F486738

General Info

Members Datasets Scaffolds Average Seq Length
956 335 947 273

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100010646|Ga0068858_1000106468
Length 325
Sequence VDPHHIVPEKAHGTRDHLADGPRRRQWKGLTRGIQDGLQRRRYTTRGEHAMQIVDAQIHLWGSGLPSNRAHRQVTAFPTKEAVGLMDAGGVDAAVIHPPGWDPGATAMAFAAVRDYPGRFAIMGALPLDRPESRALVANWRSQPGMLGLRYGFLQEPLRGWLEDGTLDWLWAAAERAGVPIAMLATDSLPAIGRIAARYPGLRLTIDHLGGRGGNTTLKDAAAMTHIPALLALAQYPNVAVKATGVPGYSSEAYPFPMMQTFVRQIYDAFGPQRLFWGTDITKMPCSWRQCVTMFTEELPWLSELDKALIMGQALCAWWGWDRPT

Samples

Sample ID Description Type Environment
1 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
236 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
237 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
242 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
243 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 1.67
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10171061 3300005295 Bacteria 1484
2 Ga0070676_10000139 3300005328 Bacteria 28144
3 Ga0070676_10010241 3300005328 Bacteria 5085
4 Ga0070683_100031139 3300005329 Bacteria 4848
5 Ga0070683_100216685 3300005329 Bacteria 1819
6 Ga0070690_100108173 3300005330 Bacteria 1852
7 Ga0070690_100119716 3300005330 Unclassified 1766
8 Ga0070670_100009863 3300005331 Bacteria 8154
9 Ga0068869_100008319 3300005334 Bacteria 6685
10 Ga0068869_100040060 3300005334 Bacteria 3348
11 Ga0070680_100015720 3300005336 Bacteria 5941
12 Ga0070680_100018671 3300005336 Bacteria 5484
13 Ga0070680_100046099 3300005336 Unclassified 3545
14 Ga0070680_100072225 3300005336 Bacteria 2836
15 Ga0070682_100002778 3300005337 Bacteria 9697
16 Ga0070682_100031718 3300005337 Bacteria 3197
17 Ga0068868_100058978 3300005338 Bacteria 3035
18 Ga0068868_100560568 3300005338 Bacteria 1008
19 Ga0070660_100003858 3300005339 Bacteria 10349
20 Ga0070660_100009836 3300005339 Bacteria 6743
21 Ga0070689_100014713 3300005340 Bacteria 5691
22 Ga0070691_10006870 3300005341 Bacteria 5204
23 Ga0070691_10048273 3300005341 Unclassified 2025
24 Ga0070661_100002434 3300005344 Bacteria 12784
25 Ga0070661_100003154 3300005344 Bacteria 11345
26 Ga0070692_10000852 3300005345 Bacteria 10285
27 Ga0070692_10038767 3300005345 Bacteria 2430
28 Ga0070668_100111303 3300005347 Bacteria 2179
29 Ga0070668_100237243 3300005347 Bacteria 1509
30 Ga0070668_100238987 3300005347 Bacteria 1504
31 Ga0070669_100018188 3300005353 Bacteria 5020
32 Ga0070669_100047314 3300005353 Bacteria 3138
33 Ga0070669_100132882 3300005353 Unclassified 1911
34 Ga0070669_100219121 3300005353 Bacteria 1504
35 Ga0070671_100028581 3300005355 Bacteria 4592
36 Ga0070671_100335524 3300005355 Bacteria 1289
37 Ga0070671_100353110 3300005355 Bacteria 1255
38 Ga0070673_100089595 3300005364 Bacteria 2511
39 Ga0070659_100000845 3300005366 Bacteria 22350
40 Ga0070659_100004245 3300005366 Bacteria 10230
41 Ga0070703_10012015 3300005406 Bacteria 2450
42 Ga0070703_10015958 3300005406 Unclassified 2152
43 Ga0070709_10044346 3300005434 Bacteria 2753
44 Ga0070709_10056477 3300005434 Unclassified 2482
45 Ga0070709_10174078 3300005434 Bacteria 1506
46 Ga0070714_100046847 3300005435 Bacteria 3670
47 Ga0070714_100084675 3300005435 Bacteria 2767
48 Ga0070714_100598110 3300005435 Unclassified 1059
49 Ga0070713_100215916 3300005436 Bacteria 1738
50 Ga0070713_100410993 3300005436 Bacteria 1265
51 Ga0070710_10008505 3300005437 Bacteria 4996
52 Ga0070710_10220804 3300005437 Bacteria 1206
53 Ga0070711_100025659 3300005439 Bacteria 3857
54 Ga0070711_100099749 3300005439 Bacteria 2111
55 Ga0070705_100007634 3300005440 Bacteria 5333
56 Ga0070705_100035136 3300005440 Bacteria 2807
57 Ga0070705_100089981 3300005440 Unclassified 1909
58 Ga0070705_100112138 3300005440 Bacteria 1745
59 Ga0070700_100003634 3300005441 Bacteria 7980
60 Ga0070694_100007032 3300005444 Bacteria 6846
61 Ga0070694_100008535 3300005444 Bacteria 6270
62 Ga0070694_100019525 3300005444 Bacteria 4311
63 Ga0070694_100068033 3300005444 Bacteria 2447
64 Ga0070694_100070908 3300005444 Unclassified 2400
65 Ga0070694_100090621 3300005444 Bacteria 2144
66 Ga0070708_100041368 3300005445 Bacteria 4040
67 Ga0070708_100087120 3300005445 Bacteria 2837
68 Ga0070708_100216269 3300005445 Unclassified 1796
69 Ga0070708_100392260 3300005445 Unclassified 1309
70 Ga0070708_100454447 3300005445 Bacteria 1208
71 Ga0070708_100520776 3300005445 Bacteria 1122
72 Ga0070708_100650257 3300005445 Bacteria 993
73 Ga0070663_100002361 3300005455 Bacteria 10617
74 Ga0070663_100051009 3300005455 Bacteria 2945
75 Ga0070678_100178491 3300005456 Bacteria 1736
76 Ga0070662_100006420 3300005457 Bacteria 7579
77 Ga0070681_10069882 3300005458 Bacteria 3477
78 Ga0070681_10107718 3300005458 Bacteria 2727
79 Ga0070681_10200719 3300005458 Bacteria 1912
80 Ga0070681_10360246 3300005458 Bacteria 1365
81 Ga0070681_10398905 3300005458 Unclassified 1287
82 Ga0068867_100002041 3300005459 Bacteria 14136
83 Ga0068867_100218259 3300005459 Bacteria 1535
84 Ga0070706_100035549 3300005467 Bacteria 4601
85 Ga0070706_100046033 3300005467 Bacteria 4027
86 Ga0070706_100064868 3300005467 Bacteria 3376
87 Ga0070706_100109729 3300005467 Unclassified 2567
88 Ga0070706_100125561 3300005467 Bacteria 2392
89 Ga0070706_100137790 3300005467 Bacteria 2277
90 Ga0070706_100217239 3300005467 Bacteria 1785
91 Ga0070706_100339977 3300005467 Bacteria 1399
92 Ga0070706_100385173 3300005467 Bacteria 1305
93 Ga0070706_100515253 3300005467 Bacteria 1112
94 Ga0070707_100024547 3300005468 Bacteria 5711
95 Ga0070707_100028956 3300005468 Bacteria 5272
96 Ga0070707_100032796 3300005468 Bacteria 4948
97 Ga0070707_100108925 3300005468 Bacteria 2686
98 Ga0070707_100134242 3300005468 Bacteria 2407
99 Ga0070707_100164163 3300005468 Bacteria 2164
100 Ga0070707_100254299 3300005468 Bacteria 1709
101 Ga0070707_100312867 3300005468 Bacteria 1526
102 Ga0070707_100427788 3300005468 Bacteria 1284
103 Ga0070707_100438053 3300005468 Bacteria 1267
104 Ga0070698_100019850 3300005471 Bacteria 7049
105 Ga0070698_100322916 3300005471 Unclassified 1474
106 Ga0070698_100386797 3300005471 Bacteria 1332
107 Ga0070698_100468672 3300005471 Bacteria 1196
108 Ga0070698_100518920 3300005471 Bacteria 1130
109 Ga0070699_100002124 3300005518 Bacteria 17975
110 Ga0070699_100020265 3300005518 Bacteria 5733
111 Ga0070699_100021823 3300005518 Bacteria 5519
112 Ga0070699_100028026 3300005518 Bacteria 4857
113 Ga0070699_100049292 3300005518 Bacteria 3645
114 Ga0070699_100056610 3300005518 Bacteria 3396
115 Ga0070699_100248333 3300005518 Bacteria 1589
116 Ga0070699_100512462 3300005518 Unclassified 1090
117 Ga0070679_100001475 3300005530 Bacteria 20865
118 Ga0070679_100044379 3300005530 Bacteria 4428
119 Ga0070679_100055490 3300005530 Bacteria 3944
120 Ga0070679_100140190 3300005530 Bacteria 2398
121 Ga0070679_100300361 3300005530 Bacteria 1556
122 Ga0070684_100205850 3300005535 Bacteria 1793
123 Ga0070684_100506100 3300005535 Unclassified 1119
124 Ga0070697_100085500 3300005536 Bacteria 2602
125 Ga0070697_100088887 3300005536 Bacteria 2552
126 Ga0070697_100095053 3300005536 Bacteria 2470
127 Ga0070697_100121894 3300005536 Unclassified 2181
128 Ga0068853_100000232 3300005539 Bacteria 39364
129 Ga0070672_100013035 3300005543 Bacteria 5859
130 Ga0070672_100144616 3300005543 Bacteria 1964
131 Ga0070686_100046147 3300005544 Bacteria 2748
132 Ga0070686_100107972 3300005544 Bacteria 1891
133 Ga0070695_100013796 3300005545 Bacteria 4860
134 Ga0070695_100024657 3300005545 Bacteria 3708
135 Ga0070695_100165669 3300005545 Bacteria 1555
136 Ga0070695_100185619 3300005545 Bacteria 1476
137 Ga0070696_100002075 3300005546 Bacteria 13151
138 Ga0070696_100061462 3300005546 Bacteria 2628
139 Ga0070696_100083525 3300005546 Unclassified 2265
140 Ga0070693_100000028 3300005547 Bacteria 56126
141 Ga0070693_100010662 3300005547 Bacteria 4608
142 Ga0070693_100141331 3300005547 Bacteria 1516
143 Ga0070704_100007578 3300005549 Bacteria 6468
144 Ga0070704_100033340 3300005549 Bacteria 3481
145 Ga0070704_100137386 3300005549 Unclassified 1903
146 Ga0070704_100178648 3300005549 Bacteria 1696
147 Ga0070704_100221121 3300005549 Unclassified 1540
148 Ga0070704_100482713 3300005549 Bacteria 1073
149 Ga0070704_100614379 3300005549 Bacteria 956
150 Ga0068855_100001465 3300005563 Bacteria 29468
151 Ga0068855_100001875 3300005563 Bacteria 26134
152 Ga0070664_100021732 3300005564 Bacteria 5292
153 Ga0070664_100036938 3300005564 Bacteria 4105
154 Ga0070664_100219696 3300005564 Bacteria 1700
155 Ga0068857_100038738 3300005577 Bacteria 4220
156 Ga0068854_100050887 3300005578 Bacteria 2966
157 Ga0068856_100001138 3300005614 Bacteria 27944
158 Ga0068856_100044583 3300005614 Bacteria 4365
159 Ga0068856_100522601 3300005614 Bacteria 1208
160 Ga0070702_100031846 3300005615 Unclassified 2889
161 Ga0068859_100023978 3300005617 Bacteria 6123
162 Ga0068859_100042516 3300005617 Bacteria 4565
163 Ga0068859_100107528 3300005617 Bacteria 2850
164 Ga0068859_100149416 3300005617 Bacteria 2412
165 Ga0068859_100232191 3300005617 Unclassified 1933
166 Ga0068859_100251400 3300005617 Bacteria 1858
167 Ga0068859_100284162 3300005617 Unclassified 1747
168 Ga0068864_100045652 3300005618 Bacteria 3758
169 Ga0068864_100049049 3300005618 Bacteria 3631
170 Ga0068864_100799731 3300005618 Bacteria 927
171 Ga0068861_100003774 3300005719 Bacteria 10114
172 Ga0068861_100113019 3300005719 Unclassified 2178
173 Ga0068861_100118513 3300005719 Bacteria 2132
174 Ga0068861_100568862 3300005719 Bacteria 1035
175 Ga0068870_10000446 3300005840 Bacteria 15641
176 Ga0068863_100032204 3300005841 Bacteria 4997
177 Ga0068863_100088941 3300005841 Unclassified 2927
178 Ga0068863_100094075 3300005841 Unclassified 2844
179 Ga0068863_100152931 3300005841 Bacteria 2208
180 Ga0068863_100302880 3300005841 Unclassified 1551
181 Ga0068858_100010646 3300005842 Bacteria 8702
182 Ga0068858_100144238 3300005842 Bacteria 2236
183 Ga0068858_100220348 3300005842 Bacteria 1797
184 Ga0068860_100029232 3300005843 Bacteria 5300
185 Ga0068860_100030891 3300005843 Bacteria 5150
186 Ga0068860_100036157 3300005843 Bacteria 4734
187 Ga0068860_100080148 3300005843 Bacteria 3105
188 Ga0068860_100098090 3300005843 Bacteria 2794
189 Ga0068860_100098138 3300005843 Unclassified 2794
190 Ga0068860_100166466 3300005843 Bacteria 2128
191 Ga0068860_100402964 3300005843 Bacteria 1353
192 Ga0068862_100022721 3300005844 Bacteria 5248
193 Ga0068862_100052686 3300005844 Bacteria 3482
194 Ga0068862_100334577 3300005844 Bacteria 1401
195 Ga0068862_100407809 3300005844 Bacteria 1273
196 Ga0068862_100580697 3300005844 Bacteria 1074
197 Ga0081455_10000824 3300005937 Bacteria 39882
198 Ga0081455_10067439 3300005937 Bacteria 2982
199 Ga0081538_10006853 3300005981 Bacteria 9923
200 Ga0081538_10148360 3300005981 Unclassified 1067
201 Ga0081540_1009575 3300005983 Bacteria 6667
202 Ga0081540_1011768 3300005983 Bacteria 5820
203 Ga0081540_1013000 3300005983 Bacteria 5437
204 Ga0081540_1018443 3300005983 Bacteria 4279
205 Ga0081540_1019705 3300005983 Bacteria 4086
206 Ga0081540_1035896 3300005983 Bacteria 2652
207 Ga0081539_10000021 3300005985 Bacteria 360643
208 Ga0081539_10031167 3300005985 Bacteria 3293
209 Ga0070717_10000606 3300006028 Bacteria 22984
210 Ga0070717_10043316 3300006028 Bacteria 3674
211 Ga0070717_10158959 3300006028 Bacteria 1959
212 Ga0075365_10003905 3300006038 Bacteria 7805
213 Ga0075363_100027866 3300006048 Bacteria 2901
214 Ga0075364_10087479 3300006051 Bacteria 2065
215 Ga0075432_10049483 3300006058 Bacteria 1481
216 Ga0070716_100015635 3300006173 Bacteria 3903
217 Ga0070712_100043204 3300006175 Bacteria 3102
218 Ga0070712_100055130 3300006175 Unclassified 2782
219 Ga0075362_10040143 3300006177 Bacteria 2059
220 Ga0075367_10003112 3300006178 Bacteria 7803
221 Ga0075369_10002094 3300006186 Bacteria 7042
222 Ga0075428_100000103 3300006844 Bacteria 71205
223 Ga0075428_100001389 3300006844 Bacteria 25742
224 Ga0075428_100003715 3300006844 Bacteria 16725
225 Ga0075428_100021808 3300006844 Bacteria 7092
226 Ga0075428_100032038 3300006844 Bacteria 5807
227 Ga0075428_100048068 3300006844 Bacteria 4684
228 Ga0075428_100146503 3300006844 Bacteria 2566
229 Ga0075428_100163361 3300006844 Bacteria 2416
230 Ga0075428_100210594 3300006844 Bacteria 2100
231 Ga0075428_100272958 3300006844 Bacteria 1819
232 Ga0075428_100284701 3300006844 Bacteria 1778
233 Ga0075428_100362548 3300006844 Bacteria 1554
234 Ga0075428_100472058 3300006844 Bacteria 1343
235 Ga0075428_100531309 3300006844 Unclassified 1258
236 Ga0075430_100000499 3300006846 Bacteria 29432
237 Ga0075430_100001172 3300006846 Bacteria 20997
238 Ga0075430_100002301 3300006846 Bacteria 15849
239 Ga0075430_100008431 3300006846 Bacteria 8708
240 Ga0075430_100023489 3300006846 Bacteria 5249
241 Ga0075430_100068371 3300006846 Bacteria 2980
242 Ga0075430_100334713 3300006846 Unclassified 1251
243 Ga0075431_100000226 3300006847 Bacteria 42242
244 Ga0075431_100002712 3300006847 Bacteria 17168
245 Ga0075431_100008045 3300006847 Bacteria 10521
246 Ga0075431_100029890 3300006847 Bacteria 5609
247 Ga0075431_100061131 3300006847 Bacteria 3887
248 Ga0075431_100087432 3300006847 Bacteria 3216
249 Ga0075431_100093911 3300006847 Bacteria 3096
250 Ga0075431_100114244 3300006847 Unclassified 2787
251 Ga0075431_100161077 3300006847 Unclassified 2307
252 Ga0075431_100310306 3300006847 Unclassified 1592
253 Ga0075431_100324704 3300006847 Bacteria 1551
254 Ga0075431_100396183 3300006847 Bacteria 1382
255 Ga0075433_10001404 3300006852 Bacteria 17758
256 Ga0075433_10028008 3300006852 Bacteria 4786
257 Ga0075433_10036047 3300006852 Bacteria 4258
258 Ga0075433_10037587 3300006852 Unclassified 4177
259 Ga0075433_10055198 3300006852 Bacteria 3467
260 Ga0075433_10063716 3300006852 Bacteria 3230
261 Ga0075433_10067526 3300006852 Bacteria 3138
262 Ga0075433_10246277 3300006852 Bacteria 1586
263 Ga0075433_10259549 3300006852 Unclassified 1541
264 Ga0075433_10379228 3300006852 Bacteria 1248
265 Ga0075434_100013019 3300006871 Bacteria 7899
266 Ga0075434_100013803 3300006871 Bacteria 7703
267 Ga0075434_100037372 3300006871 Bacteria 4807
268 Ga0075434_100071271 3300006871 Bacteria 3467
269 Ga0075434_100085679 3300006871 Bacteria 3150
270 Ga0075434_100097029 3300006871 Bacteria 2952
271 Ga0075434_100205158 3300006871 Unclassified 1991
272 Ga0075434_100261864 3300006871 Bacteria 1748
273 Ga0075434_100519922 3300006871 Bacteria 1210
274 Ga0075434_100565560 3300006871 Unclassified 1156
275 Ga0075429_100007420 3300006880 Bacteria 9515
276 Ga0075429_100019832 3300006880 Bacteria 5830
277 Ga0075429_100021867 3300006880 Bacteria 5544
278 Ga0075429_100023371 3300006880 Bacteria 5364
279 Ga0075429_100039897 3300006880 Bacteria 4085
280 Ga0075429_100047238 3300006880 Bacteria 3745
281 Ga0075429_100056275 3300006880 Bacteria 3423
282 Ga0075429_100249176 3300006880 Unclassified 1555
283 Ga0075429_100304858 3300006880 Bacteria 1394
284 Ga0075429_100324454 3300006880 Bacteria 1347
285 Ga0068865_100057926 3300006881 Bacteria 2704
286 Ga0068865_100490423 3300006881 Bacteria 1023
287 Ga0075436_100001877 3300006914 Bacteria 14439
288 Ga0075436_100015732 3300006914 Bacteria 5179
289 Ga0075436_100030743 3300006914 Bacteria 3696
290 Ga0075436_100198765 3300006914 Bacteria 1419
291 Ga0075436_100256477 3300006914 Bacteria 1246
292 Ga0097620_100023979 3300006931 Bacteria 6123
293 Ga0097620_100042510 3300006931 Bacteria 4565
294 Ga0097620_100107527 3300006931 Bacteria 2850
295 Ga0097620_100149416 3300006931 Bacteria 2412
296 Ga0097620_100232183 3300006931 Unclassified 1933
297 Ga0097620_100251393 3300006931 Bacteria 1858
298 Ga0097620_100284149 3300006931 Unclassified 1747
299 Ga0075435_100019967 3300007076 Bacteria 5122
300 Ga0075435_100062156 3300007076 Bacteria 3030
301 Ga0075435_100081720 3300007076 Bacteria 2654
302 Ga0075435_100225542 3300007076 Unclassified 1591
303 Ga0075435_100232970 3300007076 Bacteria 1565
304 Ga0099794_10003016 3300007265 Bacteria 6362
305 Ga0099794_10013628 3300007265 Bacteria 3543
306 Ga0099795_10005301 3300007788 Bacteria 3414
307 Ga0099795_10009925 3300007788 Bacteria 2781
308 Ga0105240_10360659 3300009093 Bacteria 1646
309 Ga0105240_10526218 3300009093 Bacteria 1311
310 Ga0111539_10000098 3300009094 Bacteria 91568
311 Ga0111539_10000527 3300009094 Bacteria 48473
312 Ga0111539_10002606 3300009094 Bacteria 23897
313 Ga0111539_10006099 3300009094 Bacteria 15559
314 Ga0111539_10015171 3300009094 Bacteria 9600
315 Ga0111539_10039864 3300009094 Bacteria 5657
316 Ga0111539_10050168 3300009094 Bacteria 4972
317 Ga0111539_10060175 3300009094 Bacteria 4501
318 Ga0111539_10060886 3300009094 Bacteria 4473
319 Ga0111539_10074985 3300009094 Bacteria 3986
320 Ga0111539_10163362 3300009094 Bacteria 2604
321 Ga0111539_10204378 3300009094 Bacteria 2303
322 Ga0111539_10776358 3300009094 Unclassified 1115
323 Ga0105247_10033597 3300009101 Bacteria 3120
324 Ga0114129_10005514 3300009147 Bacteria 17895
325 Ga0114129_10016188 3300009147 Bacteria 10612
326 Ga0114129_10021159 3300009147 Bacteria 9237
327 Ga0114129_10108451 3300009147 Bacteria 3833
328 Ga0114129_10125258 3300009147 Bacteria 3533
329 Ga0114129_10129442 3300009147 Bacteria 3469
330 Ga0114129_10208330 3300009147 Bacteria 2645
331 Ga0114129_10221888 3300009147 Unclassified 2549
332 Ga0114129_10222938 3300009147 Bacteria 2543
333 Ga0114129_10228188 3300009147 Bacteria 2509
334 Ga0114129_10286869 3300009147 Bacteria 2198
335 Ga0114129_10406786 3300009147 Bacteria 1793
336 Ga0114129_10427732 3300009147 Unclassified 1740
337 Ga0114129_10524625 3300009147 Bacteria 1544
338 Ga0114129_10587358 3300009147 Bacteria 1445
339 Ga0105243_10075714 3300009148 Unclassified 2732
340 Ga0105243_10097265 3300009148 Bacteria 2436
341 Ga0105243_10203983 3300009148 Bacteria 1736
342 Ga0105241_10000273 3300009174 Bacteria 38438
343 Ga0105241_10010697 3300009174 Bacteria 6733
344 Ga0105241_10026978 3300009174 Bacteria 4275
345 Ga0105241_10035951 3300009174 Bacteria 3727
346 Ga0105242_10152176 3300009176 Bacteria 2018
347 Ga0105248_10287617 3300009177 Bacteria 1851
348 Ga0105249_10276401 3300009553 Bacteria 1675
349 Ga0105249_10421587 3300009553 Bacteria 1368
350 Ga0105249_10438533 3300009553 Bacteria 1343
351 Ga0105249_10660940 3300009553 Bacteria 1103
352 Ga0099796_10117199 3300010159 Bacteria 1020
353 Ga0099796_10124771 3300010159 Bacteria 993
354 Ga0105239_10221860 3300010375 Bacteria 2120
355 Ga0105246_10030220 3300011119 Unclassified 3576
356 Ga0105246_10032792 3300011119 Bacteria 3447
357 Ga0157373_10000408 3300013100 Bacteria 34529
358 Ga0157373_10146911 3300013100 Bacteria 1658
359 Ga0157373_10250968 3300013100 Bacteria 1251
360 Ga0157371_10375909 3300013102 Bacteria 1037
361 Ga0157370_10067301 3300013104 Bacteria 3386
362 Ga0157374_10257913 3300013296 Bacteria 1717
363 Ga0157378_10092775 3300013297 Bacteria 2747
364 Ga0157378_10250837 3300013297 Unclassified 1694
365 Ga0163162_10020700 3300013306 Bacteria 6465
366 Ga0163162_10436605 3300013306 Bacteria 1441
367 Ga0157372_10000612 3300013307 Bacteria 39043
368 Ga0157372_10000827 3300013307 Bacteria 33525
369 Ga0157372_10178659 3300013307 Bacteria 2457
370 Ga0157375_10114421 3300013308 Bacteria 2800
371 Ga0157375_10241638 3300013308 Unclassified 1965
372 Ga0157375_10245732 3300013308 Bacteria 1950
373 Ga0157375_10259767 3300013308 Bacteria 1898
374 Ga0157375_10593522 3300013308 Bacteria 1267
375 Ga0163163_10022085 3300014325 Bacteria 6019
376 Ga0163163_10033352 3300014325 Bacteria 4980
377 Ga0163163_10089171 3300014325 Bacteria 3096
378 Ga0157380_10420654 3300014326 Bacteria 1274
379 Ga0157380_10442423 3300014326 Bacteria 1246
380 Ga0182008_10042430 3300014497 Bacteria 2266
381 Ga0182008_10047793 3300014497 Bacteria 2126
382 Ga0182008_10055650 3300014497 Bacteria 1956
383 Ga0182008_10199216 3300014497 Bacteria 1018
384 Ga0157379_10000856 3300014968 Bacteria 24672
385 Ga0157379_10007151 3300014968 Bacteria 9653
386 Ga0157379_10266603 3300014968 Unclassified 1557
387 Ga0157379_10378844 3300014968 Unclassified 1298
388 Ga0157379_10442055 3300014968 Bacteria 1199
389 Ga0157376_10360015 3300014969 Bacteria 1395
390 Ga0157376_10807938 3300014969 Bacteria 951
391 Ga0182007_10018621 3300015262 Bacteria 2512
392 Ga0163161_10169085 3300017792 Bacteria 1670
393 Ga0213875_10000844 3300021388 Bacteria 22655
394 Ga0213875_10002430 3300021388 Bacteria 11154
395 Ga0213875_10024186 3300021388 Bacteria 2898
396 Ga0213875_10029477 3300021388 Bacteria 2603
397 Ga0228598_1011879 3300024227 Bacteria 1732
398 Ga0207697_10096648 3300025315 Bacteria 1256
399 Ga0207653_10000704 3300025885 Bacteria 11470
400 Ga0207642_10064976 3300025899 Unclassified 1712
401 Ga0207710_10034098 3300025900 Unclassified 2235
402 Ga0207688_10008445 3300025901 Bacteria 5602
403 Ga0207688_10142830 3300025901 Bacteria 1410
404 Ga0207680_10075290 3300025903 Bacteria 2105
405 Ga0207647_10026791 3300025904 Bacteria 3766
406 Ga0207645_10003491 3300025907 Bacteria 11902
407 Ga0207645_10145964 3300025907 Unclassified 1542
408 Ga0207643_10001164 3300025908 Bacteria 15631
409 Ga0207643_10012683 3300025908 Bacteria 4554
410 Ga0207684_10008329 3300025910 Bacteria 9218
411 Ga0207684_10031376 3300025910 Bacteria 4520
412 Ga0207684_10048374 3300025910 Bacteria 3607
413 Ga0207684_10058899 3300025910 Bacteria 3260
414 Ga0207684_10128648 3300025910 Bacteria 2174
415 Ga0207684_10182167 3300025910 Bacteria 1811
416 Ga0207684_10251054 3300025910 Unclassified 1526
417 Ga0207684_10252269 3300025910 Unclassified 1522
418 Ga0207684_10315369 3300025910 Unclassified 1348
419 Ga0207684_10432671 3300025910 Bacteria 1130
420 Ga0207684_10571499 3300025910 Unclassified 967
421 Ga0207654_10000814 3300025911 Bacteria 17183
422 Ga0207654_10010924 3300025911 Bacteria 4622
423 Ga0207707_10000170 3300025912 Bacteria 68142
424 Ga0207707_10000198 3300025912 Bacteria 63730
425 Ga0207707_10101457 3300025912 Bacteria 2515
426 Ga0207707_10119265 3300025912 Bacteria 2306
427 Ga0207707_10158782 3300025912 Bacteria 1977
428 Ga0207695_10440586 3300025913 Bacteria 1186
429 Ga0207693_10014693 3300025915 Bacteria 6290
430 Ga0207693_10019858 3300025915 Bacteria 5344
431 Ga0207693_10027641 3300025915 Bacteria 4484
432 Ga0207693_10030564 3300025915 Bacteria 4255
433 Ga0207693_10037494 3300025915 Bacteria 3821
434 Ga0207693_10073922 3300025915 Bacteria 2668
435 Ga0207693_10131210 3300025915 Unclassified 1970
436 Ga0207693_10145600 3300025915 Bacteria 1863
437 Ga0207663_10040687 3300025916 Unclassified 2827
438 Ga0207663_10156875 3300025916 Bacteria 1602
439 Ga0207660_10000236 3300025917 Bacteria 35775
440 Ga0207660_10013858 3300025917 Bacteria 5290
441 Ga0207660_10084372 3300025917 Bacteria 2341
442 Ga0207657_10000113 3300025919 Bacteria 79650
443 Ga0207657_10001106 3300025919 Bacteria 28608
444 Ga0207649_10004063 3300025920 Bacteria 7965
445 Ga0207649_10014769 3300025920 Bacteria 4379
446 Ga0207652_10000284 3300025921 Bacteria 52907
447 Ga0207652_10004264 3300025921 Bacteria 11671
448 Ga0207646_10049331 3300025922 Bacteria 3771
449 Ga0207646_10055267 3300025922 Bacteria 3549
450 Ga0207646_10063838 3300025922 Bacteria 3287
451 Ga0207646_10075082 3300025922 Bacteria 3020
452 Ga0207646_10095143 3300025922 Bacteria 2668
453 Ga0207646_10361026 3300025922 Bacteria 1312
454 Ga0207681_10143621 3300025923 Bacteria 1780
455 Ga0207681_10172770 3300025923 Bacteria 1639
456 Ga0207681_10236486 3300025923 Bacteria 1420
457 Ga0207681_10300442 3300025923 Bacteria 1270
458 Ga0207650_10020994 3300025925 Bacteria 4613
459 Ga0207650_10024111 3300025925 Bacteria 4321
460 Ga0207700_10027855 3300025928 Bacteria 3963
461 Ga0207700_10056067 3300025928 Bacteria 2965
462 Ga0207700_10130259 3300025928 Bacteria 2053
463 Ga0207700_10205402 3300025928 Bacteria 1662
464 Ga0207664_10036700 3300025929 Bacteria 3788
465 Ga0207664_10093140 3300025929 Bacteria 2474
466 Ga0207664_10125702 3300025929 Bacteria 2152
467 Ga0207664_10452246 3300025929 Bacteria 1146
468 Ga0207644_10231329 3300025931 Unclassified 1469
469 Ga0207644_10398703 3300025931 Bacteria 1124
470 Ga0207690_10002071 3300025932 Bacteria 12292
471 Ga0207690_10022024 3300025932 Bacteria 3958
472 Ga0207706_10000622 3300025933 Bacteria 37676
473 Ga0207706_10023768 3300025933 Bacteria 5499
474 Ga0207706_10097940 3300025933 Bacteria 2580
475 Ga0207706_10153379 3300025933 Bacteria 2026
476 Ga0207686_10052743 3300025934 Bacteria 2539
477 Ga0207686_10228659 3300025934 Bacteria 1347
478 Ga0207709_10109508 3300025935 Bacteria 1844
479 Ga0207709_10118634 3300025935 Bacteria 1782
480 Ga0207709_10182783 3300025935 Unclassified 1482
481 Ga0207670_10009414 3300025936 Bacteria 5576
482 Ga0207670_10022880 3300025936 Bacteria 3881
483 Ga0207670_10211650 3300025936 Bacteria 1479
484 Ga0207669_10215918 3300025937 Bacteria 1404
485 Ga0207665_10019498 3300025939 Bacteria 4459
486 Ga0207691_10030698 3300025940 Bacteria 5020
487 Ga0207691_10074595 3300025940 Bacteria 3059
488 Ga0207711_10092712 3300025941 Bacteria 2659
489 Ga0207711_10221628 3300025941 Unclassified 1730
490 Ga0207689_10000839 3300025942 Bacteria 29620
491 Ga0207689_10027704 3300025942 Bacteria 4742
492 Ga0207689_10084832 3300025942 Bacteria 2603
493 Ga0207689_10095104 3300025942 Bacteria 2447
494 Ga0207689_10192365 3300025942 Bacteria 1683
495 Ga0207689_10372716 3300025942 Bacteria 1188
496 Ga0207661_10518363 3300025944 Bacteria 1090
497 Ga0207679_10000523 3300025945 Bacteria 25949
498 Ga0207679_10001316 3300025945 Bacteria 15693
499 Ga0207679_10048362 3300025945 Bacteria 3096
500 Ga0207667_10014534 3300025949 Bacteria 8970
501 Ga0207667_10100023 3300025949 Bacteria 2991
502 Ga0207651_10022636 3300025960 Bacteria 3847
503 Ga0207712_10265123 3300025961 Unclassified 1395
504 Ga0207640_10069230 3300025981 Bacteria 2369
505 Ga0207640_10086432 3300025981 Bacteria 2159
506 Ga0207658_10203715 3300025986 Bacteria 1654
507 Ga0207677_10425041 3300026023 Bacteria 1133
508 Ga0207703_10006818 3300026035 Bacteria 9098
509 Ga0207703_10243764 3300026035 Bacteria 1617
510 Ga0207703_10581367 3300026035 Bacteria 1058
511 Ga0207639_10026015 3300026041 Bacteria 4249
512 Ga0207678_10002857 3300026067 Bacteria 15674
513 Ga0207708_10014915 3300026075 Bacteria 5819
514 Ga0207708_10054251 3300026075 Bacteria 3056
515 Ga0207708_10176607 3300026075 Bacteria 1694
516 Ga0207708_10232429 3300026075 Bacteria 1481
517 Ga0207702_10000493 3300026078 Bacteria 44394
518 Ga0207702_10006470 3300026078 Bacteria 10099
519 Ga0207702_10211977 3300026078 Bacteria 1801
520 Ga0207641_10100436 3300026088 Unclassified 2548
521 Ga0207641_10272596 3300026088 Bacteria 1588
522 Ga0207641_10322689 3300026088 Bacteria 1465
523 Ga0207641_10641714 3300026088 Bacteria 1042
524 Ga0207648_10004641 3300026089 Bacteria 14062
525 Ga0207648_10063959 3300026089 Bacteria 3206
526 Ga0207648_10077191 3300026089 Bacteria 2903
527 Ga0207648_10279462 3300026089 Bacteria 1493
528 Ga0207676_10015865 3300026095 Bacteria 5447
529 Ga0207676_10091394 3300026095 Bacteria 2500
530 Ga0207676_10599486 3300026095 Bacteria 1058
531 Ga0207674_10000197 3300026116 Bacteria 74719
532 Ga0207674_10001680 3300026116 Bacteria 28444
533 Ga0207674_10072516 3300026116 Bacteria 3459
534 Ga0207675_100014032 3300026118 Bacteria 7470
535 Ga0207675_100367778 3300026118 Bacteria 1412
536 Ga0207698_10647175 3300026142 Bacteria 1047
537 Ga0209996_1000557 3300027395 Bacteria 4499
538 Ga0209995_1006153 3300027471 Bacteria 1929
539 Ga0209968_1000802 3300027526 Bacteria 4848
540 Ga0209999_1009513 3300027543 Bacteria 1756
541 Ga0209970_1030826 3300027614 Bacteria 931
542 Ga0209983_1010399 3300027665 Bacteria 1901
543 Ga0209588_1014131 3300027671 Bacteria 2442
544 Ga0209971_1000574 3300027682 Bacteria 9605
545 Ga0209966_1000416 3300027695 Bacteria 12351
546 Ga0209998_10001841 3300027717 Bacteria 5028
547 Ga0209974_10001363 3300027876 Bacteria 8803
548 Ga0209974_10024653 3300027876 Bacteria 1990
549 Ga0207428_10000341 3300027907 Bacteria 60709
550 Ga0207428_10003164 3300027907 Bacteria 16129
551 Ga0207428_10010024 3300027907 Bacteria 8479
552 Ga0207428_10010492 3300027907 Bacteria 8270
553 Ga0207428_10041238 3300027907 Bacteria 3738
554 Ga0207428_10101501 3300027907 Bacteria 2223
555 Ga0207428_10164161 3300027907 Bacteria 1685
556 Ga0207428_10184064 3300027907 Bacteria 1577
557 Ga0268266_10287547 3300028379 Bacteria 1530
558 Ga0268265_10106556 3300028380 Bacteria 2277
559 Ga0268265_10188039 3300028380 Bacteria 1781
560 Ga0268265_10367717 3300028380 Unclassified 1319
561 Ga0268265_10369773 3300028380 Unclassified 1315
562 Ga0268264_10015033 3300028381 Bacteria 6350
563 Ga0268264_10031539 3300028381 Bacteria 4344
564 Ga0268264_10130543 3300028381 Bacteria 2226
565 Ga0268264_10242771 3300028381 Bacteria 1669
566 Ga0265338_10027357 3300028800 Bacteria 5723
567 Ga0265325_10119049 3300031241 Bacteria 1275
568 Ga0307408_100007449 3300031548 Bacteria 7240
569 Ga0307408_100084504 3300031548 Bacteria 2381
570 Ga0307406_10039957 3300031901 Bacteria 2914
571 Ga0307407_10169463 3300031903 Unclassified 1437
572 Ga0307416_100221576 3300032002 Unclassified 1815
573 Ga0307411_10242894 3300032005 Bacteria 1411
574 Ga0373950_0020086 3300034818 Bacteria 1172
575 Ga0373938_0026974 3300034957 Unclassified 1206
576 Ga0373926_0007148 3300035083 Bacteria 3717
577 Ga0373929_0022726 3300035085 Bacteria 1282
578 Ga0373934_0028976 3300035086 Bacteria 2160
579 Ga0373949_0049099 3300035090 Unclassified 1059
580 Ga0373951_0005728 3300035091 Bacteria 2873
581 Ga0373923_0020635 3300035111 Bacteria 2562
582 Ga0373936_0063772 3300035113 Archaea 1509
583 Ga0373953_0135968 3300035117 Bacteria 1050
584 Ga0373956_0038538 3300035119 Bacteria 2115
585 Ga0373957_0035248 3300035120 Bacteria 1858
586 Ga0373960_0010057 3300035121 Bacteria 2305
587 Ga0373943_0130526 3300035170 Bacteria 1344
588 Ga0373946_0060724 3300035171 Bacteria 1608
589 Ga0373955_0077248 3300035172 Bacteria 1874
590 Ga0373942_0022149 3300035207 Bacteria 1610
591 Ga0373961_0011996 3300035241 Bacteria 2162
592 Ga0316574_0245469 3300035398 Bacteria 1144
593 Ga0373924_0055530 3300035410 Archaea 1648
594 Ga0373931_0008533 3300035691 Bacteria 4863
595 Ga0373931_0049612 3300035691 Unclassified 2230
596 Ga0373931_0085842 3300035691 Bacteria 1745
597 Ga0373931_0088119 3300035691 Bacteria 1724
598 Ga0373931_0144230 3300035691 Bacteria 1382
599 Ga0373935_0095173 3300035692 Bacteria 1956
600 Ga0373935_0369581 3300035692 Bacteria 1025
601 Ga0373927_0073687 3300035695 Bacteria 2211
602 Ga0373927_0081288 3300035695 Bacteria 2100
603 Ga0373927_0144962 3300035695 Bacteria 1554
604 Ga0373927_0257915 3300035695 Bacteria 1146
605 Ga0373933_0008687 3300035724 Bacteria 5539
606 Ga0373933_0018196 3300035724 Bacteria 3949
607 Ga0373933_0018425 3300035724 Unclassified 3926
608 Ga0373933_0054050 3300035724 Bacteria 2406
609 Ga0373933_0124382 3300035724 Bacteria 1617
610 Ga0373933_0205150 3300035724 Bacteria 1262
611 Ga0373947_0030927 3300035725 Bacteria 3148
612 Ga0373947_0121834 3300035725 Bacteria 1657
613 Ga0373947_0186845 3300035725 Bacteria 1351
614 Ga0373947_0274760 3300035725 Bacteria 1119
615 Ga0373937_0010067 3300036401 Bacteria 8245
616 Ga0373937_0022237 3300036401 Bacteria 5699
617 Ga0373937_0047215 3300036401 Bacteria 3939
618 Ga0373937_0048067 3300036401 Unclassified 3904
619 Ga0373937_0070697 3300036401 Bacteria 3219
620 Ga0373937_0076417 3300036401 Bacteria 3093
621 Ga0373937_0083428 3300036401 Bacteria 2956
622 Ga0373937_0101362 3300036401 Bacteria 2672
623 Ga0373937_0121415 3300036401 Unclassified 2435
624 Ga0373937_0262237 3300036401 Bacteria 1630
625 Ga0373925_0014791 3300037068 Bacteria 5641
626 Ga0373925_0025637 3300037068 Bacteria 4309
627 Ga0373925_0026815 3300037068 Bacteria 4218
628 Ga0373925_0090722 3300037068 Bacteria 2336
629 Ga0373925_0185614 3300037068 Unclassified 1648
630 Ga0395900_0002247 3300037418 Bacteria 21493
631 Ga0395898_0052997 3300037466 Bacteria 3962
632 Ga0395905_0154660 3300037471 Unclassified 2157
633 Ga0436364_0080442 3300037853 Bacteria 24108
634 Ga0436364_0639322 3300037853 Bacteria 2327
635 Ga0436364_0722137 3300037853 Bacteria 20685
636 Ga0436364_0874567 3300037853 Bacteria 2284
637 Ga0436364_1034225 3300037853 Bacteria 1492
638 Ga0436364_1071444 3300037853 Bacteria 39553
639 Ga0436364_1078611 3300037853 Bacteria 1539
640 Ga0436364_1102652 3300037853 Bacteria 9586
641 Ga0436364_1278604 3300037853 Bacteria 2089
642 Ga0436364_1430783 3300037853 Bacteria 2617
643 Ga0395901_0004315 3300038443 Bacteria 14353
644 Ga0242419_000774 3300038698 Bacteria 1822
645 Ga0436365_0043846 3300039437 Unclassified 1608
646 Ga0436365_0469844 3300039437 Bacteria 1496
647 Ga0436365_1004606 3300039437 Bacteria 16150
648 Ga0436365_1930435 3300039437 Bacteria 39331
649 Ga0436360_0109953 3300039438 Bacteria 3450
650 Ga0436360_0292686 3300039438 Unclassified 1829
651 Ga0436360_0479510 3300039438 Bacteria 1045
652 Ga0436360_0987873 3300039438 Bacteria 1821
653 Ga0436361_0619205 3300039447 Bacteria 2348
654 Ga0436361_0731630 3300039447 Bacteria 1934
655 Ga0436363_0709230 3300039450 Bacteria 1797
656 Ga0436363_1130753 3300039450 Bacteria 1585
657 Ga0436363_1397028 3300039450 Bacteria 3874
658 Ga0436363_1417233 3300039450 Unclassified 814
659 Ga0436362_0330598 3300039453 Unclassified 1171
660 Ga0436362_0360447 3300039453 Unclassified 1261
661 Ga0436362_0874942 3300039453 Bacteria 1210
662 Ga0436362_1134760 3300039453 Bacteria 1048
663 Ga0436362_1275549 3300039453 Bacteria 1632
664 Ga0439443_007911 3300042003 Bacteria 1488
665 Ga0439448_0004733 3300042005 Bacteria 3852
666 Ga0439448_0062803 3300042005 Bacteria 1229
667 Ga0439450_036298 3300042008 Bacteria 1128
668 Ga0439454_002012 3300042011 Bacteria 2070
669 Ga0439455_0007857 3300042012 Bacteria 2271
670 Ga0439456_020830 3300042013 Bacteria 1385
671 Ga0439463_084522 3300042016 Bacteria 816
672 Ga0439458_0003476 3300042157 Bacteria 3677
673 Ga0439458_0029822 3300042157 Bacteria 1296
674 Ga0439458_0032782 3300042157 Bacteria 1243
675 Ga0439444_0015911 3300042437 Bacteria 1274
676 Ga0439459_0000622 3300042438 Bacteria 4768
677 Ga0439460_0019695 3300042461 Bacteria 1830
678 Ga0439460_0061952 3300042461 Bacteria 1143
679 Ga0451577_0008310 3300042876 Bacteria 10100
680 Ga0451577_0022382 3300042876 Bacteria 5770
681 Ga0451577_0034237 3300042876 Bacteria 4580
682 Ga0451577_0114449 3300042876 Bacteria 2415
683 Ga0451577_0760077 3300042876 Bacteria 876
684 Ga0453683_0105723 3300044673 Bacteria 1768
685 Ga0453683_0139472 3300044673 Bacteria 1530
686 Ga0453683_0168758 3300044673 Bacteria 1386
687 Ga0453683_0169769 3300044673 Bacteria 1381
688 Ga0453684_0207778 3300044712 Bacteria 2278
689 Ga0453684_0441454 3300044712 Bacteria 1450
690 Ga0466960_0017701 3300044901 Bacteria 3113
691 Ga0451576_0026470 3300045051 Bacteria 6239
692 Ga0451576_0038151 3300045051 Bacteria 5085
693 Ga0451576_0046180 3300045051 Bacteria 4586
694 Ga0451576_0075915 3300045051 Bacteria 3497
695 Ga0451576_0096233 3300045051 Bacteria 3079
696 Ga0451576_0241924 3300045051 Bacteria 1885
697 Ga0451576_0301506 3300045051 Bacteria 1676
698 Ga0451576_0320070 3300045051 Bacteria 1623
699 Ga0495592_0028281 3300046454 Bacteria 4247
700 Ga0495592_0071975 3300046454 Bacteria 2516
701 Ga0495603_0043372 3300046455 Bacteria 2686
702 Ga0495629_0200696 3300046459 Bacteria 1379
703 Ga0495651_0002425 3300046462 Bacteria 14392
704 Ga0495651_0043748 3300046462 Bacteria 3473
705 Ga0495651_0294272 3300046462 Unclassified 1091
706 Ga0495580_0034280 3300046472 Unclassified 3655
707 Ga0495580_0109918 3300046472 Bacteria 1914
708 Ga0495662_0175629 3300046476 Bacteria 1056
709 Ga0495664_0004201 3300046477 Bacteria 7864
710 Ga0495585_0020518 3300046492 Bacteria 3800
711 Ga0495594_0078085 3300046499 Bacteria 1847
712 Ga0495608_0002946 3300046511 Bacteria 12171
713 Ga0495608_0131967 3300046511 Bacteria 1598
714 Ga0495618_0235909 3300046514 Unclassified 1151
715 Ga0495628_0020266 3300046516 Bacteria 5489
716 Ga0495640_0109722 3300046533 Unclassified 1804
717 Ga0495640_0127170 3300046533 Bacteria 1652
718 Ga0495587_0039338 3300046536 Bacteria 2831
719 Ga0495598_0042554 3300046537 Bacteria 1334
720 Ga0495609_0083286 3300046538 Bacteria 1397
721 Ga0495645_0019796 3300046543 Bacteria 4848
722 Ga0495645_0182413 3300046543 Bacteria 1437
723 Ga0495667_0055717 3300046559 Bacteria 2600
724 Ga0495667_0065576 3300046559 Bacteria 2375
725 Ga0495667_0237094 3300046559 Bacteria 1162
726 Ga0495656_0022506 3300046615 Unclassified 2469
727 Ga0495634_0023101 3300046642 Bacteria 4376
728 Ga0495635_0004464 3300046663 Bacteria 9695
729 Ga0495659_0135100 3300046664 Bacteria 981
730 Ga0495588_0109904 3300046674 Bacteria 1452
731 Ga0495599_0016495 3300046678 Bacteria 4586
732 Ga0495646_0008364 3300046680 Bacteria 6579
733 Ga0495669_0097101 3300046684 Bacteria 1366
734 Ga0495669_0097681 3300046684 Bacteria 1362
735 Ga0495670_0117994 3300046691 Bacteria 1377
736 Ga0495600_0086227 3300046809 Bacteria 2049
737 Ga0495604_0001943 3300047317 Bacteria 16715
738 Ga0495674_0052106 3300047319 Bacteria 3603
739 Ga0495674_0412013 3300047319 Bacteria 1090
740 Ga0495680_0056648 3300047322 Bacteria 3034
741 Ga0495680_0292495 3300047322 Bacteria 1145
742 Ga0495687_000460 3300047443 Bacteria 49792
743 Ga0495675_0006262 3300047444 Bacteria 7282
744 Ga0495602_0005445 3300048088 Bacteria 13350
745 Ga0495602_0397476 3300048088 Archaea 983
746 Ga0496102_0034282 3300048905 Bacteria 4565
747 Ga0496102_0088469 3300048905 Bacteria 2863
748 Ga0496102_0213606 3300048905 Unclassified 1819
749 Ga0496102_0430062 3300048905 Bacteria 1240
750 Ga0496103_0066394 3300048906 Bacteria 2252
751 Ga0496103_0181678 3300048906 Bacteria 1352
752 Ga0496104_0118569 3300048907 Bacteria 2541
753 Ga0496106_0164475 3300048909 Unclassified 1756
754 Ga0496107_0093032 3300048910 Bacteria 2205
755 Ga0496108_0803033 3300048911 Unclassified 812
756 Ga0496109_0284093 3300048912 Bacteria 1560
757 Ga0496110_0087763 3300048913 Bacteria 2778
758 Ga0496112_0082970 3300048915 Bacteria 3169
759 Ga0496112_0683189 3300048915 Bacteria 955
760 Ga0496112_0852517 3300048915 Bacteria 834
761 Ga0496113_0149933 3300048916 Bacteria 1839
762 Ga0496125_0000040 3300048928 Bacteria 314478
763 Ga0501031_0055022 3300049568 Unclassified 2593
764 Ga0501032_0284764 3300049569 Unclassified 1070
765 Ga0501033_0028100 3300049570 Bacteria 4228
766 Ga0501036_0039695 3300049572 Bacteria 3983
767 Ga0501036_0378370 3300049572 Bacteria 1182
768 Ga0501039_0089993 3300049575 Bacteria 2392
769 Ga0501040_0002455 3300049576 Bacteria 11937
770 Ga0501040_0011967 3300049576 Bacteria 5677
771 Ga0501040_0097457 3300049576 Bacteria 2049
772 Ga0501041_0008299 3300049577 Bacteria 6113
773 Ga0501041_0032102 3300049577 Unclassified 3174
774 Ga0501042_0175111 3300049578 Bacteria 1548
775 Ga0501042_0437871 3300049578 Bacteria 948
776 Ga0501046_0008696 3300049580 Bacteria 8825
777 Ga0501046_0216241 3300049580 Bacteria 1421
778 Ga0501046_0260939 3300049580 Unclassified 1273
779 Ga0501047_0229759 3300049581 Bacteria 1709
780 Ga0501047_0401916 3300049581 Bacteria 1203
781 Ga0501047_0722847 3300049581 Bacteria 813
782 Ga0501048_0134367 3300049582 Bacteria 1748
783 Ga0501068_0152179 3300049584 Bacteria 1454
784 Ga0501071_0095327 3300049587 Bacteria 2190
785 Ga0501072_0056903 3300049588 Bacteria 3081
786 Ga0501072_0076295 3300049588 Bacteria 2652
787 Ga0501072_0165654 3300049588 Bacteria 1763
788 Ga0501072_0227828 3300049588 Bacteria 1485
789 Ga0501074_0113378 3300049590 Bacteria 1940
790 Ga0501074_0155600 3300049590 Unclassified 1633
791 Ga0501075_0019807 3300049591 Bacteria 4884
792 Ga0501075_0020845 3300049591 Bacteria 4772
793 Ga0501075_0267581 3300049591 Bacteria 1303
794 Ga0501076_0009174 3300049592 Bacteria 7291
795 Ga0501076_0032859 3300049592 Bacteria 4051
796 Ga0501076_0051075 3300049592 Bacteria 3272
797 Ga0501077_0043878 3300049593 Bacteria 2841
798 Ga0501077_0047733 3300049593 Bacteria 2720
799 Ga0501079_0115962 3300049741 Bacteria 2082
800 Ga0501079_0126301 3300049741 Bacteria 1990
801 Ga0501080_0105835 3300049742 Bacteria 2608
802 Ga0501081_0069521 3300049743 Bacteria 2453
803 Ga0501081_0103034 3300049743 Unclassified 2019
804 Ga0501083_0434580 3300049744 Bacteria 854
805 Ga0501045_0004695 3300049824 Bacteria 9438
806 Ga0501045_0091395 3300049824 Bacteria 2250
807 Ga0501045_0159169 3300049824 Bacteria 1681
808 nmdc:mga03683_37180_c1 3300050489 Bacteria 1983
809 nmdc:mga03n38_151265_c1 3300050490 Bacteria 1168
810 nmdc:mga05p37_110366_c1 3300050507 Bacteria 3384
811 nmdc:mga05p37_111467_c1 3300050507 Bacteria 3365
812 nmdc:mga05p37_11702_c1 3300050507 Bacteria 10456
813 nmdc:mga05p37_12706_c1 3300050507 Bacteria 10064
814 nmdc:mga05p37_13953_c1 3300050507 Bacteria 9634
815 nmdc:mga05p37_18613_c1 3300050507 Bacteria 8394
816 nmdc:mga05p37_187746_c1 3300050507 Bacteria 2512
817 nmdc:mga05p37_19887_c1 3300050507 Bacteria 8122
818 nmdc:mga05p37_275468_c1 3300050507 Unclassified 2009
819 nmdc:mga05p37_288978_c1 3300050507 Unclassified 1952
820 nmdc:mga05p37_362807_c1 3300050507 Bacteria 1703
821 nmdc:mga05p37_3695_c1 3300050507 Bacteria 17900
822 nmdc:mga05p37_411742_c1 3300050507 Bacteria 1576
823 nmdc:mga05p37_43013_c1 3300050507 Bacteria 5554
824 nmdc:mga05p37_43813_c1 3300050507 Bacteria 5506
825 nmdc:mga05p37_463416_c1 3300050507 Bacteria 1464
826 nmdc:mga05p37_49599_c1 3300050507 Bacteria 4811
827 nmdc:mga05p37_497203_c1 3300050507 Bacteria 1401
828 nmdc:mga05p37_50609_c1 3300050507 Bacteria 5110
829 nmdc:mga05p37_5872_c1 3300050507 Bacteria 14438
830 nmdc:mga05p37_5938_c1 3300050507 Bacteria 14366
831 nmdc:mga05p37_72066_c1 3300050507 Bacteria 4251
832 nmdc:mga05p37_93333_c1 3300050507 Bacteria 3709
833 nmdc:mga09592_11845_c1 3300050508 Bacteria 7094
834 nmdc:mga09592_211939_c1 3300050508 Bacteria 1678
835 nmdc:mga09592_254965_c1 3300050508 Bacteria 1521
836 nmdc:mga09592_287554_c1 3300050508 Bacteria 1425
837 nmdc:mga09592_298468_c1 3300050508 Bacteria 1397
838 nmdc:mga09592_32647_c1 3300050508 Bacteria 4340
839 nmdc:mga09592_4575_c1 3300050508 Bacteria 11195
840 nmdc:mga09592_59360_c1 3300050508 Bacteria 3234
841 nmdc:mga09592_60059_c1 3300050508 Unclassified 3214
842 nmdc:mga09592_7598_c1 3300050508 Bacteria 8817
843 nmdc:mga09592_9333_c1 3300050508 Bacteria 7976
844 nmdc:mga0qj67_13254_c1 3300050509 Bacteria 6221
845 nmdc:mga0qj67_181262_c1 3300050509 Bacteria 1710
846 nmdc:mga0qj67_25488_c1 3300050509 Bacteria 4570
847 nmdc:mga0qj67_28136_c1 3300050509 Bacteria 4361
848 nmdc:mga0qj67_281645_c1 3300050509 Bacteria 1347
849 nmdc:mga0qj67_306405_c1 3300050509 Bacteria 1287
850 nmdc:mga0qj67_446232_c1 3300050509 Bacteria 1042
851 nmdc:mga0qj67_4500_c1 3300050509 Bacteria 10100
852 nmdc:mga0qj67_6292_c1 3300050509 Bacteria 8711
853 nmdc:mga06r32_122830_c1 3300050510 Bacteria 2562
854 nmdc:mga06r32_1480_c1 3300050510 Bacteria 21119
855 nmdc:mga06r32_15165_c1 3300050510 Bacteria 6999
856 nmdc:mga06r32_15543_c1 3300050510 Bacteria 6913
857 nmdc:mga06r32_216085_c1 3300050510 Bacteria 1905
858 nmdc:mga06r32_3616_c1 3300050510 Bacteria 13796
859 nmdc:mga06r32_38249_c1 3300050510 Bacteria 4544
860 nmdc:mga06r32_4690_c1 3300050510 Bacteria 12276
861 nmdc:mga06r32_51413_c1 3300050510 Bacteria 3944
862 nmdc:mga06r32_53_c1 3300050510 Bacteria 72230
863 nmdc:mga06r32_604932_c1 3300050510 Bacteria 1067
864 nmdc:mga06r32_670757_c1 3300050510 Unclassified 1004
865 nmdc:mga08y16_1374_c1 3300050511 Bacteria 24321
866 nmdc:mga08y16_146409_c1 3300050511 Bacteria 2456
867 nmdc:mga08y16_174421_c1 3300050511 Unclassified 2232
868 nmdc:mga08y16_181260_c1 3300050511 Bacteria 2187
869 nmdc:mga08y16_19917_c1 3300050511 Bacteria 7078
870 nmdc:mga08y16_2072_c1 3300050511 Bacteria 20554
871 nmdc:mga08y16_2077_c1 3300050511 Bacteria 20542
872 nmdc:mga08y16_271415_c1 3300050511 Bacteria 1751
873 nmdc:mga08y16_318024_c1 3300050511 Bacteria 1603
874 nmdc:mga08y16_424193_c1 3300050511 Unclassified 1359
875 nmdc:mga08y16_466211_c1 3300050511 Unclassified 1287
876 nmdc:mga08y16_4905_c1 3300050511 Bacteria 13985
877 nmdc:mga08y16_52344_c1 3300050511 Bacteria 4272
878 nmdc:mga08y16_61788_c1 3300050511 Bacteria 3912
879 nmdc:mga08y16_888683_c1 3300050511 Bacteria 878
880 nmdc:mga0n895_110674_c1 3300050512 Unclassified 2763
881 nmdc:mga0n895_117785_c1 3300050512 Bacteria 2676
882 nmdc:mga0n895_151713_c1 3300050512 Bacteria 2348
883 nmdc:mga0n895_15352_c1 3300050512 Bacteria 6981
884 nmdc:mga0n895_160407_c1 3300050512 Bacteria 2281
885 nmdc:mga0n895_199044_c1 3300050512 Bacteria 2035
886 nmdc:mga0n895_20267_c1 3300050512 Bacteria 6198
887 nmdc:mga0n895_231009_c1 3300050512 Bacteria 1878
888 nmdc:mga0n895_335478_c1 3300050512 Unclassified 1532
889 nmdc:mga0n895_41370_c1 3300050512 Bacteria 4480
890 nmdc:mga0n895_462276_c1 3300050512 Bacteria 1281
891 nmdc:mga0n895_531656_c1 3300050512 Bacteria 1183
892 nmdc:mga0n895_62339_c1 3300050512 Bacteria 3685
893 nmdc:mga0n895_66054_c1 3300050512 Unclassified 3582
894 nmdc:mga0n895_96721_c1 3300050512 Bacteria 2958
895 nmdc:mga0rr50_146214_c1 3300050513 Unclassified 1906
896 nmdc:mga0rr50_20685_c1 3300050513 Bacteria 4475
897 nmdc:mga0rr50_211050_c1 3300050513 Bacteria 1600
898 nmdc:mga0rr50_21612_c1 3300050513 Bacteria 4397
899 nmdc:mga0rr50_221421_c1 3300050513 Bacteria 1563
900 nmdc:mga0rr50_2510_c1 3300050513 Bacteria 10382
901 nmdc:mga0rr50_340608_c1 3300050513 Bacteria 1260
902 nmdc:mga0rr50_469172_c1 3300050513 Bacteria 1068
903 nmdc:mga0rr50_60161_c1 3300050513 Bacteria 2856
904 nmdc:mga08x19_11850_c1 3300050514 Bacteria 5244
905 nmdc:mga08x19_163629_c1 3300050514 Bacteria 1512
906 nmdc:mga08x19_18788_c1 3300050514 Bacteria 4237
907 nmdc:mga08x19_225253_c1 3300050514 Bacteria 1289
908 nmdc:mga08x19_275225_c1 3300050514 Bacteria 1166
909 nmdc:mga08x19_292274_c1 3300050514 Bacteria 1131
910 nmdc:mga08x19_5839_c1 3300050514 Bacteria 7282
911 nmdc:mga08x19_7456_c1 3300050514 Bacteria 6498
912 nmdc:mga0a205_1834_c1 3300050515 Bacteria 18384
913 nmdc:mga0a205_22841_c1 3300050515 Bacteria 5930
914 nmdc:mga0a205_230090_c1 3300050515 Bacteria 1737
915 nmdc:mga0a205_280511_c1 3300050515 Bacteria 1541
916 nmdc:mga0a205_280652_c1 3300050515 Unclassified 1541
917 nmdc:mga0a205_317331_c1 3300050515 Unclassified 1430
918 nmdc:mga0a205_33040_c1 3300050515 Bacteria 4962
919 nmdc:mga0a205_33041_c1 3300050515 Bacteria 4962
920 nmdc:mga0a205_34800_c1 3300050515 Bacteria 4834
921 nmdc:mga0a205_502448_c1 3300050515 Bacteria 1069
922 nmdc:mga0a205_56763_c1 3300050515 Bacteria 3780
923 nmdc:mga0a205_61211_c1 3300050515 Bacteria 3636
924 nmdc:mga0a205_7552_c1 3300050515 Bacteria 9852
925 nmdc:mga0a205_83920_c1 3300050515 Bacteria 3077
926 nmdc:mga0sz30_6309_c1 3300050516 Plasmid 4397
927 Ga0495601_0004617 3300053077 Bacteria 7968
928 Ga0495601_0037130 3300053077 Bacteria 3045
929 Ga0495601_0055492 3300053077 Bacteria 2508
930 Ga0495612_0004119 3300053078 Bacteria 6022
931 Ga0495619_0001776 3300053085 Bacteria 14334
932 Ga0495619_0023030 3300053085 Unclassified 3989
933 Ga0495619_0028172 3300053085 Bacteria 3622
934 Ga0495619_0099727 3300053085 Bacteria 1976
935 Ga0495619_0124931 3300053085 Unclassified 1765
936 Ga0495619_0141600 3300053085 Bacteria 1656
937 Ga0495619_0167358 3300053085 Archaea 1519
938 Ga0495619_0376198 3300053085 Unclassified 982
939 Ga0500568_0003463 3300053139 Bacteria 8779
940 Ga0501084_0092355 3300054114 Unclassified 2541
941 Ga0501084_0337865 3300054114 Bacteria 1272
942 Ga0501082_0009040 3300060353 Bacteria 8593
943 Ga0501082_0500421 3300060353 Bacteria 1062
944 Ga0530510_0001282 3300061734 Bacteria 16773
945 Ga0530510_0038180 3300061734 Bacteria 3467
946 Ga0530510_0080309 3300061734 Bacteria 2373
947 Ga0530510_0103036 3300061734 Bacteria 2087

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1417233 Ga0436363_1417233_79_777 227
2 3300025315 Ga0207697_10096648 Ga0207697_100966482 229
3 3300050511 nmdc:mga08y16_466211_c1 nmdc:mga08y16_466211_c1_520_1233 229
4 3300042016 Ga0439463_084522 Ga0439463_084522_44_757 230
5 3300042876 Ga0451577_0760077 Ga0451577_0760077_20_733 230
6 3300048911 Ga0496108_0803033 Ga0496108_0803033_79_792 230
7 3300049581 Ga0501047_0722847 Ga0501047_0722847_76_789 230
8 3300049744 Ga0501083_0434580 Ga0501083_0434580_124_837 230
9 3300050489 nmdc:mga03683_37180_c1 nmdc:mga03683_37180_c1_1213_1920 230
10 3300035117 Ga0373953_0135968 Ga0373953_0135968_34_750 232
11 3300036401 Ga0373937_0076417 Ga0373937_0076417_2356_3072 232
12 3300037853 Ga0436364_1078611 Ga0436364_1078611_807_1520 232
13 3300039453 Ga0436362_0330598 Ga0436362_0330598_46_759 232
14 3300039453 Ga0436362_1134760 Ga0436362_1134760_293_1006 232
15 3300046559 Ga0495667_0065576 Ga0495667_0065576_1572_2288 232
16 3300048915 Ga0496112_0852517 Ga0496112_0852517_70_783 232
17 3300005471 Ga0070698_100518920 Ga0070698_1005189201 235
18 3300025942 Ga0207689_10372716 Ga0207689_103727161 236
19 3300050507 nmdc:mga05p37_288978_c1 nmdc:mga05p37_288978_c1_913_1653 239
20 3300009553 Ga0105249_10421587 Ga0105249_104215871 243
21 3300035398 Ga0316574_0245469 Ga0316574_0245469_14_802 253
22 3300021388 Ga0213875_10024186 Ga0213875_100241863 254
23 3300025923 Ga0207681_10143621 Ga0207681_101436212 254
24 3300037853 Ga0436364_1102652 Ga0436364_1102652_3352_4197 254
25 3300025933 Ga0207706_10153379 Ga0207706_101533792 255
26 3300047443 Ga0495687_000460 Ga0495687_000460_8851_9657 256
27 3300048928 Ga0496125_0000040 Ga0496125_0000040_95576_96382 256
28 3300050509 nmdc:mga0qj67_281645_c1 nmdc:mga0qj67_281645_c1_208_1035 256
29 3300050510 nmdc:mga06r32_604932_c1 nmdc:mga06r32_604932_c1_31_858 256
30 3300021388 Ga0213875_10002430 Ga0213875_100024305 257
31 3300037853 Ga0436364_1071444 Ga0436364_1071444_16819_17646 257
32 3300005937 Ga0081455_10067439 Ga0081455_100674391 261
33 3300006038 Ga0075365_10003905 Ga0075365_100039055 261
34 3300006048 Ga0075363_100027866 Ga0075363_1000278661 261
35 3300006051 Ga0075364_10087479 Ga0075364_100874791 261
36 3300006177 Ga0075362_10040143 Ga0075362_100401431 261
37 3300006178 Ga0075367_10003112 Ga0075367_100031121 261
38 3300006186 Ga0075369_10002094 Ga0075369_100020943 261
39 3300050490 nmdc:mga03n38_151265_c1 nmdc:mga03n38_151265_c1_207_1010 261
40 3300050516 nmdc:mga0sz30_6309_c1 nmdc:mga0sz30_6309_c1_177_980 261
41 iso_pu_bacteria 2894772417 2894772543 261
42 3300014326 Ga0157380_10420654 Ga0157380_104206541 263
43 3300039437 Ga0436365_1930435 Ga0436365_1930435_36531_37349 263
44 3300005347 Ga0070668_100111303 Ga0070668_1001113032 264
45 3300005440 Ga0070705_100112138 Ga0070705_1001121382 264
46 3300005458 Ga0070681_10107718 Ga0070681_101077182 264
47 3300005458 Ga0070681_10398905 Ga0070681_103989051 264
48 3300005467 Ga0070706_100385173 Ga0070706_1003851732 264
49 3300005468 Ga0070707_100134242 Ga0070707_1001342422 264
50 3300005518 Ga0070699_100021823 Ga0070699_1000218233 264
51 3300005536 Ga0070697_100095053 Ga0070697_1000950531 264
52 3300005536 Ga0070697_100121894 Ga0070697_1001218942 264
53 3300005543 Ga0070672_100144616 Ga0070672_1001446162 264
54 3300005545 Ga0070695_100185619 Ga0070695_1001856192 264
55 3300005546 Ga0070696_100061462 Ga0070696_1000614622 264
56 3300005547 Ga0070693_100141331 Ga0070693_1001413312 264
57 3300005618 Ga0068864_100799731 Ga0068864_1007997311 264
58 3300005841 Ga0068863_100152931 Ga0068863_1001529313 264
59 3300005843 Ga0068860_100036157 Ga0068860_1000361571 264
60 3300005844 Ga0068862_100407809 Ga0068862_1004078092 264
61 3300005983 Ga0081540_1013000 Ga0081540_10130003 264
62 3300006844 Ga0075428_100032038 Ga0075428_1000320383 264
63 3300006844 Ga0075428_100146503 Ga0075428_1001465031 264
64 3300006846 Ga0075430_100068371 Ga0075430_1000683714 264
65 3300006847 Ga0075431_100061131 Ga0075431_1000611312 264
66 3300006847 Ga0075431_100093911 Ga0075431_1000939112 264
67 3300006852 Ga0075433_10036047 Ga0075433_100360475 264
68 3300006852 Ga0075433_10037587 Ga0075433_100375872 264
69 3300006852 Ga0075433_10063716 Ga0075433_100637162 264
70 3300006852 Ga0075433_10259549 Ga0075433_102595492 264
71 3300006871 Ga0075434_100013803 Ga0075434_1000138035 264
72 3300006880 Ga0075429_100021867 Ga0075429_1000218672 264
73 3300006880 Ga0075429_100039897 Ga0075429_1000398972 264
74 3300006880 Ga0075429_100249176 Ga0075429_1002491762 264
75 3300007076 Ga0075435_100225542 Ga0075435_1002255422 264
76 3300009094 Ga0111539_10000098 Ga0111539_1000009881 264
77 3300009094 Ga0111539_10050168 Ga0111539_100501683 264
78 3300009094 Ga0111539_10060886 Ga0111539_100608865 264
79 3300009147 Ga0114129_10021159 Ga0114129_100211592 264
80 3300009147 Ga0114129_10208330 Ga0114129_102083302 264
81 3300009147 Ga0114129_10228188 Ga0114129_102281882 264
82 3300009174 Ga0105241_10026978 Ga0105241_100269784 264
83 3300013100 Ga0157373_10250968 Ga0157373_102509681 264
84 3300013297 Ga0157378_10092775 Ga0157378_100927752 264
85 3300013308 Ga0157375_10259767 Ga0157375_102597672 264
86 3300014969 Ga0157376_10360015 Ga0157376_103600152 264
87 3300025910 Ga0207684_10252269 Ga0207684_102522692 264
88 3300025910 Ga0207684_10432671 Ga0207684_104326712 264
89 3300025912 Ga0207707_10119265 Ga0207707_101192652 264
90 3300025922 Ga0207646_10049331 Ga0207646_100493312 264
91 3300025923 Ga0207681_10172770 Ga0207681_101727702 264
92 3300025934 Ga0207686_10052743 Ga0207686_100527432 264
93 3300025935 Ga0207709_10182783 Ga0207709_101827832 264
94 3300025937 Ga0207669_10215918 Ga0207669_102159182 264
95 3300025940 Ga0207691_10074595 Ga0207691_100745952 264
96 3300025986 Ga0207658_10203715 Ga0207658_102037152 264
97 3300026075 Ga0207708_10054251 Ga0207708_100542511 264
98 3300026088 Ga0207641_10100436 Ga0207641_101004363 264
99 3300026088 Ga0207641_10322689 Ga0207641_103226892 264
100 3300026089 Ga0207648_10063959 Ga0207648_100639592 264
101 3300027876 Ga0209974_10024653 Ga0209974_100246532 264
102 3300027907 Ga0207428_10000341 Ga0207428_1000034141 264
103 3300027907 Ga0207428_10041238 Ga0207428_100412383 264
104 3300035090 Ga0373949_0049099 Ga0373949_0049099_49_867 264
105 3300035691 Ga0373931_0088119 Ga0373931_0088119_14_832 264
106 3300045051 Ga0451576_0026470 Ga0451576_0026470_20_838 264
107 3300045051 Ga0451576_0320070 Ga0451576_0320070_769_1587 264
108 3300046455 Ga0495603_0043372 Ga0495603_0043372_296_1114 264
109 3300046499 Ga0495594_0078085 Ga0495594_0078085_753_1571 264
110 3300046684 Ga0495669_0097681 Ga0495669_0097681_469_1287 264
111 3300048909 Ga0496106_0164475 Ga0496106_0164475_214_1029 264
112 3300049741 Ga0501079_0126301 Ga0501079_0126301_1073_1891 264
113 3300050507 nmdc:mga05p37_12706_c1 nmdc:mga05p37_12706_c1_2054_2872 264
114 3300050507 nmdc:mga05p37_19887_c1 nmdc:mga05p37_19887_c1_298_1116 264
115 3300050507 nmdc:mga05p37_43813_c1 nmdc:mga05p37_43813_c1_2661_3479 264
116 3300050508 nmdc:mga09592_32647_c1 nmdc:mga09592_32647_c1_2653_3471 264
117 3300050508 nmdc:mga09592_4575_c1 nmdc:mga09592_4575_c1_7579_8397 264
118 3300050508 nmdc:mga09592_59360_c1 nmdc:mga09592_59360_c1_2222_3040 264
119 3300050509 nmdc:mga0qj67_25488_c1 nmdc:mga0qj67_25488_c1_3558_4376 264
120 3300050509 nmdc:mga0qj67_446232_c1 nmdc:mga0qj67_446232_c1_160_978 264
121 3300050510 nmdc:mga06r32_122830_c1 nmdc:mga06r32_122830_c1_1429_2247 264
122 3300050510 nmdc:mga06r32_4690_c1 nmdc:mga06r32_4690_c1_671_1489 264
123 3300050511 nmdc:mga08y16_19917_c1 nmdc:mga08y16_19917_c1_4181_4999 264
124 3300050511 nmdc:mga08y16_52344_c1 nmdc:mga08y16_52344_c1_1941_2759 264
125 3300050512 nmdc:mga0n895_110674_c1 nmdc:mga0n895_110674_c1_617_1435 264
126 3300050512 nmdc:mga0n895_117785_c1 nmdc:mga0n895_117785_c1_1402_2220 264
127 3300050512 nmdc:mga0n895_151713_c1 nmdc:mga0n895_151713_c1_164_982 264
128 3300050512 nmdc:mga0n895_41370_c1 nmdc:mga0n895_41370_c1_2096_2914 264
129 3300050513 nmdc:mga0rr50_146214_c1 nmdc:mga0rr50_146214_c1_375_1193 264
130 3300050513 nmdc:mga0rr50_20685_c1 nmdc:mga0rr50_20685_c1_3624_4442 264
131 3300050513 nmdc:mga0rr50_340608_c1 nmdc:mga0rr50_340608_c1_62_877 264
132 3300050514 nmdc:mga08x19_18788_c1 nmdc:mga08x19_18788_c1_2888_3706 264
133 3300050515 nmdc:mga0a205_280652_c1 nmdc:mga0a205_280652_c1_443_1261 264
134 3300050515 nmdc:mga0a205_7552_c1 nmdc:mga0a205_7552_c1_1178_1996 264
135 3300053139 Ga0500568_0003463 Ga0500568_0003463_5165_5986 264
136 3300005328 Ga0070676_10010241 Ga0070676_100102413 265
137 3300005334 Ga0068869_100040060 Ga0068869_1000400603 265
138 3300005336 Ga0070680_100046099 Ga0070680_1000460994 265
139 3300005336 Ga0070680_100072225 Ga0070680_1000722251 265
140 3300005337 Ga0070682_100031718 Ga0070682_1000317183 265
141 3300005339 Ga0070660_100009836 Ga0070660_1000098364 265
142 3300005341 Ga0070691_10048273 Ga0070691_100482733 265
143 3300005344 Ga0070661_100002434 Ga0070661_10000243412 265
144 3300005347 Ga0070668_100237243 Ga0070668_1002372432 265
145 3300005353 Ga0070669_100132882 Ga0070669_1001328821 265
146 3300005366 Ga0070659_100004245 Ga0070659_1000042459 265
147 3300005406 Ga0070703_10015958 Ga0070703_100159583 265
148 3300005434 Ga0070709_10056477 Ga0070709_100564771 265
149 3300005437 Ga0070710_10220804 Ga0070710_102208042 265
150 3300005440 Ga0070705_100035136 Ga0070705_1000351363 265
151 3300005444 Ga0070694_100007032 Ga0070694_1000070323 265
152 3300005444 Ga0070694_100068033 Ga0070694_1000680333 265
153 3300005445 Ga0070708_100041368 Ga0070708_1000413683 265
154 3300005445 Ga0070708_100087120 Ga0070708_1000871203 265
155 3300005445 Ga0070708_100216269 Ga0070708_1002162692 265
156 3300005445 Ga0070708_100520776 Ga0070708_1005207761 265
157 3300005445 Ga0070708_100650257 Ga0070708_1006502571 265
158 3300005455 Ga0070663_100051009 Ga0070663_1000510093 265
159 3300005458 Ga0070681_10200719 Ga0070681_102007192 265
160 3300005459 Ga0068867_100218259 Ga0068867_1002182592 265
161 3300005467 Ga0070706_100109729 Ga0070706_1001097292 265
162 3300005467 Ga0070706_100339977 Ga0070706_1003399772 265
163 3300005467 Ga0070706_100515253 Ga0070706_1005152532 265
164 3300005468 Ga0070707_100254299 Ga0070707_1002542992 265
165 3300005468 Ga0070707_100427788 Ga0070707_1004277882 265
166 3300005468 Ga0070707_100438053 Ga0070707_1004380532 265
167 3300005471 Ga0070698_100322916 Ga0070698_1003229162 265
168 3300005471 Ga0070698_100468672 Ga0070698_1004686721 265
169 3300005518 Ga0070699_100028026 Ga0070699_1000280265 265
170 3300005518 Ga0070699_100248333 Ga0070699_1002483332 265
171 3300005530 Ga0070679_100055490 Ga0070679_1000554903 265
172 3300005536 Ga0070697_100085500 Ga0070697_1000855002 265
173 3300005544 Ga0070686_100107972 Ga0070686_1001079723 265
174 3300005545 Ga0070695_100024657 Ga0070695_1000246572 265
175 3300005545 Ga0070695_100165669 Ga0070695_1001656691 265
176 3300005547 Ga0070693_100010662 Ga0070693_1000106624 265
177 3300005549 Ga0070704_100221121 Ga0070704_1002211212 265
178 3300005549 Ga0070704_100614379 Ga0070704_1006143791 265
179 3300005563 Ga0068855_100001465 Ga0068855_10000146513 265
180 3300005564 Ga0070664_100021732 Ga0070664_1000217324 265
181 3300005577 Ga0068857_100038738 Ga0068857_1000387383 265
182 3300005578 Ga0068854_100050887 Ga0068854_1000508874 265
183 3300005614 Ga0068856_100001138 Ga0068856_10000113810 265
184 3300005615 Ga0070702_100031846 Ga0070702_1000318464 265
185 3300005617 Ga0068859_100023978 Ga0068859_1000239784 265
186 3300005617 Ga0068859_100107528 Ga0068859_1001075284 265
187 3300005617 Ga0068859_100251400 Ga0068859_1002514002 265
188 3300005617 Ga0068859_100284162 Ga0068859_1002841622 265
189 3300005618 Ga0068864_100049049 Ga0068864_1000490494 265
190 3300005719 Ga0068861_100113019 Ga0068861_1001130192 265
191 3300005841 Ga0068863_100088941 Ga0068863_1000889413 265
192 3300005841 Ga0068863_100302880 Ga0068863_1003028803 265
193 3300005843 Ga0068860_100030891 Ga0068860_1000308912 265
194 3300005843 Ga0068860_100166466 Ga0068860_1001664663 265
195 3300005843 Ga0068860_100402964 Ga0068860_1004029641 265
196 3300005844 Ga0068862_100052686 Ga0068862_1000526863 265
197 3300005844 Ga0068862_100580697 Ga0068862_1005806972 265
198 3300005937 Ga0081455_10000824 Ga0081455_1000082430 265
199 3300005981 Ga0081538_10006853 Ga0081538_100068536 265
200 3300005983 Ga0081540_1011768 Ga0081540_10117683 265
201 3300005983 Ga0081540_1035896 Ga0081540_10358962 265
202 3300005985 Ga0081539_10000021 Ga0081539_10000021178 265
203 3300005985 Ga0081539_10031167 Ga0081539_100311673 265
204 3300006058 Ga0075432_10049483 Ga0075432_100494832 265
205 3300006173 Ga0070716_100015635 Ga0070716_1000156352 265
206 3300006844 Ga0075428_100001389 Ga0075428_10000138918 265
207 3300006844 Ga0075428_100003715 Ga0075428_10000371511 265
208 3300006844 Ga0075428_100210594 Ga0075428_1002105942 265
209 3300006844 Ga0075428_100272958 Ga0075428_1002729582 265
210 3300006844 Ga0075428_100284701 Ga0075428_1002847012 265
211 3300006844 Ga0075428_100362548 Ga0075428_1003625482 265
212 3300006844 Ga0075428_100531309 Ga0075428_1005313092 265
213 3300006846 Ga0075430_100001172 Ga0075430_1000011726 265
214 3300006846 Ga0075430_100002301 Ga0075430_10000230111 265
215 3300006846 Ga0075430_100008431 Ga0075430_1000084318 265
216 3300006846 Ga0075430_100334713 Ga0075430_1003347131 265
217 3300006847 Ga0075431_100002712 Ga0075431_1000027126 265
218 3300006847 Ga0075431_100008045 Ga0075431_1000080456 265
219 3300006847 Ga0075431_100161077 Ga0075431_1001610773 265
220 3300006847 Ga0075431_100310306 Ga0075431_1003103062 265
221 3300006852 Ga0075433_10001404 Ga0075433_1000140416 265
222 3300006852 Ga0075433_10028008 Ga0075433_100280083 265
223 3300006852 Ga0075433_10055198 Ga0075433_100551983 265
224 3300006852 Ga0075433_10246277 Ga0075433_102462774 265
225 3300006852 Ga0075433_10379228 Ga0075433_103792282 265
226 3300006871 Ga0075434_100037372 Ga0075434_1000373726 265
227 3300006871 Ga0075434_100071271 Ga0075434_1000712712 265
228 3300006871 Ga0075434_100097029 Ga0075434_1000970293 265
229 3300006871 Ga0075434_100205158 Ga0075434_1002051582 265
230 3300006871 Ga0075434_100261864 Ga0075434_1002618642 265
231 3300006871 Ga0075434_100519922 Ga0075434_1005199221 265
232 3300006871 Ga0075434_100565560 Ga0075434_1005655602 265
233 3300006880 Ga0075429_100007420 Ga0075429_1000074203 265
234 3300006880 Ga0075429_100019832 Ga0075429_1000198324 265
235 3300006880 Ga0075429_100023371 Ga0075429_1000233716 265
236 3300006880 Ga0075429_100047238 Ga0075429_1000472383 265
237 3300006880 Ga0075429_100324454 Ga0075429_1003244541 265
238 3300006881 Ga0068865_100490423 Ga0068865_1004904232 265
239 3300006914 Ga0075436_100001877 Ga0075436_10000187712 265
240 3300006914 Ga0075436_100015732 Ga0075436_1000157322 265
241 3300006931 Ga0097620_100023979 Ga0097620_1000239793 265
242 3300006931 Ga0097620_100107527 Ga0097620_1001075274 265
243 3300006931 Ga0097620_100251393 Ga0097620_1002513932 265
244 3300006931 Ga0097620_100284149 Ga0097620_1002841492 265
245 3300007076 Ga0075435_100062156 Ga0075435_1000621563 265
246 3300007076 Ga0075435_100081720 Ga0075435_1000817202 265
247 3300007076 Ga0075435_100232970 Ga0075435_1002329703 265
248 3300007265 Ga0099794_10003016 Ga0099794_100030163 265
249 3300009093 Ga0105240_10360659 Ga0105240_103606591 265
250 3300009093 Ga0105240_10526218 Ga0105240_105262181 265
251 3300009094 Ga0111539_10000098 Ga0111539_1000009885 265
252 3300009094 Ga0111539_10006099 Ga0111539_100060997 265
253 3300009094 Ga0111539_10015171 Ga0111539_1001517110 265
254 3300009094 Ga0111539_10039864 Ga0111539_100398641 265
255 3300009094 Ga0111539_10163362 Ga0111539_101633621 265
256 3300009147 Ga0114129_10005514 Ga0114129_1000551411 265
257 3300009147 Ga0114129_10021159 Ga0114129_100211598 265
258 3300009147 Ga0114129_10222938 Ga0114129_102229381 265
259 3300009148 Ga0105243_10075714 Ga0105243_100757143 265
260 3300009174 Ga0105241_10010697 Ga0105241_100106975 265
261 3300009553 Ga0105249_10438533 Ga0105249_104385332 265
262 3300013102 Ga0157371_10375909 Ga0157371_103759091 265
263 3300013104 Ga0157370_10067301 Ga0157370_100673013 265
264 3300013297 Ga0157378_10250837 Ga0157378_102508371 265
265 3300013307 Ga0157372_10000612 Ga0157372_1000061225 265
266 3300013307 Ga0157372_10178659 Ga0157372_101786592 265
267 3300013308 Ga0157375_10593522 Ga0157375_105935222 265
268 3300014325 Ga0163163_10022085 Ga0163163_100220854 265
269 3300014968 Ga0157379_10007151 Ga0157379_1000715115 265
270 3300014968 Ga0157379_10266603 Ga0157379_102666032 265
271 3300014968 Ga0157379_10378844 Ga0157379_103788441 265
272 3300014969 Ga0157376_10807938 Ga0157376_108079381 265
273 3300017792 Ga0163161_10169085 Ga0163161_101690852 265
274 3300025899 Ga0207642_10064976 Ga0207642_100649762 265
275 3300025900 Ga0207710_10034098 Ga0207710_100340983 265
276 3300025901 Ga0207688_10008445 Ga0207688_100084457 265
277 3300025904 Ga0207647_10026791 Ga0207647_100267912 265
278 3300025907 Ga0207645_10145964 Ga0207645_101459641 265
279 3300025908 Ga0207643_10012683 Ga0207643_100126834 265
280 3300025910 Ga0207684_10008329 Ga0207684_100083295 265
281 3300025910 Ga0207684_10048374 Ga0207684_100483743 265
282 3300025910 Ga0207684_10251054 Ga0207684_102510542 265
283 3300025910 Ga0207684_10571499 Ga0207684_105714991 265
284 3300025911 Ga0207654_10010924 Ga0207654_100109243 265
285 3300025912 Ga0207707_10000170 Ga0207707_1000017021 265
286 3300025912 Ga0207707_10158782 Ga0207707_101587822 265
287 3300025913 Ga0207695_10440586 Ga0207695_104405862 265
288 3300025915 Ga0207693_10019858 Ga0207693_100198585 265
289 3300025916 Ga0207663_10040687 Ga0207663_100406872 265
290 3300025917 Ga0207660_10013858 Ga0207660_100138584 265
291 3300025917 Ga0207660_10084372 Ga0207660_100843722 265
292 3300025919 Ga0207657_10001106 Ga0207657_1000110620 265
293 3300025920 Ga0207649_10014769 Ga0207649_100147696 265
294 3300025921 Ga0207652_10004264 Ga0207652_1000426411 265
295 3300025922 Ga0207646_10055267 Ga0207646_100552675 265
296 3300025922 Ga0207646_10063838 Ga0207646_100638383 265
297 3300025922 Ga0207646_10095143 Ga0207646_100951434 265
298 3300025922 Ga0207646_10361026 Ga0207646_103610262 265
299 3300025923 Ga0207681_10300442 Ga0207681_103004422 265
300 3300025925 Ga0207650_10024111 Ga0207650_100241114 265
301 3300025932 Ga0207690_10002071 Ga0207690_1000207111 265
302 3300025933 Ga0207706_10023768 Ga0207706_100237684 265
303 3300025934 Ga0207686_10228659 Ga0207686_102286592 265
304 3300025936 Ga0207670_10022880 Ga0207670_100228803 265
305 3300025939 Ga0207665_10019498 Ga0207665_100194984 265
306 3300025941 Ga0207711_10221628 Ga0207711_102216282 265
307 3300025942 Ga0207689_10027704 Ga0207689_100277041 265
308 3300025942 Ga0207689_10084832 Ga0207689_100848323 265
309 3300025945 Ga0207679_10000523 Ga0207679_1000052321 265
310 3300025949 Ga0207667_10100023 Ga0207667_101000232 265
311 3300025981 Ga0207640_10069230 Ga0207640_100692302 265
312 3300026023 Ga0207677_10425041 Ga0207677_104250412 265
313 3300026035 Ga0207703_10581367 Ga0207703_105813671 265
314 3300026075 Ga0207708_10176607 Ga0207708_101766073 265
315 3300026078 Ga0207702_10000493 Ga0207702_1000049311 265
316 3300026088 Ga0207641_10272596 Ga0207641_102725962 265
317 3300026089 Ga0207648_10077191 Ga0207648_100771913 265
318 3300026095 Ga0207676_10091394 Ga0207676_100913943 265
319 3300026116 Ga0207674_10001680 Ga0207674_1000168016 265
320 3300026116 Ga0207674_10072516 Ga0207674_100725166 265
321 3300026142 Ga0207698_10647175 Ga0207698_106471752 265
322 3300027395 Ga0209996_1000557 Ga0209996_10005572 265
323 3300027471 Ga0209995_1006153 Ga0209995_10061532 265
324 3300027526 Ga0209968_1000802 Ga0209968_10008022 265
325 3300027543 Ga0209999_1009513 Ga0209999_10095132 265
326 3300027614 Ga0209970_1030826 Ga0209970_10308261 265
327 3300027665 Ga0209983_1010399 Ga0209983_10103992 265
328 3300027682 Ga0209971_1000574 Ga0209971_100057410 265
329 3300027695 Ga0209966_1000416 Ga0209966_10004163 265
330 3300027717 Ga0209998_10001841 Ga0209998_100018412 265
331 3300027876 Ga0209974_10001363 Ga0209974_100013632 265
332 3300027907 Ga0207428_10000341 Ga0207428_1000034137 265
333 3300027907 Ga0207428_10003164 Ga0207428_1000316414 265
334 3300027907 Ga0207428_10010024 Ga0207428_100100243 265
335 3300027907 Ga0207428_10164161 Ga0207428_101641612 265
336 3300028380 Ga0268265_10106556 Ga0268265_101065563 265
337 3300028380 Ga0268265_10369773 Ga0268265_103697731 265
338 3300028381 Ga0268264_10130543 Ga0268264_101305432 265
339 3300028381 Ga0268264_10242771 Ga0268264_102427711 265
340 3300031548 Ga0307408_100007449 Ga0307408_1000074495 265
341 3300032005 Ga0307411_10242894 Ga0307411_102428942 265
342 3300034818 Ga0373950_0020086 Ga0373950_0020086_143_961 265
343 3300035121 Ga0373960_0010057 Ga0373960_0010057_1283_2101 265
344 3300035171 Ga0373946_0060724 Ga0373946_0060724_433_1248 265
345 3300035241 Ga0373961_0011996 Ga0373961_0011996_222_1040 265
346 3300035695 Ga0373927_0257915 Ga0373927_0257915_243_1058 265
347 3300035724 Ga0373933_0124382 Ga0373933_0124382_771_1586 265
348 3300035725 Ga0373947_0121834 Ga0373947_0121834_481_1296 265
349 3300036401 Ga0373937_0101362 Ga0373937_0101362_1011_1823 265
350 3300037068 Ga0373925_0025637 Ga0373925_0025637_1068_1883 265
351 3300037471 Ga0395905_0154660 Ga0395905_0154660_1114_1932 265
352 3300038698 Ga0242419_000774 Ga0242419_000774_864_1682 265
353 3300039437 Ga0436365_0469844 Ga0436365_0469844_279_1100 265
354 3300042003 Ga0439443_007911 Ga0439443_007911_395_1213 265
355 3300042005 Ga0439448_0004733 Ga0439448_0004733_2533_3363 265
356 3300042005 Ga0439448_0062803 Ga0439448_0062803_223_1041 265
357 3300042011 Ga0439454_002012 Ga0439454_002012_1136_1954 265
358 3300042012 Ga0439455_0007857 Ga0439455_0007857_23_841 265
359 3300042013 Ga0439456_020830 Ga0439456_020830_221_1039 265
360 3300042157 Ga0439458_0003476 Ga0439458_0003476_1748_2566 265
361 3300042157 Ga0439458_0032782 Ga0439458_0032782_90_908 265
362 3300042437 Ga0439444_0015911 Ga0439444_0015911_314_1132 265
363 3300042461 Ga0439460_0061952 Ga0439460_0061952_275_1093 265
364 3300042876 Ga0451577_0008310 Ga0451577_0008310_1437_2255 265
365 3300042876 Ga0451577_0034237 Ga0451577_0034237_2738_3556 265
366 3300044673 Ga0453683_0105723 Ga0453683_0105723_249_1067 265
367 3300044673 Ga0453683_0168758 Ga0453683_0168758_182_1000 265
368 3300044673 Ga0453683_0169769 Ga0453683_0169769_491_1309 265
369 3300044712 Ga0453684_0441454 Ga0453684_0441454_485_1303 265
370 3300044901 Ga0466960_0017701 Ga0466960_0017701_818_1636 265
371 3300045051 Ga0451576_0038151 Ga0451576_0038151_939_1757 265
372 3300045051 Ga0451576_0075915 Ga0451576_0075915_348_1166 265
373 3300045051 Ga0451576_0096233 Ga0451576_0096233_1052_1870 265
374 3300045051 Ga0451576_0241924 Ga0451576_0241924_542_1372 265
375 3300045051 Ga0451576_0301506 Ga0451576_0301506_118_936 265
376 3300046472 Ga0495580_0034280 Ga0495580_0034280_599_1417 265
377 3300046472 Ga0495580_0109918 Ga0495580_0109918_201_1019 265
378 3300046492 Ga0495585_0020518 Ga0495585_0020518_2884_3702 265
379 3300046537 Ga0495598_0042554 Ga0495598_0042554_230_1048 265
380 3300046538 Ga0495609_0083286 Ga0495609_0083286_160_978 265
381 3300046615 Ga0495656_0022506 Ga0495656_0022506_155_973 265
382 3300046691 Ga0495670_0117994 Ga0495670_0117994_286_1104 265
383 3300048905 Ga0496102_0213606 Ga0496102_0213606_236_1054 265
384 3300048905 Ga0496102_0430062 Ga0496102_0430062_47_865 265
385 3300048906 Ga0496103_0181678 Ga0496103_0181678_275_1093 265
386 3300048910 Ga0496107_0093032 Ga0496107_0093032_588_1406 265
387 3300048912 Ga0496109_0284093 Ga0496109_0284093_620_1438 265
388 3300049568 Ga0501031_0055022 Ga0501031_0055022_1373_2191 265
389 3300049569 Ga0501032_0284764 Ga0501032_0284764_217_1035 265
390 3300049570 Ga0501033_0028100 Ga0501033_0028100_3027_3845 265
391 3300049576 Ga0501040_0011967 Ga0501040_0011967_1360_2178 265
392 3300049576 Ga0501040_0097457 Ga0501040_0097457_950_1765 265
393 3300049578 Ga0501042_0437871 Ga0501042_0437871_25_861 265
394 3300049580 Ga0501046_0008696 Ga0501046_0008696_717_1535 265
395 3300049580 Ga0501046_0216241 Ga0501046_0216241_76_888 265
396 3300049581 Ga0501047_0229759 Ga0501047_0229759_20_838 265
397 3300049587 Ga0501071_0095327 Ga0501071_0095327_312_1127 265
398 3300049588 Ga0501072_0165654 Ga0501072_0165654_515_1333 265
399 3300049590 Ga0501074_0155600 Ga0501074_0155600_269_1087 265
400 3300049591 Ga0501075_0019807 Ga0501075_0019807_3546_4364 265
401 3300049591 Ga0501075_0267581 Ga0501075_0267581_18_836 265
402 3300049592 Ga0501076_0009174 Ga0501076_0009174_4068_4886 265
403 3300049592 Ga0501076_0051075 Ga0501076_0051075_1460_2275 265
404 3300049593 Ga0501077_0043878 Ga0501077_0043878_599_1417 265
405 3300049742 Ga0501080_0105835 Ga0501080_0105835_990_1808 265
406 3300049743 Ga0501081_0069521 Ga0501081_0069521_381_1196 265
407 3300049743 Ga0501081_0103034 Ga0501081_0103034_198_1016 265
408 3300049824 Ga0501045_0004695 Ga0501045_0004695_2895_3713 265
409 3300049824 Ga0501045_0091395 Ga0501045_0091395_912_1727 265
410 3300050507 nmdc:mga05p37_11702_c1 nmdc:mga05p37_11702_c1_9341_10159 265
411 3300050507 nmdc:mga05p37_13953_c1 nmdc:mga05p37_13953_c1_2628_3446 265
412 3300050507 nmdc:mga05p37_18613_c1 nmdc:mga05p37_18613_c1_7540_8358 265
413 3300050507 nmdc:mga05p37_187746_c1 nmdc:mga05p37_187746_c1_1190_2008 265
414 3300050507 nmdc:mga05p37_3695_c1 nmdc:mga05p37_3695_c1_12027_12848 265
415 3300050507 nmdc:mga05p37_49599_c1 nmdc:mga05p37_49599_c1_3697_4515 265
416 3300050507 nmdc:mga05p37_497203_c1 nmdc:mga05p37_497203_c1_425_1243 265
417 3300050507 nmdc:mga05p37_50609_c1 nmdc:mga05p37_50609_c1_48_866 265
418 3300050507 nmdc:mga05p37_72066_c1 nmdc:mga05p37_72066_c1_2272_3090 265
419 3300050507 nmdc:mga05p37_93333_c1 nmdc:mga05p37_93333_c1_2293_3111 265
420 3300050508 nmdc:mga09592_11845_c1 nmdc:mga09592_11845_c1_1164_1982 265
421 3300050508 nmdc:mga09592_4575_c1 nmdc:mga09592_4575_c1_1696_2514 265
422 3300050508 nmdc:mga09592_9333_c1 nmdc:mga09592_9333_c1_6928_7746 265
423 3300050509 nmdc:mga0qj67_181262_c1 nmdc:mga0qj67_181262_c1_309_1127 265
424 3300050509 nmdc:mga0qj67_28136_c1 nmdc:mga0qj67_28136_c1_868_1686 265
425 3300050509 nmdc:mga0qj67_306405_c1 nmdc:mga0qj67_306405_c1_192_1010 265
426 3300050509 nmdc:mga0qj67_4500_c1 nmdc:mga0qj67_4500_c1_4964_5785 265
427 3300050509 nmdc:mga0qj67_6292_c1 nmdc:mga0qj67_6292_c1_6488_7312 265
428 3300050510 nmdc:mga06r32_15165_c1 nmdc:mga06r32_15165_c1_3059_3880 265
429 3300050510 nmdc:mga06r32_15543_c1 nmdc:mga06r32_15543_c1_1318_2136 265
430 3300050510 nmdc:mga06r32_3616_c1 nmdc:mga06r32_3616_c1_9459_10277 265
431 3300050510 nmdc:mga06r32_38249_c1 nmdc:mga06r32_38249_c1_2943_3761 265
432 3300050510 nmdc:mga06r32_51413_c1 nmdc:mga06r32_51413_c1_82_900 265
433 3300050511 nmdc:mga08y16_2072_c1 nmdc:mga08y16_2072_c1_16677_17495 265
434 3300050511 nmdc:mga08y16_2077_c1 nmdc:mga08y16_2077_c1_781_1599 265
435 3300050511 nmdc:mga08y16_271415_c1 nmdc:mga08y16_271415_c1_714_1532 265
436 3300050511 nmdc:mga08y16_318024_c1 nmdc:mga08y16_318024_c1_417_1235 265
437 3300050511 nmdc:mga08y16_424193_c1 nmdc:mga08y16_424193_c1_78_926 265
438 3300050511 nmdc:mga08y16_61788_c1 nmdc:mga08y16_61788_c1_1268_2086 265
439 3300050512 nmdc:mga0n895_15352_c1 nmdc:mga0n895_15352_c1_5312_6130 265
440 3300050512 nmdc:mga0n895_160407_c1 nmdc:mga0n895_160407_c1_511_1329 265
441 3300050512 nmdc:mga0n895_199044_c1 nmdc:mga0n895_199044_c1_82_900 265
442 3300050512 nmdc:mga0n895_335478_c1 nmdc:mga0n895_335478_c1_515_1333 265
443 3300050512 nmdc:mga0n895_462276_c1 nmdc:mga0n895_462276_c1_117_950 265
444 3300050512 nmdc:mga0n895_531656_c1 nmdc:mga0n895_531656_c1_152_970 265
445 3300050512 nmdc:mga0n895_62339_c1 nmdc:mga0n895_62339_c1_455_1273 265
446 3300050512 nmdc:mga0n895_96721_c1 nmdc:mga0n895_96721_c1_1493_2311 265
447 3300050513 nmdc:mga0rr50_21612_c1 nmdc:mga0rr50_21612_c1_11_829 265
448 3300050513 nmdc:mga0rr50_221421_c1 nmdc:mga0rr50_221421_c1_191_1009 265
449 3300050513 nmdc:mga0rr50_2510_c1 nmdc:mga0rr50_2510_c1_2328_3146 265
450 3300050514 nmdc:mga08x19_11850_c1 nmdc:mga08x19_11850_c1_911_1729 265
451 3300050514 nmdc:mga08x19_275225_c1 nmdc:mga08x19_275225_c1_326_1144 265
452 3300050514 nmdc:mga08x19_292274_c1 nmdc:mga08x19_292274_c1_261_1079 265
453 3300050514 nmdc:mga08x19_7456_c1 nmdc:mga08x19_7456_c1_724_1542 265
454 3300050515 nmdc:mga0a205_1834_c1 nmdc:mga0a205_1834_c1_4527_5345 265
455 3300050515 nmdc:mga0a205_317331_c1 nmdc:mga0a205_317331_c1_32_850 265
456 3300050515 nmdc:mga0a205_33040_c1 nmdc:mga0a205_33040_c1_1879_2697 265
457 3300050515 nmdc:mga0a205_33041_c1 nmdc:mga0a205_33041_c1_1175_1993 265
458 3300050515 nmdc:mga0a205_502448_c1 nmdc:mga0a205_502448_c1_16_834 265
459 3300050515 nmdc:mga0a205_61211_c1 nmdc:mga0a205_61211_c1_299_1117 265
460 3300050515 nmdc:mga0a205_7552_c1 nmdc:mga0a205_7552_c1_7061_7879 265
461 3300050515 nmdc:mga0a205_83920_c1 nmdc:mga0a205_83920_c1_465_1313 265
462 3300054114 Ga0501084_0092355 Ga0501084_0092355_1441_2259 265
463 3300060353 Ga0501082_0009040 Ga0501082_0009040_4591_5409 265
464 3300060353 Ga0501082_0500421 Ga0501082_0500421_143_961 265
465 3300061734 Ga0530510_0038180 Ga0530510_0038180_204_1022 265
466 3300061734 Ga0530510_0080309 Ga0530510_0080309_88_906 265
467 3300061734 Ga0530510_0103036 Ga0530510_0103036_368_1183 265
468 3300005330 Ga0070690_100119716 Ga0070690_1001197163 266
469 3300005355 Ga0070671_100353110 Ga0070671_1003531102 266
470 3300005440 Ga0070705_100089981 Ga0070705_1000899812 266
471 3300005444 Ga0070694_100070908 Ga0070694_1000709082 266
472 3300005518 Ga0070699_100002124 Ga0070699_10000212414 266
473 3300005545 Ga0070695_100013796 Ga0070695_1000137962 266
474 3300005546 Ga0070696_100083525 Ga0070696_1000835252 266
475 3300005549 Ga0070704_100137386 Ga0070704_1001373862 266
476 3300005617 Ga0068859_100232191 Ga0068859_1002321912 266
477 3300005983 Ga0081540_1009575 Ga0081540_10095754 266
478 3300006028 Ga0070717_10043316 Ga0070717_100433166 266
479 3300006844 Ga0075428_100000103 Ga0075428_10000010354 266
480 3300006844 Ga0075428_100472058 Ga0075428_1004720582 266
481 3300006846 Ga0075430_100008431 Ga0075430_1000084319 266
482 3300006880 Ga0075429_100056275 Ga0075429_1000562754 266
483 3300006931 Ga0097620_100232183 Ga0097620_1002321832 266
484 3300009094 Ga0111539_10000527 Ga0111539_1000052729 266
485 3300009147 Ga0114129_10221888 Ga0114129_102218882 266
486 3300025931 Ga0207644_10231329 Ga0207644_102313292 266
487 3300025961 Ga0207712_10265123 Ga0207712_102651232 266
488 3300027907 Ga0207428_10010492 Ga0207428_100104928 266
489 3300039438 Ga0436360_0479510 Ga0436360_0479510_59_904 266
490 3300039450 Ga0436363_1130753 Ga0436363_1130753_379_1197 266
491 3300046454 Ga0495592_0071975 Ga0495592_0071975_1474_2289 266
492 3300049572 Ga0501036_0039695 Ga0501036_0039695_3116_3931 266
493 3300049572 Ga0501036_0378370 Ga0501036_0378370_52_876 266
494 3300050507 nmdc:mga05p37_275468_c1 nmdc:mga05p37_275468_c1_309_1109 266
495 3300050508 nmdc:mga09592_7598_c1 nmdc:mga09592_7598_c1_6433_7257 266
496 3300050509 nmdc:mga0qj67_6292_c1 nmdc:mga0qj67_6292_c1_7399_8226 266
497 3300050511 nmdc:mga08y16_1374_c1 nmdc:mga08y16_1374_c1_18687_19511 266
498 3300050511 nmdc:mga08y16_174421_c1 nmdc:mga08y16_174421_c1_1307_2125 266
499 3300053077 Ga0495601_0004617 Ga0495601_0004617_5414_6229 266
500 3300053085 Ga0495619_0001776 Ga0495619_0001776_9806_10621 266
501 3300005295 Ga0065707_10171061 Ga0065707_101710612 267
502 3300005328 Ga0070676_10000139 Ga0070676_100001395 267
503 3300005329 Ga0070683_100031139 Ga0070683_1000311392 267
504 3300005329 Ga0070683_100216685 Ga0070683_1002166853 267
505 3300005330 Ga0070690_100108173 Ga0070690_1001081732 267
506 3300005331 Ga0070670_100009863 Ga0070670_1000098636 267
507 3300005334 Ga0068869_100008319 Ga0068869_1000083194 267
508 3300005336 Ga0070680_100015720 Ga0070680_1000157204 267
509 3300005336 Ga0070680_100018671 Ga0070680_1000186714 267
510 3300005337 Ga0070682_100002778 Ga0070682_1000027787 267
511 3300005338 Ga0068868_100058978 Ga0068868_1000589781 267
512 3300005338 Ga0068868_100560568 Ga0068868_1005605681 267
513 3300005339 Ga0070660_100003858 Ga0070660_10000385810 267
514 3300005340 Ga0070689_100014713 Ga0070689_1000147133 267
515 3300005341 Ga0070691_10006870 Ga0070691_100068703 267
516 3300005344 Ga0070661_100003154 Ga0070661_10000315412 267
517 3300005345 Ga0070692_10000852 Ga0070692_1000085210 267
518 3300005345 Ga0070692_10038767 Ga0070692_100387671 267
519 3300005347 Ga0070668_100238987 Ga0070668_1002389872 267
520 3300005353 Ga0070669_100018188 Ga0070669_1000181884 267
521 3300005353 Ga0070669_100047314 Ga0070669_1000473142 267
522 3300005353 Ga0070669_100219121 Ga0070669_1002191212 267
523 3300005355 Ga0070671_100028581 Ga0070671_1000285817 267
524 3300005355 Ga0070671_100335524 Ga0070671_1003355241 267
525 3300005364 Ga0070673_100089595 Ga0070673_1000895953 267
526 3300005366 Ga0070659_100000845 Ga0070659_10000084519 267
527 3300005406 Ga0070703_10012015 Ga0070703_100120152 267
528 3300005434 Ga0070709_10044346 Ga0070709_100443462 267
529 3300005434 Ga0070709_10174078 Ga0070709_101740782 267
530 3300005435 Ga0070714_100046847 Ga0070714_1000468473 267
531 3300005435 Ga0070714_100084675 Ga0070714_1000846752 267
532 3300005435 Ga0070714_100598110 Ga0070714_1005981101 267
533 3300005436 Ga0070713_100215916 Ga0070713_1002159162 267
534 3300005436 Ga0070713_100410993 Ga0070713_1004109932 267
535 3300005437 Ga0070710_10008505 Ga0070710_100085052 267
536 3300005439 Ga0070711_100025659 Ga0070711_1000256593 267
537 3300005439 Ga0070711_100099749 Ga0070711_1000997492 267
538 3300005440 Ga0070705_100007634 Ga0070705_1000076345 267
539 3300005441 Ga0070700_100003634 Ga0070700_1000036347 267
540 3300005444 Ga0070694_100008535 Ga0070694_1000085356 267
541 3300005444 Ga0070694_100019525 Ga0070694_1000195252 267
542 3300005444 Ga0070694_100090621 Ga0070694_1000906212 267
543 3300005445 Ga0070708_100392260 Ga0070708_1003922602 267
544 3300005445 Ga0070708_100454447 Ga0070708_1004544472 267
545 3300005455 Ga0070663_100002361 Ga0070663_1000023617 267
546 3300005456 Ga0070678_100178491 Ga0070678_1001784911 267
547 3300005457 Ga0070662_100006420 Ga0070662_1000064206 267
548 3300005458 Ga0070681_10069882 Ga0070681_100698822 267
549 3300005458 Ga0070681_10360246 Ga0070681_103602462 267
550 3300005459 Ga0068867_100002041 Ga0068867_10000204112 267
551 3300005467 Ga0070706_100035549 Ga0070706_1000355493 267
552 3300005467 Ga0070706_100046033 Ga0070706_1000460335 267
553 3300005467 Ga0070706_100064868 Ga0070706_1000648683 267
554 3300005467 Ga0070706_100125561 Ga0070706_1001255614 267
555 3300005467 Ga0070706_100137790 Ga0070706_1001377902 267
556 3300005467 Ga0070706_100217239 Ga0070706_1002172392 267
557 3300005468 Ga0070707_100024547 Ga0070707_1000245473 267
558 3300005468 Ga0070707_100028956 Ga0070707_1000289562 267
559 3300005468 Ga0070707_100032796 Ga0070707_1000327963 267
560 3300005468 Ga0070707_100108925 Ga0070707_1001089252 267
561 3300005468 Ga0070707_100164163 Ga0070707_1001641632 267
562 3300005468 Ga0070707_100312867 Ga0070707_1003128672 267
563 3300005471 Ga0070698_100019850 Ga0070698_1000198504 267
564 3300005471 Ga0070698_100386797 Ga0070698_1003867971 267
565 3300005518 Ga0070699_100020265 Ga0070699_1000202652 267
566 3300005518 Ga0070699_100049292 Ga0070699_1000492923 267
567 3300005518 Ga0070699_100056610 Ga0070699_1000566102 267
568 3300005518 Ga0070699_100512462 Ga0070699_1005124622 267
569 3300005530 Ga0070679_100001475 Ga0070679_10000147514 267
570 3300005530 Ga0070679_100044379 Ga0070679_1000443794 267
571 3300005530 Ga0070679_100140190 Ga0070679_1001401902 267
572 3300005530 Ga0070679_100300361 Ga0070679_1003003612 267
573 3300005535 Ga0070684_100205850 Ga0070684_1002058502 267
574 3300005535 Ga0070684_100506100 Ga0070684_1005061001 267
575 3300005536 Ga0070697_100088887 Ga0070697_1000888872 267
576 3300005539 Ga0068853_100000232 Ga0068853_1000002321 267
577 3300005543 Ga0070672_100013035 Ga0070672_1000130355 267
578 3300005544 Ga0070686_100046147 Ga0070686_1000461472 267
579 3300005546 Ga0070696_100002075 Ga0070696_1000020753 267
580 3300005547 Ga0070693_100000028 Ga0070693_10000002822 267
581 3300005549 Ga0070704_100007578 Ga0070704_1000075786 267
582 3300005549 Ga0070704_100033340 Ga0070704_1000333405 267
583 3300005549 Ga0070704_100178648 Ga0070704_1001786482 267
584 3300005549 Ga0070704_100482713 Ga0070704_1004827132 267
585 3300005563 Ga0068855_100001875 Ga0068855_1000018753 267
586 3300005564 Ga0070664_100036938 Ga0070664_1000369386 267
587 3300005564 Ga0070664_100219696 Ga0070664_1002196963 267
588 3300005614 Ga0068856_100044583 Ga0068856_1000445832 267
589 3300005614 Ga0068856_100522601 Ga0068856_1005226012 267
590 3300005617 Ga0068859_100042516 Ga0068859_1000425165 267
591 3300005617 Ga0068859_100149416 Ga0068859_1001494162 267
592 3300005618 Ga0068864_100045652 Ga0068864_1000456522 267
593 3300005719 Ga0068861_100003774 Ga0068861_1000037746 267
594 3300005719 Ga0068861_100118513 Ga0068861_1001185131 267
595 3300005719 Ga0068861_100568862 Ga0068861_1005688621 267
596 3300005840 Ga0068870_10000446 Ga0068870_100004465 267
597 3300005841 Ga0068863_100032204 Ga0068863_1000322045 267
598 3300005841 Ga0068863_100094075 Ga0068863_1000940752 267
599 3300005842 Ga0068858_100010646 Ga0068858_1000106468 267
600 3300005842 Ga0068858_100144238 Ga0068858_1001442382 267
601 3300005842 Ga0068858_100220348 Ga0068858_1002203481 267
602 3300005843 Ga0068860_100029232 Ga0068860_1000292323 267
603 3300005843 Ga0068860_100080148 Ga0068860_1000801483 267
604 3300005843 Ga0068860_100098090 Ga0068860_1000980903 267
605 3300005843 Ga0068860_100098138 Ga0068860_1000981381 267
606 3300005844 Ga0068862_100022721 Ga0068862_1000227213 267
607 3300005844 Ga0068862_100334577 Ga0068862_1003345772 267
608 3300005981 Ga0081538_10148360 Ga0081538_101483601 267
609 3300005983 Ga0081540_1018443 Ga0081540_10184433 267
610 3300005983 Ga0081540_1019705 Ga0081540_10197056 267
611 3300006028 Ga0070717_10000606 Ga0070717_1000060622 267
612 3300006028 Ga0070717_10158959 Ga0070717_101589592 267
613 3300006175 Ga0070712_100043204 Ga0070712_1000432043 267
614 3300006175 Ga0070712_100055130 Ga0070712_1000551303 267
615 3300006844 Ga0075428_100021808 Ga0075428_1000218086 267
616 3300006844 Ga0075428_100048068 Ga0075428_1000480685 267
617 3300006844 Ga0075428_100163361 Ga0075428_1001633612 267
618 3300006846 Ga0075430_100000499 Ga0075430_1000004993 267
619 3300006846 Ga0075430_100023489 Ga0075430_1000234895 267
620 3300006847 Ga0075431_100000226 Ga0075431_10000022622 267
621 3300006847 Ga0075431_100029890 Ga0075431_1000298905 267
622 3300006847 Ga0075431_100087432 Ga0075431_1000874322 267
623 3300006847 Ga0075431_100114244 Ga0075431_1001142442 267
624 3300006847 Ga0075431_100324704 Ga0075431_1003247041 267
625 3300006847 Ga0075431_100396183 Ga0075431_1003961832 267
626 3300006852 Ga0075433_10067526 Ga0075433_100675262 267
627 3300006871 Ga0075434_100013019 Ga0075434_1000130196 267
628 3300006871 Ga0075434_100085679 Ga0075434_1000856794 267
629 3300006880 Ga0075429_100304858 Ga0075429_1003048582 267
630 3300006881 Ga0068865_100057926 Ga0068865_1000579262 267
631 3300006914 Ga0075436_100030743 Ga0075436_1000307433 267
632 3300006914 Ga0075436_100198765 Ga0075436_1001987652 267
633 3300006914 Ga0075436_100256477 Ga0075436_1002564772 267
634 3300006931 Ga0097620_100042510 Ga0097620_1000425105 267
635 3300006931 Ga0097620_100149416 Ga0097620_1001494162 267
636 3300007076 Ga0075435_100019967 Ga0075435_1000199672 267
637 3300007265 Ga0099794_10013628 Ga0099794_100136284 267
638 3300007788 Ga0099795_10005301 Ga0099795_100053014 267
639 3300007788 Ga0099795_10009925 Ga0099795_100099252 267
640 3300009094 Ga0111539_10002606 Ga0111539_100026065 267
641 3300009094 Ga0111539_10060175 Ga0111539_100601755 267
642 3300009094 Ga0111539_10074985 Ga0111539_100749852 267
643 3300009094 Ga0111539_10204378 Ga0111539_102043782 267
644 3300009094 Ga0111539_10776358 Ga0111539_107763581 267
645 3300009101 Ga0105247_10033597 Ga0105247_100335972 267
646 3300009147 Ga0114129_10016188 Ga0114129_100161889 267
647 3300009147 Ga0114129_10108451 Ga0114129_101084514 267
648 3300009147 Ga0114129_10125258 Ga0114129_101252584 267
649 3300009147 Ga0114129_10129442 Ga0114129_101294422 267
650 3300009147 Ga0114129_10286869 Ga0114129_102868692 267
651 3300009147 Ga0114129_10406786 Ga0114129_104067862 267
652 3300009147 Ga0114129_10427732 Ga0114129_104277322 267
653 3300009147 Ga0114129_10524625 Ga0114129_105246252 267
654 3300009147 Ga0114129_10587358 Ga0114129_105873582 267
655 3300009148 Ga0105243_10097265 Ga0105243_100972652 267
656 3300009148 Ga0105243_10203983 Ga0105243_102039832 267
657 3300009174 Ga0105241_10000273 Ga0105241_1000027332 267
658 3300009174 Ga0105241_10035951 Ga0105241_100359514 267
659 3300009176 Ga0105242_10152176 Ga0105242_101521763 267
660 3300009177 Ga0105248_10287617 Ga0105248_102876172 267
661 3300009553 Ga0105249_10276401 Ga0105249_102764011 267
662 3300009553 Ga0105249_10660940 Ga0105249_106609402 267
663 3300010159 Ga0099796_10117199 Ga0099796_101171991 267
664 3300010159 Ga0099796_10124771 Ga0099796_101247711 267
665 3300010375 Ga0105239_10221860 Ga0105239_102218601 267
666 3300011119 Ga0105246_10030220 Ga0105246_100302204 267
667 3300011119 Ga0105246_10032792 Ga0105246_100327925 267
668 3300013100 Ga0157373_10000408 Ga0157373_1000040825 267
669 3300013100 Ga0157373_10146911 Ga0157373_101469112 267
670 3300013296 Ga0157374_10257913 Ga0157374_102579132 267
671 3300013306 Ga0163162_10020700 Ga0163162_100207003 267
672 3300013306 Ga0163162_10436605 Ga0163162_104366052 267
673 3300013307 Ga0157372_10000827 Ga0157372_1000082725 267
674 3300013308 Ga0157375_10114421 Ga0157375_101144212 267
675 3300013308 Ga0157375_10241638 Ga0157375_102416382 267
676 3300013308 Ga0157375_10245732 Ga0157375_102457323 267
677 3300014325 Ga0163163_10033352 Ga0163163_100333524 267
678 3300014325 Ga0163163_10089171 Ga0163163_100891711 267
679 3300014326 Ga0157380_10442423 Ga0157380_104424232 267
680 3300014497 Ga0182008_10042430 Ga0182008_100424302 267
681 3300014497 Ga0182008_10047793 Ga0182008_100477932 267
682 3300014497 Ga0182008_10055650 Ga0182008_100556503 267
683 3300014497 Ga0182008_10199216 Ga0182008_101992162 267
684 3300014968 Ga0157379_10000856 Ga0157379_1000085615 267
685 3300014968 Ga0157379_10442055 Ga0157379_104420552 267
686 3300015262 Ga0182007_10018621 Ga0182007_100186214 267
687 3300021388 Ga0213875_10000844 Ga0213875_1000084411 267
688 3300021388 Ga0213875_10029477 Ga0213875_100294772 267
689 3300024227 Ga0228598_1011879 Ga0228598_10118792 267
690 3300025885 Ga0207653_10000704 Ga0207653_100007044 267
691 3300025901 Ga0207688_10142830 Ga0207688_101428302 267
692 3300025903 Ga0207680_10075290 Ga0207680_100752903 267
693 3300025907 Ga0207645_10003491 Ga0207645_100034918 267
694 3300025908 Ga0207643_10001164 Ga0207643_1000116412 267
695 3300025910 Ga0207684_10031376 Ga0207684_100313765 267
696 3300025910 Ga0207684_10058899 Ga0207684_100588993 267
697 3300025910 Ga0207684_10128648 Ga0207684_101286484 267
698 3300025910 Ga0207684_10182167 Ga0207684_101821672 267
699 3300025910 Ga0207684_10315369 Ga0207684_103153692 267
700 3300025911 Ga0207654_10000814 Ga0207654_100008145 267
701 3300025912 Ga0207707_10000198 Ga0207707_1000019848 267
702 3300025912 Ga0207707_10101457 Ga0207707_101014572 267
703 3300025915 Ga0207693_10014693 Ga0207693_100146935 267
704 3300025915 Ga0207693_10027641 Ga0207693_100276413 267
705 3300025915 Ga0207693_10030564 Ga0207693_100305643 267
706 3300025915 Ga0207693_10037494 Ga0207693_100374943 267
707 3300025915 Ga0207693_10073922 Ga0207693_100739224 267
708 3300025915 Ga0207693_10131210 Ga0207693_101312102 267
709 3300025915 Ga0207693_10145600 Ga0207693_101456002 267
710 3300025916 Ga0207663_10156875 Ga0207663_101568752 267
711 3300025917 Ga0207660_10000236 Ga0207660_100002368 267
712 3300025919 Ga0207657_10000113 Ga0207657_1000011339 267
713 3300025920 Ga0207649_10004063 Ga0207649_100040639 267
714 3300025921 Ga0207652_10000284 Ga0207652_1000028416 267
715 3300025922 Ga0207646_10075082 Ga0207646_100750822 267
716 3300025923 Ga0207681_10236486 Ga0207681_102364862 267
717 3300025925 Ga0207650_10020994 Ga0207650_100209943 267
718 3300025928 Ga0207700_10027855 Ga0207700_100278553 267
719 3300025928 Ga0207700_10056067 Ga0207700_100560674 267
720 3300025928 Ga0207700_10130259 Ga0207700_101302592 267
721 3300025928 Ga0207700_10205402 Ga0207700_102054022 267
722 3300025929 Ga0207664_10036700 Ga0207664_100367001 267
723 3300025929 Ga0207664_10093140 Ga0207664_100931401 267
724 3300025929 Ga0207664_10125702 Ga0207664_101257022 267
725 3300025929 Ga0207664_10452246 Ga0207664_104522462 267
726 3300025931 Ga0207644_10398703 Ga0207644_103987031 267
727 3300025932 Ga0207690_10022024 Ga0207690_100220245 267
728 3300025933 Ga0207706_10000622 Ga0207706_100006224 267
729 3300025933 Ga0207706_10097940 Ga0207706_100979402 267
730 3300025935 Ga0207709_10109508 Ga0207709_101095084 267
731 3300025935 Ga0207709_10118634 Ga0207709_101186342 267
732 3300025936 Ga0207670_10009414 Ga0207670_100094147 267
733 3300025936 Ga0207670_10211650 Ga0207670_102116502 267
734 3300025940 Ga0207691_10030698 Ga0207691_100306985 267
735 3300025941 Ga0207711_10092712 Ga0207711_100927124 267
736 3300025942 Ga0207689_10000839 Ga0207689_1000083926 267
737 3300025942 Ga0207689_10095104 Ga0207689_100951042 267
738 3300025942 Ga0207689_10192365 Ga0207689_101923651 267
739 3300025944 Ga0207661_10518363 Ga0207661_105183631 267
740 3300025945 Ga0207679_10001316 Ga0207679_1000131616 267
741 3300025945 Ga0207679_10048362 Ga0207679_100483624 267
742 3300025949 Ga0207667_10014534 Ga0207667_100145347 267
743 3300025960 Ga0207651_10022636 Ga0207651_100226362 267
744 3300025981 Ga0207640_10086432 Ga0207640_100864323 267
745 3300026035 Ga0207703_10006818 Ga0207703_100068189 267
746 3300026035 Ga0207703_10243764 Ga0207703_102437642 267
747 3300026041 Ga0207639_10026015 Ga0207639_100260155 267
748 3300026067 Ga0207678_10002857 Ga0207678_100028575 267
749 3300026075 Ga0207708_10014915 Ga0207708_100149153 267
750 3300026075 Ga0207708_10232429 Ga0207708_102324291 267
751 3300026078 Ga0207702_10006470 Ga0207702_100064709 267
752 3300026078 Ga0207702_10211977 Ga0207702_102119771 267
753 3300026088 Ga0207641_10641714 Ga0207641_106417141 267
754 3300026089 Ga0207648_10004641 Ga0207648_1000464112 267
755 3300026089 Ga0207648_10279462 Ga0207648_102794622 267
756 3300026095 Ga0207676_10015865 Ga0207676_100158653 267
757 3300026095 Ga0207676_10599486 Ga0207676_105994862 267
758 3300026116 Ga0207674_10000197 Ga0207674_100001975 267
759 3300026118 Ga0207675_100014032 Ga0207675_1000140324 267
760 3300026118 Ga0207675_100367778 Ga0207675_1003677782 267
761 3300027671 Ga0209588_1014131 Ga0209588_10141313 267
762 3300027907 Ga0207428_10101501 Ga0207428_101015011 267
763 3300027907 Ga0207428_10184064 Ga0207428_101840642 267
764 3300028379 Ga0268266_10287547 Ga0268266_102875473 267
765 3300028380 Ga0268265_10188039 Ga0268265_101880392 267
766 3300028380 Ga0268265_10367717 Ga0268265_103677172 267
767 3300028381 Ga0268264_10015033 Ga0268264_100150335 267
768 3300028381 Ga0268264_10031539 Ga0268264_100315393 267
769 3300028800 Ga0265338_10027357 Ga0265338_100273572 267
770 3300031241 Ga0265325_10119049 Ga0265325_101190492 267
771 3300031548 Ga0307408_100084504 Ga0307408_1000845042 267
772 3300031901 Ga0307406_10039957 Ga0307406_100399572 267
773 3300031903 Ga0307407_10169463 Ga0307407_101694631 267
774 3300032002 Ga0307416_100221576 Ga0307416_1002215762 267
775 3300034957 Ga0373938_0026974 Ga0373938_0026974_23_886 267
776 3300035083 Ga0373926_0007148 Ga0373926_0007148_1400_2227 267
777 3300035085 Ga0373929_0022726 Ga0373929_0022726_98_925 267
778 3300035086 Ga0373934_0028976 Ga0373934_0028976_923_1741 267
779 3300035091 Ga0373951_0005728 Ga0373951_0005728_35_859 267
780 3300035111 Ga0373923_0020635 Ga0373923_0020635_561_1388 267
781 3300035113 Ga0373936_0063772 Ga0373936_0063772_30_857 267
782 3300035119 Ga0373956_0038538 Ga0373956_0038538_570_1397 267
783 3300035120 Ga0373957_0035248 Ga0373957_0035248_102_929 267
784 3300035170 Ga0373943_0130526 Ga0373943_0130526_295_1122 267
785 3300035172 Ga0373955_0077248 Ga0373955_0077248_608_1426 267
786 3300035207 Ga0373942_0022149 Ga0373942_0022149_167_997 267
787 3300035410 Ga0373924_0055530 Ga0373924_0055530_38_865 267
788 3300035691 Ga0373931_0008533 Ga0373931_0008533_45_866 267
789 3300035691 Ga0373931_0049612 Ga0373931_0049612_1079_1942 267
790 3300035691 Ga0373931_0085842 Ga0373931_0085842_516_1346 267
791 3300035691 Ga0373931_0144230 Ga0373931_0144230_57_881 267
792 3300035692 Ga0373935_0095173 Ga0373935_0095173_647_1474 267
793 3300035692 Ga0373935_0369581 Ga0373935_0369581_27_854 267
794 3300035695 Ga0373927_0073687 Ga0373927_0073687_924_1751 267
795 3300035695 Ga0373927_0081288 Ga0373927_0081288_882_1718 267
796 3300035695 Ga0373927_0144962 Ga0373927_0144962_334_1161 267
797 3300035724 Ga0373933_0008687 Ga0373933_0008687_1771_2589 267
798 3300035724 Ga0373933_0018196 Ga0373933_0018196_2222_3049 267
799 3300035724 Ga0373933_0018425 Ga0373933_0018425_767_1609 267
800 3300035724 Ga0373933_0054050 Ga0373933_0054050_738_1565 267
801 3300035724 Ga0373933_0205150 Ga0373933_0205150_30_857 267
802 3300035725 Ga0373947_0030927 Ga0373947_0030927_1775_2602 267
803 3300035725 Ga0373947_0186845 Ga0373947_0186845_351_1178 267
804 3300035725 Ga0373947_0274760 Ga0373947_0274760_151_972 267
805 3300036401 Ga0373937_0010067 Ga0373937_0010067_3604_4542 267
806 3300036401 Ga0373937_0022237 Ga0373937_0022237_490_1317 267
807 3300036401 Ga0373937_0047215 Ga0373937_0047215_2348_3175 267
808 3300036401 Ga0373937_0048067 Ga0373937_0048067_1685_2527 267
809 3300036401 Ga0373937_0070697 Ga0373937_0070697_146_973 267
810 3300036401 Ga0373937_0083428 Ga0373937_0083428_145_972 267
811 3300036401 Ga0373937_0121415 Ga0373937_0121415_781_1608 267
812 3300036401 Ga0373937_0262237 Ga0373937_0262237_623_1450 267
813 3300037068 Ga0373925_0014791 Ga0373925_0014791_1454_2281 267
814 3300037068 Ga0373925_0026815 Ga0373925_0026815_1102_1929 267
815 3300037068 Ga0373925_0090722 Ga0373925_0090722_12_839 267
816 3300037068 Ga0373925_0185614 Ga0373925_0185614_620_1447 267
817 3300037418 Ga0395900_0002247 Ga0395900_0002247_13509_14360 267
818 3300037466 Ga0395898_0052997 Ga0395898_0052997_1390_2241 267
819 3300037853 Ga0436364_0080442 Ga0436364_0080442_546_1391 267
820 3300037853 Ga0436364_0639322 Ga0436364_0639322_152_979 267
821 3300037853 Ga0436364_0722137 Ga0436364_0722137_15072_15890 267
822 3300037853 Ga0436364_0874567 Ga0436364_0874567_161_979 267
823 3300037853 Ga0436364_1034225 Ga0436364_1034225_188_1006 267
824 3300037853 Ga0436364_1278604 Ga0436364_1278604_516_1343 267
825 3300037853 Ga0436364_1430783 Ga0436364_1430783_1442_2269 267
826 3300038443 Ga0395901_0004315 Ga0395901_0004315_11063_11914 267
827 3300039437 Ga0436365_0043846 Ga0436365_0043846_39_857 267
828 3300039437 Ga0436365_1004606 Ga0436365_1004606_13202_14020 267
829 3300039438 Ga0436360_0109953 Ga0436360_0109953_312_1151 267
830 3300039438 Ga0436360_0292686 Ga0436360_0292686_610_1446 267
831 3300039438 Ga0436360_0987873 Ga0436360_0987873_972_1799 267
832 3300039447 Ga0436361_0619205 Ga0436361_0619205_861_1688 267
833 3300039447 Ga0436361_0731630 Ga0436361_0731630_926_1762 267
834 3300039450 Ga0436363_0709230 Ga0436363_0709230_823_1641 267
835 3300039450 Ga0436363_1397028 Ga0436363_1397028_1501_2328 267
836 3300039453 Ga0436362_0360447 Ga0436362_0360447_297_1142 267
837 3300039453 Ga0436362_0874942 Ga0436362_0874942_192_1010 267
838 3300039453 Ga0436362_1275549 Ga0436362_1275549_658_1497 267
839 3300042008 Ga0439450_036298 Ga0439450_036298_53_880 267
840 3300042157 Ga0439458_0029822 Ga0439458_0029822_444_1268 267
841 3300042438 Ga0439459_0000622 Ga0439459_0000622_2527_3351 267
842 3300042461 Ga0439460_0019695 Ga0439460_0019695_861_1709 267
843 3300042876 Ga0451577_0022382 Ga0451577_0022382_2279_3103 267
844 3300042876 Ga0451577_0114449 Ga0451577_0114449_712_1542 267
845 3300044673 Ga0453683_0139472 Ga0453683_0139472_520_1347 267
846 3300044712 Ga0453684_0207778 Ga0453684_0207778_1355_2179 267
847 3300045051 Ga0451576_0046180 Ga0451576_0046180_2354_3178 267
848 3300046454 Ga0495592_0028281 Ga0495592_0028281_697_1524 267
849 3300046459 Ga0495629_0200696 Ga0495629_0200696_351_1178 267
850 3300046462 Ga0495651_0002425 Ga0495651_0002425_9644_10471 267
851 3300046462 Ga0495651_0043748 Ga0495651_0043748_2507_3334 267
852 3300046462 Ga0495651_0294272 Ga0495651_0294272_11_838 267
853 3300046476 Ga0495662_0175629 Ga0495662_0175629_194_1021 267
854 3300046477 Ga0495664_0004201 Ga0495664_0004201_6451_7278 267
855 3300046511 Ga0495608_0002946 Ga0495608_0002946_791_1618 267
856 3300046511 Ga0495608_0131967 Ga0495608_0131967_222_1040 267
857 3300046514 Ga0495618_0235909 Ga0495618_0235909_228_1055 267
858 3300046516 Ga0495628_0020266 Ga0495628_0020266_3304_4131 267
859 3300046533 Ga0495640_0109722 Ga0495640_0109722_53_880 267
860 3300046533 Ga0495640_0127170 Ga0495640_0127170_79_921 267
861 3300046536 Ga0495587_0039338 Ga0495587_0039338_1087_1914 267
862 3300046543 Ga0495645_0019796 Ga0495645_0019796_3868_4695 267
863 3300046543 Ga0495645_0182413 Ga0495645_0182413_423_1250 267
864 3300046559 Ga0495667_0055717 Ga0495667_0055717_1666_2493 267
865 3300046559 Ga0495667_0237094 Ga0495667_0237094_217_1044 267
866 3300046642 Ga0495634_0023101 Ga0495634_0023101_1851_2678 267
867 3300046663 Ga0495635_0004464 Ga0495635_0004464_53_880 267
868 3300046664 Ga0495659_0135100 Ga0495659_0135100_92_916 267
869 3300046674 Ga0495588_0109904 Ga0495588_0109904_404_1228 267
870 3300046678 Ga0495599_0016495 Ga0495599_0016495_592_1419 267
871 3300046680 Ga0495646_0008364 Ga0495646_0008364_4964_5791 267
872 3300046684 Ga0495669_0097101 Ga0495669_0097101_131_955 267
873 3300046809 Ga0495600_0086227 Ga0495600_0086227_879_1706 267
874 3300047317 Ga0495604_0001943 Ga0495604_0001943_5060_5887 267
875 3300047319 Ga0495674_0052106 Ga0495674_0052106_2065_2892 267
876 3300047319 Ga0495674_0412013 Ga0495674_0412013_64_900 267
877 3300047322 Ga0495680_0056648 Ga0495680_0056648_1045_1872 267
878 3300047322 Ga0495680_0292495 Ga0495680_0292495_13_840 267
879 3300047444 Ga0495675_0006262 Ga0495675_0006262_4392_5219 267
880 3300048088 Ga0495602_0005445 Ga0495602_0005445_12379_13206 267
881 3300048088 Ga0495602_0397476 Ga0495602_0397476_146_973 267
882 3300048905 Ga0496102_0034282 Ga0496102_0034282_3015_3839 267
883 3300048905 Ga0496102_0088469 Ga0496102_0088469_671_1501 267
884 3300048906 Ga0496103_0066394 Ga0496103_0066394_458_1282 267
885 3300048907 Ga0496104_0118569 Ga0496104_0118569_521_1339 267
886 3300048913 Ga0496110_0087763 Ga0496110_0087763_1102_1920 267
887 3300048915 Ga0496112_0082970 Ga0496112_0082970_2266_3084 267
888 3300048915 Ga0496112_0683189 Ga0496112_0683189_43_867 267
889 3300048916 Ga0496113_0149933 Ga0496113_0149933_464_1282 267
890 3300049575 Ga0501039_0089993 Ga0501039_0089993_229_1047 267
891 3300049576 Ga0501040_0002455 Ga0501040_0002455_5905_6741 267
892 3300049577 Ga0501041_0008299 Ga0501041_0008299_3360_4178 267
893 3300049577 Ga0501041_0032102 Ga0501041_0032102_2144_2971 267
894 3300049578 Ga0501042_0175111 Ga0501042_0175111_71_889 267
895 3300049580 Ga0501046_0260939 Ga0501046_0260939_19_867 267
896 3300049581 Ga0501047_0401916 Ga0501047_0401916_146_973 267
897 3300049582 Ga0501048_0134367 Ga0501048_0134367_162_989 267
898 3300049584 Ga0501068_0152179 Ga0501068_0152179_528_1346 267
899 3300049588 Ga0501072_0056903 Ga0501072_0056903_1030_1872 267
900 3300049588 Ga0501072_0076295 Ga0501072_0076295_1702_2520 267
901 3300049588 Ga0501072_0227828 Ga0501072_0227828_149_976 267
902 3300049590 Ga0501074_0113378 Ga0501074_0113378_947_1765 267
903 3300049591 Ga0501075_0020845 Ga0501075_0020845_1525_2352 267
904 3300049592 Ga0501076_0032859 Ga0501076_0032859_2990_3808 267
905 3300049593 Ga0501077_0047733 Ga0501077_0047733_1847_2665 267
906 3300049741 Ga0501079_0115962 Ga0501079_0115962_833_1675 267
907 3300049824 Ga0501045_0159169 Ga0501045_0159169_676_1503 267
908 3300050507 nmdc:mga05p37_110366_c1 nmdc:mga05p37_110366_c1_722_1663 267
909 3300050507 nmdc:mga05p37_111467_c1 nmdc:mga05p37_111467_c1_2082_2885 267
910 3300050507 nmdc:mga05p37_11702_c1 nmdc:mga05p37_11702_c1_274_1125 267
911 3300050507 nmdc:mga05p37_362807_c1 nmdc:mga05p37_362807_c1_575_1417 267
912 3300050507 nmdc:mga05p37_411742_c1 nmdc:mga05p37_411742_c1_386_1216 267
913 3300050507 nmdc:mga05p37_43013_c1 nmdc:mga05p37_43013_c1_802_1629 267
914 3300050507 nmdc:mga05p37_463416_c1 nmdc:mga05p37_463416_c1_594_1418 267
915 3300050507 nmdc:mga05p37_5872_c1 nmdc:mga05p37_5872_c1_13395_14237 267
916 3300050507 nmdc:mga05p37_5938_c1 nmdc:mga05p37_5938_c1_11253_12080 267
917 3300050508 nmdc:mga09592_211939_c1 nmdc:mga09592_211939_c1_766_1593 267
918 3300050508 nmdc:mga09592_254965_c1 nmdc:mga09592_254965_c1_10_837 267
919 3300050508 nmdc:mga09592_287554_c1 nmdc:mga09592_287554_c1_400_1224 267
920 3300050508 nmdc:mga09592_298468_c1 nmdc:mga09592_298468_c1_418_1260 267
921 3300050508 nmdc:mga09592_60059_c1 nmdc:mga09592_60059_c1_2101_2931 267
922 3300050509 nmdc:mga0qj67_13254_c1 nmdc:mga0qj67_13254_c1_1118_1960 267
923 3300050510 nmdc:mga06r32_1480_c1 nmdc:mga06r32_1480_c1_1961_2803 267
924 3300050510 nmdc:mga06r32_216085_c1 nmdc:mga06r32_216085_c1_671_1498 267
925 3300050510 nmdc:mga06r32_53_c1 nmdc:mga06r32_53_c1_13044_13868 267
926 3300050510 nmdc:mga06r32_670757_c1 nmdc:mga06r32_670757_c1_150_986 267
927 3300050511 nmdc:mga08y16_146409_c1 nmdc:mga08y16_146409_c1_378_1205 267
928 3300050511 nmdc:mga08y16_181260_c1 nmdc:mga08y16_181260_c1_710_1513 267
929 3300050511 nmdc:mga08y16_4905_c1 nmdc:mga08y16_4905_c1_8723_9547 267
930 3300050511 nmdc:mga08y16_888683_c1 nmdc:mga08y16_888683_c1_10_837 267
931 3300050512 nmdc:mga0n895_20267_c1 nmdc:mga0n895_20267_c1_3580_4383 267
932 3300050512 nmdc:mga0n895_231009_c1 nmdc:mga0n895_231009_c1_177_1001 267
933 3300050512 nmdc:mga0n895_66054_c1 nmdc:mga0n895_66054_c1_136_1020 267
934 3300050513 nmdc:mga0rr50_211050_c1 nmdc:mga0rr50_211050_c1_145_948 267
935 3300050513 nmdc:mga0rr50_469172_c1 nmdc:mga0rr50_469172_c1_170_973 267
936 3300050513 nmdc:mga0rr50_60161_c1 nmdc:mga0rr50_60161_c1_58_897 267
937 3300050514 nmdc:mga08x19_163629_c1 nmdc:mga08x19_163629_c1_377_1225 267
938 3300050514 nmdc:mga08x19_225253_c1 nmdc:mga08x19_225253_c1_174_992 267
939 3300050514 nmdc:mga08x19_5839_c1 nmdc:mga08x19_5839_c1_297_1124 267
940 3300050515 nmdc:mga0a205_22841_c1 nmdc:mga0a205_22841_c1_1973_2857 267
941 3300050515 nmdc:mga0a205_230090_c1 nmdc:mga0a205_230090_c1_342_1145 267
942 3300050515 nmdc:mga0a205_280511_c1 nmdc:mga0a205_280511_c1_419_1246 267
943 3300050515 nmdc:mga0a205_34800_c1 nmdc:mga0a205_34800_c1_985_1809 267
944 3300050515 nmdc:mga0a205_56763_c1 nmdc:mga0a205_56763_c1_962_1786 267
945 3300053077 Ga0495601_0037130 Ga0495601_0037130_43_870 267
946 3300053077 Ga0495601_0055492 Ga0495601_0055492_1185_2012 267
947 3300053078 Ga0495612_0004119 Ga0495612_0004119_135_962 267
948 3300053085 Ga0495619_0023030 Ga0495619_0023030_1694_2521 267
949 3300053085 Ga0495619_0028172 Ga0495619_0028172_596_1417 267
950 3300053085 Ga0495619_0099727 Ga0495619_0099727_720_1556 267
951 3300053085 Ga0495619_0124931 Ga0495619_0124931_255_1097 267
952 3300053085 Ga0495619_0141600 Ga0495619_0141600_514_1341 267
953 3300053085 Ga0495619_0167358 Ga0495619_0167358_654_1481 267
954 3300053085 Ga0495619_0376198 Ga0495619_0376198_39_866 267
955 3300054114 Ga0501084_0337865 Ga0501084_0337865_15_833 267
956 3300061734 Ga0530510_0001282 Ga0530510_0001282_12996_13814 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

54

315

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8379 1 264
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.8362 1 264
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8264 1 264
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.8248 1 264
2ffi-assembly2.cif.gz_B crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23. 0.8183 2 266
ID Description Score Start End Superfamily
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8573 2 260 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8379 1 264 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8303 2 260 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8264 1 264 3.20.20.140
2ffiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8099 2 266 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V7CJM0-F1-model_v4 Amidohydrolase 0.9938 1 267 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V7CQG8-F1-model_v4 Amidohydrolase 0.9924 1 264 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V7CJM0-F1-model_v4 Amidohydrolase 0.9901 1 267 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V6SQI5-F1-model_v4 Amidohydrolase 0.9871 174 265 GO:0016787
AF-A0A2V7I645-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9826 1 264 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.84 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map