173647 | 3300009147 | Bacteria | 2937 |
| 392 | Ga0114129_10457174 | 3300009147 | Bacteria | 1673 |
| 393 | Ga0114129_10467945 | 3300009147 | Unclassified | 1651 |
| 394 | Ga0114129_10734971 | 3300009147 | Bacteria | 1265 |
| 395 | Ga0114129_10824790 | 3300009147 | Bacteria | 1181 |
| 396 | Ga0114129_10846836 | 3300009147 | Bacteria | 1163 |
| 397 | Ga0105243_10000207 | 3300009148 | Bacteria | 68914 |
| 398 | Ga0105243_10010199 | 3300009148 | Bacteria | 7142 |
| 399 | Ga0105243_10091815 | 3300009148 | Bacteria | 2501 |
| 400 | Ga0105243_10162976 | 3300009148 | Unclassified | 1924 |
| 401 | Ga0105243_10223067 | 3300009148 | Unclassified | 1667 |
| 402 | Ga0105243_10302440 | 3300009148 | Unclassified | 1450 |
| 403 | Ga0105243_10391710 | 3300009148 | Bacteria | 1288 |
| 404 | Ga0105243_10456979 | 3300009148 | Bacteria | 1200 |
| 405 | Ga0105243_10744145 | 3300009148 | Unclassified | 960 |
| 406 | Ga0105243_10831056 | 3300009148 | Unclassified | 913 |
| 407 | Ga0105243_10838201 | 3300009148 | Bacteria | 909 |
| 408 | Ga0105243_10918687 | 3300009148 | Unclassified | 872 |
| 409 | Ga0105243_11192177 | 3300009148 | Unclassified | 774 |
| 410 | Ga0105243_11534336 | 3300009148 | Unclassified | 691 |
| 411 | Ga0105241_10070433 | 3300009174 | Bacteria | 2713 |
| 412 | Ga0105241_10072606 | 3300009174 | Bacteria | 2675 |
| 413 | Ga0105241_10135613 | 3300009174 | Bacteria | 1998 |
| 414 | Ga0105241_10258072 | 3300009174 | Bacteria | 1480 |
| 415 | Ga0105241_10312566 | 3300009174 | Unclassified | 1352 |
| 416 | Ga0105241_10981288 | 3300009174 | Unclassified | 789 |
| 417 | Ga0105241_11401424 | 3300009174 | Unclassified | 669 |
| 418 | Ga0105242_10001183 | 3300009176 | Bacteria | 20547 |
| 419 | Ga0105242_10001619 | 3300009176 | Bacteria | 17740 |
| 420 | Ga0105242_10005056 | 3300009176 | Bacteria | 10185 |
| 421 | Ga0105242_10088792 | 3300009176 | Bacteria | 2597 |
| 422 | Ga0105242_10330978 | 3300009176 | Bacteria | 1400 |
| 423 | Ga0105242_10569339 | 3300009176 | Unclassified | 1089 |
| 424 | Ga0105242_10665701 | 3300009176 | Bacteria | 1014 |
| 425 | Ga0105242_10842469 | 3300009176 | Archaea | 912 |
| 426 | Ga0105242_11049628 | 3300009176 | Bacteria | 826 |
| 427 | Ga0105242_12268148 | 3300009176 | Unclassified | 589 |
| 428 | Ga0105248_10002980 | 3300009177 | Bacteria | 18768 |
| 429 | Ga0105248_10004578 | 3300009177 | Bacteria | 15313 |
| 430 | Ga0105248_10039245 | 3300009177 | Bacteria | 5302 |
| 431 | Ga0105248_10118675 | 3300009177 | Bacteria | 2984 |
| 432 | Ga0105248_10123388 | 3300009177 | Bacteria | 2922 |
| 433 | Ga0105248_10149134 | 3300009177 | Bacteria | 2639 |
| 434 | Ga0105248_10155036 | 3300009177 | Bacteria | 2584 |
| 435 | Ga0105248_10257247 | 3300009177 | Bacteria | 1965 |
| 436 | Ga0105248_10663841 | 3300009177 | Bacteria | 1176 |
| 437 | Ga0105248_10863190 | 3300009177 | Bacteria | 1022 |
| 438 | Ga0105248_10885816 | 3300009177 | Bacteria | 1008 |
| 439 | Ga0105248_11395378 | 3300009177 | Bacteria | 793 |
| 440 | Ga0105237_10000889 | 3300009545 | Bacteria | 40291 |
| 441 | Ga0105237_10379550 | 3300009545 | Bacteria | 1418 |
| 442 | Ga0105238_10014107 | 3300009551 | Bacteria | 8080 |
| 443 | Ga0105238_11355751 | 3300009551 | Unclassified | 738 |
| 444 | Ga0105249_10000288 | 3300009553 | Bacteria | 51931 |
| 445 | Ga0105249_10034881 | 3300009553 | Bacteria | 4560 |
| 446 | Ga0105249_10041639 | 3300009553 | Bacteria | 4176 |
| 447 | Ga0105249_10141115 | 3300009553 | Unclassified | 2311 |
| 448 | Ga0105249_11095406 | 3300009553 | Unclassified | 867 |
| 449 | Ga0105249_11775487 | 3300009553 | Unclassified | 689 |
| 450 | Ga0105249_12275949 | 3300009553 | Unclassified | 615 |
| 451 | Ga0105239_10453090 | 3300010375 | Bacteria | 1456 |
| 452 | Ga0105239_10893203 | 3300010375 | Bacteria | 1020 |
| 453 | Ga0105239_10912890 | 3300010375 | Unclassified | 1008 |
| 454 | Ga0105239_10938583 | 3300010375 | Bacteria | 994 |
| 455 | Ga0105239_10987723 | 3300010375 | Bacteria | 968 |
| 456 | Ga0105239_11073932 | 3300010375 | Unclassified | 926 |
| 457 | Ga0105239_11137957 | 3300010375 | Unclassified | 899 |
| 458 | Ga0105239_11262156 | 3300010375 | Unclassified | 852 |
| 459 | Ga0105239_11692322 | 3300010375 | Unclassified | 732 |
| 460 | Ga0105239_11848728 | 3300010375 | Unclassified | 700 |
| 461 | Ga0105246_10019038 | 3300011119 | Bacteria | 4380 |
| 462 | Ga0105246_10250657 | 3300011119 | Bacteria | 1405 |
| 463 | Ga0105246_10381931 | 3300011119 | Unclassified | 1164 |
| 464 | Ga0105246_10440453 | 3300011119 | Bacteria | 1092 |
| 465 | Ga0105246_10517571 | 3300011119 | Bacteria | 1016 |
| 466 | Ga0157373_10003789 | 3300013100 | Bacteria | 11435 |
| 467 | Ga0157373_10021163 | 3300013100 | Bacteria | 4721 |
| 468 | Ga0157373_10086941 | 3300013100 | Bacteria | 2203 |
| 469 | Ga0157373_10398833 | 3300013100 | Unclassified | 986 |
| 470 | Ga0157373_10642149 | 3300013100 | Bacteria | 775 |
| 471 | Ga0157373_10671146 | 3300013100 | Unclassified | 758 |
| 472 | Ga0157371_10455127 | 3300013102 | Unclassified | 941 |
| 473 | Ga0157374_10056975 | 3300013296 | Bacteria | 3649 |
| 474 | Ga0157374_10262237 | 3300013296 | Bacteria | 1702 |
| 475 | Ga0157374_10667272 | 3300013296 | Bacteria | 1052 |
| 476 | Ga0157378_10000191 | 3300013297 | Bacteria | 59071 |
| 477 | Ga0157378_10001421 | 3300013297 | Bacteria | 21532 |
| 478 | Ga0157378_10002587 | 3300013297 | Bacteria | 16102 |
| 479 | Ga0157378_10008810 | 3300013297 | Bacteria | 8783 |
| 480 | Ga0157378_10047689 | 3300013297 | Bacteria | 3809 |
| 481 | Ga0157378_10161136 | 3300013297 | Bacteria | 2098 |
| 482 | Ga0157378_10172869 | 3300013297 | Bacteria | 2027 |
| 483 | Ga0157378_10194769 | 3300013297 | Bacteria | 1914 |
| 484 | Ga0157378_10257220 | 3300013297 | Bacteria | 1674 |
| 485 | Ga0157378_10333683 | 3300013297 | Bacteria | 1476 |
| 486 | Ga0157378_10386155 | 3300013297 | Unclassified | 1376 |
| 487 | Ga0157378_10528305 | 3300013297 | Unclassified | 1182 |
| 488 | Ga0157378_10714214 | 3300013297 | Bacteria | 1023 |
| 489 | Ga0157378_11147434 | 3300013297 | Unclassified | 815 |
| 490 | Ga0163162_10000211 | 3300013306 | Bacteria | 54106 |
| 491 | Ga0163162_10005668 | 3300013306 | Bacteria | 12065 |
| 492 | Ga0163162_10010770 | 3300013306 | Bacteria | 8896 |
| 493 | Ga0163162_10016674 | 3300013306 | Bacteria | 7181 |
| 494 | Ga0163162_10045971 | 3300013306 | Bacteria | 4376 |
| 495 | Ga0163162_10099061 | 3300013306 | Bacteria | 3005 |
| 496 | Ga0163162_10124342 | 3300013306 | Bacteria | 2685 |
| 497 | Ga0163162_10144803 | 3300013306 | Bacteria | 2491 |
| 498 | Ga0163162_10186620 | 3300013306 | Bacteria | 2201 |
| 499 | Ga0163162_10278682 | 3300013306 | Bacteria | 1804 |
| 500 | Ga0163162_10739503 | 3300013306 | Bacteria | 1103 |
| 501 | Ga0163162_10768472 | 3300013306 | Bacteria | 1082 |
| 502 | Ga0163162_10875101 | 3300013306 | Bacteria | 1013 |
| 503 | Ga0157372_10059465 | 3300013307 | Bacteria | 4274 |
| 504 | Ga0157372_10060392 | 3300013307 | Bacteria | 4242 |
| 505 | Ga0157372_10201332 | 3300013307 | Bacteria | 2306 |
| 506 | Ga0157372_10231996 | 3300013307 | Unclassified | 2140 |
| 507 | Ga0157372_10612413 | 3300013307 | Archaea | 1269 |
| 508 | Ga0157372_10736006 | 3300013307 | Bacteria | 1147 |
| 509 | Ga0157372_10994771 | 3300013307 | Unclassified | 971 |
| 510 | Ga0157372_11039107 | 3300013307 | Unclassified | 948 |
| 511 | Ga0157375_10001748 | 3300013308 | Bacteria | 18645 |
| 512 | Ga0157375_10066797 | 3300013308 | Bacteria | 3591 |
| 513 | Ga0157375_10163283 | 3300013308 | Bacteria | 2371 |
| 514 | Ga0157375_10207426 | 3300013308 | Bacteria | 2116 |
| 515 | Ga0157375_10474034 | 3300013308 | Bacteria | 1417 |
| 516 | Ga0157375_10491044 | 3300013308 | Bacteria | 1392 |
| 517 | Ga0157375_10786099 | 3300013308 | Bacteria | 1101 |
| 518 | Ga0163163_10000333 | 3300014325 | Bacteria | 45333 |
| 519 | Ga0163163_10018597 | 3300014325 | Bacteria | 6509 |
| 520 | Ga0163163_10024482 | 3300014325 | Bacteria | 5746 |
| 521 | Ga0163163_10042730 | 3300014325 | Bacteria | 4440 |
| 522 | Ga0163163_10043458 | 3300014325 | Bacteria | 4406 |
| 523 | Ga0163163_10097008 | 3300014325 | Bacteria | 2968 |
| 524 | Ga0163163_10109945 | 3300014325 | Bacteria | 2784 |
| 525 | Ga0163163_10242478 | 3300014325 | Bacteria | 1852 |
| 526 | Ga0163163_10324365 | 3300014325 | Bacteria | 1594 |
| 527 | Ga0157380_10042170 | 3300014326 | Bacteria | 3566 |
| 528 | Ga0157380_10055423 | 3300014326 | Bacteria | 3149 |
| 529 | Ga0157380_10160524 | 3300014326 | Bacteria | 1953 |
| 530 | Ga0157380_10227883 | 3300014326 | Bacteria | 1671 |
| 531 | Ga0157380_10654063 | 3300014326 | Unclassified | 1049 |
| 532 | Ga0157380_10701978 | 3300014326 | Bacteria | 1017 |
| 533 | Ga0157380_10836368 | 3300014326 | Unclassified | 941 |
| 534 | Ga0157377_10085640 | 3300014745 | Unclassified | 1851 |
| 535 | Ga0157377_10630341 | 3300014745 | Unclassified | 769 |
| 536 | Ga0157377_10721377 | 3300014745 | Bacteria | 726 |
| 537 | Ga0157377_10816471 | 3300014745 | Unclassified | 689 |
| 538 | Ga0157377_10855371 | 3300014745 | Unclassified | 676 |
| 539 | Ga0157379_10073742 | 3300014968 | Bacteria | 3055 |
| 540 | Ga0157379_10096357 | 3300014968 | Bacteria | 2655 |
| 541 | Ga0157379_10348521 | 3300014968 | Unclassified | 1355 |
| 542 | Ga0157379_10519976 | 3300014968 | Bacteria | 1105 |
| 543 | Ga0157376_10023169 | 3300014969 | Bacteria | 4855 |
| 544 | Ga0157376_10107203 | 3300014969 | Bacteria | 2452 |
| 545 | Ga0182007_10054637 | 3300015262 | Bacteria | 1313 |
| 546 | Ga0182007_10061132 | 3300015262 | Unclassified | 1235 |
| 547 | Ga0163161_10010034 | 3300017792 | Bacteria | 6557 |
| 548 | Ga0207672_1000082 | 3300025223 | Bacteria | 12518 |
| 549 | Ga0207697_10304909 | 3300025315 | Unclassified | 706 |
| 550 | Ga0207653_10001183 | 3300025885 | Bacteria | 8518 |
| 551 | Ga0207682_10230328 | 3300025893 | Bacteria | 859 |
| 552 | Ga0207642_10002875 | 3300025899 | Bacteria | 5384 |
| 553 | Ga0207642_10270717 | 3300025899 | Unclassified | 973 |
| 554 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 555 | Ga0207710_10001369 | 3300025900 | Bacteria | 12235 |
| 556 | Ga0207688_10183662 | 3300025901 | Bacteria | 1248 |
| 557 | Ga0207688_10350157 | 3300025901 | Unclassified | 910 |
| 558 | Ga0207680_10014597 | 3300025903 | Bacteria | 4073 |
| 559 | Ga0207680_10335499 | 3300025903 | Bacteria | 1060 |
| 560 | Ga0207647_10032362 | 3300025904 | Bacteria | 3361 |
| 561 | Ga0207647_10216121 | 3300025904 | Bacteria | 1106 |
| 562 | Ga0207647_10375782 | 3300025904 | Unclassified | 803 |
| 563 | Ga0207685_10000068 | 3300025905 | Bacteria | 27372 |
| 564 | Ga0207645_10015459 | 3300025907 | Bacteria | 5068 |
| 565 | Ga0207645_10507856 | 3300025907 | Unclassified | 816 |
| 566 | Ga0207645_10756428 | 3300025907 | Unclassified | 661 |
| 567 | Ga0207643_10001673 | 3300025908 | Bacteria | 12441 |
| 568 | Ga0207643_10036446 | 3300025908 | Bacteria | 2758 |
| 569 | Ga0207643_10072726 | 3300025908 | Bacteria | 1981 |
| 570 | Ga0207643_10348556 | 3300025908 | Bacteria | 929 |
| 571 | Ga0207684_10000065 | 3300025910 | Bacteria | 194463 |
| 572 | Ga0207684_10004172 | 3300025910 | Bacteria | 13729 |
| 573 | Ga0207684_10016010 | 3300025910 | Bacteria | 6440 |
| 574 | Ga0207684_10016926 | 3300025910 | Bacteria | 6262 |
| 575 | Ga0207684_10021254 | 3300025910 | Bacteria | 5541 |
| 576 | Ga0207684_10639136 | 3300025910 | Unclassified | 907 |
| 577 | Ga0207654_10163842 | 3300025911 | Unclassified | 1438 |
| 578 | Ga0207654_10450288 | 3300025911 | Unclassified | 903 |
| 579 | Ga0207654_10612011 | 3300025911 | Unclassified | 778 |
| 580 | Ga0207707_10000028 | 3300025912 | Bacteria | 167115 |
| 581 | Ga0207695_10053394 | 3300025913 | Bacteria | 4227 |
| 582 | Ga0207695_11135198 | 3300025913 | Unclassified | 661 |
| 583 | Ga0207671_10005350 | 3300025914 | Bacteria | 11877 |
| 584 | Ga0207671_10990312 | 3300025914 | Unclassified | 663 |
| 585 | Ga0207660_10006116 | 3300025917 | Bacteria | 7811 |
| 586 | Ga0207660_10097002 | 3300025917 | Bacteria | 2196 |
| 587 | Ga0207662_10008108 | 3300025918 | Bacteria | 5739 |
| 588 | Ga0207662_10017704 | 3300025918 | Bacteria | 4033 |
| 589 | Ga0207662_10266882 | 3300025918 | Unclassified | 1128 |
| 590 | Ga0207662_10303790 | 3300025918 | Bacteria | 1061 |
| 591 | Ga0207662_10378475 | 3300025918 | Bacteria | 956 |
| 592 | Ga0207662_10412845 | 3300025918 | Bacteria | 917 |
| 593 | Ga0207657_10052099 | 3300025919 | Bacteria | 3554 |
| 594 | Ga0207657_10763337 | 3300025919 | Unclassified | 749 |
| 595 | Ga0207649_10126714 | 3300025920 | Bacteria | 1729 |
| 596 | Ga0207652_10000443 | 3300025921 | Bacteria | 42831 |
| 597 | Ga0207646_10004429 | 3300025922 | Bacteria | 15249 |
| 598 | Ga0207646_10032101 | 3300025922 | Bacteria | 4752 |
| 599 | Ga0207646_10096152 | 3300025922 | Bacteria | 2653 |
| 600 | Ga0207646_10203510 | 3300025922 | Unclassified | 1788 |
| 601 | Ga0207646_10241438 | 3300025922 | Bacteria | 1632 |
| 602 | Ga0207681_10000729 | 3300025923 | Bacteria | 21525 |
| 603 | Ga0207681_10011656 | 3300025923 | Bacteria | 5405 |
| 604 | Ga0207681_10020953 | 3300025923 | Bacteria | 4149 |
| 605 | Ga0207681_10028279 | 3300025923 | Bacteria | 3631 |
| 606 | Ga0207681_10028782 | 3300025923 | Bacteria | 3602 |
| 607 | Ga0207694_10007517 | 3300025924 | Bacteria | 8260 |
| 608 | Ga0207650_10000046 | 3300025925 | Bacteria | 178190 |
| 609 | Ga0207650_10014146 | 3300025925 | Bacteria | 5542 |
| 610 | Ga0207650_10181222 | 3300025925 | Bacteria | 1678 |
| 611 | Ga0207650_10396794 | 3300025925 | Bacteria | 1141 |
| 612 | Ga0207650_10437782 | 3300025925 | Unclassified | 1086 |
| 613 | Ga0207650_10597055 | 3300025925 | Bacteria | 928 |
| 614 | Ga0207650_10995197 | 3300025925 | Bacteria | 713 |
| 615 | Ga0207659_10525991 | 3300025926 | Bacteria | 1003 |
| 616 | Ga0207687_10024975 | 3300025927 | Bacteria | 3997 |
| 617 | Ga0207687_10443041 | 3300025927 | Unclassified | 1076 |
| 618 | Ga0207687_10784073 | 3300025927 | Bacteria | 812 |
| 619 | Ga0207644_10014406 | 3300025931 | Bacteria | 5290 |
| 620 | Ga0207644_10106793 | 3300025931 | Bacteria | 2111 |
| 621 | Ga0207644_10580006 | 3300025931 | Unclassified | 930 |
| 622 | Ga0207690_10055370 | 3300025932 | Bacteria | 2671 |
| 623 | Ga0207690_10099174 | 3300025932 | Bacteria | 2076 |
| 624 | Ga0207690_10252634 | 3300025932 | Unclassified | 1362 |
| 625 | Ga0207690_10566082 | 3300025932 | Bacteria | 925 |
| 626 | Ga0207706_10333437 | 3300025933 | Unclassified | 1320 |
| 627 | Ga0207706_10375695 | 3300025933 | Bacteria | 1234 |
| 628 | Ga0207686_10000373 | 3300025934 | Bacteria | 31299 |
| 629 | Ga0207686_10000820 | 3300025934 | Bacteria | 18978 |
| 630 | Ga0207686_10022755 | 3300025934 | Bacteria | 3612 |
| 631 | Ga0207686_10033605 | 3300025934 | Bacteria | 3063 |
| 632 | Ga0207686_10410519 | 3300025934 | Bacteria | 1034 |
| 633 | Ga0207709_10001161 | 3300025935 | Bacteria | 19155 |
| 634 | Ga0207709_10060464 | 3300025935 | Bacteria | 2362 |
| 635 | Ga0207709_10452618 | 3300025935 | Unclassified | 993 |
| 636 | Ga0207709_10558923 | 3300025935 | Bacteria | 901 |
| 637 | Ga0207709_10756594 | 3300025935 | Bacteria | 781 |
| 638 | Ga0207709_11163975 | 3300025935 | Unclassified | 635 |
| 639 | Ga0207709_11325148 | 3300025935 | Unclassified | 595 |
| 640 | Ga0207670_10000322 | 3300025936 | Bacteria | 28637 |
| 641 | Ga0207670_10436201 | 3300025936 | Bacteria | 1054 |
| 642 | Ga0207704_10090158 | 3300025938 | Bacteria | 2011 |
| 643 | Ga0207704_10192385 | 3300025938 | Bacteria | 1485 |
| 644 | Ga0207665_10000083 | 3300025939 | Bacteria | 61629 |
| 645 | Ga0207665_10320094 | 3300025939 | Bacteria | 1164 |
| 646 | Ga0207691_10001701 | 3300025940 | Bacteria | 21735 |
| 647 | Ga0207691_10262998 | 3300025940 | Bacteria | 1487 |
| 648 | Ga0207691_10549452 | 3300025940 | Bacteria | 979 |
| 649 | Ga0207711_10001639 | 3300025941 | Bacteria | 20644 |
| 650 | Ga0207711_10011584 | 3300025941 | Bacteria | 7330 |
| 651 | Ga0207711_10219007 | 3300025941 | Bacteria | 1740 |
| 652 | Ga0207711_10326908 | 3300025941 | Bacteria | 1418 |
| 653 | Ga0207711_10347452 | 3300025941 | Bacteria | 1373 |
| 654 | Ga0207711_10584634 | 3300025941 | Unclassified | 1042 |
| 655 | Ga0207711_10636261 | 3300025941 | Unclassified | 995 |
| 656 | Ga0207711_10898993 | 3300025941 | Bacteria | 823 |
| 657 | Ga0207689_10003706 | 3300025942 | Bacteria | 13935 |
| 658 | Ga0207689_10009911 | 3300025942 | Bacteria | 8215 |
| 659 | Ga0207689_10149654 | 3300025942 | Bacteria | 1924 |
| 660 | Ga0207689_10194291 | 3300025942 | Bacteria | 1674 |
| 661 | Ga0207689_10324396 | 3300025942 | Bacteria | 1278 |
| 662 | Ga0207689_10364970 | 3300025942 | Bacteria | 1201 |
| 663 | Ga0207689_10508557 | 3300025942 | Bacteria | 1010 |
| 664 | Ga0207689_10537246 | 3300025942 | Unclassified | 981 |
| 665 | Ga0207689_10921038 | 3300025942 | Unclassified | 737 |
| 666 | Ga0207689_10932151 | 3300025942 | Unclassified | 733 |
| 667 | Ga0207679_10200205 | 3300025945 | Bacteria | 1667 |
| 668 | Ga0207679_10321396 | 3300025945 | Bacteria | 1340 |
| 669 | Ga0207679_10493169 | 3300025945 | Unclassified | 1092 |
| 670 | Ga0207679_10545689 | 3300025945 | Bacteria | 1039 |
| 671 | Ga0207667_10314303 | 3300025949 | Bacteria | 1600 |
| 672 | Ga0207651_10059446 | 3300025960 | Bacteria | 2648 |
| 673 | Ga0207651_10168667 | 3300025960 | Unclassified | 1724 |
| 674 | Ga0207651_10369336 | 3300025960 | Bacteria | 1213 |
| 675 | Ga0207651_10394115 | 3300025960 | Unclassified | 1176 |
| 676 | Ga0207712_10000180 | 3300025961 | Bacteria | 65420 |
| 677 | Ga0207712_10583253 | 3300025961 | Unclassified | 965 |
| 678 | Ga0207668_10014786 | 3300025972 | Unclassified | 4837 |
| 679 | Ga0207668_10454649 | 3300025972 | Bacteria | 1094 |
| 680 | Ga0207640_10704588 | 3300025981 | Unclassified | 866 |
| 681 | Ga0207640_11241784 | 3300025981 | Unclassified | 664 |
| 682 | Ga0207658_10111351 | 3300025986 | Bacteria | 2165 |
| 683 | Ga0207658_11079439 | 3300025986 | Viruses | 733 |
| 684 | Ga0207677_10036820 | 3300026023 | Bacteria | 3192 |
| 685 | Ga0207677_10048529 | 3300026023 | Bacteria | 2859 |
| 686 | Ga0207677_10132243 | 3300026023 | Bacteria | 1897 |
| 687 | Ga0207677_10662553 | 3300026023 | Bacteria | 922 |
| 688 | Ga0207703_10000481 | 3300026035 | Bacteria | 41719 |
| 689 | Ga0207703_10010674 | 3300026035 | Bacteria | 7174 |
| 690 | Ga0207703_10165221 | 3300026035 | Bacteria | 1942 |
| 691 | Ga0207703_10331982 | 3300026035 | Unclassified | 1395 |
| 692 | Ga0207703_10407325 | 3300026035 | Bacteria | 1263 |
| 693 | Ga0207703_10572733 | 3300026035 | Bacteria | 1066 |
| 694 | Ga0207703_10613174 | 3300026035 | Bacteria | 1030 |
| 695 | Ga0207703_11291904 | 3300026035 | Unclassified | 702 |
| 696 | Ga0207703_11315093 | 3300026035 | Unclassified | 695 |
| 697 | Ga0207639_10052991 | 3300026041 | Bacteria | 3094 |
| 698 | Ga0207639_10287674 | 3300026041 | Bacteria | 1448 |
| 699 | Ga0207639_11174308 | 3300026041 | Unclassified | 720 |
| 700 | Ga0207708_10000133 | 3300026075 | Bacteria | 58317 |
| 701 | Ga0207708_10035005 | 3300026075 | Bacteria | 3821 |
| 702 | Ga0207708_10036570 | 3300026075 | Bacteria | 3739 |
| 703 | Ga0207708_10077768 | 3300026075 | Bacteria | 2547 |
| 704 | Ga0207708_10129725 | 3300026075 | Bacteria | 1970 |
| 705 | Ga0207708_10270771 | 3300026075 | Bacteria | 1374 |
| 706 | Ga0207708_10422029 | 3300026075 | Bacteria | 1106 |
| 707 | Ga0207708_10689833 | 3300026075 | Bacteria | 872 |
| 708 | Ga0207708_11299541 | 3300026075 | Unclassified | 637 |
| 709 | Ga0207641_10053414 | 3300026088 | Bacteria | 3425 |
| 710 | Ga0207641_10075378 | 3300026088 | Bacteria | 2913 |
| 711 | Ga0207641_10102462 | 3300026088 | Bacteria | 2524 |
| 712 | Ga0207641_10114554 | 3300026088 | Bacteria | 2396 |
| 713 | Ga0207641_10174723 | 3300026088 | Bacteria | 1963 |
| 714 | Ga0207641_10301670 | 3300026088 | Bacteria | 1513 |
| 715 | Ga0207641_10430609 | 3300026088 | Bacteria | 1272 |
| 716 | Ga0207641_10706624 | 3300026088 | Unclassified | 993 |
| 717 | Ga0207648_10056273 | 3300026089 | Bacteria | 3433 |
| 718 | Ga0207648_10097769 | 3300026089 | Bacteria | 2569 |
| 719 | Ga0207648_10106665 | 3300026089 | Bacteria | 2458 |
| 720 | Ga0207648_10401820 | 3300026089 | Bacteria | 1241 |
| 721 | Ga0207648_10590659 | 3300026089 | Unclassified | 1023 |
| 722 | Ga0207648_10897474 | 3300026089 | Bacteria | 828 |
| 723 | Ga0207676_10018008 | 3300026095 | Bacteria | 5128 |
| 724 | Ga0207676_10031122 | 3300026095 | Bacteria | 4011 |
| 725 | Ga0207676_10084507 | 3300026095 | Bacteria | 2587 |
| 726 | Ga0207676_10131523 | 3300026095 | Bacteria | 2128 |
| 727 | Ga0207676_10179898 | 3300026095 | Bacteria | 1850 |
| 728 | Ga0207676_10337215 | 3300026095 | Unclassified | 1390 |
| 729 | Ga0207676_10535047 | 3300026095 | Unclassified | 1117 |
| 730 | Ga0207676_11025189 | 3300026095 | Bacteria | 814 |
| 731 | Ga0207676_11496683 | 3300026095 | Bacteria | 672 |
| 732 | Ga0207674_10002025 | 3300026116 | Bacteria | 25725 |
| 733 | Ga0207674_10039964 | 3300026116 | Unclassified | 4860 |
| 734 | Ga0207674_10042739 | 3300026116 | Bacteria | 4678 |
| 735 | Ga0207674_10504676 | 3300026116 | Unclassified | 1168 |
| 736 | Ga0207674_10621492 | 3300026116 | Bacteria | 1043 |
| 737 | Ga0207674_10730423 | 3300026116 | Unclassified | 956 |
| 738 | Ga0207674_11243734 | 3300026116 | Unclassified | 714 |
| 739 | Ga0207674_11280623 | 3300026116 | Bacteria | 703 |
| 740 | Ga0207675_100006381 | 3300026118 | Bacteria | 11176 |
| 741 | Ga0207675_100008376 | 3300026118 | Bacteria | 9745 |
| 742 | Ga0207675_100052371 | 3300026118 | Bacteria | 3809 |
| 743 | Ga0207675_100092374 | 3300026118 | Bacteria | 2846 |
| 744 | Ga0207675_100525524 | 3300026118 | Unclassified | 1180 |
| 745 | Ga0207683_10066395 | 3300026121 | Bacteria | 3181 |
| 746 | Ga0207683_10460550 | 3300026121 | Bacteria | 1173 |
| 747 | Ga0207683_11056806 | 3300026121 | Bacteria | 753 |
| 748 | Ga0207698_10288633 | 3300026142 | Bacteria | 1521 |
| 749 | Ga0207698_10410961 | 3300026142 | Bacteria | 1296 |
| 750 | Ga0207698_10971198 | 3300026142 | Unclassified | 859 |
| 751 | Ga0207428_10061421 | 3300027907 | Bacteria | 2975 |
| 752 | Ga0207428_10062946 | 3300027907 | Bacteria | 2932 |
| 753 | Ga0207428_10082670 | 3300027907 | Bacteria | 2506 |
| 754 | Ga0268266_11207440 | 3300028379 | Unclassified | 731 |
| 755 | Ga0268265_10190613 | 3300028380 | Bacteria | 1770 |
| 756 | Ga0268265_10251467 | 3300028380 | Bacteria | 1566 |
| 757 | Ga0268265_10636575 | 3300028380 | Bacteria | 1023 |
| 758 | Ga0268265_11036422 | 3300028380 | Unclassified | 812 |
| 759 | Ga0268264_10149136 | 3300028381 | Bacteria | 2095 |
| 760 | Ga0268264_10196598 | 3300028381 | Bacteria | 1842 |
| 761 | Ga0268264_10200058 | 3300028381 | Bacteria | 1827 |
| 762 | Ga0268264_10284478 | 3300028381 | Bacteria | 1550 |
| 763 | Ga0268264_10366323 | 3300028381 | Bacteria | 1376 |
| 764 | Ga0268264_10483580 | 3300028381 | Unclassified | 1205 |
| 765 | Ga0268264_10743732 | 3300028381 | Unclassified | 976 |
| 766 | Ga0268264_11327601 | 3300028381 | Unclassified | 729 |
| 767 | Ga0268264_11424692 | 3300028381 | Unclassified | 703 |
| 768 | Ga0307408_100741992 | 3300031548 | Unclassified | 886 |
| 769 | Ga0307405_10001250 | 3300031731 | Bacteria | 10583 |
| 770 | Ga0307405_10595661 | 3300031731 | Unclassified | 901 |
| 771 | Ga0307413_10162438 | 3300031824 | Bacteria | 1571 |
| 772 | Ga0307413_10169920 | 3300031824 | Unclassified | 1542 |
| 773 | Ga0307410_10000784 | 3300031852 | Bacteria | 13396 |
| 774 | Ga0307410_10423130 | 3300031852 | Unclassified | 1081 |
| 775 | Ga0307406_10019764 | 3300031901 | Bacteria | 3957 |
| 776 | Ga0307407_10090076 | 3300031903 | Bacteria | 1878 |
| 777 | Ga0307412_10086616 | 3300031911 | Bacteria | 2180 |
| 778 | Ga0307412_10208802 | 3300031911 | Bacteria | 1488 |
| 779 | Ga0307409_100090538 | 3300031995 | Bacteria | 2505 |
| 780 | Ga0307416_100007007 | 3300032002 | Bacteria | 7110 |
| 781 | Ga0307416_100050841 | 3300032002 | Bacteria | 3306 |
| 782 | Ga0307416_100195986 | 3300032002 | Bacteria | 1911 |
| 783 | Ga0307416_100703092 | 3300032002 | Unclassified | 1100 |
| 784 | Ga0307416_100803576 | 3300032002 | Bacteria | 1036 |
| 785 | Ga0307416_100866137 | 3300032002 | Unclassified | 1002 |
| 786 | Ga0307416_100936390 | 3300032002 | Bacteria | 968 |
| 787 | Ga0307416_102527026 | 3300032002 | Bacteria | 612 |
| 788 | Ga0307414_10267859 | 3300032004 | Bacteria | 1429 |
| 789 | Ga0307414_10351944 | 3300032004 | Unclassified | 1264 |
| 790 | Ga0307414_10946434 | 3300032004 | Unclassified | 791 |
| 791 | Ga0307411_10071544 | 3300032005 | Bacteria | 2351 |
| 792 | Ga0307411_10101533 | 3300032005 | Bacteria | 2036 |
| 793 | Ga0307411_10614482 | 3300032005 | Unclassified | 936 |
| 794 | Ga0307415_100001321 | 3300032126 | Bacteria | 11735 |
| 795 | Ga0307415_100189808 | 3300032126 | Bacteria | 1620 |
| 796 | Ga0373930_0093832 | 3300034816 | Bacteria | 707 |
| 797 | Ga0373940_0042346 | 3300035088 | Bacteria | 1255 |
| 798 | Ga0373949_0007134 | 3300035090 | Bacteria | 2450 |
| 799 | Ga0373951_0005735 | 3300035091 | Bacteria | 2871 |
| 800 | Ga0373951_0183267 | 3300035091 | Archaea | 602 |
| 801 | Ga0373939_0179581 | 3300035114 | Unclassified | 789 |
| 802 | Ga0373961_0069440 | 3300035241 | Unclassified | 1087 |
| 803 | Ga0373937_1104487 | 3300036401 | Unclassified | 742 |
| 804 | Ga0395900_0097549 | 3300037418 | Bacteria | 3020 |
| 805 | Ga0395900_0696470 | 3300037418 | Bacteria | 950 |
| 806 | Ga0395898_0054223 | 3300037466 | Bacteria | 3913 |
| 807 | Ga0395898_0470602 | 3300037466 | Unclassified | 1196 |
| 808 | Ga0395905_0370806 | 3300037471 | Bacteria | 1325 |
| 809 | Ga0395901_0188839 | 3300038443 | Bacteria | 2161 |
| 810 | Ga0242420_027007 | 3300038996 | Unclassified | 1050 |
| 811 | Ga0242420_069892 | 3300038996 | Unclassified | 712 |
| 812 | Ga0436365_0789093 | 3300039437 | Bacteria | 4233 |
| 813 | Ga0450892_019785 | 3300042130 | Bacteria | 655 |
| 814 | Ga0439458_0020070 | 3300042157 | Bacteria | 1542 |
| 815 | Ga0451576_0301272 | 3300045051 | Bacteria | 1677 |
| 816 | Ga0451576_0394580 | 3300045051 | Bacteria | 1451 |
| 817 | Ga0495580_0417439 | 3300046472 | Unclassified | 903 |
| 818 | Ga0495632_0080157 | 3300046519 | Bacteria | 1558 |
| 819 | Ga0495663_0000891 | 3300046525 | Bacteria | 10055 |
| 820 | Ga0495640_0356745 | 3300046533 | Bacteria | 902 |
| 821 | Ga0495598_0000764 | 3300046537 | Bacteria | 6122 |
| 822 | Ga0495621_0000016 | 3300046539 | Bacteria | 34269 |
| 823 | Ga0495621_0024488 | 3300046539 | Bacteria | 2017 |
| 824 | Ga0495668_0081774 | 3300046616 | Bacteria | 1772 |
| 825 | Ga0495668_0346155 | 3300046616 | Unclassified | 816 |
| 826 | Ga0495658_0073232 | 3300046683 | Bacteria | 1994 |
| 827 | Ga0495636_0021587 | 3300047318 | Bacteria | 2600 |
| 828 | Ga0495684_0185145 | 3300047471 | Bacteria | 1542 |
| 829 | Ga0496103_0597868 | 3300048906 | Unclassified | 703 |
| 830 | Ga0496104_0729866 | 3300048907 | Unclassified | 898 |
| 831 | Ga0496104_0905451 | 3300048907 | Unclassified | 787 |
| 832 | Ga0496106_0020516 | 3300048909 | Bacteria | 4905 |
| 833 | Ga0496106_0026558 | 3300048909 | Bacteria | 4312 |
| 834 | Ga0496106_0352608 | 3300048909 | Bacteria | 1182 |
| 835 | Ga0496108_0037751 | 3300048911 | Bacteria | 4025 |
| 836 | Ga0496108_0268904 | 3300048911 | Bacteria | 1484 |
| 837 | Ga0496112_1185164 | 3300048915 | Bacteria | 681 |
| 838 | Ga0496113_0174346 | 3300048916 | Bacteria | 1704 |
| 839 | Ga0496113_1201362 | 3300048916 | Unclassified | 592 |
| 840 | Ga0501292_001073 | 3300049515 | Bacteria | 3341 |
| 841 | Ga0501292_004416 | 3300049515 | Bacteria | 1925 |
| 842 | Ga0501292_028406 | 3300049515 | Unclassified | 931 |
| 843 | Ga0501296_005275 | 3300049519 | Bacteria | 1436 |
| 844 | Ga0501297_010981 | 3300049520 | Unclassified | 1033 |
| 845 | Ga0501298_000849 | 3300049521 | Bacteria | 4308 |
| 846 | Ga0501298_009255 | 3300049521 | Bacteria | 1672 |
| 847 | Ga0501298_030331 | 3300049521 | Bacteria | 1058 |
| 848 | Ga0501299_013322 | 3300049522 | Bacteria | 1417 |
| 849 | Ga0501300_041500 | 3300049523 | Unclassified | 694 |
| 850 | Ga0501031_0159623 | 3300049568 | Archaea | 1474 |
| 851 | Ga0501036_0586925 | 3300049572 | Bacteria | 925 |
| 852 | Ga0501038_0022901 | 3300049574 | Bacteria | 5592 |
| 853 | Ga0501040_0275485 | 3300049576 | Archaea | 1202 |
| 854 | Ga0501072_0545758 | 3300049588 | Unclassified | 916 |
| 855 | Ga0501076_0443467 | 3300049592 | Bacteria | 1069 |
| 856 | Ga0501198_039968 | 3300049649 | Unclassified | 810 |
| 857 | Ga0501202_016901 | 3300049652 | Bacteria | 1420 |
| 858 | Ga0501202_081653 | 3300049652 | Unclassified | 760 |
| 859 | Ga0501206_013972 | 3300049653 | Unclassified | 1100 |
| 860 | Ga0501207_008814 | 3300049654 | Bacteria | 1464 |
| 861 | Ga0501207_046199 | 3300049654 | Unclassified | 768 |
| 862 | Ga0501216_001003 | 3300049660 | Bacteria | 3635 |
| 863 | Ga0501216_084908 | 3300049660 | Unclassified | 675 |
| 864 | Ga0501217_000261 | 3300049661 | Bacteria | 8189 |
| 865 | Ga0501217_021013 | 3300049661 | Bacteria | 1538 |
| 866 | Ga0501223_003502 | 3300049663 | Bacteria | 3409 |
| 867 | Ga0501223_014933 | 3300049663 | Bacteria | 1539 |
| 868 | Ga0501223_032948 | 3300049663 | Bacteria | 1007 |
| 869 | Ga0501223_067293 | 3300049663 | Unclassified | 704 |
| 870 | Ga0501224_029550 | 3300049664 | Unclassified | 820 |
| 871 | Ga0501224_034572 | 3300049664 | Unclassified | 759 |
| 872 | Ga0501227_000224 | 3300049665 | Bacteria | 11441 |
| 873 | Ga0501227_097147 | 3300049665 | Unclassified | 781 |
| 874 | Ga0501227_105908 | 3300049665 | Unclassified | 750 |
| 875 | Ga0501233_001991 | 3300049668 | Bacteria | 3561 |
| 876 | Ga0501233_013694 | 3300049668 | Bacteria | 1648 |
| 877 | Ga0501233_033821 | 3300049668 | Unclassified | 1170 |
| 878 | Ga0501235_000213 | 3300049669 | Bacteria | 10407 |
| 879 | Ga0501235_003502 | 3300049669 | Bacteria | 3400 |
| 880 | Ga0501235_017358 | 3300049669 | Bacteria | 1593 |
| 881 | Ga0501235_022659 | 3300049669 | Bacteria | 1397 |
| 882 | Ga0501239_034779 | 3300049672 | Unclassified | 675 |
| 883 | Ga0501242_033125 | 3300049674 | Unclassified | 707 |
| 884 | Ga0501243_001571 | 3300049675 | Bacteria | 3277 |
| 885 | Ga0501243_022556 | 3300049675 | Unclassified | 1043 |
| 886 | Ga0501247_055830 | 3300049677 | Unclassified | 596 |
| 887 | Ga0501249_090057 | 3300049679 | Unclassified | 727 |
| 888 | Ga0501253_022770 | 3300049683 | Bacteria | 1119 |
| 889 | Ga0501253_045134 | 3300049683 | Bacteria | 904 |
| 890 | Ga0501257_096602 | 3300049686 | Unclassified | 772 |
| 891 | Ga0501257_121279 | 3300049686 | Unclassified | 700 |
| 892 | Ga0501259_024714 | 3300049688 | Unclassified | 1096 |
| 893 | Ga0501259_065102 | 3300049688 | Unclassified | 770 |
| 894 | Ga0501260_020581 | 3300049689 | Unclassified | 713 |
| 895 | Ga0501261_004827 | 3300049690 | Bacteria | 1681 |
| 896 | Ga0501219_012714 | 3300049703 | Unclassified | 655 |
| 897 | Ga0501221_021808 | 3300049704 | Bacteria | 1264 |
| 898 | Ga0501221_036300 | 3300049704 | Unclassified | 1055 |
| 899 | Ga0501221_065347 | 3300049704 | Unclassified | 849 |
| 900 | Ga0501225_0117117 | 3300049705 | Unclassified | 789 |
| 901 | Ga0501225_0139918 | 3300049705 | Bacteria | 731 |
| 902 | Ga0501234_004415 | 3300049707 | Bacteria | 2212 |
| 903 | Ga0501079_0174402 | 3300049741 | Bacteria | 1677 |
| 904 | Ga0501241_033376 | 3300049758 | Unclassified | 978 |
| 905 | Ga0501266_006017 | 3300049763 | Unclassified | 1507 |
| 906 | Ga0501268_010129 | 3300049765 | Unclassified | 1462 |
| 907 | Ga0501272_016181 | 3300049769 | Unclassified | 872 |
| 908 | Ga0501273_008737 | 3300049770 | Bacteria | 1217 |
| 909 | Ga0501273_016122 | 3300049770 | Bacteria | 976 |
| 910 | Ga0501279_007853 | 3300049775 | Bacteria | 1419 |
| 911 | Ga0501283_000552 | 3300049779 | Bacteria | 4942 |
| 912 | Ga0501283_012075 | 3300049779 | Unclassified | 1294 |
| 913 | Ga0501283_062179 | 3300049779 | Unclassified | 676 |
| 914 | Ga0501212_006202 | 3300049851 | Bacteria | 1606 |
| 915 | Ga0501212_032467 | 3300049851 | Unclassified | 845 |
| 916 | Ga0501212_039129 | 3300049851 | Unclassified | 780 |
| 917 | Ga0501226_000157 | 3300049853 | Bacteria | 12014 |
| 918 | nmdc:mga05p37_1115641_c1 | 3300050507 | Unclassified | 824 |
| 919 | nmdc:mga05p37_1166994_c1 | 3300050507 | Unclassified | 799 |
| 920 | nmdc:mga05p37_174771_c1 | 3300050507 | Bacteria | 2617 |
| 921 | nmdc:mga05p37_386829_c1 | 3300050507 | Unclassified | 1637 |
| 922 | nmdc:mga05p37_423591_c1 | 3300050507 | Bacteria | 1548 |
| 923 | nmdc:mga05p37_452769_c1 | 3300050507 | Bacteria | 1485 |
| 924 | nmdc:mga05p37_544429_c1 | 3300050507 | Unclassified | 1323 |
| 925 | nmdc:mga05p37_608002_c1 | 3300050507 | Unclassified | 1233 |
| 926 | nmdc:mga05p37_677906_c1 | 3300050507 | Bacteria | 1149 |
| 927 | nmdc:mga05p37_772228_c1 | 3300050507 | Bacteria | 1056 |
| 928 | nmdc:mga05p37_841088_c1 | 3300050507 | Unclassified | 998 |
| 929 | nmdc:mga05p37_91917_c1 | 3300050507 | Bacteria | 3739 |
| 930 | nmdc:mga09592_107233_c1 | 3300050508 | Bacteria | 2396 |
| 931 | nmdc:mga09592_1135009_c1 | 3300050508 | Unclassified | 648 |
| 932 | nmdc:mga09592_285496_c1 | 3300050508 | Bacteria | 1431 |
| 933 | nmdc:mga0qj67_234185_c1 | 3300050509 | Bacteria | 1490 |
| 934 | nmdc:mga0qj67_56399_c1 | 3300050509 | Bacteria | 3114 |
| 935 | nmdc:mga06r32_225788_c1 | 3300050510 | Bacteria | 1861 |
| 936 | nmdc:mga06r32_283216_c1 | 3300050510 | Bacteria | 1644 |
| 937 | nmdc:mga06r32_375996_c1 | 3300050510 | Bacteria | 1404 |
| 938 | nmdc:mga06r32_428987_c1 | 3300050510 | Bacteria | 1303 |
| 939 | nmdc:mga08y16_1172535_c1 | 3300050511 | Unclassified | 740 |
| 940 | nmdc:mga08y16_148128_c1 | 3300050511 | Bacteria | 2440 |
| 941 | nmdc:mga08y16_245832_c1 | 3300050511 | Bacteria | 1849 |
| 942 | nmdc:mga08y16_501711_c1 | 3300050511 | Bacteria | 1233 |
| 943 | nmdc:mga08y16_8295_c1 | 3300050511 | Bacteria | 10872 |
| 944 | nmdc:mga0n895_151046_c1 | 3300050512 | Bacteria | 2353 |
| 945 | nmdc:mga0n895_154749_c1 | 3300050512 | Bacteria | 2323 |
| 946 | nmdc:mga0n895_315174_c1 | 3300050512 | Unclassified | 1585 |
| 947 | nmdc:mga0n895_547011_c1 | 3300050512 | Bacteria | 1164 |
| 948 | nmdc:mga0n895_642562_c1 | 3300050512 | Bacteria | 1060 |
| 949 | nmdc:mga0n895_727295_c1 | 3300050512 | Unclassified | 987 |
| 950 | nmdc:mga0rr50_1253427_c1 | 3300050513 | Bacteria | 629 |
| 951 | nmdc:mga0a205_1033380_c1 | 3300050515 | Unclassified | 669 |
| 952 | nmdc:mga0a205_12842_c1 | 3300050515 | Bacteria | 7769 |
| 953 | nmdc:mga0a205_133596_c1 | 3300050515 | Bacteria | 2382 |
| 954 | nmdc:mga0a205_338121_c1 | 3300050515 | Unclassified | 1374 |
| 955 | nmdc:mga0a205_416548_c1 | 3300050515 | Bacteria | 1206 |
| 956 | nmdc:mga0a205_584393_c1 | 3300050515 | Bacteria | 971 |
| 957 | Ga0501084_0953280 | 3300054114 | Archaea | 721 |
| 958 | Ga0070680_100225153 | |||
| 959 | MRS1b_contig_6674846 | |||
| 960 | MBSR1b_contig_11571009 | |||
| 961 | CNAas_1000869 | |||
| 962 | JGI24748J21848_1000003 | |||
| 963 | JGI24034J26672_10000005 | |||
| 964 | JGI24751J29686_10000033 | |||
| 965 | JGI25406J46586_10008071 | |||
| 966 | rootH2_10229866 | |||
| 967 | rootL2_10158938 | |||
| 968 | rootH1_10265298 | |||
| 969 | Ga0065714_10064444 | |||
| 970 | Ga0065704_10021175 | |||
| 971 | Ga0065712_10006950 | |||
| 972 | Ga0065712_10067736 | |||
| 973 | Ga0065712_10256067 | |||
| 974 | Ga0065715_10008808 | |||
| 975 | Ga0065715_10024859 | |||
| 976 | Ga0065715_10030092 | |||
| 977 | Ga0065715_10033645 | |||
| 978 | Ga0065715_10045465 | |||
| 979 | Ga0065715_10090002 | |||
| 980 | Ga0065715_10091138 | |||
| 981 | Ga0065715_10094034 | |||
| 982 | Ga0065715_10127997 | |||
| 983 | Ga0065715_10148342 | |||
| 984 | Ga0065707_10001442 | |||
| 985 | Ga0065707_10172728 | |||
| 986 | Ga0065707_10230806 | |||
| 987 | Ga0065707_10481442 | |||
| 988 | Ga0065707_10608064 | |||
| 989 | Ga0070676_10032215 | |||
| 990 | Ga0070690_100000817 | |||
| 991 | Ga0070690_100048410 | |||
| 992 | Ga0070690_100102003 | |||
| 993 | Ga0070690_100790248 | |||
| 994 | Ga0070670_100000142 | |||
| 995 | Ga0070670_100006153 | |||
| 996 | Ga0070670_100098739 | |||
| 997 | Ga0070670_100278421 | |||
| 998 | Ga0070670_100288918 | |||
| 999 | Ga0070670_100445333 | |||
| 1000 | Ga0070670_101172313 | |||
| 1001 | Ga0070670_101540431 | |||
| 1002 | Ga0070677_10545481 | |||
| 1003 | Ga0068869_100005669 | |||
| 1004 | Ga0068869_100069452 | |||
| 1005 | Ga0068869_100070101 | |||
| 1006 | Ga0068869_100426129 | |||
| 1007 | Ga0068869_100504041 | |||
| 1008 | Ga0068869_100536642 | |||
| 1009 | Ga0068869_100950054 | |||
| 1010 | Ga0068869_101139463 | |||
| 1011 | Ga0070680_100002408 | |||
| 1012 | Ga0070680_100137513 | |||
| 1013 | Ga0070680_100206144 | |||
| 1014 | Ga0070680_100679737 | |||
| 1015 | Ga0070682_100013810 | |||
| 1016 | Ga0068868_100013176 | |||
| 1017 | Ga0068868_100020616 | |||
| 1018 | Ga0068868_100180272 | |||
| 1019 | Ga0068868_100908261 | |||
| 1020 | Ga0070660_100015879 | |||
| 1021 | Ga0070660_100550635 | |||
| 1022 | Ga0070689_100002620 | |||
| 1023 | Ga0070689_100048941 | |||
| 1024 | Ga0070689_100290801 | |||
| 1025 | Ga0070689_100570502 | |||
| 1026 | Ga0070687_100006624 | |||
| 1027 | Ga0070687_100189549 | |||
| 1028 | Ga0070687_100402979 | |||
| 1029 | Ga0070687_100467735 | |||
| 1030 | Ga0070687_100565354 | |||
| 1031 | Ga0070661_100077563 | |||
| 1032 | Ga0070692_10012645 | |||
| 1033 | Ga0070692_10082600 | |||
| 1034 | Ga0070692_10185877 | |||
| 1035 | Ga0070692_10342116 | |||
| 1036 | Ga0070668_100004093 | |||
| 1037 | Ga0070669_100008291 | |||
| 1038 | Ga0070669_100044896 | |||
| 1039 | Ga0070669_100120373 | |||
| 1040 | Ga0070669_100373727 | |||
| 1041 | Ga0070675_100638237 | |||
| 1042 | Ga0070671_100001580 | |||
| 1043 | Ga0070671_100332284 | |||
| 1044 | Ga0070674_100030870 | |||
| 1045 | Ga0070673_100011790 | |||
| 1046 | Ga0070673_100023045 | |||
| 1047 | Ga0070673_100231029 | |||
| 1048 | Ga0070673_100680203 | |||
| 1049 | Ga0070673_100711311 | |||
| 1050 | Ga0070673_101507361 | |||
| 1051 | Ga0070688_100007597 | |||
| 1052 | Ga0070659_100024585 | |||
| 1053 | Ga0070659_100120922 | |||
| 1054 | Ga0070659_100153750 | |||
| 1055 | Ga0070659_100627880 | |||
| 1056 | Ga0070659_100667689 | |||
| 1057 | Ga0070667_100926728 | |||
| 1058 | Ga0070703_10003365 | |||
| 1059 | Ga0070703_10216295 | |||
| 1060 | Ga0070709_10285382 | |||
| 1061 | Ga0070701_10007401 | |||
| 1062 | Ga0070701_10101335 | |||
| 1063 | Ga0070701_10141777 | |||
| 1064 | Ga0070701_10283973 | |||
| 1065 | Ga0070701_10354342 | |||
| 1066 | Ga0070705_100006983 | |||
| 1067 | Ga0070705_100063402 | |||
| 1068 | Ga0070705_100329168 | |||
| 1069 | Ga0070700_100000238 | |||
| 1070 | Ga0070700_100019390 | |||
| 1071 | Ga0070700_100042126 | |||
| 1072 | Ga0070700_100098352 | |||
| 1073 | Ga0070700_100221783 | |||
| 1074 | Ga0070700_100402341 | |||
| 1075 | Ga0070700_100429957 | |||
| 1076 | Ga0070694_100006926 | |||
| 1077 | Ga0070694_100007458 | |||
| 1078 | Ga0070694_100009509 | |||
| 1079 | Ga0070694_100015795 | |||
| 1080 | Ga0070694_100071355 | |||
| 1081 | Ga0070694_100150586 | |||
| 1082 | Ga0070694_100190266 | |||
| 1083 | Ga0070694_100355039 | |||
| 1084 | Ga0070694_100601205 | |||
| 1085 | Ga0070694_100822816 | |||
| 1086 | Ga0070708_100322306 | |||
| 1087 | Ga0070678_100060217 | |||
| 1088 | Ga0070678_100932032 | |||
| 1089 | Ga0070662_100094683 | |||
| 1090 | Ga0070662_100517224 | |||
| 1091 | Ga0070662_100575907 | |||
| 1092 | Ga0070681_10000100 | |||
| 1093 | Ga0070681_10000986 | |||
| 1094 | Ga0070681_10041236 | |||
| 1095 | Ga0070681_10417810 | |||
| 1096 | Ga0068867_100024849 | |||
| 1097 | Ga0068867_100068727 | |||
| 1098 | Ga0068867_100155585 | |||
| 1099 | Ga0068867_100276751 | |||
| 1100 | Ga0068867_100343735 | |||
| 1101 | Ga0070685_10380277 | |||
| 1102 | Ga0070706_100000002 | |||
| 1103 | Ga0070706_100180334 | |||
| 1104 | Ga0070706_100258172 | |||
| 1105 | Ga0070706_100639305 | |||
| 1106 | Ga0070706_100649343 | |||
| 1107 | Ga0070707_100000562 | |||
| 1108 | Ga0070707_100008628 | |||
| 1109 | Ga0070707_100050836 | |||
| 1110 | Ga0070707_100239229 | |||
| 1111 | Ga0070698_100009059 | |||
| 1112 | Ga0070698_100020732 | |||
| 1113 | Ga0070698_100034361 | |||
| 1114 | Ga0070698_100063342 | |||
| 1115 | Ga0070698_100066837 | |||
| 1116 | Ga0070698_100588687 | |||
| 1117 | Ga0070698_100753880 | |||
| 1118 | Ga0070699_100000980 | |||
| 1119 | Ga0070699_100004102 | |||
| 1120 | Ga0070699_100038390 | |||
| 1121 | Ga0070699_100162285 | |||
| 1122 | Ga0070699_100345571 | |||
| 1123 | Ga0070699_101258131 | |||
| 1124 | Ga0070679_100000819 | |||
| 1125 | Ga0070679_101508047 | |||
| 1126 | Ga0070684_100355930 | |||
| 1127 | Ga0070697_100000184 | |||
| 1128 | Ga0070697_100000379 | |||
| 1129 | Ga0070697_100144047 | |||
| 1130 | Ga0070697_100207412 | |||
| 1131 | Ga0070697_100339563 | |||
| 1132 | Ga0070697_100399308 | |||
| 1133 | Ga0070697_100554251 | |||
| 1134 | Ga0070697_100786123 | |||
| 1135 | Ga0070697_101069703 | |||
| 1136 | Ga0068853_100063797 | |||
| 1137 | Ga0068853_100129052 | |||
| 1138 | Ga0068853_100340318 | |||
| 1139 | Ga0068853_100589858 | |||
| 1140 | Ga0070672_100123700 | |||
| 1141 | Ga0070672_100125200 | |||
| 1142 | Ga0070672_100260208 | |||
| 1143 | Ga0070672_100274167 | |||
| 1144 | Ga0070672_101300969 | |||
| 1145 | Ga0070686_100012452 | |||
| 1146 | Ga0070686_100031759 | |||
| 1147 | Ga0070686_100076856 | |||
| 1148 | Ga0070695_100040072 | |||
| 1149 | Ga0070695_100048497 | |||
| 1150 | Ga0070695_100104550 | |||
| 1151 | Ga0070695_100118768 | |||
| 1152 | Ga0070695_100133237 | |||
| 1153 | Ga0070695_100157837 | |||
| 1154 | Ga0070695_100157840 | |||
| 1155 | Ga0070695_100202780 | |||
| 1156 | Ga0070695_100475659 | |||
| 1157 | Ga0070695_100516735 | |||
| 1158 | Ga0070695_100568060 | |||
| 1159 | Ga0070695_101009985 | |||
| 1160 | Ga0070696_100031372 | |||
| 1161 | Ga0070696_100122084 | |||
| 1162 | Ga0070696_100192872 | |||
| 1163 | Ga0070696_100238124 | |||
| 1164 | Ga0070696_100300846 | |||
| 1165 | Ga0070696_100329018 | |||
| 1166 | Ga0070696_100485247 | |||
| 1167 | Ga0070696_100651788 | |||
| 1168 | Ga0070693_100080251 | |||
| 1169 | Ga0070693_100127427 | |||
| 1170 | Ga0070693_100174432 | |||
| 1171 | Ga0070693_100182162 | |||
| 1172 | Ga0070693_100324355 | |||
| 1173 | Ga0070665_101038882 | |||
| 1174 | Ga0070704_100010701 | |||
| 1175 | Ga0070704_100010965 | |||
| 1176 | Ga0070704_100105652 | |||
| 1177 | Ga0070704_100124189 | |||
| 1178 | Ga0070704_100177607 | |||
| 1179 | Ga0070704_100189743 | |||
| 1180 | Ga0070704_100224723 | |||
| 1181 | Ga0070704_100231390 | |||
| 1182 | Ga0070704_100313692 | |||
| 1183 | Ga0070704_100489016 | |||
| 1184 | Ga0070704_100835761 | |||
| 1185 | Ga0070664_100011274 | |||
| 1186 | Ga0068857_100019415 | |||
| 1187 | Ga0068857_100187430 | |||
| 1188 | Ga0068857_100614994 | |||
| 1189 | Ga0068857_100680346 | |||
| 1190 | Ga0068857_100801424 | |||
| 1191 | Ga0068854_100024594 | |||
| 1192 | Ga0068854_100076809 | |||
| 1193 | Ga0068854_100271691 | |||
| 1194 | Ga0068854_100344096 | |||
| 1195 | Ga0068854_100358589 | |||
| 1196 | Ga0068854_100800128 | |||
| 1197 | Ga0068856_100974276 | |||
| 1198 | Ga0070702_100018094 | |||
| 1199 | Ga0070702_100025366 | |||
| 1200 | Ga0070702_100032786 | |||
| 1201 | Ga0070702_100048390 | |||
| 1202 | Ga0070702_100172311 | |||
| 1203 | Ga0070702_100179893 | |||
| 1204 | Ga0070702_100238574 | |||
| 1205 | Ga0068852_100247212 | |||
| 1206 | Ga0068852_100498669 | |||
| 1207 | Ga0068859_100007022 | |||
| 1208 | Ga0068859_100029694 | |||
| 1209 | Ga0068859_100056650 | |||
| 1210 | Ga0068859_100057911 | |||
| 1211 | Ga0068859_100064797 | |||
| 1212 | Ga0068859_100072553 | |||
| 1213 | Ga0068859_100138905 | |||
| 1214 | Ga0068859_100143008 | |||
| 1215 | Ga0068859_100153435 | |||
| 1216 | Ga0068859_100174596 | |||
| 1217 | Ga0068859_100190651 | |||
| 1218 | Ga0068859_100234474 | |||
| 1219 | Ga0068859_100418182 | |||
| 1220 | Ga0068859_100458223 | |||
| 1221 | Ga0068859_100644441 | |||
| 1222 | Ga0068859_100652398 | |||
| 1223 | Ga0068859_100715470 | |||
| 1224 | Ga0068864_100004220 | |||
| 1225 | Ga0068864_100010017 | |||
| 1226 | Ga0068864_100025101 | |||
| 1227 | Ga0068864_100080646 | |||
| 1228 | Ga0068864_100212159 | |||
| 1229 | Ga0068864_100452140 | |||
| 1230 | Ga0068864_100928740 | |||
| 1231 | Ga0068864_101251616 | |||
| 1232 | Ga0068866_10001848 | |||
| 1233 | Ga0068866_10042419 | |||
| 1234 | Ga0068861_100006098 | |||
| 1235 | Ga0068861_100024337 | |||
| 1236 | Ga0068861_100077494 | |||
| 1237 | Ga0068861_100214798 | |||
| 1238 | Ga0068861_100384425 | |||
| 1239 | Ga0068861_101018987 | |||
| 1240 | Ga0068861_101334318 | |||
| 1241 | Ga0068851_10007431 | |||
| 1242 | Ga0068851_10160619 | |||
| 1243 | Ga0068870_10061753 | |||
| 1244 | Ga0068870_10334629 | |||
| 1245 | Ga0068863_100037389 | |||
| 1246 | Ga0068863_100039428 | |||
| 1247 | Ga0068863_100054451 | |||
| 1248 | Ga0068863_100226630 | |||
| 1249 | Ga0068863_100468624 | |||
| 1250 | Ga0068858_100000134 | |||
| 1251 | Ga0068858_100063016 | |||
| 1252 | Ga0068858_100155249 | |||
| 1253 | Ga0068858_100244669 | |||
| 1254 | Ga0068858_100287913 | |||
| 1255 | Ga0068858_100306234 | |||
| 1256 | Ga0068858_100355541 | |||
| 1257 | Ga0068858_100377862 | |||
| 1258 | Ga0068858_100440552 | |||
| 1259 | Ga0068858_100545049 | |||
| 1260 | Ga0068860_100006307 | |||
| 1261 | Ga0068860_100049231 | |||
| 1262 | Ga0068860_100056486 | |||
| 1263 | Ga0068860_100084954 | |||
| 1264 | Ga0068860_100134736 | |||
| 1265 | Ga0068860_100418619 | |||
| 1266 | Ga0068862_100014383 | |||
| 1267 | Ga0068862_100029312 | |||
| 1268 | Ga0081455_10053041 | |||
| 1269 | Ga0081455_10099679 | |||
| 1270 | Ga0081539_10000508 | |||
| 1271 | Ga0081539_10000731 | |||
| 1272 | Ga0081539_10001267 | |||
| 1273 | Ga0081539_10009109 | |||
| 1274 | Ga0081539_10119914 | |||
| 1275 | Ga0070716_100038099 | |||
| 1276 | Ga0097621_100008887 | |||
| 1277 | Ga0097621_100065970 | |||
| 1278 | Ga0097621_100099710 | |||
| 1279 | Ga0068871_100006263 | |||
| 1280 | Ga0068871_100008816 | |||
| 1281 | Ga0068871_100021420 | |||
| 1282 | Ga0068871_100372437 | |||
| 1283 | Ga0075428_100312176 | |||
| 1284 | Ga0075430_100053895 | |||
| 1285 | Ga0075431_100067859 | |||
| 1286 | Ga0075431_100090543 | |||
| 1287 | Ga0075431_100246344 | |||
| 1288 | Ga0075431_100266054 | |||
| 1289 | Ga0075433_10036452 | |||
| 1290 | Ga0075433_10062368 | |||
| 1291 | Ga0075433_10580575 | |||
| 1292 | Ga0075433_10855434 | |||
| 1293 | Ga0075434_100062330 | |||
| 1294 | Ga0075434_100152095 | |||
| 1295 | Ga0075434_100353897 | |||
| 1296 | Ga0075434_100467436 | |||
| 1297 | Ga0075429_100074934 | |||
| 1298 | Ga0075429_100373289 | |||
| 1299 | Ga0068865_100009196 | |||
| 1300 | Ga0068865_100999671 | |||
| 1301 | Ga0075436_100826426 | |||
| 1302 | Ga0097620_100007022 | |||
| 1303 | Ga0097620_100029692 | |||
| 1304 | Ga0097620_100056651 | |||
| 1305 | Ga0097620_100057909 | |||
| 1306 | Ga0097620_100064796 | |||
| 1307 | Ga0097620_100072556 | |||
| 1308 | Ga0097620_100138904 | |||
| 1309 | Ga0097620_100143012 | |||
| 1310 | Ga0097620_100153438 | |||
| 1311 | Ga0097620_100174610 | |||
| 1312 | Ga0097620_100190654 | |||
| 1313 | Ga0097620_100234484 | |||
| 1314 | Ga0097620_100418147 | |||
| 1315 | Ga0097620_100644402 | |||
| 1316 | Ga0097620_100652402 | |||
| 1317 | Ga0097620_100715423 | |||
| 1318 | Ga0075435_100273599 | |||
| 1319 | Ga0099795_10068027 | |||
| 1320 | Ga0105251_10157369 | |||
| 1321 | Ga0105240_10042198 | |||
| 1322 | Ga0105240_10511825 | |||
| 1323 | Ga0111539_10004239 | |||
| 1324 | Ga0111539_10005862 | |||
| 1325 | Ga0111539_10228922 | |||
| 1326 | Ga0111539_10298790 | |||
| 1327 | Ga0111539_10450977 | |||
| 1328 | Ga0111539_10616488 | |||
| 1329 | Ga0111539_11189515 | |||
| 1330 | Ga0111539_11585050 | |||
| 1331 | Ga0105245_10031318 | |||
| 1332 | Ga0105245_10242185 | |||
| 1333 | Ga0105245_10413750 | |||
| 1334 | Ga0105245_10596461 | |||
| 1335 | Ga0105245_11237566 | |||
| 1336 | Ga0105245_11755185 | |||
| 1337 | Ga0105247_10000022 | |||
| 1338 | Ga0105247_10000940 | |||
| 1339 | Ga0105247_10167471 | |||
| 1340 | Ga0105247_10700375 | |||
| 1341 | Ga0105247_10735739 | |||
| 1342 | Ga0105247_10774580 | |||
| 1343 | Ga0105247_10927543 | |||
| 1344 | Ga0114129_10002234 | |||
| 1345 | Ga0114129_10014519 | |||
| 1346 | Ga0114129_10052100 | |||
| 1347 | Ga0114129_10163448 | |||
| 1348 | Ga0114129_10173647 | |||
| 1349 | Ga0114129_10457174 | |||
| 1350 | Ga0114129_10467945 | |||
| 1351 | Ga0114129_10734971 | |||
| 1352 | Ga0114129_10824790 | |||
| 1353 | Ga0114129_10846836 | |||
| 1354 | Ga0105243_10000207 | |||
| 1355 | Ga0105243_10010199 | |||
| 1356 | Ga0105243_10091815 | |||
| 1357 | Ga0105243_10162976 | |||
| 1358 | Ga0105243_10223067 | |||
| 1359 | Ga0105243_10302440 | |||
| 1360 | Ga0105243_10391710 | |||
| 1361 | Ga0105243_10456979 | |||
| 1362 | Ga0105243_10744145 | |||
| 1363 | Ga0105243_10831056 | |||
| 1364 | Ga0105243_10838201 | |||
| 1365 | Ga0105243_10918687 | |||
| 1366 | Ga0105243_11192177 | |||
| 1367 | Ga0105243_11534336 | |||
| 1368 | Ga0105241_10070433 | |||
| 1369 | Ga0105241_10072606 | |||
| 1370 | Ga0105241_10135613 | |||
| 1371 | Ga0105241_10258072 | |||
| 1372 | Ga0105241_10312566 | |||
| 1373 | Ga0105241_10981288 | |||
| 1374 | Ga0105241_11401424 | |||
| 1375 | Ga0105242_10001183 | |||
| 1376 | Ga0105242_10001619 | |||
| 1377 | Ga0105242_10005056 | |||
| 1378 | Ga0105242_10088792 | |||
| 1379 | Ga0105242_10330978 | |||
| 1380 | Ga0105242_10569339 | |||
| 1381 | Ga0105242_10665701 | |||
| 1382 | Ga0105242_10842469 | |||
| 1383 | Ga0105242_11049628 | |||
| 1384 | Ga0105242_12268148 | |||
| 1385 | Ga0105248_10002980 | |||
| 1386 | Ga0105248_10004578 | |||
| 1387 | Ga0105248_10039245 | |||
| 1388 | Ga0105248_10118675 | |||
| 1389 | Ga0105248_10123388 | |||
| 1390 | Ga0105248_10149134 | |||
| 1391 | Ga0105248_10155036 | |||
| 1392 | Ga0105248_10257247 | |||
| 1393 | Ga0105248_10663841 | |||
| 1394 | Ga0105248_10863190 | |||
| 1395 | Ga0105248_10885816 | |||
| 1396 | Ga0105248_11395378 | |||
| 1397 | Ga0105237_10000889 | |||
| 1398 | Ga0105237_10379550 | |||
| 1399 | Ga0105238_10014107 | |||
| 1400 | Ga0105238_11355751 | |||
| 1401 | Ga0105249_10000288 | |||
| 1402 | Ga0105249_10034881 | |||
| 1403 | Ga0105249_10041639 | |||
| 1404 | Ga0105249_10141115 | |||
| 1405 | Ga0105249_11095406 | |||
| 1406 | Ga0105249_11775487 | |||
| 1407 | Ga0105249_12275949 | |||
| 1408 | Ga0105239_10453090 | |||
| 1409 | Ga0105239_10893203 | |||
| 1410 | Ga0105239_10912890 | |||
| 1411 | Ga0105239_10938583 | |||
| 1412 | Ga0105239_10987723 | |||
| 1413 | Ga0105239_11073932 | |||
| 1414 | Ga0105239_11137957 | |||
| 1415 | Ga0105239_11262156 | |||
| 1416 | Ga0105239_11692322 | |||
| 1417 | Ga0105239_11848728 | |||
| 1418 | Ga0105246_10019038 | |||
| 1419 | Ga0105246_10250657 | |||
| 1420 | Ga0105246_10381931 | |||
| 1421 | Ga0105246_10440453 | |||
| 1422 | Ga0105246_10517571 | |||
| 1423 | Ga0157373_10003789 | |||
| 1424 | Ga0157373_10021163 | |||
| 1425 | Ga0157373_10086941 | |||
| 1426 | Ga0157373_10398833 | |||
| 1427 | Ga0157373_10642149 | |||
| 1428 | Ga0157373_10671146 | |||
| 1429 | Ga0157371_10455127 | |||
| 1430 | Ga0157374_10056975 | |||
| 1431 | Ga0157374_10262237 | |||
| 1432 | Ga0157374_10667272 | |||
| 1433 | Ga0157378_10000191 | |||
| 1434 | Ga0157378_10001421 | |||
| 1435 | Ga0157378_10002587 | |||
| 1436 | Ga0157378_10008810 | |||
| 1437 | Ga0157378_10047689 | |||
| 1438 | Ga0157378_10161136 | |||
| 1439 | Ga0157378_10172869 | |||
| 1440 | Ga0157378_10194769 | |||
| 1441 | Ga0157378_10257220 | |||
| 1442 | Ga0157378_10333683 | |||
| 1443 | Ga0157378_10386155 | |||
| 1444 | Ga0157378_10528305 | |||
| 1445 | Ga0157378_10714214 | |||
| 1446 | Ga0157378_11147434 | |||
| 1447 | Ga0163162_10000211 | |||
| 1448 | Ga0163162_10005668 | |||
| 1449 | Ga0163162_10010770 | |||
| 1450 | Ga0163162_10016674 | |||
| 1451 | Ga0163162_10045971 | |||
| 1452 | Ga0163162_10099061 | |||
| 1453 | Ga0163162_10124342 | |||
| 1454 | Ga0163162_10144803 | |||
| 1455 | Ga0163162_10186620 | |||
| 1456 | Ga0163162_10278682 | |||
| 1457 | Ga0163162_10739503 | |||
| 1458 | Ga0163162_10768472 | |||
| 1459 | Ga0163162_10875101 | |||
| 1460 | Ga0157372_10059465 | |||
| 1461 | Ga0157372_10060392 | |||
| 1462 | Ga0157372_10201332 | |||
| 1463 | Ga0157372_10231996 | |||
| 1464 | Ga0157372_10612413 | |||
| 1465 | Ga0157372_10736006 | |||
| 1466 | Ga0157372_10994771 | |||
| 1467 | Ga0157372_11039107 | |||
| 1468 | Ga0157375_10001748 | |||
| 1469 | Ga0157375_10066797 | |||
| 1470 | Ga0157375_10163283 | |||
| 1471 | Ga0157375_10207426 | |||
| 1472 | Ga0157375_10474034 | |||
| 1473 | Ga0157375_10491044 | |||
| 1474 | Ga0157375_10786099 | |||
| 1475 | Ga0163163_10000333 | |||
| 1476 | Ga0163163_10018597 | |||
| 1477 | Ga0163163_10024482 | |||
| 1478 | Ga0163163_10042730 | |||
| 1479 | Ga0163163_10043458 | |||
| 1480 | Ga0163163_10097008 | |||
| 1481 | Ga0163163_10109945 | |||
| 1482 | Ga0163163_10242478 | |||
| 1483 | Ga0163163_10324365 | |||
| 1484 | Ga0157380_10042170 | |||
| 1485 | Ga0157380_10055423 | |||
| 1486 | Ga0157380_10160524 | |||
| 1487 | Ga0157380_10227883 | |||
| 1488 | Ga0157380_10654063 | |||
| 1489 | Ga0157380_10701978 | |||
| 1490 | Ga0157380_10836368 | |||
| 1491 | Ga0157377_10085640 | |||
| 1492 | Ga0157377_10630341 | |||
| 1493 | Ga0157377_10721377 | |||
| 1494 | Ga0157377_10816471 | |||
| 1495 | Ga0157377_10855371 | |||
| 1496 | Ga0157379_10073742 | |||
| 1497 | Ga0157379_10096357 | |||
| 1498 | Ga0157379_10348521 | |||
| 1499 | Ga0157379_10519976 | |||
| 1500 | Ga0157376_10023169 | |||
| 1501 | Ga0157376_10107203 | |||
| 1502 | Ga0182007_10054637 | |||
| 1503 | Ga0182007_10061132 | |||
| 1504 | Ga0163161_10010034 | |||
| 1505 | Ga0207672_1000082 | |||
| 1506 | Ga0207697_10304909 | |||
| 1507 | Ga0207653_10001183 | |||
| 1508 | Ga0207682_10230328 | |||
| 1509 | Ga0207642_10002875 | |||
| 1510 | Ga0207642_10270717 | |||
| 1511 | Ga0207710_10000001 | |||
| 1512 | Ga0207710_10001369 | |||
| 1513 | Ga0207688_10183662 | |||
| 1514 | Ga0207688_10350157 | |||
| 1515 | Ga0207680_10014597 | |||
| 1516 | Ga0207680_10335499 | |||
| 1517 | Ga0207647_10032362 | |||
| 1518 | Ga0207647_10216121 | |||
| 1519 | Ga0207647_10375782 | |||
| 1520 | Ga0207685_10000068 | |||
| 1521 | Ga0207645_10015459 | |||
| 1522 | Ga0207645_10507856 | |||
| 1523 | Ga0207645_10756428 | |||
| 1524 | Ga0207643_10001673 | |||
| 1525 | Ga0207643_10036446 | |||
| 1526 | Ga0207643_10072726 | |||
| 1527 | Ga0207643_10348556 | |||
| 1528 | Ga0207684_10000065 | |||
| 1529 | Ga0207684_10004172 | |||
| 1530 | Ga0207684_10016010 | |||
| 1531 | Ga0207684_10016926 | |||
| 1532 | Ga0207684_10021254 | |||
| 1533 | Ga0207684_10639136 | |||
| 1534 | Ga0207654_10163842 | |||
| 1535 | Ga0207654_10450288 | |||
| 1536 | Ga0207654_10612011 | |||
| 1537 | Ga0207707_10000028 | |||
| 1538 | Ga0207695_10053394 | |||
| 1539 | Ga0207695_11135198 | |||
| 1540 | Ga0207671_10005350 | |||
| 1541 | Ga0207671_10990312 | |||
| 1542 | Ga0207660_10006116 | |||
| 1543 | Ga0207660_10097002 | |||
| 1544 | Ga0207662_10008108 | |||
| 1545 | Ga0207662_10017704 | |||
| 1546 | Ga0207662_10266882 | |||
| 1547 | Ga0207662_10303790 | |||
| 1548 | Ga0207662_10378475 | |||
| 1549 | Ga0207662_10412845 | |||
| 1550 | Ga0207657_10052099 | |||
| 1551 | Ga0207657_10763337 | |||
| 1552 | Ga0207649_10126714 | |||
| 1553 | Ga0207652_10000443 | |||
| 1554 | Ga0207646_10004429 | |||
| 1555 | Ga0207646_10032101 | |||
| 1556 | Ga0207646_10096152 | |||
| 1557 | Ga0207646_10203510 | |||
| 1558 | Ga0207646_10241438 | |||
| 1559 | Ga0207681_10000729 | |||
| 1560 | Ga0207681_10011656 | |||
| 1561 | Ga0207681_10020953 | |||
| 1562 | Ga0207681_10028279 | |||
| 1563 | Ga0207681_10028782 | |||
| 1564 | Ga0207694_10007517 | |||
| 1565 | Ga0207650_10000046 | |||
| 1566 | Ga0207650_10014146 | |||
| 1567 | Ga0207650_10181222 | |||
| 1568 | Ga0207650_10396794 | |||
| 1569 | Ga0207650_10437782 | |||
| 1570 | Ga0207650_10597055 | |||
| 1571 | Ga0207650_10995197 | |||
| 1572 | Ga0207659_10525991 | |||
| 1573 | Ga0207687_10024975 | |||
| 1574 | Ga0207687_10443041 | |||
| 1575 | Ga0207687_10784073 | |||
| 1576 | Ga0207644_10014406 | |||
| 1577 | Ga0207644_10106793 | |||
| 1578 | Ga0207644_10580006 | |||
| 1579 | Ga0207690_10055370 | |||
| 1580 | Ga0207690_10099174 | |||
| 1581 | Ga0207690_10252634 | |||
| 1582 | Ga0207690_10566082 | |||
| 1583 | Ga0207706_10333437 | |||
| 1584 | Ga0207706_10375695 | |||
| 1585 | Ga0207686_10000373 | |||
| 1586 | Ga0207686_10000820 | |||
| 1587 | Ga0207686_10022755 | |||
| 1588 | Ga0207686_10033605 | |||
| 1589 | Ga0207686_10410519 | |||
| 1590 | Ga0207709_10001161 | |||
| 1591 | Ga0207709_10060464 | |||
| 1592 | Ga0207709_10452618 | |||
| 1593 | Ga0207709_10558923 | |||
| 1594 | Ga0207709_10756594 | |||
| 1595 | Ga0207709_11163975 | |||
| 1596 | Ga0207709_11325148 | |||
| 1597 | Ga0207670_10000322 | |||
| 1598 | Ga0207670_10436201 | |||
| 1599 | Ga0207704_10090158 | |||
| 1600 | Ga0207704_10192385 | |||
| 1601 | Ga0207665_10000083 | |||
| 1602 | Ga0207665_10320094 | |||
| 1603 | Ga0207691_10001701 | |||
| 1604 | Ga0207691_10262998 | |||
| 1605 | Ga0207691_10549452 | |||
| 1606 | Ga0207711_10001639 | |||
| 1607 | Ga0207711_10011584 | |||
| 1608 | Ga0207711_10219007 | |||
| 1609 | Ga0207711_10326908 | |||
| 1610 | Ga0207711_10347452 | |||
| 1611 | Ga0207711_10584634 | |||
| 1612 | Ga0207711_10636261 | |||
| 1613 | Ga0207711_10898993 | |||
| 1614 | Ga0207689_10003706 | |||
| 1615 | Ga0207689_10009911 | |||
| 1616 | Ga0207689_10149654 | |||
| 1617 | Ga0207689_10194291 | |||
| 1618 | Ga0207689_10324396 | |||
| 1619 | Ga0207689_10364970 | |||
| 1620 | Ga0207689_10508557 | |||
| 1621 | Ga0207689_10537246 | |||
| 1622 | Ga0207689_10921038 | |||
| 1623 | Ga0207689_10932151 | |||
| 1624 | Ga0207679_10200205 | |||
| 1625 | Ga0207679_10321396 | |||
| 1626 | Ga0207679_10493169 | |||
| 1627 | Ga0207679_10545689 | |||
| 1628 | Ga0207667_10314303 | |||
| 1629 | Ga0207651_10059446 | |||
| 1630 | Ga0207651_10168667 | |||
| 1631 | Ga0207651_10369336 | |||
| 1632 | Ga0207651_10394115 | |||
| 1633 | Ga0207712_10000180 | |||
| 1634 | Ga0207712_10583253 | |||
| 1635 | Ga0207668_10014786 | |||
| 1636 | Ga0207668_10454649 | |||
| 1637 | Ga0207640_10704588 | |||
| 1638 | Ga0207640_11241784 | |||
| 1639 | Ga0207658_10111351 | |||
| 1640 | Ga0207658_11079439 | |||
| 1641 | Ga0207677_10036820 | |||
| 1642 | Ga0207677_10048529 | |||
| 1643 | Ga0207677_10132243 | |||
| 1644 | Ga0207677_10662553 | |||
| 1645 | Ga0207703_10000481 | |||
| 1646 | Ga0207703_10010674 | |||
| 1647 | Ga0207703_10165221 | |||
| 1648 | Ga0207703_10331982 | |||
| 1649 | Ga0207703_10407325 | |||
| 1650 | Ga0207703_10572733 | |||
| 1651 | Ga0207703_10613174 | |||
| 1652 | Ga0207703_11291904 | |||
| 1653 | Ga0207703_11315093 | |||
| 1654 | Ga0207639_10052991 | |||
| 1655 | Ga0207639_10287674 | |||
| 1656 | Ga0207639_11174308 | |||
| 1657 | Ga0207708_10000133 | |||
| 1658 | Ga0207708_10035005 | |||
| 1659 | Ga0207708_10036570 | |||
| 1660 | Ga0207708_10077768 | |||
| 1661 | Ga0207708_10129725 | |||
| 1662 | Ga0207708_10270771 | |||
| 1663 | Ga0207708_10422029 | |||
| 1664 | Ga0207708_10689833 | |||
| 1665 | Ga0207708_11299541 | |||
| 1666 | Ga0207641_10053414 | |||
| 1667 | Ga0207641_10075378 | |||
| 1668 | Ga0207641_10102462 | |||
| 1669 | Ga0207641_10114554 | |||
| 1670 | Ga0207641_10174723 | |||
| 1671 | Ga0207641_10301670 | |||
| 1672 | Ga0207641_10430609 | |||
| 1673 | Ga0207641_10706624 | |||
| 1674 | Ga0207648_10056273 | |||
| 1675 | Ga0207648_10097769 | |||
| 1676 | Ga0207648_10106665 | |||
| 1677 | Ga0207648_10401820 | |||
| 1678 | Ga0207648_10590659 | |||
| 1679 | Ga0207648_10897474 | |||
| 1680 | Ga0207676_10018008 | |||
| 1681 | Ga0207676_10031122 | |||
| 1682 | Ga0207676_10084507 | |||
| 1683 | Ga0207676_10131523 | |||
| 1684 | Ga0207676_10179898 | |||
| 1685 | Ga0207676_10337215 | |||
| 1686 | Ga0207676_10535047 | |||
| 1687 | Ga0207676_11025189 | |||
| 1688 | Ga0207676_11496683 | |||
| 1689 | Ga0207674_10002025 | |||
| 1690 | Ga0207674_10039964 | |||
| 1691 | Ga0207674_10042739 | |||
| 1692 | Ga0207674_10504676 | |||
| 1693 | Ga0207674_10621492 | |||
| 1694 | Ga0207674_10730423 | |||
| 1695 | Ga0207674_11243734 | |||
| 1696 | Ga0207674_11280623 | |||
| 1697 | Ga0207675_100006381 | |||
| 1698 | Ga0207675_100008376 | |||
| 1699 | Ga0207675_100052371 | |||
| 1700 | Ga0207675_100092374 | |||
| 1701 | Ga0207675_100525524 | |||
| 1702 | Ga0207683_10066395 | |||
| 1703 | Ga0207683_10460550 | |||
| 1704 | Ga0207683_11056806 | |||
| 1705 | Ga0207698_10288633 | |||
| 1706 | Ga0207698_10410961 | |||
| 1707 | Ga0207698_10971198 | |||
| 1708 | Ga0207428_10061421 | |||
| 1709 | Ga0207428_10062946 | |||
| 1710 | Ga0207428_10082670 | |||
| 1711 | Ga0268266_11207440 | |||
| 1712 | Ga0268265_10190613 | |||
| 1713 | Ga0268265_10251467 | |||
| 1714 | Ga0268265_10636575 | |||
| 1715 | Ga0268265_11036422 | |||
| 1716 | Ga0268264_10149136 | |||
| 1717 | Ga0268264_10196598 | |||
| 1718 | Ga0268264_10200058 | |||
| 1719 | Ga0268264_10284478 | |||
| 1720 | Ga0268264_10366323 | |||
| 1721 | Ga0268264_10483580 | |||
| 1722 | Ga0268264_10743732 | |||
| 1723 | Ga0268264_11327601 | |||
| 1724 | Ga0268264_11424692 | |||
| 1725 | Ga0307408_100741992 | |||
| 1726 | Ga0307405_10001250 | |||
| 1727 | Ga0307405_10595661 | |||
| 1728 | Ga0307413_10162438 | |||
| 1729 | Ga0307413_10169920 | |||
| 1730 | Ga0307410_10000784 | |||
| 1731 | Ga0307410_10423130 | |||
| 1732 | Ga0307406_10019764 | |||
| 1733 | Ga0307407_10090076 | |||
| 1734 | Ga0307412_10086616 | |||
| 1735 | Ga0307412_10208802 | |||
| 1736 | Ga0307409_100090538 | |||
| 1737 | Ga0307416_100007007 | |||
| 1738 | Ga0307416_100050841 | |||
| 1739 | Ga0307416_100195986 | |||
| 1740 | Ga0307416_100703092 | |||
| 1741 | Ga0307416_100803576 | |||
| 1742 | Ga0307416_100866137 | |||
| 1743 | Ga0307416_100936390 | |||
| 1744 | Ga0307416_102527026 | |||
| 1745 | Ga0307414_10267859 | |||
| 1746 | Ga0307414_10351944 | |||
| 1747 | Ga0307414_10946434 | |||
| 1748 | Ga0307411_10071544 | |||
| 1749 | Ga0307411_10101533 | |||
| 1750 | Ga0307411_10614482 | |||
| 1751 | Ga0307415_100001321 | |||
| 1752 | Ga0307415_100189808 | |||
| 1753 | Ga0373930_0093832 | |||
| 1754 | Ga0373940_0042346 | |||
| 1755 | Ga0373949_0007134 | |||
| 1756 | Ga0373951_0005735 | |||
| 1757 | Ga0373951_0183267 | |||
| 1758 | Ga0373939_0179581 | |||
| 1759 | Ga0373961_0069440 | |||
| 1760 | Ga0373937_1104487 | |||
| 1761 | Ga0395900_0097549 | |||
| 1762 | Ga0395900_0696470 | |||
| 1763 | Ga0395898_0054223 | |||
| 1764 | Ga0395898_0470602 | |||
| 1765 | Ga0395905_0370806 | |||
| 1766 | Ga0395901_0188839 | |||
| 1767 | Ga0242420_027007 | |||
| 1768 | Ga0242420_069892 | |||
| 1769 | Ga0436365_0789093 | |||
| 1770 | Ga0450892_019785 | |||
| 1771 | Ga0439458_0020070 | |||
| 1772 | Ga0451576_0301272 | |||
| 1773 | Ga0451576_0394580 | |||
| 1774 | Ga0495580_0417439 | |||
| 1775 | Ga0495632_0080157 | |||
| 1776 | Ga0495663_0000891 | |||
| 1777 | Ga0495640_0356745 | |||
| 1778 | Ga0495598_0000764 | |||
| 1779 | Ga0495621_0000016 | |||
| 1780 | Ga0495621_0024488 | |||
| 1781 | Ga0495668_0081774 | |||
| 1782 | Ga0495668_0346155 | |||
| 1783 | Ga0495658_0073232 | |||
| 1784 | Ga0495636_0021587 | |||
| 1785 | Ga0495684_0185145 | |||
| 1786 | Ga0496103_0597868 | |||
| 1787 | Ga0496104_0729866 | |||
| 1788 | Ga0496104_0905451 | |||
| 1789 | Ga0496106_0020516 | |||
| 1790 | Ga0496106_0026558 | |||
| 1791 | Ga0496106_0352608 | |||
| 1792 | Ga0496108_0037751 | |||
| 1793 | Ga0496108_0268904 | |||
| 1794 | Ga0496112_1185164 | |||
| 1795 | Ga0496113_0174346 | |||
| 1796 | Ga0496113_1201362 | |||
| 1797 | Ga0501292_001073 | |||
| 1798 | Ga0501292_004416 | |||
| 1799 | Ga0501292_028406 | |||
| 1800 | Ga0501296_005275 | |||
| 1801 | Ga0501297_010981 | |||
| 1802 | Ga0501298_000849 | |||
| 1803 | Ga0501298_009255 | |||
| 1804 | Ga0501298_030331 | |||
| 1805 | Ga0501299_013322 | |||
| 1806 | Ga0501300_041500 | |||
| 1807 | Ga0501031_0159623 | |||
| 1808 | Ga0501036_0586925 | |||
| 1809 | Ga0501038_0022901 | |||
| 1810 | Ga0501040_0275485 | |||
| 1811 | Ga0501072_0545758 | |||
| 1812 | Ga0501076_0443467 | |||
| 1813 | Ga0501198_039968 | |||
| 1814 | Ga0501202_016901 | |||
| 1815 | Ga0501202_081653 | |||
| 1816 | Ga0501206_013972 | |||
| 1817 | Ga0501207_008814 | |||
| 1818 | Ga0501207_046199 | |||
| 1819 | Ga0501216_001003 | |||
| 1820 | Ga0501216_084908 | |||
| 1821 | Ga0501217_000261 | |||
| 1822 | Ga0501217_021013 | |||
| 1823 | Ga0501223_003502 | |||
| 1824 | Ga0501223_014933 | |||
| 1825 | Ga0501223_032948 | |||
| 1826 | Ga0501223_067293 | |||
| 1827 | Ga0501224_029550 | |||
| 1828 | Ga0501224_034572 | |||
| 1829 | Ga0501227_000224 | |||
| 1830 | Ga0501227_097147 | |||
| 1831 | Ga0501227_105908 | |||
| 1832 | Ga0501233_001991 | |||
| 1833 | Ga0501233_013694 | |||
| 1834 | Ga0501233_033821 | |||
| 1835 | Ga0501235_000213 | |||
| 1836 | Ga0501235_003502 | |||
| 1837 | Ga0501235_017358 | |||
| 1838 | Ga0501235_022659 | |||
| 1839 | Ga0501239_034779 | |||
| 1840 | Ga0501242_033125 | |||
| 1841 | Ga0501243_001571 | |||
| 1842 | Ga0501243_022556 | |||
| 1843 | Ga0501247_055830 | |||
| 1844 | Ga0501249_090057 | |||
| 1845 | Ga0501253_022770 | |||
| 1846 | Ga0501253_045134 | |||
| 1847 | Ga0501257_096602 | |||
| 1848 | Ga0501257_121279 | |||
| 1849 | Ga0501259_024714 | |||
| 1850 | Ga0501259_065102 | |||
| 1851 | Ga0501260_020581 | |||
| 1852 | Ga0501261_004827 | |||
| 1853 | Ga0501219_012714 | |||
| 1854 | Ga0501221_021808 | |||
| 1855 | Ga0501221_036300 | |||
| 1856 | Ga0501221_065347 | |||
| 1857 | Ga0501225_0117117 | |||
| 1858 | Ga0501225_0139918 | |||
| 1859 | Ga0501234_004415 | |||
| 1860 | Ga0501079_0174402 | |||
| 1861 | Ga0501241_033376 | |||
| 1862 | Ga0501266_006017 | |||
| 1863 | Ga0501268_010129 | |||
| 1864 | Ga0501272_016181 | |||
| 1865 | Ga0501273_008737 | |||
| 1866 | Ga0501273_016122 | |||
| 1867 | Ga0501279_007853 | |||
| 1868 | Ga0501283_000552 | |||
| 1869 | Ga0501283_012075 | |||
| 1870 | Ga0501283_062179 | |||
| 1871 | Ga0501212_006202 | |||
| 1872 | Ga0501212_032467 | |||
| 1873 | Ga0501212_039129 | |||
| 1874 | Ga0501226_000157 | |||
| 1875 | nmdc:mga05p37_1115641_c1 | |||
| 1876 | nmdc:mga05p37_1166994_c1 | |||
| 1877 | nmdc:mga05p37_174771_c1 | |||
| 1878 | nmdc:mga05p37_386829_c1 | |||
| 1879 | nmdc:mga05p37_423591_c1 | |||
| 1880 | nmdc:mga05p37_452769_c1 | |||
| 1881 | nmdc:mga05p37_544429_c1 | |||
| 1882 | nmdc:mga05p37_608002_c1 | |||
| 1883 | nmdc:mga05p37_677906_c1 | |||
| 1884 | nmdc:mga05p37_772228_c1 | |||
| 1885 | nmdc:mga05p37_841088_c1 | |||
| 1886 | nmdc:mga05p37_91917_c1 | |||
| 1887 | nmdc:mga09592_107233_c1 | |||
| 1888 | nmdc:mga09592_1135009_c1 | |||
| 1889 | nmdc:mga09592_285496_c1 | |||
| 1890 | nmdc:mga0qj67_234185_c1 | |||
| 1891 | nmdc:mga0qj67_56399_c1 | |||
| 1892 | nmdc:mga06r32_225788_c1 | |||
| 1893 | nmdc:mga06r32_283216_c1 | |||
| 1894 | nmdc:mga06r32_375996_c1 | |||
| 1895 | nmdc:mga06r32_428987_c1 | |||
| 1896 | nmdc:mga08y16_1172535_c1 | |||
| 1897 | nmdc:mga08y16_148128_c1 | |||
| 1898 | nmdc:mga08y16_245832_c1 | |||
| 1899 | nmdc:mga08y16_501711_c1 | |||
| 1900 | nmdc:mga08y16_8295_c1 | |||
| 1901 | nmdc:mga0n895_151046_c1 | |||
| 1902 | nmdc:mga0n895_154749_c1 | |||
| 1903 | nmdc:mga0n895_315174_c1 | |||
| 1904 | nmdc:mga0n895_547011_c1 | |||
| 1905 | nmdc:mga0n895_642562_c1 | |||
| 1906 | nmdc:mga0n895_727295_c1 | |||
| 1907 | nmdc:mga0rr50_1253427_c1 | |||
| 1908 | nmdc:mga0a205_1033380_c1 | |||
| 1909 | nmdc:mga0a205_12842_c1 | |||
| 1910 | nmdc:mga0a205_133596_c1 | |||
| 1911 | nmdc:mga0a205_338121_c1 | |||
| 1912 | nmdc:mga0a205_416548_c1 | |||
| 1913 | nmdc:mga0a205_584393_c1 | |||
| 1914 | Ga0501084_0953280 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7udi-assembly1.cif.gz_B | full-length dimer of dna-damage response protein c from deinococcus radiodurans | 0.6835 | 99 | 147 |
| 6qm9-assembly1.cif.gz_B | cryo-em structure of calcium-bound nhtmem16 lipid scramblase in nanodisc (open state) | 0.6661 | 94 | 139 |
| 7y7o-assembly1.cif.gz_A | crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus | 0.6456 | 2 | 142 |
| 7y7o-assembly1.cif.gz_A | crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus | 0.5927 | 2 | 142 |
| 7kaq-assembly1.cif.gz_A | cryo-em structure of the sec complex from s. cerevisiae, sec61 pore mutant, class with sec62, conformation 2 (c2) | 0.5683 | 78 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGX9_1_163_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.5503 | 1 | 152 | 3.40.390.30 |
| 1oz9A00 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.5404 | 3 | 140 | 3.40.390.30 |
| 3e11B00 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.5361 | 9 | 129 | 3.30.2010.20 |
| 1oz9A00 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.5251 | 3 | 140 | 3.40.390.30 |
| 3e11B00 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.5214 | 9 | 129 | 3.30.2010.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2GHS4-F1-model_v4 | Uncharacterized protein | 0.8296 | 3 | 172 |
|
| AF-A0A0B6WXB6-F1-model_v4 | Uncharacterized protein | 0.8151 | 2 | 180 |
|
| AF-A0A2V8S589-F1-model_v4 | Transposase IS200-like domain-containing protein | 0.8124 | 25 | 178 |
|
| AF-M1YJ30-F1-model_v4 | IrrE N-terminal-like domain-containing protein | 0.8115 | 3 | 167 |
|
| AF-A0A7Y4UEC0-F1-model_v4 | Uncharacterized protein | 0.807 | 1 | 179 |
|