F486739

General Info

Members Datasets Scaffolds Average Seq Length
956 341 1912 169

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100135939|Ga0075430_1001359393
Length 205
Sequence MVLGFAGTFSPRSATTCALRHLPSSSPHSRRGGSTSTVTLRRVLVNDKMQQGYVYVCIEPAGRNFDPRFAPELTPKQMLELGVFGGKYMTDCRNEFPASWFTRAKLCAERHDPRLNYFGVNASQTLGEWWRKGWIHPQDPRGWFQWYCRYYMGRRTKDDARQIRRWRAIARHLAQIRNNCEPGDLDCRRRQRQAVLHWAYDSRNL

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
201 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
234 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
235 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
236 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
237 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
283 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
284 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
285 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
308 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
309 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
310 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
311 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
312 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
313 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
319 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 4.81
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100135939 3300006846 Bacteria 2048
2 JGI24750J21931_1032912 3300002070 Bacteria 766
3 Ga0065714_10147806 3300005288 Bacteria 1126
4 Ga0065712_10000670 3300005290 Bacteria 12756
5 Ga0065712_10007292 3300005290 Bacteria 3151
6 Ga0065712_10069731 3300005290 Bacteria 6791
7 Ga0065712_10146634 3300005290 Bacteria 1403
8 Ga0065712_10290796 3300005290 Bacteria 878
9 Ga0065715_10015126 3300005293 Bacteria 3170
10 Ga0065715_10094469 3300005293 Bacteria 4330
11 Ga0065715_10147963 3300005293 Bacteria 1764
12 Ga0065715_10174613 3300005293 Bacteria 1521
13 Ga0065707_10083956 3300005295 Bacteria 7902
14 Ga0065707_10198166 3300005295 Bacteria 1323
15 Ga0065707_10397181 3300005295 Bacteria 844
16 Ga0070658_10071719 3300005327 Bacteria 2837
17 Ga0070676_10097669 3300005328 Bacteria 1809
18 Ga0070676_10129161 3300005328 Unclassified 1596
19 Ga0070676_10392638 3300005328 Bacteria 963
20 Ga0070683_100002109 3300005329 Bacteria 15710
21 Ga0070690_100007742 3300005330 Bacteria 6159
22 Ga0070690_100013898 3300005330 Bacteria 4773
23 Ga0070690_100372467 3300005330 Bacteria 1042
24 Ga0070670_100000992 3300005331 Bacteria 22312
25 Ga0070670_100012248 3300005331 Bacteria 7337
26 Ga0070670_100018857 3300005331 Bacteria 5917
27 Ga0070670_100045797 3300005331 Bacteria 3760
28 Ga0070670_100531259 3300005331 Bacteria 1048
29 Ga0070677_10217042 3300005333 Bacteria 932
30 Ga0068869_100001307 3300005334 Bacteria 14746
31 Ga0068869_100097503 3300005334 Bacteria 2220
32 Ga0068869_100255953 3300005334 Bacteria 1400
33 Ga0068869_100586177 3300005334 Bacteria 940
34 Ga0070666_10013766 3300005335 Bacteria 5137
35 Ga0070666_10186993 3300005335 Bacteria 1454
36 Ga0070666_10426409 3300005335 Bacteria 956
37 Ga0070666_10928723 3300005335 Bacteria 644
38 Ga0070682_100272017 3300005337 Unclassified 1231
39 Ga0068868_100024692 3300005338 Bacteria 4563
40 Ga0070660_100344805 3300005339 Bacteria 1226
41 Ga0070689_100011750 3300005340 Bacteria 6281
42 Ga0070689_100042868 3300005340 Bacteria 3475
43 Ga0070689_100105274 3300005340 Bacteria 2237
44 Ga0070689_100294190 3300005340 Unclassified 1350
45 Ga0070689_101114907 3300005340 Bacteria 706
46 Ga0070691_10072479 3300005341 Bacteria 1673
47 Ga0070687_100007746 3300005343 Bacteria 4503
48 Ga0070687_100041058 3300005343 Bacteria 2335
49 Ga0070687_100042511 3300005343 Bacteria 2303
50 Ga0070687_100159066 3300005343 Bacteria 1334
51 Ga0070661_100079898 3300005344 Bacteria 2413
52 Ga0070692_10184654 3300005345 Bacteria 1211
53 Ga0070668_100027470 3300005347 Bacteria 4321
54 Ga0070668_100175302 3300005347 Bacteria 1748
55 Ga0070669_100038800 3300005353 Bacteria 3458
56 Ga0070669_100040560 3300005353 Bacteria 3384
57 Ga0070669_100230430 3300005353 Bacteria 1468
58 Ga0070669_100254565 3300005353 Unclassified 1399
59 Ga0070669_100338798 3300005353 Bacteria 1218
60 Ga0070669_100429898 3300005353 Bacteria 1085
61 Ga0070669_100554656 3300005353 Bacteria 958
62 Ga0070669_100561225 3300005353 Bacteria 953
63 Ga0070675_100000213 3300005354 Bacteria 37368
64 Ga0070675_100016897 3300005354 Bacteria 5794
65 Ga0070675_100018351 3300005354 Bacteria 5567
66 Ga0070675_100018565 3300005354 Bacteria 5538
67 Ga0070675_100145193 3300005354 Bacteria 2031
68 Ga0070675_100184746 3300005354 Bacteria 1804
69 Ga0070675_100228446 3300005354 Bacteria 1623
70 Ga0070675_100499074 3300005354 Bacteria 1096
71 Ga0070675_101007433 3300005354 Bacteria 765
72 Ga0070671_100013310 3300005355 Bacteria 6631
73 Ga0070671_100026741 3300005355 Bacteria 4745
74 Ga0070671_100418251 3300005355 Bacteria 1148
75 Ga0070671_100500654 3300005355 Bacteria 1045
76 Ga0070671_100754493 3300005355 Bacteria 846
77 Ga0070673_100014175 3300005364 Bacteria 5541
78 Ga0070673_100126441 3300005364 Bacteria 2139
79 Ga0070673_100253661 3300005364 Bacteria 1534
80 Ga0070673_100354509 3300005364 Bacteria 1303
81 Ga0070673_101049998 3300005364 Bacteria 760
82 Ga0070688_100015341 3300005365 Bacteria 4358
83 Ga0070688_100100697 3300005365 Bacteria 1904
84 Ga0070688_100106836 3300005365 Bacteria 1855
85 Ga0070688_100124840 3300005365 Bacteria 1729
86 Ga0070659_100407709 3300005366 Bacteria 1148
87 Ga0070659_100664662 3300005366 Bacteria 899
88 Ga0070667_100000213 3300005367 Bacteria 67548
89 Ga0070667_100000229 3300005367 Bacteria 64270
90 Ga0070667_100035502 3300005367 Bacteria 4177
91 Ga0070667_100061677 3300005367 Bacteria 3175
92 Ga0070667_100064543 3300005367 Bacteria 3107
93 Ga0070667_100116100 3300005367 Bacteria 2325
94 Ga0070714_100045607 3300005435 Bacteria 3716
95 Ga0070713_100034914 3300005436 Unclassified 4045
96 Ga0070701_10007383 3300005438 Bacteria 4692
97 Ga0070701_10066123 3300005438 Bacteria 1920
98 Ga0070700_100020231 3300005441 Bacteria 3852
99 Ga0070700_100072580 3300005441 Bacteria 2201
100 Ga0070700_100106784 3300005441 Unclassified 1854
101 Ga0070694_100020429 3300005444 Bacteria 4222
102 Ga0070663_100017427 3300005455 Bacteria 4688
103 Ga0070678_100020453 3300005456 Bacteria 4343
104 Ga0070678_100232081 3300005456 Bacteria 1539
105 Ga0070662_100008607 3300005457 Bacteria 6658
106 Ga0070662_100050442 3300005457 Bacteria 3002
107 Ga0070662_100429637 3300005457 Bacteria 1094
108 Ga0068867_100000506 3300005459 Bacteria 26008
109 Ga0068867_100035934 3300005459 Bacteria 3595
110 Ga0068867_100047960 3300005459 Bacteria 3141
111 Ga0068867_100175506 3300005459 Bacteria 1700
112 Ga0068867_100607359 3300005459 Bacteria 955
113 Ga0070685_10005922 3300005466 Bacteria 6221
114 Ga0070685_10008218 3300005466 Bacteria 5352
115 Ga0070707_100232851 3300005468 Bacteria 1793
116 Ga0070699_100116816 3300005518 Bacteria 2345
117 Ga0070684_100006800 3300005535 Bacteria 8869
118 Ga0070684_100018179 3300005535 Bacteria 5786
119 Ga0070684_100099405 3300005535 Bacteria 2597
120 Ga0068853_100639095 3300005539 Bacteria 1012
121 Ga0068853_101422876 3300005539 Bacteria 671
122 Ga0070672_100023273 3300005543 Bacteria 4563
123 Ga0070672_100023672 3300005543 Bacteria 4530
124 Ga0070672_100058721 3300005543 Bacteria 3025
125 Ga0070672_100082336 3300005543 Bacteria 2582
126 Ga0070672_100088399 3300005543 Bacteria 2495
127 Ga0070672_100109241 3300005543 Bacteria 2252
128 Ga0070672_100146009 3300005543 Bacteria 1955
129 Ga0070672_100271524 3300005543 Bacteria 1432
130 Ga0070672_100371166 3300005543 Bacteria 1222
131 Ga0070686_100003209 3300005544 Bacteria 8956
132 Ga0070686_100006603 3300005544 Bacteria 6459
133 Ga0070686_100011769 3300005544 Bacteria 4970
134 Ga0070686_100082624 3300005544 Bacteria 2131
135 Ga0070686_100118499 3300005544 Bacteria 1814
136 Ga0070686_101364127 3300005544 Bacteria 594
137 Ga0070695_100494210 3300005545 Bacteria 945
138 Ga0070695_100588043 3300005545 Bacteria 872
139 Ga0070696_100081107 3300005546 Bacteria 2298
140 Ga0070696_100330945 3300005546 Bacteria 1175
141 Ga0070665_100017249 3300005548 Bacteria 7245
142 Ga0070665_100026210 3300005548 Bacteria 5870
143 Ga0070665_100032621 3300005548 Bacteria 5241
144 Ga0070665_100040549 3300005548 Bacteria 4679
145 Ga0070665_100274042 3300005548 Bacteria 1689
146 Ga0070665_100375828 3300005548 Bacteria 1428
147 Ga0070704_100070993 3300005549 Bacteria 2528
148 Ga0070704_100087649 3300005549 Bacteria 2311
149 Ga0068855_100522458 3300005563 Bacteria 1288
150 Ga0070664_100004878 3300005564 Bacteria 10751
151 Ga0070664_100041653 3300005564 Bacteria 3875
152 Ga0070664_100043742 3300005564 Bacteria 3779
153 Ga0070664_100049024 3300005564 Bacteria 3571
154 Ga0070664_100146493 3300005564 Bacteria 2083
155 Ga0070664_100200027 3300005564 Bacteria 1783
156 Ga0070664_100208462 3300005564 Bacteria 1746
157 Ga0068857_100021274 3300005577 Bacteria 5709
158 Ga0068857_100093482 3300005577 Bacteria 2693
159 Ga0068857_100097871 3300005577 Bacteria 2631
160 Ga0068854_100001377 3300005578 Bacteria 14634
161 Ga0068854_100181656 3300005578 Bacteria 1644
162 Ga0068854_100188293 3300005578 Bacteria 1616
163 Ga0068854_100272951 3300005578 Bacteria 1358
164 Ga0068854_100314072 3300005578 Bacteria 1272
165 Ga0068856_100348345 3300005614 Bacteria 1500
166 Ga0070702_100012327 3300005615 Bacteria 4279
167 Ga0070702_100049737 3300005615 Bacteria 2392
168 Ga0068852_100350189 3300005616 Unclassified 1442
169 Ga0068852_100419946 3300005616 Bacteria 1319
170 Ga0068852_100623672 3300005616 Bacteria 1084
171 Ga0068859_100002473 3300005617 Bacteria 18792
172 Ga0068859_100003697 3300005617 Bacteria 15596
173 Ga0068859_100119934 3300005617 Bacteria 2697
174 Ga0068859_100233016 3300005617 Bacteria 1930
175 Ga0068859_100738278 3300005617 Unclassified 1074
176 Ga0068859_102000883 3300005617 Bacteria 640
177 Ga0068864_100013424 3300005618 Bacteria 6790
178 Ga0068864_100070470 3300005618 Bacteria 3042
179 Ga0068864_100093470 3300005618 Bacteria 2657
180 Ga0068864_100134112 3300005618 Bacteria 2228
181 Ga0068864_100217482 3300005618 Bacteria 1761
182 Ga0068864_100229265 3300005618 Bacteria 1717
183 Ga0068864_100248319 3300005618 Bacteria 1651
184 Ga0068864_100372034 3300005618 Bacteria 1352
185 Ga0068866_10082596 3300005718 Bacteria 1729
186 Ga0068866_10152476 3300005718 Bacteria 1340
187 Ga0068861_100008276 3300005719 Bacteria 7154
188 Ga0068861_100111803 3300005719 Bacteria 2189
189 Ga0068861_100169060 3300005719 Bacteria 1810
190 Ga0068861_100279634 3300005719 Bacteria 1437
191 Ga0068870_10009359 3300005840 Bacteria 4453
192 Ga0068870_10023803 3300005840 Bacteria 3024
193 Ga0068870_10346554 3300005840 Bacteria 952
194 Ga0068863_100015574 3300005841 Bacteria 7306
195 Ga0068863_100037788 3300005841 Bacteria 4595
196 Ga0068863_100103678 3300005841 Bacteria 2705
197 Ga0068863_100660962 3300005841 Bacteria 1037
198 Ga0068863_100744428 3300005841 Bacteria 976
199 Ga0068858_100053886 3300005842 Bacteria 3720
200 Ga0068858_100059058 3300005842 Bacteria 3545
201 Ga0068858_100168824 3300005842 Bacteria 2062
202 Ga0068858_100182585 3300005842 Bacteria 1981
203 Ga0068858_100718131 3300005842 Bacteria 973
204 Ga0068858_100795138 3300005842 Bacteria 923
205 Ga0068858_100856103 3300005842 Bacteria 888
206 Ga0068858_100902600 3300005842 Unclassified 864
207 Ga0068860_100002274 3300005843 Bacteria 20180
208 Ga0068860_100035275 3300005843 Bacteria 4798
209 Ga0068860_100137311 3300005843 Bacteria 2348
210 Ga0068860_100221399 3300005843 Bacteria 1838
211 Ga0068860_100306506 3300005843 Bacteria 1557
212 Ga0068860_100308970 3300005843 Unclassified 1550
213 Ga0068860_101006290 3300005843 Bacteria 851
214 Ga0068860_101817429 3300005843 Bacteria 631
215 Ga0068862_100220041 3300005844 Bacteria 1718
216 Ga0068862_100359107 3300005844 Bacteria 1353
217 Ga0068862_101038566 3300005844 Bacteria 812
218 Ga0068862_101714878 3300005844 Bacteria 637
219 Ga0081539_10003440 3300005985 Bacteria 19453
220 Ga0081539_10027061 3300005985 Bacteria 3641
221 Ga0075368_10010946 3300006042 Bacteria 3291
222 Ga0075364_10092532 3300006051 Bacteria 2007
223 Ga0075364_10152575 3300006051 Bacteria 1557
224 Ga0075362_10000633 3300006177 Bacteria 10306
225 Ga0075367_10017900 3300006178 Bacteria 3898
226 Ga0075367_10032799 3300006178 Bacteria 2990
227 Ga0075367_10316099 3300006178 Bacteria 984
228 Ga0075366_10002529 3300006195 Bacteria 9398
229 Ga0075366_10041208 3300006195 Bacteria 2734
230 Ga0097621_100023659 3300006237 Bacteria 4785
231 Ga0097621_100056576 3300006237 Bacteria 3205
232 Ga0075370_10070315 3300006353 Bacteria 2001
233 Ga0068871_100004257 3300006358 Bacteria 9922
234 Ga0068871_100010599 3300006358 Bacteria 6737
235 Ga0068871_100058818 3300006358 Bacteria 3130
236 Ga0068871_100089983 3300006358 Bacteria 2555
237 Ga0068871_100201070 3300006358 Bacteria 1720
238 Ga0068871_100332345 3300006358 Bacteria 1340
239 Ga0068871_100363796 3300006358 Bacteria 1282
240 Ga0068871_101112414 3300006358 Bacteria 739
241 Ga0075428_100038580 3300006844 Bacteria 5257
242 Ga0075428_100045484 3300006844 Bacteria 4823
243 Ga0075428_100514063 3300006844 Bacteria 1281
244 Ga0075428_100772386 3300006844 Bacteria 1022
245 Ga0075430_100017937 3300006846 Bacteria 6024
246 Ga0075430_100019920 3300006846 Bacteria 5708
247 Ga0075431_100123090 3300006847 Bacteria 2676
248 Ga0075431_100132981 3300006847 Bacteria 2565
249 Ga0075431_100191143 3300006847 Bacteria 2097
250 Ga0075433_10200567 3300006852 Bacteria 1774
251 Ga0075433_10864797 3300006852 Bacteria 789
252 Ga0075434_100192460 3300006871 Bacteria 2060
253 Ga0075434_101568959 3300006871 Bacteria 667
254 Ga0075429_100064694 3300006880 Bacteria 3185
255 Ga0075429_100072027 3300006880 Bacteria 3009
256 Ga0075429_100328003 3300006880 Bacteria 1339
257 Ga0075429_100541924 3300006880 Bacteria 1020
258 Ga0068865_100059256 3300006881 Bacteria 2677
259 Ga0068865_100207354 3300006881 Bacteria 1525
260 Ga0068865_100556866 3300006881 Bacteria 964
261 Ga0068865_100567016 3300006881 Bacteria 956
262 Ga0097620_100002473 3300006931 Bacteria 18792
263 Ga0097620_100003697 3300006931 Bacteria 15596
264 Ga0097620_100100865 3300006931 Bacteria 2943
265 Ga0097620_100119929 3300006931 Bacteria 2697
266 Ga0097620_100233008 3300006931 Bacteria 1930
267 Ga0097620_100738364 3300006931 Unclassified 1074
268 Ga0097620_100935263 3300006931 Bacteria 951
269 Ga0097620_102001180 3300006931 Bacteria 640
270 Ga0075435_100411524 3300007076 Bacteria 1164
271 Ga0105240_10002932 3300009093 Bacteria 26921
272 Ga0105240_11582013 3300009093 Bacteria 686
273 Ga0111539_10021405 3300009094 Bacteria 7958
274 Ga0111539_10030472 3300009094 Bacteria 6556
275 Ga0111539_10040028 3300009094 Bacteria 5645
276 Ga0111539_10081459 3300009094 Bacteria 3807
277 Ga0111539_10094514 3300009094 Bacteria 3512
278 Ga0111539_10167441 3300009094 Bacteria 2568
279 Ga0111539_10866246 3300009094 Bacteria 1051
280 Ga0111539_11259704 3300009094 Bacteria 858
281 Ga0111539_11437437 3300009094 Bacteria 800
282 Ga0105245_10068637 3300009098 Bacteria 3213
283 Ga0105245_10140779 3300009098 Bacteria 2272
284 Ga0105245_10897858 3300009098 Unclassified 928
285 Ga0105247_10405894 3300009101 Bacteria 972
286 Ga0114129_10070490 3300009147 Bacteria 4874
287 Ga0114129_10223208 3300009147 Bacteria 2541
288 Ga0114129_10709924 3300009147 Bacteria 1291
289 Ga0114129_10717368 3300009147 Bacteria 1283
290 Ga0105243_10091474 3300009148 Bacteria 2505
291 Ga0105243_10100495 3300009148 Bacteria 2400
292 Ga0105243_10100867 3300009148 Bacteria 2396
293 Ga0105243_10313171 3300009148 Bacteria 1427
294 Ga0105243_10814228 3300009148 Bacteria 922
295 Ga0105241_10047716 3300009174 Bacteria 3257
296 Ga0105241_10231035 3300009174 Bacteria 1559
297 Ga0105241_10317192 3300009174 Bacteria 1343
298 Ga0105241_10725600 3300009174 Bacteria 909
299 Ga0105241_11052195 3300009174 Bacteria 764
300 Ga0105242_10005714 3300009176 Bacteria 9594
301 Ga0105242_10020146 3300009176 Bacteria 5228
302 Ga0105242_10105206 3300009176 Bacteria 2397
303 Ga0105242_10413046 3300009176 Bacteria 1263
304 Ga0105242_10896336 3300009176 Bacteria 886
305 Ga0105242_11240308 3300009176 Bacteria 767
306 Ga0105248_10024596 3300009177 Bacteria 6696
307 Ga0105248_10036387 3300009177 Bacteria 5505
308 Ga0105248_10147582 3300009177 Bacteria 2654
309 Ga0105248_10178160 3300009177 Bacteria 2396
310 Ga0105248_10232636 3300009177 Bacteria 2074
311 Ga0105248_10238614 3300009177 Bacteria 2046
312 Ga0105248_10361537 3300009177 Bacteria 1634
313 Ga0105248_10445901 3300009177 Bacteria 1458
314 Ga0105248_10565783 3300009177 Bacteria 1282
315 Ga0105248_12103707 3300009177 Bacteria 642
316 Ga0105238_10267449 3300009551 Bacteria 1690
317 Ga0105238_10452613 3300009551 Unclassified 1281
318 Ga0105249_10013623 3300009553 Bacteria 7180
319 Ga0105249_10015432 3300009553 Bacteria 6761
320 Ga0105249_10119145 3300009553 Bacteria 2506
321 Ga0105239_10430331 3300010375 Bacteria 1496
322 Ga0105239_10615940 3300010375 Bacteria 1239
323 Ga0105246_10226222 3300011119 Bacteria 1470
324 Ga0105246_11096084 3300011119 Bacteria 727
325 Ga0157323_1018018 3300012495 Bacteria 643
326 Ga0157373_10028743 3300013100 Bacteria 4009
327 Ga0157369_11307666 3300013105 Unclassified 739
328 Ga0157374_10033973 3300013296 Bacteria 4656
329 Ga0157374_10084602 3300013296 Bacteria 3015
330 Ga0157374_10284200 3300013296 Bacteria 1634
331 Ga0157374_10465280 3300013296 Bacteria 1267
332 Ga0157374_10981925 3300013296 Bacteria 863
333 Ga0157374_11263188 3300013296 Unclassified 760
334 Ga0157378_10147779 3300013297 Bacteria 2187
335 Ga0157378_10211298 3300013297 Bacteria 1840
336 Ga0157378_10228085 3300013297 Bacteria 1773
337 Ga0157378_10451215 3300013297 Bacteria 1276
338 Ga0157378_10548141 3300013297 Bacteria 1161
339 Ga0163162_10431317 3300013306 Bacteria 1450
340 Ga0163162_10557442 3300013306 Bacteria 1274
341 Ga0163162_11110222 3300013306 Bacteria 896
342 Ga0163162_11488023 3300013306 Bacteria 771
343 Ga0157372_10019399 3300013307 Bacteria 7329
344 Ga0157372_10510269 3300013307 Bacteria 1402
345 Ga0157372_10926316 3300013307 Bacteria 1010
346 Ga0157375_10013766 3300013308 Bacteria 7212
347 Ga0157375_10022749 3300013308 Bacteria 5772
348 Ga0157375_10037078 3300013308 Bacteria 4668
349 Ga0157375_10121912 3300013308 Bacteria 2717
350 Ga0157375_10280843 3300013308 Bacteria 1828
351 Ga0157375_10329688 3300013308 Bacteria 1691
352 Ga0157375_10489568 3300013308 Bacteria 1394
353 Ga0163163_10014083 3300014325 Bacteria 7343
354 Ga0163163_10027774 3300014325 Bacteria 5426
355 Ga0163163_10061462 3300014325 Bacteria 3722
356 Ga0163163_10063187 3300014325 Bacteria 3670
357 Ga0163163_10144309 3300014325 Bacteria 2423
358 Ga0163163_10179746 3300014325 Unclassified 2163
359 Ga0163163_10625275 3300014325 Bacteria 1140
360 Ga0163163_11031027 3300014325 Bacteria 886
361 Ga0163163_11039584 3300014325 Bacteria 882
362 Ga0163163_11142727 3300014325 Bacteria 841
363 Ga0163163_11514714 3300014325 Bacteria 732
364 Ga0157380_10224313 3300014326 Bacteria 1683
365 Ga0157380_10255726 3300014326 Bacteria 1588
366 Ga0157380_10805223 3300014326 Bacteria 957
367 Ga0157380_11180308 3300014326 Bacteria 808
368 Ga0157377_10008880 3300014745 Bacteria 4916
369 Ga0157377_10018481 3300014745 Bacteria 3623
370 Ga0157377_10060176 3300014745 Bacteria 2167
371 Ga0157377_10193057 3300014745 Bacteria 1288
372 Ga0157377_10324653 3300014745 Bacteria 1024
373 Ga0157379_10059863 3300014968 Bacteria 3406
374 Ga0157379_10645099 3300014968 Bacteria 991
375 Ga0157376_10024658 3300014969 Bacteria 4726
376 Ga0157376_10063165 3300014969 Bacteria 3118
377 Ga0157376_10082015 3300014969 Bacteria 2770
378 Ga0157376_10230369 3300014969 Bacteria 1720
379 Ga0157376_10594924 3300014969 Bacteria 1100
380 Ga0157376_11131300 3300014969 Bacteria 809
381 Ga0182007_10040076 3300015262 Bacteria 1565
382 Ga0182005_1042886 3300015265 Bacteria 1230
383 Ga0182005_1128844 3300015265 Bacteria 725
384 Ga0163161_10053714 3300017792 Bacteria 2922
385 Ga0163161_10294770 3300017792 Bacteria 1276
386 Ga0213873_10049291 3300021358 Bacteria 1110
387 Ga0213876_10156411 3300021384 Bacteria 1212
388 Ga0207666_1008484 3300025271 Bacteria 1374
389 Ga0207697_10044644 3300025315 Bacteria 1824
390 Ga0207682_10084116 3300025893 Bacteria 1369
391 Ga0207682_10107737 3300025893 Bacteria 1224
392 Ga0207682_10329890 3300025893 Bacteria 717
393 Ga0207642_10267500 3300025899 Bacteria 977
394 Ga0207710_10152131 3300025900 Bacteria 1123
395 Ga0207688_10005943 3300025901 Bacteria 6643
396 Ga0207688_10090248 3300025901 Bacteria 1759
397 Ga0207688_10096732 3300025901 Bacteria 1701
398 Ga0207680_10004597 3300025903 Bacteria 6550
399 Ga0207680_10166776 3300025903 Bacteria 1481
400 Ga0207680_10199474 3300025903 Bacteria 1363
401 Ga0207680_10355851 3300025903 Bacteria 1029
402 Ga0207645_10016674 3300025907 Bacteria 4859
403 Ga0207645_10018504 3300025907 Bacteria 4582
404 Ga0207645_10031356 3300025907 Bacteria 3421
405 Ga0207645_10157468 3300025907 Bacteria 1485
406 Ga0207645_10437448 3300025907 Bacteria 882
407 Ga0207643_10002418 3300025908 Bacteria 10109
408 Ga0207643_10024519 3300025908 Bacteria 3329
409 Ga0207643_10188193 3300025908 Bacteria 1252
410 Ga0207705_10083174 3300025909 Bacteria 2335
411 Ga0207654_10059392 3300025911 Bacteria 2230
412 Ga0207695_10032334 3300025913 Bacteria 5726
413 Ga0207671_10107005 3300025914 Bacteria 2124
414 Ga0207662_10023481 3300025918 Bacteria 3543
415 Ga0207662_10056994 3300025918 Bacteria 2335
416 Ga0207662_10075243 3300025918 Bacteria 2051
417 Ga0207657_10743837 3300025919 Bacteria 760
418 Ga0207657_11000233 3300025919 Bacteria 641
419 Ga0207649_10734255 3300025920 Bacteria 767
420 Ga0207646_10847590 3300025922 Bacteria 812
421 Ga0207681_10014708 3300025923 Bacteria 4872
422 Ga0207681_10082077 3300025923 Bacteria 2278
423 Ga0207681_10385257 3300025923 Bacteria 1129
424 Ga0207681_10687297 3300025923 Bacteria 850
425 Ga0207681_11003585 3300025923 Bacteria 700
426 Ga0207694_10203804 3300025924 Unclassified 1610
427 Ga0207694_10719081 3300025924 Bacteria 842
428 Ga0207650_10007667 3300025925 Bacteria 7351
429 Ga0207650_10009394 3300025925 Bacteria 6684
430 Ga0207650_10026237 3300025925 Bacteria 4155
431 Ga0207650_10159957 3300025925 Bacteria 1784
432 Ga0207650_10228560 3300025925 Bacteria 1500
433 Ga0207650_10228810 3300025925 Bacteria 1499
434 Ga0207650_10395191 3300025925 Bacteria 1144
435 Ga0207650_10474600 3300025925 Bacteria 1043
436 Ga0207659_10002411 3300025926 Bacteria 11129
437 Ga0207659_10025809 3300025926 Bacteria 3955
438 Ga0207659_10031754 3300025926 Bacteria 3619
439 Ga0207659_10060319 3300025926 Bacteria 2730
440 Ga0207659_10161427 3300025926 Bacteria 1760
441 Ga0207659_10359400 3300025926 Bacteria 1210
442 Ga0207659_10531984 3300025926 Bacteria 998
443 Ga0207659_11111433 3300025926 Bacteria 680
444 Ga0207687_10180990 3300025927 Bacteria 1633
445 Ga0207700_10025744 3300025928 Unclassified 4091
446 Ga0207700_10618552 3300025928 Bacteria 964
447 Ga0207664_10051251 3300025929 Bacteria 3258
448 Ga0207644_10018820 3300025931 Bacteria 4679
449 Ga0207644_10031085 3300025931 Bacteria 3718
450 Ga0207644_10042288 3300025931 Bacteria 3229
451 Ga0207644_10338891 3300025931 Bacteria 1219
452 Ga0207644_10543482 3300025931 Bacteria 961
453 Ga0207690_10601294 3300025932 Bacteria 898
454 Ga0207690_10953453 3300025932 Bacteria 713
455 Ga0207706_10024065 3300025933 Bacteria 5463
456 Ga0207706_10026388 3300025933 Bacteria 5200
457 Ga0207706_10075462 3300025933 Bacteria 2965
458 Ga0207706_10121738 3300025933 Bacteria 2294
459 Ga0207706_10309067 3300025933 Bacteria 1377
460 Ga0207686_10029796 3300025934 Bacteria 3224
461 Ga0207686_10143074 3300025934 Bacteria 1656
462 Ga0207686_10767981 3300025934 Bacteria 771
463 Ga0207709_10109529 3300025935 Bacteria 1844
464 Ga0207709_10113803 3300025935 Bacteria 1814
465 Ga0207709_10163118 3300025935 Bacteria 1556
466 Ga0207670_10020146 3300025936 Bacteria 4092
467 Ga0207670_10049276 3300025936 Bacteria 2816
468 Ga0207670_10601463 3300025936 Bacteria 903
469 Ga0207670_11030923 3300025936 Bacteria 693
470 Ga0207704_10028215 3300025938 Bacteria 3110
471 Ga0207704_11221729 3300025938 Bacteria 641
472 Ga0207691_10030467 3300025940 Bacteria 5041
473 Ga0207691_10037997 3300025940 Bacteria 4456
474 Ga0207691_10067769 3300025940 Bacteria 3226
475 Ga0207691_10213905 3300025940 Bacteria 1674
476 Ga0207691_10277433 3300025940 Bacteria 1443
477 Ga0207691_10371055 3300025940 Bacteria 1222
478 Ga0207691_10459115 3300025940 Bacteria 1083
479 Ga0207711_10058635 3300025941 Bacteria 3314
480 Ga0207711_10067863 3300025941 Bacteria 3088
481 Ga0207711_10115426 3300025941 Bacteria 2393
482 Ga0207711_10116350 3300025941 Bacteria 2383
483 Ga0207711_10398193 3300025941 Bacteria 1279
484 Ga0207711_10690644 3300025941 Bacteria 952
485 Ga0207711_10783733 3300025941 Bacteria 888
486 Ga0207711_10806548 3300025941 Bacteria 874
487 Ga0207711_10859520 3300025941 Bacteria 844
488 Ga0207689_10007584 3300025942 Bacteria 9505
489 Ga0207689_10140612 3300025942 Bacteria 1988
490 Ga0207689_10252678 3300025942 Bacteria 1458
491 Ga0207689_10346814 3300025942 Bacteria 1234
492 Ga0207661_10018214 3300025944 Bacteria 5215
493 Ga0207661_11152360 3300025944 Bacteria 714
494 Ga0207679_10015516 3300025945 Bacteria 5036
495 Ga0207679_10030460 3300025945 Bacteria 3768
496 Ga0207679_10053461 3300025945 Bacteria 2968
497 Ga0207679_10102510 3300025945 Bacteria 2241
498 Ga0207679_10143804 3300025945 Bacteria 1931
499 Ga0207667_10087759 3300025949 Bacteria 3218
500 Ga0207667_10422952 3300025949 Bacteria 1355
501 Ga0207651_10043066 3300025960 Bacteria 3010
502 Ga0207651_10045402 3300025960 Bacteria 2947
503 Ga0207651_10073382 3300025960 Bacteria 2433
504 Ga0207651_10105609 3300025960 Bacteria 2101
505 Ga0207651_11297774 3300025960 Bacteria 654
506 Ga0207712_10002109 3300025961 Bacteria 13016
507 Ga0207712_10079646 3300025961 Bacteria 2380
508 Ga0207712_11456963 3300025961 Bacteria 613
509 Ga0207668_10081556 3300025972 Bacteria 2347
510 Ga0207668_10250476 3300025972 Bacteria 1438
511 Ga0207640_10021839 3300025981 Bacteria 3820
512 Ga0207640_10043027 3300025981 Bacteria 2884
513 Ga0207640_10047757 3300025981 Bacteria 2763
514 Ga0207640_10220096 3300025981 Bacteria 1453
515 Ga0207658_10000078 3300025986 Bacteria 108156
516 Ga0207658_10000194 3300025986 Bacteria 64273
517 Ga0207658_10052037 3300025986 Bacteria 3021
518 Ga0207658_10063641 3300025986 Bacteria 2765
519 Ga0207658_11171063 3300025986 Bacteria 703
520 Ga0207703_10023503 3300026035 Bacteria 4843
521 Ga0207703_10041763 3300026035 Bacteria 3677
522 Ga0207703_10071430 3300026035 Bacteria 2867
523 Ga0207703_10176013 3300026035 Bacteria 1885
524 Ga0207703_10178184 3300026035 Bacteria 1874
525 Ga0207703_10366369 3300026035 Bacteria 1330
526 Ga0207703_10881516 3300026035 Bacteria 856
527 Ga0207639_10524322 3300026041 Bacteria 1085
528 Ga0207678_10020734 3300026067 Bacteria 5762
529 Ga0207678_10063800 3300026067 Bacteria 3166
530 Ga0207708_10026067 3300026075 Bacteria 4423
531 Ga0207708_10037405 3300026075 Bacteria 3697
532 Ga0207708_10042040 3300026075 Unclassified 3484
533 Ga0207708_10148956 3300026075 Bacteria 1841
534 Ga0207708_10373195 3300026075 Bacteria 1175
535 Ga0207702_10776477 3300026078 Bacteria 946
536 Ga0207641_10003015 3300026088 Bacteria 15204
537 Ga0207641_10100820 3300026088 Bacteria 2543
538 Ga0207641_10236271 3300026088 Bacteria 1701
539 Ga0207641_10686987 3300026088 Bacteria 1007
540 Ga0207641_10744729 3300026088 Archaea 967
541 Ga0207641_11543579 3300026088 Bacteria 666
542 Ga0207641_11789197 3300026088 Bacteria 616
543 Ga0207648_10001503 3300026089 Bacteria 25692
544 Ga0207648_10032267 3300026089 Bacteria 4625
545 Ga0207648_10186512 3300026089 Bacteria 1837
546 Ga0207648_10321949 3300026089 Bacteria 1389
547 Ga0207648_10411032 3300026089 Bacteria 1227
548 Ga0207676_10043054 3300026095 Bacteria 3474
549 Ga0207676_10093994 3300026095 Bacteria 2470
550 Ga0207676_10160668 3300026095 Bacteria 1946
551 Ga0207676_10209038 3300026095 Bacteria 1730
552 Ga0207676_10253399 3300026095 Bacteria 1586
553 Ga0207676_10259414 3300026095 Bacteria 1568
554 Ga0207676_10353477 3300026095 Bacteria 1360
555 Ga0207676_10455738 3300026095 Bacteria 1206
556 Ga0207676_10637236 3300026095 Bacteria 1027
557 Ga0207676_11171393 3300026095 Bacteria 761
558 Ga0207674_10016506 3300026116 Bacteria 8081
559 Ga0207674_10054357 3300026116 Bacteria 4076
560 Ga0207674_10074717 3300026116 Bacteria 3400
561 Ga0207674_10305129 3300026116 Bacteria 1541
562 Ga0207674_11472305 3300026116 Bacteria 650
563 Ga0207675_100012907 3300026118 Bacteria 7802
564 Ga0207675_100052335 3300026118 Bacteria 3810
565 Ga0207675_100156923 3300026118 Bacteria 2169
566 Ga0207675_100211881 3300026118 Bacteria 1864
567 Ga0207675_100286323 3300026118 Bacteria 1602
568 Ga0207675_100568951 3300026118 Bacteria 1134
569 Ga0207675_100664115 3300026118 Bacteria 1049
570 Ga0207683_10060370 3300026121 Bacteria 3333
571 Ga0207683_10168922 3300026121 Bacteria 1980
572 Ga0207683_10173951 3300026121 Bacteria 1951
573 Ga0207683_10359261 3300026121 Bacteria 1337
574 Ga0207683_10385049 3300026121 Bacteria 1289
575 Ga0207698_10196225 3300026142 Unclassified 1804
576 Ga0207698_10322924 3300026142 Bacteria 1446
577 Ga0209984_1007877 3300027424 Bacteria 1331
578 Ga0210000_1010262 3300027462 Unclassified 1385
579 Ga0209995_1015350 3300027471 Bacteria 1256
580 Ga0209968_1039819 3300027526 Unclassified 802
581 Ga0209982_1009029 3300027552 Bacteria 1468
582 Ga0209970_1014664 3300027614 Bacteria 1302
583 Ga0209983_1007100 3300027665 Unclassified 2299
584 Ga0209971_1001948 3300027682 Bacteria 5047
585 Ga0209998_10082150 3300027717 Unclassified 782
586 Ga0209813_10061327 3300027866 Bacteria 1201
587 Ga0209974_10008070 3300027876 Bacteria 3609
588 Ga0209974_10122284 3300027876 Bacteria 923
589 Ga0207428_10000986 3300027907 Bacteria 31515
590 Ga0207428_10001229 3300027907 Bacteria 27466
591 Ga0207428_10080298 3300027907 Bacteria 2548
592 Ga0207428_10125911 3300027907 Bacteria 1962
593 Ga0207428_10155324 3300027907 Bacteria 1740
594 Ga0207428_10676329 3300027907 Bacteria 739
595 Ga0268266_10013254 3300028379 Bacteria 7107
596 Ga0268266_10016303 3300028379 Bacteria 6352
597 Ga0268266_10069157 3300028379 Bacteria 3059
598 Ga0268266_10078714 3300028379 Bacteria 2869
599 Ga0268266_10240999 3300028379 Bacteria 1669
600 Ga0268266_10251764 3300028379 Bacteria 1634
601 Ga0268266_10288410 3300028379 Bacteria 1528
602 Ga0268265_10035441 3300028380 Bacteria 3646
603 Ga0268265_10290484 3300028380 Bacteria 1467
604 Ga0268265_10927637 3300028380 Bacteria 856
605 Ga0268264_10003297 3300028381 Bacteria 13950
606 Ga0268264_10023965 3300028381 Bacteria 4979
607 Ga0268264_10132307 3300028381 Bacteria 2213
608 Ga0268264_10279131 3300028381 Unclassified 1564
609 Ga0268264_10325468 3300028381 Bacteria 1455
610 Ga0268264_10348105 3300028381 Bacteria 1409
611 Ga0268264_10448640 3300028381 Bacteria 1249
612 Ga0268264_10860550 3300028381 Bacteria 908
613 Ga0265330_10016597 3300031235 Bacteria 3395
614 Ga0265331_10000002 3300031250 Bacteria 511481
615 Ga0265316_10209567 3300031344 Bacteria 1442
616 Ga0307408_100004800 3300031548 Bacteria 9105
617 Ga0307408_100342566 3300031548 Bacteria 1266
618 Ga0265314_10000068 3300031711 Bacteria 155429
619 Ga0265314_10040552 3300031711 Bacteria 3340
620 Ga0307413_10059899 3300031824 Bacteria 2341
621 Ga0307413_10313653 3300031824 Bacteria 1195
622 Ga0307413_10637969 3300031824 Bacteria 877
623 Ga0307410_10064928 3300031852 Bacteria 2510
624 Ga0307410_10223468 3300031852 Bacteria 1450
625 Ga0307410_10442744 3300031852 Bacteria 1058
626 Ga0307410_10691758 3300031852 Bacteria 859
627 Ga0307406_11140681 3300031901 Bacteria 675
628 Ga0307406_11285774 3300031901 Bacteria 638
629 Ga0307407_10001191 3300031903 Bacteria 9184
630 Ga0307407_10741258 3300031903 Bacteria 743
631 Ga0307412_10019644 3300031911 Bacteria 4097
632 Ga0307412_10043227 3300031911 Bacteria 2933
633 Ga0307409_100027014 3300031995 Bacteria 4060
634 Ga0307416_100002197 3300032002 Bacteria 11084
635 Ga0307416_100667693 3300032002 Bacteria 1126
636 Ga0307414_10277816 3300032004 Bacteria 1406
637 Ga0307414_10474657 3300032004 Bacteria 1102
638 Ga0307411_10205383 3300032005 Bacteria 1516
639 Ga0307411_11476351 3300032005 Bacteria 624
640 Ga0307415_100001053 3300032126 Bacteria 12803
641 Ga0373950_0001108 3300034818 Bacteria 3446
642 Ga0373958_0009237 3300034819 Bacteria 1618
643 Ga0373959_0000578 3300034820 Bacteria 6410
644 Ga0373928_0017200 3300035084 Bacteria 1486
645 Ga0373928_0097699 3300035084 Bacteria 762
646 Ga0373929_0003025 3300035085 Bacteria 3060
647 Ga0373940_0006689 3300035088 Bacteria 2571
648 Ga0373949_0088483 3300035090 Bacteria 834
649 Ga0373951_0000494 3300035091 Bacteria 11194
650 Ga0373952_0001291 3300035092 Bacteria 4580
651 Ga0373952_0026915 3300035092 Bacteria 1252
652 Ga0373932_0001364 3300035112 Bacteria 6842
653 Ga0373932_0048787 3300035112 Bacteria 1249
654 Ga0373936_0138899 3300035113 Bacteria 1048
655 Ga0373939_0002808 3300035114 Bacteria 4088
656 Ga0373939_0207887 3300035114 Bacteria 743
657 Ga0373941_0001203 3300035115 Bacteria 5410
658 Ga0373941_0016058 3300035115 Bacteria 2028
659 Ga0373956_0075930 3300035119 Bacteria 1537
660 Ga0373956_0177859 3300035119 Bacteria 1005
661 Ga0373960_0004265 3300035121 Bacteria 3266
662 Ga0373960_0027153 3300035121 Bacteria 1570
663 Ga0373943_0306242 3300035170 Bacteria 903
664 Ga0373955_0034545 3300035172 Bacteria 2672
665 Ga0373942_0002787 3300035207 Bacteria 4164
666 Ga0373961_0003130 3300035241 Bacteria 4134
667 Ga0373962_0000256 3300035242 Bacteria 11349
668 Ga0316574_0029836 3300035398 Bacteria 3298
669 Ga0373931_0034347 3300035691 Unclassified 2632
670 Ga0373931_0459073 3300035691 Bacteria 816
671 Ga0373931_0482760 3300035691 Bacteria 797
672 Ga0373935_0316725 3300035692 Bacteria 1106
673 Ga0373933_0210742 3300035724 Bacteria 1245
674 Ga0373937_0005187 3300036401 Bacteria 11117
675 Ga0373937_0014513 3300036401 Bacteria 6956
676 Ga0373937_0367084 3300036401 Bacteria 1365
677 Ga0316584_0680275 3300036712 Bacteria 707
678 Ga0373925_0087753 3300037068 Bacteria 2375
679 Ga0373925_0125571 3300037068 Bacteria 1996
680 Ga0373925_0595178 3300037068 Bacteria 911
681 Ga0395905_0000937 3300037471 Bacteria 37558
682 Ga0395901_0385808 3300038443 Bacteria 1441
683 Ga0436365_1434392 3300039437 Bacteria 2380
684 Ga0436363_1190504 3300039450 Bacteria 1546
685 Ga0436362_0309424 3300039453 Unclassified 3082
686 Ga0436362_0948466 3300039453 Bacteria 1143
687 Ga0451793_0928718 3300041452 Bacteria 552
688 Ga0451807_1117510 3300041486 Unclassified 2025
689 Ga0439450_022178 3300042008 Bacteria 1369
690 Ga0439456_053880 3300042013 Bacteria 880
691 Ga0439462_0001194 3300042015 Bacteria 5680
692 Ga0450898_131033 3300042134 Bacteria 540
693 Ga0439444_0023332 3300042437 Bacteria 1110
694 Ga0451577_0078547 3300042876 Bacteria 2942
695 Ga0451577_0139195 3300042876 Bacteria 2180
696 Ga0439440_0010306 3300042993 Bacteria 1951
697 Ga0439440_0146207 3300042993 Bacteria 674
698 Ga0453683_0024944 3300044673 Bacteria 3800
699 Ga0453683_0362544 3300044673 Bacteria 932
700 Ga0466965_0095589 3300044683 Bacteria 1515
701 Ga0453684_0152163 3300044712 Bacteria 2748
702 Ga0453684_0294739 3300044712 Bacteria 1845
703 Ga0453684_0395611 3300044712 Unclassified 1549
704 Ga0453684_0858569 3300044712 Archaea 975
705 Ga0453684_1276461 3300044712 Bacteria 767
706 Ga0453684_1337847 3300044712 Bacteria 746
707 Ga0453684_1350223 3300044712 Unclassified 741
708 Ga0466959_0222542 3300045049 Bacteria 1308
709 Ga0451576_0013097 3300045051 Bacteria 9287
710 Ga0451576_0074780 3300045051 Archaea 3525
711 Ga0451576_0094013 3300045051 Unclassified 3117
712 Ga0451576_0232420 3300045051 Bacteria 1926
713 Ga0451576_0361806 3300045051 Bacteria 1520
714 Ga0451576_0920206 3300045051 Unclassified 917
715 Ga0451576_0932856 3300045051 Bacteria 910
716 Ga0451576_1395056 3300045051 Bacteria 729
717 Ga0466967_1038189 3300045976 Unclassified 816
718 Ga0495592_0326203 3300046454 Bacteria 991
719 Ga0495592_0829589 3300046454 Bacteria 547
720 Ga0495629_0113362 3300046459 Bacteria 1890
721 Ga0495629_0602015 3300046459 Bacteria 735
722 Ga0495662_0386201 3300046476 Bacteria 688
723 Ga0495664_0463156 3300046477 Bacteria 759
724 Ga0495594_0133033 3300046499 Bacteria 1409
725 Ga0495594_0146166 3300046499 Bacteria 1341
726 Ga0495594_0279989 3300046499 Bacteria 950
727 Ga0495608_0293995 3300046511 Bacteria 1006
728 Ga0495630_0417602 3300046517 Bacteria 1028
729 Ga0495630_0980810 3300046517 Bacteria 642
730 Ga0495640_0209752 3300046533 Bacteria 1232
731 Ga0495586_0106763 3300046535 Bacteria 1557
732 Ga0495586_0108801 3300046535 Bacteria 1542
733 Ga0495598_0004939 3300046537 Bacteria 2923
734 Ga0495598_0137367 3300046537 Unclassified 843
735 Ga0495621_0111446 3300046539 Bacteria 1050
736 Ga0495645_0001309 3300046543 Bacteria 16906
737 Ga0495645_0111609 3300046543 Bacteria 1934
738 Ga0495667_0149704 3300046559 Unclassified 1503
739 Ga0495667_0429872 3300046559 Bacteria 831
740 Ga0495656_0380244 3300046615 Unclassified 736
741 Ga0495635_0059689 3300046663 Bacteria 2623
742 Ga0495635_0619169 3300046663 Bacteria 706
743 Ga0495647_0067612 3300046681 Bacteria 1424
744 Ga0495658_0654607 3300046683 Bacteria 673
745 Ga0495613_0104490 3300046689 Bacteria 2045
746 Ga0495613_0116836 3300046689 Bacteria 1918
747 Ga0495600_0154543 3300046809 Bacteria 1484
748 Ga0495600_0221291 3300046809 Bacteria 1211
749 Ga0495600_0404567 3300046809 Bacteria 849
750 Ga0495680_0757009 3300047322 Bacteria 637
751 Ga0495684_0160700 3300047471 Bacteria 1676
752 Ga0495684_0180398 3300047471 Bacteria 1565
753 Ga0496100_0115182 3300048903 Bacteria 1874
754 Ga0496100_0690940 3300048903 Bacteria 796
755 Ga0496101_0106685 3300048904 Bacteria 2104
756 Ga0496101_0130204 3300048904 Bacteria 1910
757 Ga0496102_0113691 3300048905 Bacteria 2526
758 Ga0496104_0015625 3300048907 Bacteria 6882
759 Ga0496104_0052523 3300048907 Bacteria 3850
760 Ga0496104_0095410 3300048907 Bacteria 2845
761 Ga0496104_0140009 3300048907 Bacteria 2325
762 Ga0496104_0190653 3300048907 Bacteria 1961
763 Ga0496104_0324330 3300048907 Bacteria 1453
764 Ga0496105_0115464 3300048908 Bacteria 2214
765 Ga0496105_0196488 3300048908 Bacteria 1648
766 Ga0496105_0887897 3300048908 Bacteria 673
767 Ga0496106_0090363 3300048909 Bacteria 2363
768 Ga0496107_0259567 3300048910 Bacteria 1293
769 Ga0496108_0012243 3300048911 Bacteria 6977
770 Ga0496108_0019872 3300048911 Bacteria 5516
771 Ga0496109_0008221 3300048912 Bacteria 8856
772 Ga0496109_0024535 3300048912 Bacteria 5362
773 Ga0496109_0033399 3300048912 Bacteria 4629
774 Ga0496109_0758831 3300048912 Bacteria 908
775 Ga0496110_0023890 3300048913 Bacteria 5204
776 Ga0496110_0037029 3300048913 Bacteria 4239
777 Ga0496110_0309941 3300048913 Bacteria 1438
778 Ga0496110_0522547 3300048913 Bacteria 1080
779 Ga0496111_0014197 3300048914 Bacteria 5435
780 Ga0496111_0072778 3300048914 Bacteria 2502
781 Ga0496112_0006637 3300048915 Bacteria 10188
782 Ga0496112_0023201 3300048915 Bacteria 5923
783 Ga0496112_0041609 3300048915 Bacteria 4496
784 Ga0496112_0046829 3300048915 Bacteria 4242
785 Ga0496112_0165976 3300048915 Bacteria 2174
786 Ga0496112_0286306 3300048915 Bacteria 1594
787 Ga0496112_0790312 3300048915 Bacteria 874
788 Ga0496113_0016795 3300048916 Bacteria 5064
789 Ga0496113_0058553 3300048916 Bacteria 2899
790 Ga0496113_1343962 3300048916 Bacteria 555
791 Ga0496114_0084502 3300048917 Bacteria 2688
792 Ga0496114_0244341 3300048917 Bacteria 1579
793 Ga0496114_0257695 3300048917 Bacteria 1535
794 Ga0496114_0419480 3300048917 Bacteria 1185
795 Ga0496114_0497683 3300048917 Bacteria 1078
796 Ga0496115_0514767 3300048918 Bacteria 960
797 Ga0501292_007543 3300049515 Bacteria 1574
798 Ga0501297_002481 3300049520 Bacteria 1784
799 Ga0501297_016844 3300049520 Unclassified 886
800 Ga0501299_014500 3300049522 Bacteria 1372
801 Ga0501303_004585 3300049526 Bacteria 1147
802 Ga0501031_0277137 3300049568 Unclassified 1088
803 Ga0501032_0561760 3300049569 Bacteria 727
804 Ga0501033_0162727 3300049570 Unclassified 1606
805 Ga0501033_0223866 3300049570 Bacteria 1338
806 Ga0501033_0254345 3300049570 Bacteria 1244
807 Ga0501034_0013072 3300049571 Bacteria 8554
808 Ga0501036_0041712 3300049572 Bacteria 3883
809 Ga0501036_0119144 3300049572 Unclassified 2229
810 Ga0501036_0207947 3300049572 Bacteria 1645
811 Ga0501036_0899937 3300049572 Bacteria 726
812 Ga0501038_0196610 3300049574 Unclassified 1620
813 Ga0501038_0242326 3300049574 Bacteria 1431
814 Ga0501038_0422897 3300049574 Bacteria 1028
815 Ga0501039_0023492 3300049575 Unclassified 4732
816 Ga0501039_0107321 3300049575 Unclassified 2181
817 Ga0501039_0192161 3300049575 Bacteria 1605
818 Ga0501040_0373526 3300049576 Bacteria 1023
819 Ga0501040_0415954 3300049576 Bacteria 966
820 Ga0501040_0820219 3300049576 Bacteria 673
821 Ga0501041_0020516 3300049577 Bacteria 3953
822 Ga0501041_0030573 3300049577 Unclassified 3251
823 Ga0501041_0047194 3300049577 Unclassified 2622
824 Ga0501041_0123195 3300049577 Bacteria 1612
825 Ga0501041_0579788 3300049577 Bacteria 715
826 Ga0501042_0060658 3300049578 Unclassified 2701
827 Ga0501042_0126036 3300049578 Bacteria 1844
828 Ga0501042_0202625 3300049578 Bacteria 1431
829 Ga0501042_0514315 3300049578 Unclassified 869
830 Ga0501043_0167824 3300049579 Bacteria 1713
831 Ga0501043_0265738 3300049579 Bacteria 1318
832 Ga0501043_1164983 3300049579 Unclassified 542
833 Ga0501046_0087838 3300049580 Bacteria 2395
834 Ga0501046_0311991 3300049580 Unclassified 1147
835 Ga0501048_0012776 3300049582 Bacteria 6243
836 Ga0501048_0103392 3300049582 Unclassified 2010
837 Ga0501048_0327996 3300049582 Bacteria 1090
838 Ga0501048_0411887 3300049582 Bacteria 967
839 Ga0501069_0103340 3300049585 Bacteria 1619
840 Ga0501070_1002101 3300049586 Unclassified 648
841 Ga0501071_0055054 3300049587 Unclassified 2871
842 Ga0501071_0126612 3300049587 Bacteria 1896
843 Ga0501071_0331927 3300049587 Bacteria 1156
844 Ga0501071_1195063 3300049587 Bacteria 587
845 Ga0501072_0007450 3300049588 Bacteria 8301
846 Ga0501072_0008442 3300049588 Bacteria 7817
847 Ga0501072_0195660 3300049588 Bacteria 1612
848 Ga0501073_0003070 3300049589 Bacteria 12520
849 Ga0501073_0017728 3300049589 Bacteria 5154
850 Ga0501073_0430958 3300049589 Unclassified 911
851 Ga0501074_0462266 3300049590 Unclassified 899
852 Ga0501074_0715924 3300049590 Bacteria 706
853 Ga0501075_0001896 3300049591 Bacteria 13800
854 Ga0501075_0006305 3300049591 Bacteria 8151
855 Ga0501075_0023352 3300049591 Bacteria 4527
856 Ga0501075_0029862 3300049591 Unclassified 4033
857 Ga0501075_0109607 3300049591 Bacteria 2099
858 Ga0501075_0215766 3300049591 Bacteria 1463
859 Ga0501075_0962129 3300049591 Unclassified 649
860 Ga0501076_0002463 3300049592 Bacteria 12722
861 Ga0501076_0056288 3300049592 Unclassified 3121
862 Ga0501076_0070900 3300049592 Bacteria 2787
863 Ga0501076_0218354 3300049592 Bacteria 1558
864 Ga0501076_0286955 3300049592 Unclassified 1348
865 Ga0501077_0072028 3300049593 Unclassified 2190
866 Ga0501077_0224113 3300049593 Unclassified 1195
867 Ga0501202_020248 3300049652 Bacteria 1321
868 Ga0501216_051143 3300049660 Bacteria 812
869 Ga0501222_037670 3300049662 Bacteria 679
870 Ga0501233_151529 3300049668 Bacteria 647
871 Ga0501249_011005 3300049679 Bacteria 1896
872 Ga0501221_072098 3300049704 Bacteria 817
873 Ga0501079_0045070 3300049741 Bacteria 3404
874 Ga0501079_0258716 3300049741 Unclassified 1360
875 Ga0501079_0333194 3300049741 Unclassified 1188
876 Ga0501080_0098745 3300049742 Bacteria 2710
877 Ga0501080_0174323 3300049742 Bacteria 1982
878 Ga0501080_0672619 3300049742 Unclassified 915
879 Ga0501080_0700753 3300049742 Unclassified 893
880 Ga0501081_0085245 3300049743 Unclassified 2217
881 Ga0501081_0128800 3300049743 Bacteria 1807
882 Ga0501081_0144965 3300049743 Bacteria 1703
883 Ga0501081_0290636 3300049743 Bacteria 1198
884 Ga0501081_1062585 3300049743 Unclassified 612
885 Ga0501083_0216052 3300049744 Bacteria 1250
886 Ga0501083_0461834 3300049744 Bacteria 826
887 Ga0501263_010443 3300049760 Unclassified 1139
888 Ga0501266_029430 3300049763 Bacteria 779
889 Ga0501035_0258391 3300049822 Bacteria 1477
890 Ga0501035_0652116 3300049822 Bacteria 853
891 Ga0501045_0027959 3300049824 Bacteria 4067
892 Ga0501045_0046954 3300049824 Bacteria 3145
893 Ga0501045_0074873 3300049824 Unclassified 2493
894 Ga0501045_0097869 3300049824 Unclassified 2170
895 Ga0501045_0099210 3300049824 Bacteria 2155
896 Ga0501045_0120381 3300049824 Bacteria 1949
897 Ga0501045_0332975 3300049824 Bacteria 1130
898 Ga0501045_0565904 3300049824 Bacteria 843
899 Ga0501045_1097270 3300049824 Bacteria 582
900 nmdc:mga03683_7018_c1 3300050489 Bacteria 3886
901 nmdc:mga00v17_37259_c1 3300050491 Bacteria 2903
902 nmdc:mga00v17_42309_c1 3300050491 Bacteria 2739
903 nmdc:mga0k408_4862_c1 3300050493 Bacteria 2728
904 nmdc:mga0k408_5024_c1 3300050493 Bacteria 7005
905 nmdc:mga06z11_101292_c1 3300050494 Bacteria 1581
906 nmdc:mga06z11_112638_c1 3300050494 Bacteria 1508
907 nmdc:mga06z11_31968_c1 3300050494 Bacteria 2563
908 nmdc:mga06z11_578872_c1 3300050494 Bacteria 682
909 nmdc:mga07m45_16709_c1 3300050496 Bacteria 3930
910 nmdc:mga05p37_1093811_c1 3300050507 Bacteria 836
911 nmdc:mga05p37_173151_c1 3300050507 Unclassified 2631
912 nmdc:mga05p37_94222_c1 3300050507 Bacteria 3690
913 nmdc:mga09592_220289_c1 3300050508 Bacteria 1644
914 nmdc:mga09592_44878_c1 3300050508 Bacteria 3722
915 nmdc:mga09592_85407_c1 3300050508 Bacteria 2692
916 nmdc:mga0qj67_17471_c1 3300050509 Bacteria 5454
917 nmdc:mga0qj67_175941_c1 3300050509 Bacteria 1738
918 nmdc:mga0qj67_214004_c1 3300050509 Bacteria 1565
919 nmdc:mga0qj67_23422_c1 3300050509 Bacteria 4751
920 nmdc:mga0qj67_904748_c1 3300050509 Bacteria 695
921 nmdc:mga0qj67_9136_c1 3300050509 Bacteria 7357
922 nmdc:mga06r32_13625_c1 3300050510 Bacteria 7372
923 nmdc:mga06r32_34763_c1 3300050510 Bacteria 4754
924 nmdc:mga08y16_110105_c1 3300050511 Bacteria 2868
925 nmdc:mga08y16_15899_c1 3300050511 Bacteria 7909
926 nmdc:mga08y16_224705_c1 3300050511 Bacteria 1943
927 nmdc:mga08y16_3694_c1 3300050511 Bacteria 15930
928 nmdc:mga08y16_600_c1 3300050511 Bacteria 33622
929 nmdc:mga08y16_617352_c1 3300050511 Bacteria 1091
930 nmdc:mga08y16_710731_c1 3300050511 Bacteria 1004
931 nmdc:mga08y16_890618_c1 3300050511 Bacteria 877
932 nmdc:mga0n895_204608_c1 3300050512 Bacteria 2004
933 nmdc:mga0n895_208830_c1 3300050512 Bacteria 1983
934 nmdc:mga0rr50_153048_c1 3300050513 Bacteria 1866
935 nmdc:mga0a205_180987_c1 3300050515 Bacteria 2002
936 nmdc:mga0sz30_207167_c1 3300050516 Bacteria 871
937 Ga0495612_0339649 3300053078 Bacteria 677
938 Ga0495619_0111700 3300053085 Bacteria 1868
939 Ga0495619_0250825 3300053085 Unclassified 1226
940 Ga0500628_104638 3300053129 Bacteria 753
941 Ga0501084_0034958 3300054114 Bacteria 4202
942 Ga0501084_0073452 3300054114 Bacteria 2864
943 Ga0501084_0098508 3300054114 Bacteria 2455
944 Ga0501084_0867344 3300054114 Bacteria 759
945 Ga0501082_0011196 3300060353 Bacteria 7708
946 Ga0501082_0016537 3300060353 Bacteria 6350
947 Ga0501082_0055983 3300060353 Bacteria 3397
948 Ga0501082_0164179 3300060353 Bacteria 1930
949 Ga0501082_0257416 3300060353 Unclassified 1518
950 Ga0501082_0326831 3300060353 Unclassified 1336
951 Ga0530510_0004955 3300061734 Bacteria 9196
952 Ga0530510_0135864 3300061734 Unclassified 1810
953 Ga0530510_0171597 3300061734 Bacteria 1607
954 Ga0530510_0212806 3300061734 Bacteria 1436
955 Ga0530510_0763513 3300061734 Bacteria 737
956 Ga0530510_0779822 3300061734 Bacteria 729
957 Ga0075430_100135939
958 JGI24750J21931_1032912
959 Ga0065714_10147806
960 Ga0065712_10000670
961 Ga0065712_10007292
962 Ga0065712_10069731
963 Ga0065712_10146634
964 Ga0065712_10290796
965 Ga0065715_10015126
966 Ga0065715_10094469
967 Ga0065715_10147963
968 Ga0065715_10174613
969 Ga0065707_10083956
970 Ga0065707_10198166
971 Ga0065707_10397181
972 Ga0070658_10071719
973 Ga0070676_10097669
974 Ga0070676_10129161
975 Ga0070676_10392638
976 Ga0070683_100002109
977 Ga0070690_100007742
978 Ga0070690_100013898
979 Ga0070690_100372467
980 Ga0070670_100000992
981 Ga0070670_100012248
982 Ga0070670_100018857
983 Ga0070670_100045797
984 Ga0070670_100531259
985 Ga0070677_10217042
986 Ga0068869_100001307
987 Ga0068869_100097503
988 Ga0068869_100255953
989 Ga0068869_100586177
990 Ga0070666_10013766
991 Ga0070666_10186993
992 Ga0070666_10426409
993 Ga0070666_10928723
994 Ga0070682_100272017
995 Ga0068868_100024692
996 Ga0070660_100344805
997 Ga0070689_100011750
998 Ga0070689_100042868
999 Ga0070689_100105274
1000 Ga0070689_100294190
1001 Ga0070689_101114907
1002 Ga0070691_10072479
1003 Ga0070687_100007746
1004 Ga0070687_100041058
1005 Ga0070687_100042511
1006 Ga0070687_100159066
1007 Ga0070661_100079898
1008 Ga0070692_10184654
1009 Ga0070668_100027470
1010 Ga0070668_100175302
1011 Ga0070669_100038800
1012 Ga0070669_100040560
1013 Ga0070669_100230430
1014 Ga0070669_100254565
1015 Ga0070669_100338798
1016 Ga0070669_100429898
1017 Ga0070669_100554656
1018 Ga0070669_100561225
1019 Ga0070675_100000213
1020 Ga0070675_100016897
1021 Ga0070675_100018351
1022 Ga0070675_100018565
1023 Ga0070675_100145193
1024 Ga0070675_100184746
1025 Ga0070675_100228446
1026 Ga0070675_100499074
1027 Ga0070675_101007433
1028 Ga0070671_100013310
1029 Ga0070671_100026741
1030 Ga0070671_100418251
1031 Ga0070671_100500654
1032 Ga0070671_100754493
1033 Ga0070673_100014175
1034 Ga0070673_100126441
1035 Ga0070673_100253661
1036 Ga0070673_100354509
1037 Ga0070673_101049998
1038 Ga0070688_100015341
1039 Ga0070688_100100697
1040 Ga0070688_100106836
1041 Ga0070688_100124840
1042 Ga0070659_100407709
1043 Ga0070659_100664662
1044 Ga0070667_100000213
1045 Ga0070667_100000229
1046 Ga0070667_100035502
1047 Ga0070667_100061677
1048 Ga0070667_100064543
1049 Ga0070667_100116100
1050 Ga0070714_100045607
1051 Ga0070713_100034914
1052 Ga0070701_10007383
1053 Ga0070701_10066123
1054 Ga0070700_100020231
1055 Ga0070700_100072580
1056 Ga0070700_100106784
1057 Ga0070694_100020429
1058 Ga0070663_100017427
1059 Ga0070678_100020453
1060 Ga0070678_100232081
1061 Ga0070662_100008607
1062 Ga0070662_100050442
1063 Ga0070662_100429637
1064 Ga0068867_100000506
1065 Ga0068867_100035934
1066 Ga0068867_100047960
1067 Ga0068867_100175506
1068 Ga0068867_100607359
1069 Ga0070685_10005922
1070 Ga0070685_10008218
1071 Ga0070707_100232851
1072 Ga0070699_100116816
1073 Ga0070684_100006800
1074 Ga0070684_100018179
1075 Ga0070684_100099405
1076 Ga0068853_100639095
1077 Ga0068853_101422876
1078 Ga0070672_100023273
1079 Ga0070672_100023672
1080 Ga0070672_100058721
1081 Ga0070672_100082336
1082 Ga0070672_100088399
1083 Ga0070672_100109241
1084 Ga0070672_100146009
1085 Ga0070672_100271524
1086 Ga0070672_100371166
1087 Ga0070686_100003209
1088 Ga0070686_100006603
1089 Ga0070686_100011769
1090 Ga0070686_100082624
1091 Ga0070686_100118499
1092 Ga0070686_101364127
1093 Ga0070695_100494210
1094 Ga0070695_100588043
1095 Ga0070696_100081107
1096 Ga0070696_100330945
1097 Ga0070665_100017249
1098 Ga0070665_100026210
1099 Ga0070665_100032621
1100 Ga0070665_100040549
1101 Ga0070665_100274042
1102 Ga0070665_100375828
1103 Ga0070704_100070993
1104 Ga0070704_100087649
1105 Ga0068855_100522458
1106 Ga0070664_100004878
1107 Ga0070664_100041653
1108 Ga0070664_100043742
1109 Ga0070664_100049024
1110 Ga0070664_100146493
1111 Ga0070664_100200027
1112 Ga0070664_100208462
1113 Ga0068857_100021274
1114 Ga0068857_100093482
1115 Ga0068857_100097871
1116 Ga0068854_100001377
1117 Ga0068854_100181656
1118 Ga0068854_100188293
1119 Ga0068854_100272951
1120 Ga0068854_100314072
1121 Ga0068856_100348345
1122 Ga0070702_100012327
1123 Ga0070702_100049737
1124 Ga0068852_100350189
1125 Ga0068852_100419946
1126 Ga0068852_100623672
1127 Ga0068859_100002473
1128 Ga0068859_100003697
1129 Ga0068859_100119934
1130 Ga0068859_100233016
1131 Ga0068859_100738278
1132 Ga0068859_102000883
1133 Ga0068864_100013424
1134 Ga0068864_100070470
1135 Ga0068864_100093470
1136 Ga0068864_100134112
1137 Ga0068864_100217482
1138 Ga0068864_100229265
1139 Ga0068864_100248319
1140 Ga0068864_100372034
1141 Ga0068866_10082596
1142 Ga0068866_10152476
1143 Ga0068861_100008276
1144 Ga0068861_100111803
1145 Ga0068861_100169060
1146 Ga0068861_100279634
1147 Ga0068870_10009359
1148 Ga0068870_10023803
1149 Ga0068870_10346554
1150 Ga0068863_100015574
1151 Ga0068863_100037788
1152 Ga0068863_100103678
1153 Ga0068863_100660962
1154 Ga0068863_100744428
1155 Ga0068858_100053886
1156 Ga0068858_100059058
1157 Ga0068858_100168824
1158 Ga0068858_100182585
1159 Ga0068858_100718131
1160 Ga0068858_100795138
1161 Ga0068858_100856103
1162 Ga0068858_100902600
1163 Ga0068860_100002274
1164 Ga0068860_100035275
1165 Ga0068860_100137311
1166 Ga0068860_100221399
1167 Ga0068860_100306506
1168 Ga0068860_100308970
1169 Ga0068860_101006290
1170 Ga0068860_101817429
1171 Ga0068862_100220041
1172 Ga0068862_100359107
1173 Ga0068862_101038566
1174 Ga0068862_101714878
1175 Ga0081539_10003440
1176 Ga0081539_10027061
1177 Ga0075368_10010946
1178 Ga0075364_10092532
1179 Ga0075364_10152575
1180 Ga0075362_10000633
1181 Ga0075367_10017900
1182 Ga0075367_10032799
1183 Ga0075367_10316099
1184 Ga0075366_10002529
1185 Ga0075366_10041208
1186 Ga0097621_100023659
1187 Ga0097621_100056576
1188 Ga0075370_10070315
1189 Ga0068871_100004257
1190 Ga0068871_100010599
1191 Ga0068871_100058818
1192 Ga0068871_100089983
1193 Ga0068871_100201070
1194 Ga0068871_100332345
1195 Ga0068871_100363796
1196 Ga0068871_101112414
1197 Ga0075428_100038580
1198 Ga0075428_100045484
1199 Ga0075428_100514063
1200 Ga0075428_100772386
1201 Ga0075430_100017937
1202 Ga0075430_100019920
1203 Ga0075431_100123090
1204 Ga0075431_100132981
1205 Ga0075431_100191143
1206 Ga0075433_10200567
1207 Ga0075433_10864797
1208 Ga0075434_100192460
1209 Ga0075434_101568959
1210 Ga0075429_100064694
1211 Ga0075429_100072027
1212 Ga0075429_100328003
1213 Ga0075429_100541924
1214 Ga0068865_100059256
1215 Ga0068865_100207354
1216 Ga0068865_100556866
1217 Ga0068865_100567016
1218 Ga0097620_100002473
1219 Ga0097620_100003697
1220 Ga0097620_100100865
1221 Ga0097620_100119929
1222 Ga0097620_100233008
1223 Ga0097620_100738364
1224 Ga0097620_100935263
1225 Ga0097620_102001180
1226 Ga0075435_100411524
1227 Ga0105240_10002932
1228 Ga0105240_11582013
1229 Ga0111539_10021405
1230 Ga0111539_10030472
1231 Ga0111539_10040028
1232 Ga0111539_10081459
1233 Ga0111539_10094514
1234 Ga0111539_10167441
1235 Ga0111539_10866246
1236 Ga0111539_11259704
1237 Ga0111539_11437437
1238 Ga0105245_10068637
1239 Ga0105245_10140779
1240 Ga0105245_10897858
1241 Ga0105247_10405894
1242 Ga0114129_10070490
1243 Ga0114129_10223208
1244 Ga0114129_10709924
1245 Ga0114129_10717368
1246 Ga0105243_10091474
1247 Ga0105243_10100495
1248 Ga0105243_10100867
1249 Ga0105243_10313171
1250 Ga0105243_10814228
1251 Ga0105241_10047716
1252 Ga0105241_10231035
1253 Ga0105241_10317192
1254 Ga0105241_10725600
1255 Ga0105241_11052195
1256 Ga0105242_10005714
1257 Ga0105242_10020146
1258 Ga0105242_10105206
1259 Ga0105242_10413046
1260 Ga0105242_10896336
1261 Ga0105242_11240308
1262 Ga0105248_10024596
1263 Ga0105248_10036387
1264 Ga0105248_10147582
1265 Ga0105248_10178160
1266 Ga0105248_10232636
1267 Ga0105248_10238614
1268 Ga0105248_10361537
1269 Ga0105248_10445901
1270 Ga0105248_10565783
1271 Ga0105248_12103707
1272 Ga0105238_10267449
1273 Ga0105238_10452613
1274 Ga0105249_10013623
1275 Ga0105249_10015432
1276 Ga0105249_10119145
1277 Ga0105239_10430331
1278 Ga0105239_10615940
1279 Ga0105246_10226222
1280 Ga0105246_11096084
1281 Ga0157323_1018018
1282 Ga0157373_10028743
1283 Ga0157369_11307666
1284 Ga0157374_10033973
1285 Ga0157374_10084602
1286 Ga0157374_10284200
1287 Ga0157374_10465280
1288 Ga0157374_10981925
1289 Ga0157374_11263188
1290 Ga0157378_10147779
1291 Ga0157378_10211298
1292 Ga0157378_10228085
1293 Ga0157378_10451215
1294 Ga0157378_10548141
1295 Ga0163162_10431317
1296 Ga0163162_10557442
1297 Ga0163162_11110222
1298 Ga0163162_11488023
1299 Ga0157372_10019399
1300 Ga0157372_10510269
1301 Ga0157372_10926316
1302 Ga0157375_10013766
1303 Ga0157375_10022749
1304 Ga0157375_10037078
1305 Ga0157375_10121912
1306 Ga0157375_10280843
1307 Ga0157375_10329688
1308 Ga0157375_10489568
1309 Ga0163163_10014083
1310 Ga0163163_10027774
1311 Ga0163163_10061462
1312 Ga0163163_10063187
1313 Ga0163163_10144309
1314 Ga0163163_10179746
1315 Ga0163163_10625275
1316 Ga0163163_11031027
1317 Ga0163163_11039584
1318 Ga0163163_11142727
1319 Ga0163163_11514714
1320 Ga0157380_10224313
1321 Ga0157380_10255726
1322 Ga0157380_10805223
1323 Ga0157380_11180308
1324 Ga0157377_10008880
1325 Ga0157377_10018481
1326 Ga0157377_10060176
1327 Ga0157377_10193057
1328 Ga0157377_10324653
1329 Ga0157379_10059863
1330 Ga0157379_10645099
1331 Ga0157376_10024658
1332 Ga0157376_10063165
1333 Ga0157376_10082015
1334 Ga0157376_10230369
1335 Ga0157376_10594924
1336 Ga0157376_11131300
1337 Ga0182007_10040076
1338 Ga0182005_1042886
1339 Ga0182005_1128844
1340 Ga0163161_10053714
1341 Ga0163161_10294770
1342 Ga0213873_10049291
1343 Ga0213876_10156411
1344 Ga0207666_1008484
1345 Ga0207697_10044644
1346 Ga0207682_10084116
1347 Ga0207682_10107737
1348 Ga0207682_10329890
1349 Ga0207642_10267500
1350 Ga0207710_10152131
1351 Ga0207688_10005943
1352 Ga0207688_10090248
1353 Ga0207688_10096732
1354 Ga0207680_10004597
1355 Ga0207680_10166776
1356 Ga0207680_10199474
1357 Ga0207680_10355851
1358 Ga0207645_10016674
1359 Ga0207645_10018504
1360 Ga0207645_10031356
1361 Ga0207645_10157468
1362 Ga0207645_10437448
1363 Ga0207643_10002418
1364 Ga0207643_10024519
1365 Ga0207643_10188193
1366 Ga0207705_10083174
1367 Ga0207654_10059392
1368 Ga0207695_10032334
1369 Ga0207671_10107005
1370 Ga0207662_10023481
1371 Ga0207662_10056994
1372 Ga0207662_10075243
1373 Ga0207657_10743837
1374 Ga0207657_11000233
1375 Ga0207649_10734255
1376 Ga0207646_10847590
1377 Ga0207681_10014708
1378 Ga0207681_10082077
1379 Ga0207681_10385257
1380 Ga0207681_10687297
1381 Ga0207681_11003585
1382 Ga0207694_10203804
1383 Ga0207694_10719081
1384 Ga0207650_10007667
1385 Ga0207650_10009394
1386 Ga0207650_10026237
1387 Ga0207650_10159957
1388 Ga0207650_10228560
1389 Ga0207650_10228810
1390 Ga0207650_10395191
1391 Ga0207650_10474600
1392 Ga0207659_10002411
1393 Ga0207659_10025809
1394 Ga0207659_10031754
1395 Ga0207659_10060319
1396 Ga0207659_10161427
1397 Ga0207659_10359400
1398 Ga0207659_10531984
1399 Ga0207659_11111433
1400 Ga0207687_10180990
1401 Ga0207700_10025744
1402 Ga0207700_10618552
1403 Ga0207664_10051251
1404 Ga0207644_10018820
1405 Ga0207644_10031085
1406 Ga0207644_10042288
1407 Ga0207644_10338891
1408 Ga0207644_10543482
1409 Ga0207690_10601294
1410 Ga0207690_10953453
1411 Ga0207706_10024065
1412 Ga0207706_10026388
1413 Ga0207706_10075462
1414 Ga0207706_10121738
1415 Ga0207706_10309067
1416 Ga0207686_10029796
1417 Ga0207686_10143074
1418 Ga0207686_10767981
1419 Ga0207709_10109529
1420 Ga0207709_10113803
1421 Ga0207709_10163118
1422 Ga0207670_10020146
1423 Ga0207670_10049276
1424 Ga0207670_10601463
1425 Ga0207670_11030923
1426 Ga0207704_10028215
1427 Ga0207704_11221729
1428 Ga0207691_10030467
1429 Ga0207691_10037997
1430 Ga0207691_10067769
1431 Ga0207691_10213905
1432 Ga0207691_10277433
1433 Ga0207691_10371055
1434 Ga0207691_10459115
1435 Ga0207711_10058635
1436 Ga0207711_10067863
1437 Ga0207711_10115426
1438 Ga0207711_10116350
1439 Ga0207711_10398193
1440 Ga0207711_10690644
1441 Ga0207711_10783733
1442 Ga0207711_10806548
1443 Ga0207711_10859520
1444 Ga0207689_10007584
1445 Ga0207689_10140612
1446 Ga0207689_10252678
1447 Ga0207689_10346814
1448 Ga0207661_10018214
1449 Ga0207661_11152360
1450 Ga0207679_10015516
1451 Ga0207679_10030460
1452 Ga0207679_10053461
1453 Ga0207679_10102510
1454 Ga0207679_10143804
1455 Ga0207667_10087759
1456 Ga0207667_10422952
1457 Ga0207651_10043066
1458 Ga0207651_10045402
1459 Ga0207651_10073382
1460 Ga0207651_10105609
1461 Ga0207651_11297774
1462 Ga0207712_10002109
1463 Ga0207712_10079646
1464 Ga0207712_11456963
1465 Ga0207668_10081556
1466 Ga0207668_10250476
1467 Ga0207640_10021839
1468 Ga0207640_10043027
1469 Ga0207640_10047757
1470 Ga0207640_10220096
1471 Ga0207658_10000078
1472 Ga0207658_10000194
1473 Ga0207658_10052037
1474 Ga0207658_10063641
1475 Ga0207658_11171063
1476 Ga0207703_10023503
1477 Ga0207703_10041763
1478 Ga0207703_10071430
1479 Ga0207703_10176013
1480 Ga0207703_10178184
1481 Ga0207703_10366369
1482 Ga0207703_10881516
1483 Ga0207639_10524322
1484 Ga0207678_10020734
1485 Ga0207678_10063800
1486 Ga0207708_10026067
1487 Ga0207708_10037405
1488 Ga0207708_10042040
1489 Ga0207708_10148956
1490 Ga0207708_10373195
1491 Ga0207702_10776477
1492 Ga0207641_10003015
1493 Ga0207641_10100820
1494 Ga0207641_10236271
1495 Ga0207641_10686987
1496 Ga0207641_10744729
1497 Ga0207641_11543579
1498 Ga0207641_11789197
1499 Ga0207648_10001503
1500 Ga0207648_10032267
1501 Ga0207648_10186512
1502 Ga0207648_10321949
1503 Ga0207648_10411032
1504 Ga0207676_10043054
1505 Ga0207676_10093994
1506 Ga0207676_10160668
1507 Ga0207676_10209038
1508 Ga0207676_10253399
1509 Ga0207676_10259414
1510 Ga0207676_10353477
1511 Ga0207676_10455738
1512 Ga0207676_10637236
1513 Ga0207676_11171393
1514 Ga0207674_10016506
1515 Ga0207674_10054357
1516 Ga0207674_10074717
1517 Ga0207674_10305129
1518 Ga0207674_11472305
1519 Ga0207675_100012907
1520 Ga0207675_100052335
1521 Ga0207675_100156923
1522 Ga0207675_100211881
1523 Ga0207675_100286323
1524 Ga0207675_100568951
1525 Ga0207675_100664115
1526 Ga0207683_10060370
1527 Ga0207683_10168922
1528 Ga0207683_10173951
1529 Ga0207683_10359261
1530 Ga0207683_10385049
1531 Ga0207698_10196225
1532 Ga0207698_10322924
1533 Ga0209984_1007877
1534 Ga0210000_1010262
1535 Ga0209995_1015350
1536 Ga0209968_1039819
1537 Ga0209982_1009029
1538 Ga0209970_1014664
1539 Ga0209983_1007100
1540 Ga0209971_1001948
1541 Ga0209998_10082150
1542 Ga0209813_10061327
1543 Ga0209974_10008070
1544 Ga0209974_10122284
1545 Ga0207428_10000986
1546 Ga0207428_10001229
1547 Ga0207428_10080298
1548 Ga0207428_10125911
1549 Ga0207428_10155324
1550 Ga0207428_10676329
1551 Ga0268266_10013254
1552 Ga0268266_10016303
1553 Ga0268266_10069157
1554 Ga0268266_10078714
1555 Ga0268266_10240999
1556 Ga0268266_10251764
1557 Ga0268266_10288410
1558 Ga0268265_10035441
1559 Ga0268265_10290484
1560 Ga0268265_10927637
1561 Ga0268264_10003297
1562 Ga0268264_10023965
1563 Ga0268264_10132307
1564 Ga0268264_10279131
1565 Ga0268264_10325468
1566 Ga0268264_10348105
1567 Ga0268264_10448640
1568 Ga0268264_10860550
1569 Ga0265330_10016597
1570 Ga0265331_10000002
1571 Ga0265316_10209567
1572 Ga0307408_100004800
1573 Ga0307408_100342566
1574 Ga0265314_10000068
1575 Ga0265314_10040552
1576 Ga0307413_10059899
1577 Ga0307413_10313653
1578 Ga0307413_10637969
1579 Ga0307410_10064928
1580 Ga0307410_10223468
1581 Ga0307410_10442744
1582 Ga0307410_10691758
1583 Ga0307406_11140681
1584 Ga0307406_11285774
1585 Ga0307407_10001191
1586 Ga0307407_10741258
1587 Ga0307412_10019644
1588 Ga0307412_10043227
1589 Ga0307409_100027014
1590 Ga0307416_100002197
1591 Ga0307416_100667693
1592 Ga0307414_10277816
1593 Ga0307414_10474657
1594 Ga0307411_10205383
1595 Ga0307411_11476351
1596 Ga0307415_100001053
1597 Ga0373950_0001108
1598 Ga0373958_0009237
1599 Ga0373959_0000578
1600 Ga0373928_0017200
1601 Ga0373928_0097699
1602 Ga0373929_0003025
1603 Ga0373940_0006689
1604 Ga0373949_0088483
1605 Ga0373951_0000494
1606 Ga0373952_0001291
1607 Ga0373952_0026915
1608 Ga0373932_0001364
1609 Ga0373932_0048787
1610 Ga0373936_0138899
1611 Ga0373939_0002808
1612 Ga0373939_0207887
1613 Ga0373941_0001203
1614 Ga0373941_0016058
1615 Ga0373956_0075930
1616 Ga0373956_0177859
1617 Ga0373960_0004265
1618 Ga0373960_0027153
1619 Ga0373943_0306242
1620 Ga0373955_0034545
1621 Ga0373942_0002787
1622 Ga0373961_0003130
1623 Ga0373962_0000256
1624 Ga0316574_0029836
1625 Ga0373931_0034347
1626 Ga0373931_0459073
1627 Ga0373931_0482760
1628 Ga0373935_0316725
1629 Ga0373933_0210742
1630 Ga0373937_0005187
1631 Ga0373937_0014513
1632 Ga0373937_0367084
1633 Ga0316584_0680275
1634 Ga0373925_0087753
1635 Ga0373925_0125571
1636 Ga0373925_0595178
1637 Ga0395905_0000937
1638 Ga0395901_0385808
1639 Ga0436365_1434392
1640 Ga0436363_1190504
1641 Ga0436362_0309424
1642 Ga0436362_0948466
1643 Ga0451793_0928718
1644 Ga0451807_1117510
1645 Ga0439450_022178
1646 Ga0439456_053880
1647 Ga0439462_0001194
1648 Ga0450898_131033
1649 Ga0439444_0023332
1650 Ga0451577_0078547
1651 Ga0451577_0139195
1652 Ga0439440_0010306
1653 Ga0439440_0146207
1654 Ga0453683_0024944
1655 Ga0453683_0362544
1656 Ga0466965_0095589
1657 Ga0453684_0152163
1658 Ga0453684_0294739
1659 Ga0453684_0395611
1660 Ga0453684_0858569
1661 Ga0453684_1276461
1662 Ga0453684_1337847
1663 Ga0453684_1350223
1664 Ga0466959_0222542
1665 Ga0451576_0013097
1666 Ga0451576_0074780
1667 Ga0451576_0094013
1668 Ga0451576_0232420
1669 Ga0451576_0361806
1670 Ga0451576_0920206
1671 Ga0451576_0932856
1672 Ga0451576_1395056
1673 Ga0466967_1038189
1674 Ga0495592_0326203
1675 Ga0495592_0829589
1676 Ga0495629_0113362
1677 Ga0495629_0602015
1678 Ga0495662_0386201
1679 Ga0495664_0463156
1680 Ga0495594_0133033
1681 Ga0495594_0146166
1682 Ga0495594_0279989
1683 Ga0495608_0293995
1684 Ga0495630_0417602
1685 Ga0495630_0980810
1686 Ga0495640_0209752
1687 Ga0495586_0106763
1688 Ga0495586_0108801
1689 Ga0495598_0004939
1690 Ga0495598_0137367
1691 Ga0495621_0111446
1692 Ga0495645_0001309
1693 Ga0495645_0111609
1694 Ga0495667_0149704
1695 Ga0495667_0429872
1696 Ga0495656_0380244
1697 Ga0495635_0059689
1698 Ga0495635_0619169
1699 Ga0495647_0067612
1700 Ga0495658_0654607
1701 Ga0495613_0104490
1702 Ga0495613_0116836
1703 Ga0495600_0154543
1704 Ga0495600_0221291
1705 Ga0495600_0404567
1706 Ga0495680_0757009
1707 Ga0495684_0160700
1708 Ga0495684_0180398
1709 Ga0496100_0115182
1710 Ga0496100_0690940
1711 Ga0496101_0106685
1712 Ga0496101_0130204
1713 Ga0496102_0113691
1714 Ga0496104_0015625
1715 Ga0496104_0052523
1716 Ga0496104_0095410
1717 Ga0496104_0140009
1718 Ga0496104_0190653
1719 Ga0496104_0324330
1720 Ga0496105_0115464
1721 Ga0496105_0196488
1722 Ga0496105_0887897
1723 Ga0496106_0090363
1724 Ga0496107_0259567
1725 Ga0496108_0012243
1726 Ga0496108_0019872
1727 Ga0496109_0008221
1728 Ga0496109_0024535
1729 Ga0496109_0033399
1730 Ga0496109_0758831
1731 Ga0496110_0023890
1732 Ga0496110_0037029
1733 Ga0496110_0309941
1734 Ga0496110_0522547
1735 Ga0496111_0014197
1736 Ga0496111_0072778
1737 Ga0496112_0006637
1738 Ga0496112_0023201
1739 Ga0496112_0041609
1740 Ga0496112_0046829
1741 Ga0496112_0165976
1742 Ga0496112_0286306
1743 Ga0496112_0790312
1744 Ga0496113_0016795
1745 Ga0496113_0058553
1746 Ga0496113_1343962
1747 Ga0496114_0084502
1748 Ga0496114_0244341
1749 Ga0496114_0257695
1750 Ga0496114_0419480
1751 Ga0496114_0497683
1752 Ga0496115_0514767
1753 Ga0501292_007543
1754 Ga0501297_002481
1755 Ga0501297_016844
1756 Ga0501299_014500
1757 Ga0501303_004585
1758 Ga0501031_0277137
1759 Ga0501032_0561760
1760 Ga0501033_0162727
1761 Ga0501033_0223866
1762 Ga0501033_0254345
1763 Ga0501034_0013072
1764 Ga0501036_0041712
1765 Ga0501036_0119144
1766 Ga0501036_0207947
1767 Ga0501036_0899937
1768 Ga0501038_0196610
1769 Ga0501038_0242326
1770 Ga0501038_0422897
1771 Ga0501039_0023492
1772 Ga0501039_0107321
1773 Ga0501039_0192161
1774 Ga0501040_0373526
1775 Ga0501040_0415954
1776 Ga0501040_0820219
1777 Ga0501041_0020516
1778 Ga0501041_0030573
1779 Ga0501041_0047194
1780 Ga0501041_0123195
1781 Ga0501041_0579788
1782 Ga0501042_0060658
1783 Ga0501042_0126036
1784 Ga0501042_0202625
1785 Ga0501042_0514315
1786 Ga0501043_0167824
1787 Ga0501043_0265738
1788 Ga0501043_1164983
1789 Ga0501046_0087838
1790 Ga0501046_0311991
1791 Ga0501048_0012776
1792 Ga0501048_0103392
1793 Ga0501048_0327996
1794 Ga0501048_0411887
1795 Ga0501069_0103340
1796 Ga0501070_1002101
1797 Ga0501071_0055054
1798 Ga0501071_0126612
1799 Ga0501071_0331927
1800 Ga0501071_1195063
1801 Ga0501072_0007450
1802 Ga0501072_0008442
1803 Ga0501072_0195660
1804 Ga0501073_0003070
1805 Ga0501073_0017728
1806 Ga0501073_0430958
1807 Ga0501074_0462266
1808 Ga0501074_0715924
1809 Ga0501075_0001896
1810 Ga0501075_0006305
1811 Ga0501075_0023352
1812 Ga0501075_0029862
1813 Ga0501075_0109607
1814 Ga0501075_0215766
1815 Ga0501075_0962129
1816 Ga0501076_0002463
1817 Ga0501076_0056288
1818 Ga0501076_0070900
1819 Ga0501076_0218354
1820 Ga0501076_0286955
1821 Ga0501077_0072028
1822 Ga0501077_0224113
1823 Ga0501202_020248
1824 Ga0501216_051143
1825 Ga0501222_037670
1826 Ga0501233_151529
1827 Ga0501249_011005
1828 Ga0501221_072098
1829 Ga0501079_0045070
1830 Ga0501079_0258716
1831 Ga0501079_0333194
1832 Ga0501080_0098745
1833 Ga0501080_0174323
1834 Ga0501080_0672619
1835 Ga0501080_0700753
1836 Ga0501081_0085245
1837 Ga0501081_0128800
1838 Ga0501081_0144965
1839 Ga0501081_0290636
1840 Ga0501081_1062585
1841 Ga0501083_0216052
1842 Ga0501083_0461834
1843 Ga0501263_010443
1844 Ga0501266_029430
1845 Ga0501035_0258391
1846 Ga0501035_0652116
1847 Ga0501045_0027959
1848 Ga0501045_0046954
1849 Ga0501045_0074873
1850 Ga0501045_0097869
1851 Ga0501045_0099210
1852 Ga0501045_0120381
1853 Ga0501045_0332975
1854 Ga0501045_0565904
1855 Ga0501045_1097270
1856 nmdc:mga03683_7018_c1
1857 nmdc:mga00v17_37259_c1
1858 nmdc:mga00v17_42309_c1
1859 nmdc:mga0k408_4862_c1
1860 nmdc:mga0k408_5024_c1
1861 nmdc:mga06z11_101292_c1
1862 nmdc:mga06z11_112638_c1
1863 nmdc:mga06z11_31968_c1
1864 nmdc:mga06z11_578872_c1
1865 nmdc:mga07m45_16709_c1
1866 nmdc:mga05p37_1093811_c1
1867 nmdc:mga05p37_173151_c1
1868 nmdc:mga05p37_94222_c1
1869 nmdc:mga09592_220289_c1
1870 nmdc:mga09592_44878_c1
1871 nmdc:mga09592_85407_c1
1872 nmdc:mga0qj67_17471_c1
1873 nmdc:mga0qj67_175941_c1
1874 nmdc:mga0qj67_214004_c1
1875 nmdc:mga0qj67_23422_c1
1876 nmdc:mga0qj67_904748_c1
1877 nmdc:mga0qj67_9136_c1
1878 nmdc:mga06r32_13625_c1
1879 nmdc:mga06r32_34763_c1
1880 nmdc:mga08y16_110105_c1
1881 nmdc:mga08y16_15899_c1
1882 nmdc:mga08y16_224705_c1
1883 nmdc:mga08y16_3694_c1
1884 nmdc:mga08y16_600_c1
1885 nmdc:mga08y16_617352_c1
1886 nmdc:mga08y16_710731_c1
1887 nmdc:mga08y16_890618_c1
1888 nmdc:mga0n895_204608_c1
1889 nmdc:mga0n895_208830_c1
1890 nmdc:mga0rr50_153048_c1
1891 nmdc:mga0a205_180987_c1
1892 nmdc:mga0sz30_207167_c1
1893 Ga0495612_0339649
1894 Ga0495619_0111700
1895 Ga0495619_0250825
1896 Ga0500628_104638
1897 Ga0501084_0034958
1898 Ga0501084_0073452
1899 Ga0501084_0098508
1900 Ga0501084_0867344
1901 Ga0501082_0011196
1902 Ga0501082_0016537
1903 Ga0501082_0055983
1904 Ga0501082_0164179
1905 Ga0501082_0257416
1906 Ga0501082_0326831
1907 Ga0530510_0004955
1908 Ga0530510_0135864
1909 Ga0530510_0171597
1910 Ga0530510_0212806
1911 Ga0530510_0763513
1912 Ga0530510_0779822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhh-assembly1.cif.gz_A-2 crystal structure of soxr 0.2496 80 160
2zhh-assembly1.cif.gz_A-2 crystal structure of soxr 0.1566 80 160
ID Description Score Start End Superfamily
af_G5EFE1_227_442_1.10.167.10 Mainly Alpha;Orthogonal Bundle;Regulator of G-protein Signalling 4; domain 2;Regulator of G-protein Signalling 4, domain 2 0.3704 117 167 1.10.167.10
3h37A03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3217 101 165 1.20.58.1960
2zhhA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.2496 80 160 1.10.1660.10
af_P0ACS2_1_135_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.1901 27 164 1.10.1660.10
3h37A03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.1818 101 165 1.20.58.1960
ID Description Score Start End GO Terms
AF-A0A0G0I225-F1-model_v4 Uncharacterized protein 0.9913 3 167
AF-Q89SC6-F1-model_v4 Blr2476 protein 0.9911 1 167
AF-A0A0G0L2G6-F1-model_v4 Uncharacterized protein 0.9902 23 167
AF-A0A2H0PGP7-F1-model_v4 GIY-YIG domain-containing protein 0.9898 2 167
AF-A3WZQ2-F1-model_v4 Uncharacterized protein 0.9877 3 167

Map