F486738
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 956 | 335 | 947 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100010646|Ga0068858_1000106468 |
| Length | 325 |
| Sequence | VDPHHIVPEKAHGTRDHLADGPRRRQWKGLTRGIQDGLQRRRYTTRGEHAMQIVDAQIHLWGSGLPSNRAHRQVTAFPTKEAVGLMDAGGVDAAVIHPPGWDPGATAMAFAAVRDYPGRFAIMGALPLDRPESRALVANWRSQPGMLGLRYGFLQEPLRGWLEDGTLDWLWAAAERAGVPIAMLATDSLPAIGRIAARYPGLRLTIDHLGGRGGNTTLKDAAAMTHIPALLALAQYPNVAVKATGVPGYSSEAYPFPMMQTFVRQIYDAFGPQRLFWGTDITKMPCSWRQCVTMFTEELPWLSELDKALIMGQALCAWWGWDRPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 230 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 236 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 237 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 238 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 239 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 240 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 241 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 242 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 243 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 333 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.05 |
| Nodule | 0 |
| Rhizoplane | 1.67 |
| Rhizosphere | 94.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10171061 | 3300005295 | Bacteria | 1484 |
| 2 | Ga0070676_10000139 | 3300005328 | Bacteria | 28144 |
| 3 | Ga0070676_10010241 | 3300005328 | Bacteria | 5085 |
| 4 | Ga0070683_100031139 | 3300005329 | Bacteria | 4848 |
| 5 | Ga0070683_100216685 | 3300005329 | Bacteria | 1819 |
| 6 | Ga0070690_100108173 | 3300005330 | Bacteria | 1852 |
| 7 | Ga0070690_100119716 | 3300005330 | Unclassified | 1766 |
| 8 | Ga0070670_100009863 | 3300005331 | Bacteria | 8154 |
| 9 | Ga0068869_100008319 | 3300005334 | Bacteria | 6685 |
| 10 | Ga0068869_100040060 | 3300005334 | Bacteria | 3348 |
| 11 | Ga0070680_100015720 | 3300005336 | Bacteria | 5941 |
| 12 | Ga0070680_100018671 | 3300005336 | Bacteria | 5484 |
| 13 | Ga0070680_100046099 | 3300005336 | Unclassified | 3545 |
| 14 | Ga0070680_100072225 | 3300005336 | Bacteria | 2836 |
| 15 | Ga0070682_100002778 | 3300005337 | Bacteria | 9697 |
| 16 | Ga0070682_100031718 | 3300005337 | Bacteria | 3197 |
| 17 | Ga0068868_100058978 | 3300005338 | Bacteria | 3035 |
| 18 | Ga0068868_100560568 | 3300005338 | Bacteria | 1008 |
| 19 | Ga0070660_100003858 | 3300005339 | Bacteria | 10349 |
| 20 | Ga0070660_100009836 | 3300005339 | Bacteria | 6743 |
| 21 | Ga0070689_100014713 | 3300005340 | Bacteria | 5691 |
| 22 | Ga0070691_10006870 | 3300005341 | Bacteria | 5204 |
| 23 | Ga0070691_10048273 | 3300005341 | Unclassified | 2025 |
| 24 | Ga0070661_100002434 | 3300005344 | Bacteria | 12784 |
| 25 | Ga0070661_100003154 | 3300005344 | Bacteria | 11345 |
| 26 | Ga0070692_10000852 | 3300005345 | Bacteria | 10285 |
| 27 | Ga0070692_10038767 | 3300005345 | Bacteria | 2430 |
| 28 | Ga0070668_100111303 | 3300005347 | Bacteria | 2179 |
| 29 | Ga0070668_100237243 | 3300005347 | Bacteria | 1509 |
| 30 | Ga0070668_100238987 | 3300005347 | Bacteria | 1504 |
| 31 | Ga0070669_100018188 | 3300005353 | Bacteria | 5020 |
| 32 | Ga0070669_100047314 | 3300005353 | Bacteria | 3138 |
| 33 | Ga0070669_100132882 | 3300005353 | Unclassified | 1911 |
| 34 | Ga0070669_100219121 | 3300005353 | Bacteria | 1504 |
| 35 | Ga0070671_100028581 | 3300005355 | Bacteria | 4592 |
| 36 | Ga0070671_100335524 | 3300005355 | Bacteria | 1289 |
| 37 | Ga0070671_100353110 | 3300005355 | Bacteria | 1255 |
| 38 | Ga0070673_100089595 | 3300005364 | Bacteria | 2511 |
| 39 | Ga0070659_100000845 | 3300005366 | Bacteria | 22350 |
| 40 | Ga0070659_100004245 | 3300005366 | Bacteria | 10230 |
| 41 | Ga0070703_10012015 | 3300005406 | Bacteria | 2450 |
| 42 | Ga0070703_10015958 | 3300005406 | Unclassified | 2152 |
| 43 | Ga0070709_10044346 | 3300005434 | Bacteria | 2753 |
| 44 | Ga0070709_10056477 | 3300005434 | Unclassified | 2482 |
| 45 | Ga0070709_10174078 | 3300005434 | Bacteria | 1506 |
| 46 | Ga0070714_100046847 | 3300005435 | Bacteria | 3670 |
| 47 | Ga0070714_100084675 | 3300005435 | Bacteria | 2767 |
| 48 | Ga0070714_100598110 | 3300005435 | Unclassified | 1059 |
| 49 | Ga0070713_100215916 | 3300005436 | Bacteria | 1738 |
| 50 | Ga0070713_100410993 | 3300005436 | Bacteria | 1265 |
| 51 | Ga0070710_10008505 | 3300005437 | Bacteria | 4996 |
| 52 | Ga0070710_10220804 | 3300005437 | Bacteria | 1206 |
| 53 | Ga0070711_100025659 | 3300005439 | Bacteria | 3857 |
| 54 | Ga0070711_100099749 | 3300005439 | Bacteria | 2111 |
| 55 | Ga0070705_100007634 | 3300005440 | Bacteria | 5333 |
| 56 | Ga0070705_100035136 | 3300005440 | Bacteria | 2807 |
| 57 | Ga0070705_100089981 | 3300005440 | Unclassified | 1909 |
| 58 | Ga0070705_100112138 | 3300005440 | Bacteria | 1745 |
| 59 | Ga0070700_100003634 | 3300005441 | Bacteria | 7980 |
| 60 | Ga0070694_100007032 | 3300005444 | Bacteria | 6846 |
| 61 | Ga0070694_100008535 | 3300005444 | Bacteria | 6270 |
| 62 | Ga0070694_100019525 | 3300005444 | Bacteria | 4311 |
| 63 | Ga0070694_100068033 | 3300005444 | Bacteria | 2447 |
| 64 | Ga0070694_100070908 | 3300005444 | Unclassified | 2400 |
| 65 | Ga0070694_100090621 | 3300005444 | Bacteria | 2144 |
| 66 | Ga0070708_100041368 | 3300005445 | Bacteria | 4040 |
| 67 | Ga0070708_100087120 | 3300005445 | Bacteria | 2837 |
| 68 | Ga0070708_100216269 | 3300005445 | Unclassified | 1796 |
| 69 | Ga0070708_100392260 | 3300005445 | Unclassified | 1309 |
| 70 | Ga0070708_100454447 | 3300005445 | Bacteria | 1208 |
| 71 | Ga0070708_100520776 | 3300005445 | Bacteria | 1122 |
| 72 | Ga0070708_100650257 | 3300005445 | Bacteria | 993 |
| 73 | Ga0070663_100002361 | 3300005455 | Bacteria | 10617 |
| 74 | Ga0070663_100051009 | 3300005455 | Bacteria | 2945 |
| 75 | Ga0070678_100178491 | 3300005456 | Bacteria | 1736 |
| 76 | Ga0070662_100006420 | 3300005457 | Bacteria | 7579 |
| 77 | Ga0070681_10069882 | 3300005458 | Bacteria | 3477 |
| 78 | Ga0070681_10107718 | 3300005458 | Bacteria | 2727 |
| 79 | Ga0070681_10200719 | 3300005458 | Bacteria | 1912 |
| 80 | Ga0070681_10360246 | 3300005458 | Bacteria | 1365 |
| 81 | Ga0070681_10398905 | 3300005458 | Unclassified | 1287 |
| 82 | Ga0068867_100002041 | 3300005459 | Bacteria | 14136 |
| 83 | Ga0068867_100218259 | 3300005459 | Bacteria | 1535 |
| 84 | Ga0070706_100035549 | 3300005467 | Bacteria | 4601 |
| 85 | Ga0070706_100046033 | 3300005467 | Bacteria | 4027 |
| 86 | Ga0070706_100064868 | 3300005467 | Bacteria | 3376 |
| 87 | Ga0070706_100109729 | 3300005467 | Unclassified | 2567 |
| 88 | Ga0070706_100125561 | 3300005467 | Bacteria | 2392 |
| 89 | Ga0070706_100137790 | 3300005467 | Bacteria | 2277 |
| 90 | Ga0070706_100217239 | 3300005467 | Bacteria | 1785 |
| 91 | Ga0070706_100339977 | 3300005467 | Bacteria | 1399 |
| 92 | Ga0070706_100385173 | 3300005467 | Bacteria | 1305 |
| 93 | Ga0070706_100515253 | 3300005467 | Bacteria | 1112 |
| 94 | Ga0070707_100024547 | 3300005468 | Bacteria | 5711 |
| 95 | Ga0070707_100028956 | 3300005468 | Bacteria | 5272 |
| 96 | Ga0070707_100032796 | 3300005468 | Bacteria | 4948 |
| 97 | Ga0070707_100108925 | 3300005468 | Bacteria | 2686 |
| 98 | Ga0070707_100134242 | 3300005468 | Bacteria | 2407 |
| 99 | Ga0070707_100164163 | 3300005468 | Bacteria | 2164 |
| 100 | Ga0070707_100254299 | 3300005468 | Bacteria | 1709 |
| 101 | Ga0070707_100312867 | 3300005468 | Bacteria | 1526 |
| 102 | Ga0070707_100427788 | 3300005468 | Bacteria | 1284 |
| 103 | Ga0070707_100438053 | 3300005468 | Bacteria | 1267 |
| 104 | Ga0070698_100019850 | 3300005471 | Bacteria | 7049 |
| 105 | Ga0070698_100322916 | 3300005471 | Unclassified | 1474 |
| 106 | Ga0070698_100386797 | 3300005471 | Bacteria | 1332 |
| 107 | Ga0070698_100468672 | 3300005471 | Bacteria | 1196 |
| 108 | Ga0070698_100518920 | 3300005471 | Bacteria | 1130 |
| 109 | Ga0070699_100002124 | 3300005518 | Bacteria | 17975 |
| 110 | Ga0070699_100020265 | 3300005518 | Bacteria | 5733 |
| 111 | Ga0070699_100021823 | 3300005518 | Bacteria | 5519 |
| 112 | Ga0070699_100028026 | 3300005518 | Bacteria | 4857 |
| 113 | Ga0070699_100049292 | 3300005518 | Bacteria | 3645 |
| 114 | Ga0070699_100056610 | 3300005518 | Bacteria | 3396 |
| 115 | Ga0070699_100248333 | 3300005518 | Bacteria | 1589 |
| 116 | Ga0070699_100512462 | 3300005518 | Unclassified | 1090 |
| 117 | Ga0070679_100001475 | 3300005530 | Bacteria | 20865 |
| 118 | Ga0070679_100044379 | 3300005530 | Bacteria | 4428 |
| 119 | Ga0070679_100055490 | 3300005530 | Bacteria | 3944 |
| 120 | Ga0070679_100140190 | 3300005530 | Bacteria | 2398 |
| 121 | Ga0070679_100300361 | 3300005530 | Bacteria | 1556 |
| 122 | Ga0070684_100205850 | 3300005535 | Bacteria | 1793 |
| 123 | Ga0070684_100506100 | 3300005535 | Unclassified | 1119 |
| 124 | Ga0070697_100085500 | 3300005536 | Bacteria | 2602 |
| 125 | Ga0070697_100088887 | 3300005536 | Bacteria | 2552 |
| 126 | Ga0070697_100095053 | 3300005536 | Bacteria | 2470 |
| 127 | Ga0070697_100121894 | 3300005536 | Unclassified | 2181 |
| 128 | Ga0068853_100000232 | 3300005539 | Bacteria | 39364 |
| 129 | Ga0070672_100013035 | 3300005543 | Bacteria | 5859 |
| 130 | Ga0070672_100144616 | 3300005543 | Bacteria | 1964 |
| 131 | Ga0070686_100046147 | 3300005544 | Bacteria | 2748 |
| 132 | Ga0070686_100107972 | 3300005544 | Bacteria | 1891 |
| 133 | Ga0070695_100013796 | 3300005545 | Bacteria | 4860 |
| 134 | Ga0070695_100024657 | 3300005545 | Bacteria | 3708 |
| 135 | Ga0070695_100165669 | 3300005545 | Bacteria | 1555 |
| 136 | Ga0070695_100185619 | 3300005545 | Bacteria | 1476 |
| 137 | Ga0070696_100002075 | 3300005546 | Bacteria | 13151 |
| 138 | Ga0070696_100061462 | 3300005546 | Bacteria | 2628 |
| 139 | Ga0070696_100083525 | 3300005546 | Unclassified | 2265 |
| 140 | Ga0070693_100000028 | 3300005547 | Bacteria | 56126 |
| 141 | Ga0070693_100010662 | 3300005547 | Bacteria | 4608 |
| 142 | Ga0070693_100141331 | 3300005547 | Bacteria | 1516 |
| 143 | Ga0070704_100007578 | 3300005549 | Bacteria | 6468 |
| 144 | Ga0070704_100033340 | 3300005549 | Bacteria | 3481 |
| 145 | Ga0070704_100137386 | 3300005549 | Unclassified | 1903 |
| 146 | Ga0070704_100178648 | 3300005549 | Bacteria | 1696 |
| 147 | Ga0070704_100221121 | 3300005549 | Unclassified | 1540 |
| 148 | Ga0070704_100482713 | 3300005549 | Bacteria | 1073 |
| 149 | Ga0070704_100614379 | 3300005549 | Bacteria | 956 |
| 150 | Ga0068855_100001465 | 3300005563 | Bacteria | 29468 |
| 151 | Ga0068855_100001875 | 3300005563 | Bacteria | 26134 |
| 152 | Ga0070664_100021732 | 3300005564 | Bacteria | 5292 |
| 153 | Ga0070664_100036938 | 3300005564 | Bacteria | 4105 |
| 154 | Ga0070664_100219696 | 3300005564 | Bacteria | 1700 |
| 155 | Ga0068857_100038738 | 3300005577 | Bacteria | 4220 |
| 156 | Ga0068854_100050887 | 3300005578 | Bacteria | 2966 |
| 157 | Ga0068856_100001138 | 3300005614 | Bacteria | 27944 |
| 158 | Ga0068856_100044583 | 3300005614 | Bacteria | 4365 |
| 159 | Ga0068856_100522601 | 3300005614 | Bacteria | 1208 |
| 160 | Ga0070702_100031846 | 3300005615 | Unclassified | 2889 |
| 161 | Ga0068859_100023978 | 3300005617 | Bacteria | 6123 |
| 162 | Ga0068859_100042516 | 3300005617 | Bacteria | 4565 |
| 163 | Ga0068859_100107528 | 3300005617 | Bacteria | 2850 |
| 164 | Ga0068859_100149416 | 3300005617 | Bacteria | 2412 |
| 165 | Ga0068859_100232191 | 3300005617 | Unclassified | 1933 |
| 166 | Ga0068859_100251400 | 3300005617 | Bacteria | 1858 |
| 167 | Ga0068859_100284162 | 3300005617 | Unclassified | 1747 |
| 168 | Ga0068864_100045652 | 3300005618 | Bacteria | 3758 |
| 169 | Ga0068864_100049049 | 3300005618 | Bacteria | 3631 |
| 170 | Ga0068864_100799731 | 3300005618 | Bacteria | 927 |
| 171 | Ga0068861_100003774 | 3300005719 | Bacteria | 10114 |
| 172 | Ga0068861_100113019 | 3300005719 | Unclassified | 2178 |
| 173 | Ga0068861_100118513 | 3300005719 | Bacteria | 2132 |
| 174 | Ga0068861_100568862 | 3300005719 | Bacteria | 1035 |
| 175 | Ga0068870_10000446 | 3300005840 | Bacteria | 15641 |
| 176 | Ga0068863_100032204 | 3300005841 | Bacteria | 4997 |
| 177 | Ga0068863_100088941 | 3300005841 | Unclassified | 2927 |
| 178 | Ga0068863_100094075 | 3300005841 | Unclassified | 2844 |
| 179 | Ga0068863_100152931 | 3300005841 | Bacteria | 2208 |
| 180 | Ga0068863_100302880 | 3300005841 | Unclassified | 1551 |
| 181 | Ga0068858_100010646 | 3300005842 | Bacteria | 8702 |
| 182 | Ga0068858_100144238 | 3300005842 | Bacteria | 2236 |
| 183 | Ga0068858_100220348 | 3300005842 | Bacteria | 1797 |
| 184 | Ga0068860_100029232 | 3300005843 | Bacteria | 5300 |
| 185 | Ga0068860_100030891 | 3300005843 | Bacteria | 5150 |
| 186 | Ga0068860_100036157 | 3300005843 | Bacteria | 4734 |
| 187 | Ga0068860_100080148 | 3300005843 | Bacteria | 3105 |
| 188 | Ga0068860_100098090 | 3300005843 | Bacteria | 2794 |
| 189 | Ga0068860_100098138 | 3300005843 | Unclassified | 2794 |
| 190 | Ga0068860_100166466 | 3300005843 | Bacteria | 2128 |
| 191 | Ga0068860_100402964 | 3300005843 | Bacteria | 1353 |
| 192 | Ga0068862_100022721 | 3300005844 | Bacteria | 5248 |
| 193 | Ga0068862_100052686 | 3300005844 | Bacteria | 3482 |
| 194 | Ga0068862_100334577 | 3300005844 | Bacteria | 1401 |
| 195 | Ga0068862_100407809 | 3300005844 | Bacteria | 1273 |
| 196 | Ga0068862_100580697 | 3300005844 | Bacteria | 1074 |
| 197 | Ga0081455_10000824 | 3300005937 | Bacteria | 39882 |
| 198 | Ga0081455_10067439 | 3300005937 | Bacteria | 2982 |
| 199 | Ga0081538_10006853 | 3300005981 | Bacteria | 9923 |
| 200 | Ga0081538_10148360 | 3300005981 | Unclassified | 1067 |
| 201 | Ga0081540_1009575 | 3300005983 | Bacteria | 6667 |
| 202 | Ga0081540_1011768 | 3300005983 | Bacteria | 5820 |
| 203 | Ga0081540_1013000 | 3300005983 | Bacteria | 5437 |
| 204 | Ga0081540_1018443 | 3300005983 | Bacteria | 4279 |
| 205 | Ga0081540_1019705 | 3300005983 | Bacteria | 4086 |
| 206 | Ga0081540_1035896 | 3300005983 | Bacteria | 2652 |
| 207 | Ga0081539_10000021 | 3300005985 | Bacteria | 360643 |
| 208 | Ga0081539_10031167 | 3300005985 | Bacteria | 3293 |
| 209 | Ga0070717_10000606 | 3300006028 | Bacteria | 22984 |
| 210 | Ga0070717_10043316 | 3300006028 | Bacteria | 3674 |
| 211 | Ga0070717_10158959 | 3300006028 | Bacteria | 1959 |
| 212 | Ga0075365_10003905 | 3300006038 | Bacteria | 7805 |
| 213 | Ga0075363_100027866 | 3300006048 | Bacteria | 2901 |
| 214 | Ga0075364_10087479 | 3300006051 | Bacteria | 2065 |
| 215 | Ga0075432_10049483 | 3300006058 | Bacteria | 1481 |
| 216 | Ga0070716_100015635 | 3300006173 | Bacteria | 3903 |
| 217 | Ga0070712_100043204 | 3300006175 | Bacteria | 3102 |
| 218 | Ga0070712_100055130 | 3300006175 | Unclassified | 2782 |
| 219 | Ga0075362_10040143 | 3300006177 | Bacteria | 2059 |
| 220 | Ga0075367_10003112 | 3300006178 | Bacteria | 7803 |
| 221 | Ga0075369_10002094 | 3300006186 | Bacteria | 7042 |
| 222 | Ga0075428_100000103 | 3300006844 | Bacteria | 71205 |
| 223 | Ga0075428_100001389 | 3300006844 | Bacteria | 25742 |
| 224 | Ga0075428_100003715 | 3300006844 | Bacteria | 16725 |
| 225 | Ga0075428_100021808 | 3300006844 | Bacteria | 7092 |
| 226 | Ga0075428_100032038 | 3300006844 | Bacteria | 5807 |
| 227 | Ga0075428_100048068 | 3300006844 | Bacteria | 4684 |
| 228 | Ga0075428_100146503 | 3300006844 | Bacteria | 2566 |
| 229 | Ga0075428_100163361 | 3300006844 | Bacteria | 2416 |
| 230 | Ga0075428_100210594 | 3300006844 | Bacteria | 2100 |
| 231 | Ga0075428_100272958 | 3300006844 | Bacteria | 1819 |
| 232 | Ga0075428_100284701 | 3300006844 | Bacteria | 1778 |
| 233 | Ga0075428_100362548 | 3300006844 | Bacteria | 1554 |
| 234 | Ga0075428_100472058 | 3300006844 | Bacteria | 1343 |
| 235 | Ga0075428_100531309 | 3300006844 | Unclassified | 1258 |
| 236 | Ga0075430_100000499 | 3300006846 | Bacteria | 29432 |
| 237 | Ga0075430_100001172 | 3300006846 | Bacteria | 20997 |
| 238 | Ga0075430_100002301 | 3300006846 | Bacteria | 15849 |
| 239 | Ga0075430_100008431 | 3300006846 | Bacteria | 8708 |
| 240 | Ga0075430_100023489 | 3300006846 | Bacteria | 5249 |
| 241 | Ga0075430_100068371 | 3300006846 | Bacteria | 2980 |
| 242 | Ga0075430_100334713 | 3300006846 | Unclassified | 1251 |
| 243 | Ga0075431_100000226 | 3300006847 | Bacteria | 42242 |
| 244 | Ga0075431_100002712 | 3300006847 | Bacteria | 17168 |
| 245 | Ga0075431_100008045 | 3300006847 | Bacteria | 10521 |
| 246 | Ga0075431_100029890 | 3300006847 | Bacteria | 5609 |
| 247 | Ga0075431_100061131 | 3300006847 | Bacteria | 3887 |
| 248 | Ga0075431_100087432 | 3300006847 | Bacteria | 3216 |
| 249 | Ga0075431_100093911 | 3300006847 | Bacteria | 3096 |
| 250 | Ga0075431_100114244 | 3300006847 | Unclassified | 2787 |
| 251 | Ga0075431_100161077 | 3300006847 | Unclassified | 2307 |
| 252 | Ga0075431_100310306 | 3300006847 | Unclassified | 1592 |
| 253 | Ga0075431_100324704 | 3300006847 | Bacteria | 1551 |
| 254 | Ga0075431_100396183 | 3300006847 | Bacteria | 1382 |
| 255 | Ga0075433_10001404 | 3300006852 | Bacteria | 17758 |
| 256 | Ga0075433_10028008 | 3300006852 | Bacteria | 4786 |
| 257 | Ga0075433_10036047 | 3300006852 | Bacteria | 4258 |
| 258 | Ga0075433_10037587 | 3300006852 | Unclassified | 4177 |
| 259 | Ga0075433_10055198 | 3300006852 | Bacteria | 3467 |
| 260 | Ga0075433_10063716 | 3300006852 | Bacteria | 3230 |
| 261 | Ga0075433_10067526 | 3300006852 | Bacteria | 3138 |
| 262 | Ga0075433_10246277 | 3300006852 | Bacteria | 1586 |
| 263 | Ga0075433_10259549 | 3300006852 | Unclassified | 1541 |
| 264 | Ga0075433_10379228 | 3300006852 | Bacteria | 1248 |
| 265 | Ga0075434_100013019 | 3300006871 | Bacteria | 7899 |
| 266 | Ga0075434_100013803 | 3300006871 | Bacteria | 7703 |
| 267 | Ga0075434_100037372 | 3300006871 | Bacteria | 4807 |
| 268 | Ga0075434_100071271 | 3300006871 | Bacteria | 3467 |
| 269 | Ga0075434_100085679 | 3300006871 | Bacteria | 3150 |
| 270 | Ga0075434_100097029 | 3300006871 | Bacteria | 2952 |
| 271 | Ga0075434_100205158 | 3300006871 | Unclassified | 1991 |
| 272 | Ga0075434_100261864 | 3300006871 | Bacteria | 1748 |
| 273 | Ga0075434_100519922 | 3300006871 | Bacteria | 1210 |
| 274 | Ga0075434_100565560 | 3300006871 | Unclassified | 1156 |
| 275 | Ga0075429_100007420 | 3300006880 | Bacteria | 9515 |
| 276 | Ga0075429_100019832 | 3300006880 | Bacteria | 5830 |
| 277 | Ga0075429_100021867 | 3300006880 | Bacteria | 5544 |
| 278 | Ga0075429_100023371 | 3300006880 | Bacteria | 5364 |
| 279 | Ga0075429_100039897 | 3300006880 | Bacteria | 4085 |
| 280 | Ga0075429_100047238 | 3300006880 | Bacteria | 3745 |
| 281 | Ga0075429_100056275 | 3300006880 | Bacteria | 3423 |
| 282 | Ga0075429_100249176 | 3300006880 | Unclassified | 1555 |
| 283 | Ga0075429_100304858 | 3300006880 | Bacteria | 1394 |
| 284 | Ga0075429_100324454 | 3300006880 | Bacteria | 1347 |
| 285 | Ga0068865_100057926 | 3300006881 | Bacteria | 2704 |
| 286 | Ga0068865_100490423 | 3300006881 | Bacteria | 1023 |
| 287 | Ga0075436_100001877 | 3300006914 | Bacteria | 14439 |
| 288 | Ga0075436_100015732 | 3300006914 | Bacteria | 5179 |
| 289 | Ga0075436_100030743 | 3300006914 | Bacteria | 3696 |
| 290 | Ga0075436_100198765 | 3300006914 | Bacteria | 1419 |
| 291 | Ga0075436_100256477 | 3300006914 | Bacteria | 1246 |
| 292 | Ga0097620_100023979 | 3300006931 | Bacteria | 6123 |
| 293 | Ga0097620_100042510 | 3300006931 | Bacteria | 4565 |
| 294 | Ga0097620_100107527 | 3300006931 | Bacteria | 2850 |
| 295 | Ga0097620_100149416 | 3300006931 | Bacteria | 2412 |
| 296 | Ga0097620_100232183 | 3300006931 | Unclassified | 1933 |
| 297 | Ga0097620_100251393 | 3300006931 | Bacteria | 1858 |
| 298 | Ga0097620_100284149 | 3300006931 | Unclassified | 1747 |
| 299 | Ga0075435_100019967 | 3300007076 | Bacteria | 5122 |
| 300 | Ga0075435_100062156 | 3300007076 | Bacteria | 3030 |
| 301 | Ga0075435_100081720 | 3300007076 | Bacteria | 2654 |
| 302 | Ga0075435_100225542 | 3300007076 | Unclassified | 1591 |
| 303 | Ga0075435_100232970 | 3300007076 | Bacteria | 1565 |
| 304 | Ga0099794_10003016 | 3300007265 | Bacteria | 6362 |
| 305 | Ga0099794_10013628 | 3300007265 | Bacteria | 3543 |
| 306 | Ga0099795_10005301 | 3300007788 | Bacteria | 3414 |
| 307 | Ga0099795_10009925 | 3300007788 | Bacteria | 2781 |
| 308 | Ga0105240_10360659 | 3300009093 | Bacteria | 1646 |
| 309 | Ga0105240_10526218 | 3300009093 | Bacteria | 1311 |
| 310 | Ga0111539_10000098 | 3300009094 | Bacteria | 91568 |
| 311 | Ga0111539_10000527 | 3300009094 | Bacteria | 48473 |
| 312 | Ga0111539_10002606 | 3300009094 | Bacteria | 23897 |
| 313 | Ga0111539_10006099 | 3300009094 | Bacteria | 15559 |
| 314 | Ga0111539_10015171 | 3300009094 | Bacteria | 9600 |
| 315 | Ga0111539_10039864 | 3300009094 | Bacteria | 5657 |
| 316 | Ga0111539_10050168 | 3300009094 | Bacteria | 4972 |
| 317 | Ga0111539_10060175 | 3300009094 | Bacteria | 4501 |
| 318 | Ga0111539_10060886 | 3300009094 | Bacteria | 4473 |
| 319 | Ga0111539_10074985 | 3300009094 | Bacteria | 3986 |
| 320 | Ga0111539_10163362 | 3300009094 | Bacteria | 2604 |
| 321 | Ga0111539_10204378 | 3300009094 | Bacteria | 2303 |
| 322 | Ga0111539_10776358 | 3300009094 | Unclassified | 1115 |
| 323 | Ga0105247_10033597 | 3300009101 | Bacteria | 3120 |
| 324 | Ga0114129_10005514 | 3300009147 | Bacteria | 17895 |
| 325 | Ga0114129_10016188 | 3300009147 | Bacteria | 10612 |
| 326 | Ga0114129_10021159 | 3300009147 | Bacteria | 9237 |
| 327 | Ga0114129_10108451 | 3300009147 | Bacteria | 3833 |
| 328 | Ga0114129_10125258 | 3300009147 | Bacteria | 3533 |
| 329 | Ga0114129_10129442 | 3300009147 | Bacteria | 3469 |
| 330 | Ga0114129_10208330 | 3300009147 | Bacteria | 2645 |
| 331 | Ga0114129_10221888 | 3300009147 | Unclassified | 2549 |
| 332 | Ga0114129_10222938 | 3300009147 | Bacteria | 2543 |
| 333 | Ga0114129_10228188 | 3300009147 | Bacteria | 2509 |
| 334 | Ga0114129_10286869 | 3300009147 | Bacteria | 2198 |
| 335 | Ga0114129_10406786 | 3300009147 | Bacteria | 1793 |
| 336 | Ga0114129_10427732 | 3300009147 | Unclassified | 1740 |
| 337 | Ga0114129_10524625 | 3300009147 | Bacteria | 1544 |
| 338 | Ga0114129_10587358 | 3300009147 | Bacteria | 1445 |
| 339 | Ga0105243_10075714 | 3300009148 | Unclassified | 2732 |
| 340 | Ga0105243_10097265 | 3300009148 | Bacteria | 2436 |
| 341 | Ga0105243_10203983 | 3300009148 | Bacteria | 1736 |
| 342 | Ga0105241_10000273 | 3300009174 | Bacteria | 38438 |
| 343 | Ga0105241_10010697 | 3300009174 | Bacteria | 6733 |
| 344 | Ga0105241_10026978 | 3300009174 | Bacteria | 4275 |
| 345 | Ga0105241_10035951 | 3300009174 | Bacteria | 3727 |
| 346 | Ga0105242_10152176 | 3300009176 | Bacteria | 2018 |
| 347 | Ga0105248_10287617 | 3300009177 | Bacteria | 1851 |
| 348 | Ga0105249_10276401 | 3300009553 | Bacteria | 1675 |
| 349 | Ga0105249_10421587 | 3300009553 | Bacteria | 1368 |
| 350 | Ga0105249_10438533 | 3300009553 | Bacteria | 1343 |
| 351 | Ga0105249_10660940 | 3300009553 | Bacteria | 1103 |
| 352 | Ga0099796_10117199 | 3300010159 | Bacteria | 1020 |
| 353 | Ga0099796_10124771 | 3300010159 | Bacteria | 993 |
| 354 | Ga0105239_10221860 | 3300010375 | Bacteria | 2120 |
| 355 | Ga0105246_10030220 | 3300011119 | Unclassified | 3576 |
| 356 | Ga0105246_10032792 | 3300011119 | Bacteria | 3447 |
| 357 | Ga0157373_10000408 | 3300013100 | Bacteria | 34529 |
| 358 | Ga0157373_10146911 | 3300013100 | Bacteria | 1658 |
| 359 | Ga0157373_10250968 | 3300013100 | Bacteria | 1251 |
| 360 | Ga0157371_10375909 | 3300013102 | Bacteria | 1037 |
| 361 | Ga0157370_10067301 | 3300013104 | Bacteria | 3386 |
| 362 | Ga0157374_10257913 | 3300013296 | Bacteria | 1717 |
| 363 | Ga0157378_10092775 | 3300013297 | Bacteria | 2747 |
| 364 | Ga0157378_10250837 | 3300013297 | Unclassified | 1694 |
| 365 | Ga0163162_10020700 | 3300013306 | Bacteria | 6465 |
| 366 | Ga0163162_10436605 | 3300013306 | Bacteria | 1441 |
| 367 | Ga0157372_10000612 | 3300013307 | Bacteria | 39043 |
| 368 | Ga0157372_10000827 | 3300013307 | Bacteria | 33525 |
| 369 | Ga0157372_10178659 | 3300013307 | Bacteria | 2457 |
| 370 | Ga0157375_10114421 | 3300013308 | Bacteria | 2800 |
| 371 | Ga0157375_10241638 | 3300013308 | Unclassified | 1965 |
| 372 | Ga0157375_10245732 | 3300013308 | Bacteria | 1950 |
| 373 | Ga0157375_10259767 | 3300013308 | Bacteria | 1898 |
| 374 | Ga0157375_10593522 | 3300013308 | Bacteria | 1267 |
| 375 | Ga0163163_10022085 | 3300014325 | Bacteria | 6019 |
| 376 | Ga0163163_10033352 | 3300014325 | Bacteria | 4980 |
| 377 | Ga0163163_10089171 | 3300014325 | Bacteria | 3096 |
| 378 | Ga0157380_10420654 | 3300014326 | Bacteria | 1274 |
| 379 | Ga0157380_10442423 | 3300014326 | Bacteria | 1246 |
| 380 | Ga0182008_10042430 | 3300014497 | Bacteria | 2266 |
| 381 | Ga0182008_10047793 | 3300014497 | Bacteria | 2126 |
| 382 | Ga0182008_10055650 | 3300014497 | Bacteria | 1956 |
| 383 | Ga0182008_10199216 | 3300014497 | Bacteria | 1018 |
| 384 | Ga0157379_10000856 | 3300014968 | Bacteria | 24672 |
| 385 | Ga0157379_10007151 | 3300014968 | Bacteria | 9653 |
| 386 | Ga0157379_10266603 | 3300014968 | Unclassified | 1557 |
| 387 | Ga0157379_10378844 | 3300014968 | Unclassified | 1298 |
| 388 | Ga0157379_10442055 | 3300014968 | Bacteria | 1199 |
| 389 | Ga0157376_10360015 | 3300014969 | Bacteria | 1395 |
| 390 | Ga0157376_10807938 | 3300014969 | Bacteria | 951 |
| 391 | Ga0182007_10018621 | 3300015262 | Bacteria | 2512 |
| 392 | Ga0163161_10169085 | 3300017792 | Bacteria | 1670 |
| 393 | Ga0213875_10000844 | 3300021388 | Bacteria | 22655 |
| 394 | Ga0213875_10002430 | 3300021388 | Bacteria | 11154 |
| 395 | Ga0213875_10024186 | 3300021388 | Bacteria | 2898 |
| 396 | Ga0213875_10029477 | 3300021388 | Bacteria | 2603 |
| 397 | Ga0228598_1011879 | 3300024227 | Bacteria | 1732 |
| 398 | Ga0207697_10096648 | 3300025315 | Bacteria | 1256 |
| 399 | Ga0207653_10000704 | 3300025885 | Bacteria | 11470 |
| 400 | Ga0207642_10064976 | 3300025899 | Unclassified | 1712 |
| 401 | Ga0207710_10034098 | 3300025900 | Unclassified | 2235 |
| 402 | Ga0207688_10008445 | 3300025901 | Bacteria | 5602 |
| 403 | Ga0207688_10142830 | 3300025901 | Bacteria | 1410 |
| 404 | Ga0207680_10075290 | 3300025903 | Bacteria | 2105 |
| 405 | Ga0207647_10026791 | 3300025904 | Bacteria | 3766 |
| 406 | Ga0207645_10003491 | 3300025907 | Bacteria | 11902 |
| 407 | Ga0207645_10145964 | 3300025907 | Unclassified | 1542 |
| 408 | Ga0207643_10001164 | 3300025908 | Bacteria | 15631 |
| 409 | Ga0207643_10012683 | 3300025908 | Bacteria | 4554 |
| 410 | Ga0207684_10008329 | 3300025910 | Bacteria | 9218 |
| 411 | Ga0207684_10031376 | 3300025910 | Bacteria | 4520 |
| 412 | Ga0207684_10048374 | 3300025910 | Bacteria | 3607 |
| 413 | Ga0207684_10058899 | 3300025910 | Bacteria | 3260 |
| 414 | Ga0207684_10128648 | 3300025910 | Bacteria | 2174 |
| 415 | Ga0207684_10182167 | 3300025910 | Bacteria | 1811 |
| 416 | Ga0207684_10251054 | 3300025910 | Unclassified | 1526 |
| 417 | Ga0207684_10252269 | 3300025910 | Unclassified | 1522 |
| 418 | Ga0207684_10315369 | 3300025910 | Unclassified | 1348 |
| 419 | Ga0207684_10432671 | 3300025910 | Bacteria | 1130 |
| 420 | Ga0207684_10571499 | 3300025910 | Unclassified | 967 |
| 421 | Ga0207654_10000814 | 3300025911 | Bacteria | 17183 |
| 422 | Ga0207654_10010924 | 3300025911 | Bacteria | 4622 |
| 423 | Ga0207707_10000170 | 3300025912 | Bacteria | 68142 |
| 424 | Ga0207707_10000198 | 3300025912 | Bacteria | 63730 |
| 425 | Ga0207707_10101457 | 3300025912 | Bacteria | 2515 |
| 426 | Ga0207707_10119265 | 3300025912 | Bacteria | 2306 |
| 427 | Ga0207707_10158782 | 3300025912 | Bacteria | 1977 |
| 428 | Ga0207695_10440586 | 3300025913 | Bacteria | 1186 |
| 429 | Ga0207693_10014693 | 3300025915 | Bacteria | 6290 |
| 430 | Ga0207693_10019858 | 3300025915 | Bacteria | 5344 |
| 431 | Ga0207693_10027641 | 3300025915 | Bacteria | 4484 |
| 432 | Ga0207693_10030564 | 3300025915 | Bacteria | 4255 |
| 433 | Ga0207693_10037494 | 3300025915 | Bacteria | 3821 |
| 434 | Ga0207693_10073922 | 3300025915 | Bacteria | 2668 |
| 435 | Ga0207693_10131210 | 3300025915 | Unclassified | 1970 |
| 436 | Ga0207693_10145600 | 3300025915 | Bacteria | 1863 |
| 437 | Ga0207663_10040687 | 3300025916 | Unclassified | 2827 |
| 438 | Ga0207663_10156875 | 3300025916 | Bacteria | 1602 |
| 439 | Ga0207660_10000236 | 3300025917 | Bacteria | 35775 |
| 440 | Ga0207660_10013858 | 3300025917 | Bacteria | 5290 |
| 441 | Ga0207660_10084372 | 3300025917 | Bacteria | 2341 |
| 442 | Ga0207657_10000113 | 3300025919 | Bacteria | 79650 |
| 443 | Ga0207657_10001106 | 3300025919 | Bacteria | 28608 |
| 444 | Ga0207649_10004063 | 3300025920 | Bacteria | 7965 |
| 445 | Ga0207649_10014769 | 3300025920 | Bacteria | 4379 |
| 446 | Ga0207652_10000284 | 3300025921 | Bacteria | 52907 |
| 447 | Ga0207652_10004264 | 3300025921 | Bacteria | 11671 |
| 448 | Ga0207646_10049331 | 3300025922 | Bacteria | 3771 |
| 449 | Ga0207646_10055267 | 3300025922 | Bacteria | 3549 |
| 450 | Ga0207646_10063838 | 3300025922 | Bacteria | 3287 |
| 451 | Ga0207646_10075082 | 3300025922 | Bacteria | 3020 |
| 452 | Ga0207646_10095143 | 3300025922 | Bacteria | 2668 |
| 453 | Ga0207646_10361026 | 3300025922 | Bacteria | 1312 |
| 454 | Ga0207681_10143621 | 3300025923 | Bacteria | 1780 |
| 455 | Ga0207681_10172770 | 3300025923 | Bacteria | 1639 |
| 456 | Ga0207681_10236486 | 3300025923 | Bacteria | 1420 |
| 457 | Ga0207681_10300442 | 3300025923 | Bacteria | 1270 |
| 458 | Ga0207650_10020994 | 3300025925 | Bacteria | 4613 |
| 459 | Ga0207650_10024111 | 3300025925 | Bacteria | 4321 |
| 460 | Ga0207700_10027855 | 3300025928 | Bacteria | 3963 |
| 461 | Ga0207700_10056067 | 3300025928 | Bacteria | 2965 |
| 462 | Ga0207700_10130259 | 3300025928 | Bacteria | 2053 |
| 463 | Ga0207700_10205402 | 3300025928 | Bacteria | 1662 |
| 464 | Ga0207664_10036700 | 3300025929 | Bacteria | 3788 |
| 465 | Ga0207664_10093140 | 3300025929 | Bacteria | 2474 |
| 466 | Ga0207664_10125702 | 3300025929 | Bacteria | 2152 |
| 467 | Ga0207664_10452246 | 3300025929 | Bacteria | 1146 |
| 468 | Ga0207644_10231329 | 3300025931 | Unclassified | 1469 |
| 469 | Ga0207644_10398703 | 3300025931 | Bacteria | 1124 |
| 470 | Ga0207690_10002071 | 3300025932 | Bacteria | 12292 |
| 471 | Ga0207690_10022024 | 3300025932 | Bacteria | 3958 |
| 472 | Ga0207706_10000622 | 3300025933 | Bacteria | 37676 |
| 473 | Ga0207706_10023768 | 3300025933 | Bacteria | 5499 |
| 474 | Ga0207706_10097940 | 3300025933 | Bacteria | 2580 |
| 475 | Ga0207706_10153379 | 3300025933 | Bacteria | 2026 |
| 476 | Ga0207686_10052743 | 3300025934 | Bacteria | 2539 |
| 477 | Ga0207686_10228659 | 3300025934 | Bacteria | 1347 |
| 478 | Ga0207709_10109508 | 3300025935 | Bacteria | 1844 |
| 479 | Ga0207709_10118634 | 3300025935 | Bacteria | 1782 |
| 480 | Ga0207709_10182783 | 3300025935 | Unclassified | 1482 |
| 481 | Ga0207670_10009414 | 3300025936 | Bacteria | 5576 |
| 482 | Ga0207670_10022880 | 3300025936 | Bacteria | 3881 |
| 483 | Ga0207670_10211650 | 3300025936 | Bacteria | 1479 |
| 484 | Ga0207669_10215918 | 3300025937 | Bacteria | 1404 |
| 485 | Ga0207665_10019498 | 3300025939 | Bacteria | 4459 |
| 486 | Ga0207691_10030698 | 3300025940 | Bacteria | 5020 |
| 487 | Ga0207691_10074595 | 3300025940 | Bacteria | 3059 |
| 488 | Ga0207711_10092712 | 3300025941 | Bacteria | 2659 |
| 489 | Ga0207711_10221628 | 3300025941 | Unclassified | 1730 |
| 490 | Ga0207689_10000839 | 3300025942 | Bacteria | 29620 |
| 491 | Ga0207689_10027704 | 3300025942 | Bacteria | 4742 |
| 492 | Ga0207689_10084832 | 3300025942 | Bacteria | 2603 |
| 493 | Ga0207689_10095104 | 3300025942 | Bacteria | 2447 |
| 494 | Ga0207689_10192365 | 3300025942 | Bacteria | 1683 |
| 495 | Ga0207689_10372716 | 3300025942 | Bacteria | 1188 |
| 496 | Ga0207661_10518363 | 3300025944 | Bacteria | 1090 |
| 497 | Ga0207679_10000523 | 3300025945 | Bacteria | 25949 |
| 498 | Ga0207679_10001316 | 3300025945 | Bacteria | 15693 |
| 499 | Ga0207679_10048362 | 3300025945 | Bacteria | 3096 |
| 500 | Ga0207667_10014534 | 3300025949 | Bacteria | 8970 |
| 501 | Ga0207667_10100023 | 3300025949 | Bacteria | 2991 |
| 502 | Ga0207651_10022636 | 3300025960 | Bacteria | 3847 |
| 503 | Ga0207712_10265123 | 3300025961 | Unclassified | 1395 |
| 504 | Ga0207640_10069230 | 3300025981 | Bacteria | 2369 |
| 505 | Ga0207640_10086432 | 3300025981 | Bacteria | 2159 |
| 506 | Ga0207658_10203715 | 3300025986 | Bacteria | 1654 |
| 507 | Ga0207677_10425041 | 3300026023 | Bacteria | 1133 |
| 508 | Ga0207703_10006818 | 3300026035 | Bacteria | 9098 |
| 509 | Ga0207703_10243764 | 3300026035 | Bacteria | 1617 |
| 510 | Ga0207703_10581367 | 3300026035 | Bacteria | 1058 |
| 511 | Ga0207639_10026015 | 3300026041 | Bacteria | 4249 |
| 512 | Ga0207678_10002857 | 3300026067 | Bacteria | 15674 |
| 513 | Ga0207708_10014915 | 3300026075 | Bacteria | 5819 |
| 514 | Ga0207708_10054251 | 3300026075 | Bacteria | 3056 |
| 515 | Ga0207708_10176607 | 3300026075 | Bacteria | 1694 |
| 516 | Ga0207708_10232429 | 3300026075 | Bacteria | 1481 |
| 517 | Ga0207702_10000493 | 3300026078 | Bacteria | 44394 |
| 518 | Ga0207702_10006470 | 3300026078 | Bacteria | 10099 |
| 519 | Ga0207702_10211977 | 3300026078 | Bacteria | 1801 |
| 520 | Ga0207641_10100436 | 3300026088 | Unclassified | 2548 |
| 521 | Ga0207641_10272596 | 3300026088 | Bacteria | 1588 |
| 522 | Ga0207641_10322689 | 3300026088 | Bacteria | 1465 |
| 523 | Ga0207641_10641714 | 3300026088 | Bacteria | 1042 |
| 524 | Ga0207648_10004641 | 3300026089 | Bacteria | 14062 |
| 525 | Ga0207648_10063959 | 3300026089 | Bacteria | 3206 |
| 526 | Ga0207648_10077191 | 3300026089 | Bacteria | 2903 |
| 527 | Ga0207648_10279462 | 3300026089 | Bacteria | 1493 |
| 528 | Ga0207676_10015865 | 3300026095 | Bacteria | 5447 |
| 529 | Ga0207676_10091394 | 3300026095 | Bacteria | 2500 |
| 530 | Ga0207676_10599486 | 3300026095 | Bacteria | 1058 |
| 531 | Ga0207674_10000197 | 3300026116 | Bacteria | 74719 |
| 532 | Ga0207674_10001680 | 3300026116 | Bacteria | 28444 |
| 533 | Ga0207674_10072516 | 3300026116 | Bacteria | 3459 |
| 534 | Ga0207675_100014032 | 3300026118 | Bacteria | 7470 |
| 535 | Ga0207675_100367778 | 3300026118 | Bacteria | 1412 |
| 536 | Ga0207698_10647175 | 3300026142 | Bacteria | 1047 |
| 537 | Ga0209996_1000557 | 3300027395 | Bacteria | 4499 |
| 538 | Ga0209995_1006153 | 3300027471 | Bacteria | 1929 |
| 539 | Ga0209968_1000802 | 3300027526 | Bacteria | 4848 |
| 540 | Ga0209999_1009513 | 3300027543 | Bacteria | 1756 |
| 541 | Ga0209970_1030826 | 3300027614 | Bacteria | 931 |
| 542 | Ga0209983_1010399 | 3300027665 | Bacteria | 1901 |
| 543 | Ga0209588_1014131 | 3300027671 | Bacteria | 2442 |
| 544 | Ga0209971_1000574 | 3300027682 | Bacteria | 9605 |
| 545 | Ga0209966_1000416 | 3300027695 | Bacteria | 12351 |
| 546 | Ga0209998_10001841 | 3300027717 | Bacteria | 5028 |
| 547 | Ga0209974_10001363 | 3300027876 | Bacteria | 8803 |
| 548 | Ga0209974_10024653 | 3300027876 | Bacteria | 1990 |
| 549 | Ga0207428_10000341 | 3300027907 | Bacteria | 60709 |
| 550 | Ga0207428_10003164 | 3300027907 | Bacteria | 16129 |
| 551 | Ga0207428_10010024 | 3300027907 | Bacteria | 8479 |
| 552 | Ga0207428_10010492 | 3300027907 | Bacteria | 8270 |
| 553 | Ga0207428_10041238 | 3300027907 | Bacteria | 3738 |
| 554 | Ga0207428_10101501 | 3300027907 | Bacteria | 2223 |
| 555 | Ga0207428_10164161 | 3300027907 | Bacteria | 1685 |
| 556 | Ga0207428_10184064 | 3300027907 | Bacteria | 1577 |
| 557 | Ga0268266_10287547 | 3300028379 | Bacteria | 1530 |
| 558 | Ga0268265_10106556 | 3300028380 | Bacteria | 2277 |
| 559 | Ga0268265_10188039 | 3300028380 | Bacteria | 1781 |
| 560 | Ga0268265_10367717 | 3300028380 | Unclassified | 1319 |
| 561 | Ga0268265_10369773 | 3300028380 | Unclassified | 1315 |
| 562 | Ga0268264_10015033 | 3300028381 | Bacteria | 6350 |
| 563 | Ga0268264_10031539 | 3300028381 | Bacteria | 4344 |
| 564 | Ga0268264_10130543 | 3300028381 | Bacteria | 2226 |
| 565 | Ga0268264_10242771 | 3300028381 | Bacteria | 1669 |
| 566 | Ga0265338_10027357 | 3300028800 | Bacteria | 5723 |
| 567 | Ga0265325_10119049 | 3300031241 | Bacteria | 1275 |
| 568 | Ga0307408_100007449 | 3300031548 | Bacteria | 7240 |
| 569 | Ga0307408_100084504 | 3300031548 | Bacteria | 2381 |
| 570 | Ga0307406_10039957 | 3300031901 | Bacteria | 2914 |
| 571 | Ga0307407_10169463 | 3300031903 | Unclassified | 1437 |
| 572 | Ga0307416_100221576 | 3300032002 | Unclassified | 1815 |
| 573 | Ga0307411_10242894 | 3300032005 | Bacteria | 1411 |
| 574 | Ga0373950_0020086 | 3300034818 | Bacteria | 1172 |
| 575 | Ga0373938_0026974 | 3300034957 | Unclassified | 1206 |
| 576 | Ga0373926_0007148 | 3300035083 | Bacteria | 3717 |
| 577 | Ga0373929_0022726 | 3300035085 | Bacteria | 1282 |
| 578 | Ga0373934_0028976 | 3300035086 | Bacteria | 2160 |
| 579 | Ga0373949_0049099 | 3300035090 | Unclassified | 1059 |
| 580 | Ga0373951_0005728 | 3300035091 | Bacteria | 2873 |
| 581 | Ga0373923_0020635 | 3300035111 | Bacteria | 2562 |
| 582 | Ga0373936_0063772 | 3300035113 | Archaea | 1509 |
| 583 | Ga0373953_0135968 | 3300035117 | Bacteria | 1050 |
| 584 | Ga0373956_0038538 | 3300035119 | Bacteria | 2115 |
| 585 | Ga0373957_0035248 | 3300035120 | Bacteria | 1858 |
| 586 | Ga0373960_0010057 | 3300035121 | Bacteria | 2305 |
| 587 | Ga0373943_0130526 | 3300035170 | Bacteria | 1344 |
| 588 | Ga0373946_0060724 | 3300035171 | Bacteria | 1608 |
| 589 | Ga0373955_0077248 | 3300035172 | Bacteria | 1874 |
| 590 | Ga0373942_0022149 | 3300035207 | Bacteria | 1610 |
| 591 | Ga0373961_0011996 | 3300035241 | Bacteria | 2162 |
| 592 | Ga0316574_0245469 | 3300035398 | Bacteria | 1144 |
| 593 | Ga0373924_0055530 | 3300035410 | Archaea | 1648 |
| 594 | Ga0373931_0008533 | 3300035691 | Bacteria | 4863 |
| 595 | Ga0373931_0049612 | 3300035691 | Unclassified | 2230 |
| 596 | Ga0373931_0085842 | 3300035691 | Bacteria | 1745 |
| 597 | Ga0373931_0088119 | 3300035691 | Bacteria | 1724 |
| 598 | Ga0373931_0144230 | 3300035691 | Bacteria | 1382 |
| 599 | Ga0373935_0095173 | 3300035692 | Bacteria | 1956 |
| 600 | Ga0373935_0369581 | 3300035692 | Bacteria | 1025 |
| 601 | Ga0373927_0073687 | 3300035695 | Bacteria | 2211 |
| 602 | Ga0373927_0081288 | 3300035695 | Bacteria | 2100 |
| 603 | Ga0373927_0144962 | 3300035695 | Bacteria | 1554 |
| 604 | Ga0373927_0257915 | 3300035695 | Bacteria | 1146 |
| 605 | Ga0373933_0008687 | 3300035724 | Bacteria | 5539 |
| 606 | Ga0373933_0018196 | 3300035724 | Bacteria | 3949 |
| 607 | Ga0373933_0018425 | 3300035724 | Unclassified | 3926 |
| 608 | Ga0373933_0054050 | 3300035724 | Bacteria | 2406 |
| 609 | Ga0373933_0124382 | 3300035724 | Bacteria | 1617 |
| 610 | Ga0373933_0205150 | 3300035724 | Bacteria | 1262 |
| 611 | Ga0373947_0030927 | 3300035725 | Bacteria | 3148 |
| 612 | Ga0373947_0121834 | 3300035725 | Bacteria | 1657 |
| 613 | Ga0373947_0186845 | 3300035725 | Bacteria | 1351 |
| 614 | Ga0373947_0274760 | 3300035725 | Bacteria | 1119 |
| 615 | Ga0373937_0010067 | 3300036401 | Bacteria | 8245 |
| 616 | Ga0373937_0022237 | 3300036401 | Bacteria | 5699 |
| 617 | Ga0373937_0047215 | 3300036401 | Bacteria | 3939 |
| 618 | Ga0373937_0048067 | 3300036401 | Unclassified | 3904 |
| 619 | Ga0373937_0070697 | 3300036401 | Bacteria | 3219 |
| 620 | Ga0373937_0076417 | 3300036401 | Bacteria | 3093 |
| 621 | Ga0373937_0083428 | 3300036401 | Bacteria | 2956 |
| 622 | Ga0373937_0101362 | 3300036401 | Bacteria | 2672 |
| 623 | Ga0373937_0121415 | 3300036401 | Unclassified | 2435 |
| 624 | Ga0373937_0262237 | 3300036401 | Bacteria | 1630 |
| 625 | Ga0373925_0014791 | 3300037068 | Bacteria | 5641 |
| 626 | Ga0373925_0025637 | 3300037068 | Bacteria | 4309 |
| 627 | Ga0373925_0026815 | 3300037068 | Bacteria | 4218 |
| 628 | Ga0373925_0090722 | 3300037068 | Bacteria | 2336 |
| 629 | Ga0373925_0185614 | 3300037068 | Unclassified | 1648 |
| 630 | Ga0395900_0002247 | 3300037418 | Bacteria | 21493 |
| 631 | Ga0395898_0052997 | 3300037466 | Bacteria | 3962 |
| 632 | Ga0395905_0154660 | 3300037471 | Unclassified | 2157 |
| 633 | Ga0436364_0080442 | 3300037853 | Bacteria | 24108 |
| 634 | Ga0436364_0639322 | 3300037853 | Bacteria | 2327 |
| 635 | Ga0436364_0722137 | 3300037853 | Bacteria | 20685 |
| 636 | Ga0436364_0874567 | 3300037853 | Bacteria | 2284 |
| 637 | Ga0436364_1034225 | 3300037853 | Bacteria | 1492 |
| 638 | Ga0436364_1071444 | 3300037853 | Bacteria | 39553 |
| 639 | Ga0436364_1078611 | 3300037853 | Bacteria | 1539 |
| 640 | Ga0436364_1102652 | 3300037853 | Bacteria | 9586 |
| 641 | Ga0436364_1278604 | 3300037853 | Bacteria | 2089 |
| 642 | Ga0436364_1430783 | 3300037853 | Bacteria | 2617 |
| 643 | Ga0395901_0004315 | 3300038443 | Bacteria | 14353 |
| 644 | Ga0242419_000774 | 3300038698 | Bacteria | 1822 |
| 645 | Ga0436365_0043846 | 3300039437 | Unclassified | 1608 |
| 646 | Ga0436365_0469844 | 3300039437 | Bacteria | 1496 |
| 647 | Ga0436365_1004606 | 3300039437 | Bacteria | 16150 |
| 648 | Ga0436365_1930435 | 3300039437 | Bacteria | 39331 |
| 649 | Ga0436360_0109953 | 3300039438 | Bacteria | 3450 |
| 650 | Ga0436360_0292686 | 3300039438 | Unclassified | 1829 |
| 651 | Ga0436360_0479510 | 3300039438 | Bacteria | 1045 |
| 652 | Ga0436360_0987873 | 3300039438 | Bacteria | 1821 |
| 653 | Ga0436361_0619205 | 3300039447 | Bacteria | 2348 |
| 654 | Ga0436361_0731630 | 3300039447 | Bacteria | 1934 |
| 655 | Ga0436363_0709230 | 3300039450 | Bacteria | 1797 |
| 656 | Ga0436363_1130753 | 3300039450 | Bacteria | 1585 |
| 657 | Ga0436363_1397028 | 3300039450 | Bacteria | 3874 |
| 658 | Ga0436363_1417233 | 3300039450 | Unclassified | 814 |
| 659 | Ga0436362_0330598 | 3300039453 | Unclassified | 1171 |
| 660 | Ga0436362_0360447 | 3300039453 | Unclassified | 1261 |
| 661 | Ga0436362_0874942 | 3300039453 | Bacteria | 1210 |
| 662 | Ga0436362_1134760 | 3300039453 | Bacteria | 1048 |
| 663 | Ga0436362_1275549 | 3300039453 | Bacteria | 1632 |
| 664 | Ga0439443_007911 | 3300042003 | Bacteria | 1488 |
| 665 | Ga0439448_0004733 | 3300042005 | Bacteria | 3852 |
| 666 | Ga0439448_0062803 | 3300042005 | Bacteria | 1229 |
| 667 | Ga0439450_036298 | 3300042008 | Bacteria | 1128 |
| 668 | Ga0439454_002012 | 3300042011 | Bacteria | 2070 |
| 669 | Ga0439455_0007857 | 3300042012 | Bacteria | 2271 |
| 670 | Ga0439456_020830 | 3300042013 | Bacteria | 1385 |
| 671 | Ga0439463_084522 | 3300042016 | Bacteria | 816 |
| 672 | Ga0439458_0003476 | 3300042157 | Bacteria | 3677 |
| 673 | Ga0439458_0029822 | 3300042157 | Bacteria | 1296 |
| 674 | Ga0439458_0032782 | 3300042157 | Bacteria | 1243 |
| 675 | Ga0439444_0015911 | 3300042437 | Bacteria | 1274 |
| 676 | Ga0439459_0000622 | 3300042438 | Bacteria | 4768 |
| 677 | Ga0439460_0019695 | 3300042461 | Bacteria | 1830 |
| 678 | Ga0439460_0061952 | 3300042461 | Bacteria | 1143 |
| 679 | Ga0451577_0008310 | 3300042876 | Bacteria | 10100 |
| 680 | Ga0451577_0022382 | 3300042876 | Bacteria | 5770 |
| 681 | Ga0451577_0034237 | 3300042876 | Bacteria | 4580 |
| 682 | Ga0451577_0114449 | 3300042876 | Bacteria | 2415 |
| 683 | Ga0451577_0760077 | 3300042876 | Bacteria | 876 |
| 684 | Ga0453683_0105723 | 3300044673 | Bacteria | 1768 |
| 685 | Ga0453683_0139472 | 3300044673 | Bacteria | 1530 |
| 686 | Ga0453683_0168758 | 3300044673 | Bacteria | 1386 |
| 687 | Ga0453683_0169769 | 3300044673 | Bacteria | 1381 |
| 688 | Ga0453684_0207778 | 3300044712 | Bacteria | 2278 |
| 689 | Ga0453684_0441454 | 3300044712 | Bacteria | 1450 |
| 690 | Ga0466960_0017701 | 3300044901 | Bacteria | 3113 |
| 691 | Ga0451576_0026470 | 3300045051 | Bacteria | 6239 |
| 692 | Ga0451576_0038151 | 3300045051 | Bacteria | 5085 |
| 693 | Ga0451576_0046180 | 3300045051 | Bacteria | 4586 |
| 694 | Ga0451576_0075915 | 3300045051 | Bacteria | 3497 |
| 695 | Ga0451576_0096233 | 3300045051 | Bacteria | 3079 |
| 696 | Ga0451576_0241924 | 3300045051 | Bacteria | 1885 |
| 697 | Ga0451576_0301506 | 3300045051 | Bacteria | 1676 |
| 698 | Ga0451576_0320070 | 3300045051 | Bacteria | 1623 |
| 699 | Ga0495592_0028281 | 3300046454 | Bacteria | 4247 |
| 700 | Ga0495592_0071975 | 3300046454 | Bacteria | 2516 |
| 701 | Ga0495603_0043372 | 3300046455 | Bacteria | 2686 |
| 702 | Ga0495629_0200696 | 3300046459 | Bacteria | 1379 |
| 703 | Ga0495651_0002425 | 3300046462 | Bacteria | 14392 |
| 704 | Ga0495651_0043748 | 3300046462 | Bacteria | 3473 |
| 705 | Ga0495651_0294272 | 3300046462 | Unclassified | 1091 |
| 706 | Ga0495580_0034280 | 3300046472 | Unclassified | 3655 |
| 707 | Ga0495580_0109918 | 3300046472 | Bacteria | 1914 |
| 708 | Ga0495662_0175629 | 3300046476 | Bacteria | 1056 |
| 709 | Ga0495664_0004201 | 3300046477 | Bacteria | 7864 |
| 710 | Ga0495585_0020518 | 3300046492 | Bacteria | 3800 |
| 711 | Ga0495594_0078085 | 3300046499 | Bacteria | 1847 |
| 712 | Ga0495608_0002946 | 3300046511 | Bacteria | 12171 |
| 713 | Ga0495608_0131967 | 3300046511 | Bacteria | 1598 |
| 714 | Ga0495618_0235909 | 3300046514 | Unclassified | 1151 |
| 715 | Ga0495628_0020266 | 3300046516 | Bacteria | 5489 |
| 716 | Ga0495640_0109722 | 3300046533 | Unclassified | 1804 |
| 717 | Ga0495640_0127170 | 3300046533 | Bacteria | 1652 |
| 718 | Ga0495587_0039338 | 3300046536 | Bacteria | 2831 |
| 719 | Ga0495598_0042554 | 3300046537 | Bacteria | 1334 |
| 720 | Ga0495609_0083286 | 3300046538 | Bacteria | 1397 |
| 721 | Ga0495645_0019796 | 3300046543 | Bacteria | 4848 |
| 722 | Ga0495645_0182413 | 3300046543 | Bacteria | 1437 |
| 723 | Ga0495667_0055717 | 3300046559 | Bacteria | 2600 |
| 724 | Ga0495667_0065576 | 3300046559 | Bacteria | 2375 |
| 725 | Ga0495667_0237094 | 3300046559 | Bacteria | 1162 |
| 726 | Ga0495656_0022506 | 3300046615 | Unclassified | 2469 |
| 727 | Ga0495634_0023101 | 3300046642 | Bacteria | 4376 |
| 728 | Ga0495635_0004464 | 3300046663 | Bacteria | 9695 |
| 729 | Ga0495659_0135100 | 3300046664 | Bacteria | 981 |
| 730 | Ga0495588_0109904 | 3300046674 | Bacteria | 1452 |
| 731 | Ga0495599_0016495 | 3300046678 | Bacteria | 4586 |
| 732 | Ga0495646_0008364 | 3300046680 | Bacteria | 6579 |
| 733 | Ga0495669_0097101 | 3300046684 | Bacteria | 1366 |
| 734 | Ga0495669_0097681 | 3300046684 | Bacteria | 1362 |
| 735 | Ga0495670_0117994 | 3300046691 | Bacteria | 1377 |
| 736 | Ga0495600_0086227 | 3300046809 | Bacteria | 2049 |
| 737 | Ga0495604_0001943 | 3300047317 | Bacteria | 16715 |
| 738 | Ga0495674_0052106 | 3300047319 | Bacteria | 3603 |
| 739 | Ga0495674_0412013 | 3300047319 | Bacteria | 1090 |
| 740 | Ga0495680_0056648 | 3300047322 | Bacteria | 3034 |
| 741 | Ga0495680_0292495 | 3300047322 | Bacteria | 1145 |
| 742 | Ga0495687_000460 | 3300047443 | Bacteria | 49792 |
| 743 | Ga0495675_0006262 | 3300047444 | Bacteria | 7282 |
| 744 | Ga0495602_0005445 | 3300048088 | Bacteria | 13350 |
| 745 | Ga0495602_0397476 | 3300048088 | Archaea | 983 |
| 746 | Ga0496102_0034282 | 3300048905 | Bacteria | 4565 |
| 747 | Ga0496102_0088469 | 3300048905 | Bacteria | 2863 |
| 748 | Ga0496102_0213606 | 3300048905 | Unclassified | 1819 |
| 749 | Ga0496102_0430062 | 3300048905 | Bacteria | 1240 |
| 750 | Ga0496103_0066394 | 3300048906 | Bacteria | 2252 |
| 751 | Ga0496103_0181678 | 3300048906 | Bacteria | 1352 |
| 752 | Ga0496104_0118569 | 3300048907 | Bacteria | 2541 |
| 753 | Ga0496106_0164475 | 3300048909 | Unclassified | 1756 |
| 754 | Ga0496107_0093032 | 3300048910 | Bacteria | 2205 |
| 755 | Ga0496108_0803033 | 3300048911 | Unclassified | 812 |
| 756 | Ga0496109_0284093 | 3300048912 | Bacteria | 1560 |
| 757 | Ga0496110_0087763 | 3300048913 | Bacteria | 2778 |
| 758 | Ga0496112_0082970 | 3300048915 | Bacteria | 3169 |
| 759 | Ga0496112_0683189 | 3300048915 | Bacteria | 955 |
| 760 | Ga0496112_0852517 | 3300048915 | Bacteria | 834 |
| 761 | Ga0496113_0149933 | 3300048916 | Bacteria | 1839 |
| 762 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 763 | Ga0501031_0055022 | 3300049568 | Unclassified | 2593 |
| 764 | Ga0501032_0284764 | 3300049569 | Unclassified | 1070 |
| 765 | Ga0501033_0028100 | 3300049570 | Bacteria | 4228 |
| 766 | Ga0501036_0039695 | 3300049572 | Bacteria | 3983 |
| 767 | Ga0501036_0378370 | 3300049572 | Bacteria | 1182 |
| 768 | Ga0501039_0089993 | 3300049575 | Bacteria | 2392 |
| 769 | Ga0501040_0002455 | 3300049576 | Bacteria | 11937 |
| 770 | Ga0501040_0011967 | 3300049576 | Bacteria | 5677 |
| 771 | Ga0501040_0097457 | 3300049576 | Bacteria | 2049 |
| 772 | Ga0501041_0008299 | 3300049577 | Bacteria | 6113 |
| 773 | Ga0501041_0032102 | 3300049577 | Unclassified | 3174 |
| 774 | Ga0501042_0175111 | 3300049578 | Bacteria | 1548 |
| 775 | Ga0501042_0437871 | 3300049578 | Bacteria | 948 |
| 776 | Ga0501046_0008696 | 3300049580 | Bacteria | 8825 |
| 777 | Ga0501046_0216241 | 3300049580 | Bacteria | 1421 |
| 778 | Ga0501046_0260939 | 3300049580 | Unclassified | 1273 |
| 779 | Ga0501047_0229759 | 3300049581 | Bacteria | 1709 |
| 780 | Ga0501047_0401916 | 3300049581 | Bacteria | 1203 |
| 781 | Ga0501047_0722847 | 3300049581 | Bacteria | 813 |
| 782 | Ga0501048_0134367 | 3300049582 | Bacteria | 1748 |
| 783 | Ga0501068_0152179 | 3300049584 | Bacteria | 1454 |
| 784 | Ga0501071_0095327 | 3300049587 | Bacteria | 2190 |
| 785 | Ga0501072_0056903 | 3300049588 | Bacteria | 3081 |
| 786 | Ga0501072_0076295 | 3300049588 | Bacteria | 2652 |
| 787 | Ga0501072_0165654 | 3300049588 | Bacteria | 1763 |
| 788 | Ga0501072_0227828 | 3300049588 | Bacteria | 1485 |
| 789 | Ga0501074_0113378 | 3300049590 | Bacteria | 1940 |
| 790 | Ga0501074_0155600 | 3300049590 | Unclassified | 1633 |
| 791 | Ga0501075_0019807 | 3300049591 | Bacteria | 4884 |
| 792 | Ga0501075_0020845 | 3300049591 | Bacteria | 4772 |
| 793 | Ga0501075_0267581 | 3300049591 | Bacteria | 1303 |
| 794 | Ga0501076_0009174 | 3300049592 | Bacteria | 7291 |
| 795 | Ga0501076_0032859 | 3300049592 | Bacteria | 4051 |
| 796 | Ga0501076_0051075 | 3300049592 | Bacteria | 3272 |
| 797 | Ga0501077_0043878 | 3300049593 | Bacteria | 2841 |
| 798 | Ga0501077_0047733 | 3300049593 | Bacteria | 2720 |
| 799 | Ga0501079_0115962 | 3300049741 | Bacteria | 2082 |
| 800 | Ga0501079_0126301 | 3300049741 | Bacteria | 1990 |
| 801 | Ga0501080_0105835 | 3300049742 | Bacteria | 2608 |
| 802 | Ga0501081_0069521 | 3300049743 | Bacteria | 2453 |
| 803 | Ga0501081_0103034 | 3300049743 | Unclassified | 2019 |
| 804 | Ga0501083_0434580 | 3300049744 | Bacteria | 854 |
| 805 | Ga0501045_0004695 | 3300049824 | Bacteria | 9438 |
| 806 | Ga0501045_0091395 | 3300049824 | Bacteria | 2250 |
| 807 | Ga0501045_0159169 | 3300049824 | Bacteria | 1681 |
| 808 | nmdc:mga03683_37180_c1 | 3300050489 | Bacteria | 1983 |
| 809 | nmdc:mga03n38_151265_c1 | 3300050490 | Bacteria | 1168 |
| 810 | nmdc:mga05p37_110366_c1 | 3300050507 | Bacteria | 3384 |
| 811 | nmdc:mga05p37_111467_c1 | 3300050507 | Bacteria | 3365 |
| 812 | nmdc:mga05p37_11702_c1 | 3300050507 | Bacteria | 10456 |
| 813 | nmdc:mga05p37_12706_c1 | 3300050507 | Bacteria | 10064 |
| 814 | nmdc:mga05p37_13953_c1 | 3300050507 | Bacteria | 9634 |
| 815 | nmdc:mga05p37_18613_c1 | 3300050507 | Bacteria | 8394 |
| 816 | nmdc:mga05p37_187746_c1 | 3300050507 | Bacteria | 2512 |
| 817 | nmdc:mga05p37_19887_c1 | 3300050507 | Bacteria | 8122 |
| 818 | nmdc:mga05p37_275468_c1 | 3300050507 | Unclassified | 2009 |
| 819 | nmdc:mga05p37_288978_c1 | 3300050507 | Unclassified | 1952 |
| 820 | nmdc:mga05p37_362807_c1 | 3300050507 | Bacteria | 1703 |
| 821 | nmdc:mga05p37_3695_c1 | 3300050507 | Bacteria | 17900 |
| 822 | nmdc:mga05p37_411742_c1 | 3300050507 | Bacteria | 1576 |
| 823 | nmdc:mga05p37_43013_c1 | 3300050507 | Bacteria | 5554 |
| 824 | nmdc:mga05p37_43813_c1 | 3300050507 | Bacteria | 5506 |
| 825 | nmdc:mga05p37_463416_c1 | 3300050507 | Bacteria | 1464 |
| 826 | nmdc:mga05p37_49599_c1 | 3300050507 | Bacteria | 4811 |
| 827 | nmdc:mga05p37_497203_c1 | 3300050507 | Bacteria | 1401 |
| 828 | nmdc:mga05p37_50609_c1 | 3300050507 | Bacteria | 5110 |
| 829 | nmdc:mga05p37_5872_c1 | 3300050507 | Bacteria | 14438 |
| 830 | nmdc:mga05p37_5938_c1 | 3300050507 | Bacteria | 14366 |
| 831 | nmdc:mga05p37_72066_c1 | 3300050507 | Bacteria | 4251 |
| 832 | nmdc:mga05p37_93333_c1 | 3300050507 | Bacteria | 3709 |
| 833 | nmdc:mga09592_11845_c1 | 3300050508 | Bacteria | 7094 |
| 834 | nmdc:mga09592_211939_c1 | 3300050508 | Bacteria | 1678 |
| 835 | nmdc:mga09592_254965_c1 | 3300050508 | Bacteria | 1521 |
| 836 | nmdc:mga09592_287554_c1 | 3300050508 | Bacteria | 1425 |
| 837 | nmdc:mga09592_298468_c1 | 3300050508 | Bacteria | 1397 |
| 838 | nmdc:mga09592_32647_c1 | 3300050508 | Bacteria | 4340 |
| 839 | nmdc:mga09592_4575_c1 | 3300050508 | Bacteria | 11195 |
| 840 | nmdc:mga09592_59360_c1 | 3300050508 | Bacteria | 3234 |
| 841 | nmdc:mga09592_60059_c1 | 3300050508 | Unclassified | 3214 |
| 842 | nmdc:mga09592_7598_c1 | 3300050508 | Bacteria | 8817 |
| 843 | nmdc:mga09592_9333_c1 | 3300050508 | Bacteria | 7976 |
| 844 | nmdc:mga0qj67_13254_c1 | 3300050509 | Bacteria | 6221 |
| 845 | nmdc:mga0qj67_181262_c1 | 3300050509 | Bacteria | 1710 |
| 846 | nmdc:mga0qj67_25488_c1 | 3300050509 | Bacteria | 4570 |
| 847 | nmdc:mga0qj67_28136_c1 | 3300050509 | Bacteria | 4361 |
| 848 | nmdc:mga0qj67_281645_c1 | 3300050509 | Bacteria | 1347 |
| 849 | nmdc:mga0qj67_306405_c1 | 3300050509 | Bacteria | 1287 |
| 850 | nmdc:mga0qj67_446232_c1 | 3300050509 | Bacteria | 1042 |
| 851 | nmdc:mga0qj67_4500_c1 | 3300050509 | Bacteria | 10100 |
| 852 | nmdc:mga0qj67_6292_c1 | 3300050509 | Bacteria | 8711 |
| 853 | nmdc:mga06r32_122830_c1 | 3300050510 | Bacteria | 2562 |
| 854 | nmdc:mga06r32_1480_c1 | 3300050510 | Bacteria | 21119 |
| 855 | nmdc:mga06r32_15165_c1 | 3300050510 | Bacteria | 6999 |
| 856 | nmdc:mga06r32_15543_c1 | 3300050510 | Bacteria | 6913 |
| 857 | nmdc:mga06r32_216085_c1 | 3300050510 | Bacteria | 1905 |
| 858 | nmdc:mga06r32_3616_c1 | 3300050510 | Bacteria | 13796 |
| 859 | nmdc:mga06r32_38249_c1 | 3300050510 | Bacteria | 4544 |
| 860 | nmdc:mga06r32_4690_c1 | 3300050510 | Bacteria | 12276 |
| 861 | nmdc:mga06r32_51413_c1 | 3300050510 | Bacteria | 3944 |
| 862 | nmdc:mga06r32_53_c1 | 3300050510 | Bacteria | 72230 |
| 863 | nmdc:mga06r32_604932_c1 | 3300050510 | Bacteria | 1067 |
| 864 | nmdc:mga06r32_670757_c1 | 3300050510 | Unclassified | 1004 |
| 865 | nmdc:mga08y16_1374_c1 | 3300050511 | Bacteria | 24321 |
| 866 | nmdc:mga08y16_146409_c1 | 3300050511 | Bacteria | 2456 |
| 867 | nmdc:mga08y16_174421_c1 | 3300050511 | Unclassified | 2232 |
| 868 | nmdc:mga08y16_181260_c1 | 3300050511 | Bacteria | 2187 |
| 869 | nmdc:mga08y16_19917_c1 | 3300050511 | Bacteria | 7078 |
| 870 | nmdc:mga08y16_2072_c1 | 3300050511 | Bacteria | 20554 |
| 871 | nmdc:mga08y16_2077_c1 | 3300050511 | Bacteria | 20542 |
| 872 | nmdc:mga08y16_271415_c1 | 3300050511 | Bacteria | 1751 |
| 873 | nmdc:mga08y16_318024_c1 | 3300050511 | Bacteria | 1603 |
| 874 | nmdc:mga08y16_424193_c1 | 3300050511 | Unclassified | 1359 |
| 875 | nmdc:mga08y16_466211_c1 | 3300050511 | Unclassified | 1287 |
| 876 | nmdc:mga08y16_4905_c1 | 3300050511 | Bacteria | 13985 |
| 877 | nmdc:mga08y16_52344_c1 | 3300050511 | Bacteria | 4272 |
| 878 | nmdc:mga08y16_61788_c1 | 3300050511 | Bacteria | 3912 |
| 879 | nmdc:mga08y16_888683_c1 | 3300050511 | Bacteria | 878 |
| 880 | nmdc:mga0n895_110674_c1 | 3300050512 | Unclassified | 2763 |
| 881 | nmdc:mga0n895_117785_c1 | 3300050512 | Bacteria | 2676 |
| 882 | nmdc:mga0n895_151713_c1 | 3300050512 | Bacteria | 2348 |
| 883 | nmdc:mga0n895_15352_c1 | 3300050512 | Bacteria | 6981 |
| 884 | nmdc:mga0n895_160407_c1 | 3300050512 | Bacteria | 2281 |
| 885 | nmdc:mga0n895_199044_c1 | 3300050512 | Bacteria | 2035 |
| 886 | nmdc:mga0n895_20267_c1 | 3300050512 | Bacteria | 6198 |
| 887 | nmdc:mga0n895_231009_c1 | 3300050512 | Bacteria | 1878 |
| 888 | nmdc:mga0n895_335478_c1 | 3300050512 | Unclassified | 1532 |
| 889 | nmdc:mga0n895_41370_c1 | 3300050512 | Bacteria | 4480 |
| 890 | nmdc:mga0n895_462276_c1 | 3300050512 | Bacteria | 1281 |
| 891 | nmdc:mga0n895_531656_c1 | 3300050512 | Bacteria | 1183 |
| 892 | nmdc:mga0n895_62339_c1 | 3300050512 | Bacteria | 3685 |
| 893 | nmdc:mga0n895_66054_c1 | 3300050512 | Unclassified | 3582 |
| 894 | nmdc:mga0n895_96721_c1 | 3300050512 | Bacteria | 2958 |
| 895 | nmdc:mga0rr50_146214_c1 | 3300050513 | Unclassified | 1906 |
| 896 | nmdc:mga0rr50_20685_c1 | 3300050513 | Bacteria | 4475 |
| 897 | nmdc:mga0rr50_211050_c1 | 3300050513 | Bacteria | 1600 |
| 898 | nmdc:mga0rr50_21612_c1 | 3300050513 | Bacteria | 4397 |
| 899 | nmdc:mga0rr50_221421_c1 | 3300050513 | Bacteria | 1563 |
| 900 | nmdc:mga0rr50_2510_c1 | 3300050513 | Bacteria | 10382 |
| 901 | nmdc:mga0rr50_340608_c1 | 3300050513 | Bacteria | 1260 |
| 902 | nmdc:mga0rr50_469172_c1 | 3300050513 | Bacteria | 1068 |
| 903 | nmdc:mga0rr50_60161_c1 | 3300050513 | Bacteria | 2856 |
| 904 | nmdc:mga08x19_11850_c1 | 3300050514 | Bacteria | 5244 |
| 905 | nmdc:mga08x19_163629_c1 | 3300050514 | Bacteria | 1512 |
| 906 | nmdc:mga08x19_18788_c1 | 3300050514 | Bacteria | 4237 |
| 907 | nmdc:mga08x19_225253_c1 | 3300050514 | Bacteria | 1289 |
| 908 | nmdc:mga08x19_275225_c1 | 3300050514 | Bacteria | 1166 |
| 909 | nmdc:mga08x19_292274_c1 | 3300050514 | Bacteria | 1131 |
| 910 | nmdc:mga08x19_5839_c1 | 3300050514 | Bacteria | 7282 |
| 911 | nmdc:mga08x19_7456_c1 | 3300050514 | Bacteria | 6498 |
| 912 | nmdc:mga0a205_1834_c1 | 3300050515 | Bacteria | 18384 |
| 913 | nmdc:mga0a205_22841_c1 | 3300050515 | Bacteria | 5930 |
| 914 | nmdc:mga0a205_230090_c1 | 3300050515 | Bacteria | 1737 |
| 915 | nmdc:mga0a205_280511_c1 | 3300050515 | Bacteria | 1541 |
| 916 | nmdc:mga0a205_280652_c1 | 3300050515 | Unclassified | 1541 |
| 917 | nmdc:mga0a205_317331_c1 | 3300050515 | Unclassified | 1430 |
| 918 | nmdc:mga0a205_33040_c1 | 3300050515 | Bacteria | 4962 |
| 919 | nmdc:mga0a205_33041_c1 | 3300050515 | Bacteria | 4962 |
| 920 | nmdc:mga0a205_34800_c1 | 3300050515 | Bacteria | 4834 |
| 921 | nmdc:mga0a205_502448_c1 | 3300050515 | Bacteria | 1069 |
| 922 | nmdc:mga0a205_56763_c1 | 3300050515 | Bacteria | 3780 |
| 923 | nmdc:mga0a205_61211_c1 | 3300050515 | Bacteria | 3636 |
| 924 | nmdc:mga0a205_7552_c1 | 3300050515 | Bacteria | 9852 |
| 925 | nmdc:mga0a205_83920_c1 | 3300050515 | Bacteria | 3077 |
| 926 | nmdc:mga0sz30_6309_c1 | 3300050516 | Plasmid | 4397 |
| 927 | Ga0495601_0004617 | 3300053077 | Bacteria | 7968 |
| 928 | Ga0495601_0037130 | 3300053077 | Bacteria | 3045 |
| 929 | Ga0495601_0055492 | 3300053077 | Bacteria | 2508 |
| 930 | Ga0495612_0004119 | 3300053078 | Bacteria | 6022 |
| 931 | Ga0495619_0001776 | 3300053085 | Bacteria | 14334 |
| 932 | Ga0495619_0023030 | 3300053085 | Unclassified | 3989 |
| 933 | Ga0495619_0028172 | 3300053085 | Bacteria | 3622 |
| 934 | Ga0495619_0099727 | 3300053085 | Bacteria | 1976 |
| 935 | Ga0495619_0124931 | 3300053085 | Unclassified | 1765 |
| 936 | Ga0495619_0141600 | 3300053085 | Bacteria | 1656 |
| 937 | Ga0495619_0167358 | 3300053085 | Archaea | 1519 |
| 938 | Ga0495619_0376198 | 3300053085 | Unclassified | 982 |
| 939 | Ga0500568_0003463 | 3300053139 | Bacteria | 8779 |
| 940 | Ga0501084_0092355 | 3300054114 | Unclassified | 2541 |
| 941 | Ga0501084_0337865 | 3300054114 | Bacteria | 1272 |
| 942 | Ga0501082_0009040 | 3300060353 | Bacteria | 8593 |
| 943 | Ga0501082_0500421 | 3300060353 | Bacteria | 1062 |
| 944 | Ga0530510_0001282 | 3300061734 | Bacteria | 16773 |
| 945 | Ga0530510_0038180 | 3300061734 | Bacteria | 3467 |
| 946 | Ga0530510_0080309 | 3300061734 | Bacteria | 2373 |
| 947 | Ga0530510_0103036 | 3300061734 | Bacteria | 2087 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_1417233 | Ga0436363_1417233_79_777 | 227 |
| 2 | 3300025315 | Ga0207697_10096648 | Ga0207697_100966482 | 229 |
| 3 | 3300050511 | nmdc:mga08y16_466211_c1 | nmdc:mga08y16_466211_c1_520_1233 | 229 |
| 4 | 3300042016 | Ga0439463_084522 | Ga0439463_084522_44_757 | 230 |
| 5 | 3300042876 | Ga0451577_0760077 | Ga0451577_0760077_20_733 | 230 |
| 6 | 3300048911 | Ga0496108_0803033 | Ga0496108_0803033_79_792 | 230 |
| 7 | 3300049581 | Ga0501047_0722847 | Ga0501047_0722847_76_789 | 230 |
| 8 | 3300049744 | Ga0501083_0434580 | Ga0501083_0434580_124_837 | 230 |
| 9 | 3300050489 | nmdc:mga03683_37180_c1 | nmdc:mga03683_37180_c1_1213_1920 | 230 |
| 10 | 3300035117 | Ga0373953_0135968 | Ga0373953_0135968_34_750 | 232 |
| 11 | 3300036401 | Ga0373937_0076417 | Ga0373937_0076417_2356_3072 | 232 |
| 12 | 3300037853 | Ga0436364_1078611 | Ga0436364_1078611_807_1520 | 232 |
| 13 | 3300039453 | Ga0436362_0330598 | Ga0436362_0330598_46_759 | 232 |
| 14 | 3300039453 | Ga0436362_1134760 | Ga0436362_1134760_293_1006 | 232 |
| 15 | 3300046559 | Ga0495667_0065576 | Ga0495667_0065576_1572_2288 | 232 |
| 16 | 3300048915 | Ga0496112_0852517 | Ga0496112_0852517_70_783 | 232 |
| 17 | 3300005471 | Ga0070698_100518920 | Ga0070698_1005189201 | 235 |
| 18 | 3300025942 | Ga0207689_10372716 | Ga0207689_103727161 | 236 |
| 19 | 3300050507 | nmdc:mga05p37_288978_c1 | nmdc:mga05p37_288978_c1_913_1653 | 239 |
| 20 | 3300009553 | Ga0105249_10421587 | Ga0105249_104215871 | 243 |
| 21 | 3300035398 | Ga0316574_0245469 | Ga0316574_0245469_14_802 | 253 |
| 22 | 3300021388 | Ga0213875_10024186 | Ga0213875_100241863 | 254 |
| 23 | 3300025923 | Ga0207681_10143621 | Ga0207681_101436212 | 254 |
| 24 | 3300037853 | Ga0436364_1102652 | Ga0436364_1102652_3352_4197 | 254 |
| 25 | 3300025933 | Ga0207706_10153379 | Ga0207706_101533792 | 255 |
| 26 | 3300047443 | Ga0495687_000460 | Ga0495687_000460_8851_9657 | 256 |
| 27 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_95576_96382 | 256 |
| 28 | 3300050509 | nmdc:mga0qj67_281645_c1 | nmdc:mga0qj67_281645_c1_208_1035 | 256 |
| 29 | 3300050510 | nmdc:mga06r32_604932_c1 | nmdc:mga06r32_604932_c1_31_858 | 256 |
| 30 | 3300021388 | Ga0213875_10002430 | Ga0213875_100024305 | 257 |
| 31 | 3300037853 | Ga0436364_1071444 | Ga0436364_1071444_16819_17646 | 257 |
| 32 | 3300005937 | Ga0081455_10067439 | Ga0081455_100674391 | 261 |
| 33 | 3300006038 | Ga0075365_10003905 | Ga0075365_100039055 | 261 |
| 34 | 3300006048 | Ga0075363_100027866 | Ga0075363_1000278661 | 261 |
| 35 | 3300006051 | Ga0075364_10087479 | Ga0075364_100874791 | 261 |
| 36 | 3300006177 | Ga0075362_10040143 | Ga0075362_100401431 | 261 |
| 37 | 3300006178 | Ga0075367_10003112 | Ga0075367_100031121 | 261 |
| 38 | 3300006186 | Ga0075369_10002094 | Ga0075369_100020943 | 261 |
| 39 | 3300050490 | nmdc:mga03n38_151265_c1 | nmdc:mga03n38_151265_c1_207_1010 | 261 |
| 40 | 3300050516 | nmdc:mga0sz30_6309_c1 | nmdc:mga0sz30_6309_c1_177_980 | 261 |
| 41 | iso_pu_bacteria | 2894772417 | 2894772543 | 261 |
| 42 | 3300014326 | Ga0157380_10420654 | Ga0157380_104206541 | 263 |
| 43 | 3300039437 | Ga0436365_1930435 | Ga0436365_1930435_36531_37349 | 263 |
| 44 | 3300005347 | Ga0070668_100111303 | Ga0070668_1001113032 | 264 |
| 45 | 3300005440 | Ga0070705_100112138 | Ga0070705_1001121382 | 264 |
| 46 | 3300005458 | Ga0070681_10107718 | Ga0070681_101077182 | 264 |
| 47 | 3300005458 | Ga0070681_10398905 | Ga0070681_103989051 | 264 |
| 48 | 3300005467 | Ga0070706_100385173 | Ga0070706_1003851732 | 264 |
| 49 | 3300005468 | Ga0070707_100134242 | Ga0070707_1001342422 | 264 |
| 50 | 3300005518 | Ga0070699_100021823 | Ga0070699_1000218233 | 264 |
| 51 | 3300005536 | Ga0070697_100095053 | Ga0070697_1000950531 | 264 |
| 52 | 3300005536 | Ga0070697_100121894 | Ga0070697_1001218942 | 264 |
| 53 | 3300005543 | Ga0070672_100144616 | Ga0070672_1001446162 | 264 |
| 54 | 3300005545 | Ga0070695_100185619 | Ga0070695_1001856192 | 264 |
| 55 | 3300005546 | Ga0070696_100061462 | Ga0070696_1000614622 | 264 |
| 56 | 3300005547 | Ga0070693_100141331 | Ga0070693_1001413312 | 264 |
| 57 | 3300005618 | Ga0068864_100799731 | Ga0068864_1007997311 | 264 |
| 58 | 3300005841 | Ga0068863_100152931 | Ga0068863_1001529313 | 264 |
| 59 | 3300005843 | Ga0068860_100036157 | Ga0068860_1000361571 | 264 |
| 60 | 3300005844 | Ga0068862_100407809 | Ga0068862_1004078092 | 264 |
| 61 | 3300005983 | Ga0081540_1013000 | Ga0081540_10130003 | 264 |
| 62 | 3300006844 | Ga0075428_100032038 | Ga0075428_1000320383 | 264 |
| 63 | 3300006844 | Ga0075428_100146503 | Ga0075428_1001465031 | 264 |
| 64 | 3300006846 | Ga0075430_100068371 | Ga0075430_1000683714 | 264 |
| 65 | 3300006847 | Ga0075431_100061131 | Ga0075431_1000611312 | 264 |
| 66 | 3300006847 | Ga0075431_100093911 | Ga0075431_1000939112 | 264 |
| 67 | 3300006852 | Ga0075433_10036047 | Ga0075433_100360475 | 264 |
| 68 | 3300006852 | Ga0075433_10037587 | Ga0075433_100375872 | 264 |
| 69 | 3300006852 | Ga0075433_10063716 | Ga0075433_100637162 | 264 |
| 70 | 3300006852 | Ga0075433_10259549 | Ga0075433_102595492 | 264 |
| 71 | 3300006871 | Ga0075434_100013803 | Ga0075434_1000138035 | 264 |
| 72 | 3300006880 | Ga0075429_100021867 | Ga0075429_1000218672 | 264 |
| 73 | 3300006880 | Ga0075429_100039897 | Ga0075429_1000398972 | 264 |
| 74 | 3300006880 | Ga0075429_100249176 | Ga0075429_1002491762 | 264 |
| 75 | 3300007076 | Ga0075435_100225542 | Ga0075435_1002255422 | 264 |
| 76 | 3300009094 | Ga0111539_10000098 | Ga0111539_1000009881 | 264 |
| 77 | 3300009094 | Ga0111539_10050168 | Ga0111539_100501683 | 264 |
| 78 | 3300009094 | Ga0111539_10060886 | Ga0111539_100608865 | 264 |
| 79 | 3300009147 | Ga0114129_10021159 | Ga0114129_100211592 | 264 |
| 80 | 3300009147 | Ga0114129_10208330 | Ga0114129_102083302 | 264 |
| 81 | 3300009147 | Ga0114129_10228188 | Ga0114129_102281882 | 264 |
| 82 | 3300009174 | Ga0105241_10026978 | Ga0105241_100269784 | 264 |
| 83 | 3300013100 | Ga0157373_10250968 | Ga0157373_102509681 | 264 |
| 84 | 3300013297 | Ga0157378_10092775 | Ga0157378_100927752 | 264 |
| 85 | 3300013308 | Ga0157375_10259767 | Ga0157375_102597672 | 264 |
| 86 | 3300014969 | Ga0157376_10360015 | Ga0157376_103600152 | 264 |
| 87 | 3300025910 | Ga0207684_10252269 | Ga0207684_102522692 | 264 |
| 88 | 3300025910 | Ga0207684_10432671 | Ga0207684_104326712 | 264 |
| 89 | 3300025912 | Ga0207707_10119265 | Ga0207707_101192652 | 264 |
| 90 | 3300025922 | Ga0207646_10049331 | Ga0207646_100493312 | 264 |
| 91 | 3300025923 | Ga0207681_10172770 | Ga0207681_101727702 | 264 |
| 92 | 3300025934 | Ga0207686_10052743 | Ga0207686_100527432 | 264 |
| 93 | 3300025935 | Ga0207709_10182783 | Ga0207709_101827832 | 264 |
| 94 | 3300025937 | Ga0207669_10215918 | Ga0207669_102159182 | 264 |
| 95 | 3300025940 | Ga0207691_10074595 | Ga0207691_100745952 | 264 |
| 96 | 3300025986 | Ga0207658_10203715 | Ga0207658_102037152 | 264 |
| 97 | 3300026075 | Ga0207708_10054251 | Ga0207708_100542511 | 264 |
| 98 | 3300026088 | Ga0207641_10100436 | Ga0207641_101004363 | 264 |
| 99 | 3300026088 | Ga0207641_10322689 | Ga0207641_103226892 | 264 |
| 100 | 3300026089 | Ga0207648_10063959 | Ga0207648_100639592 | 264 |
| 101 | 3300027876 | Ga0209974_10024653 | Ga0209974_100246532 | 264 |
| 102 | 3300027907 | Ga0207428_10000341 | Ga0207428_1000034141 | 264 |
| 103 | 3300027907 | Ga0207428_10041238 | Ga0207428_100412383 | 264 |
| 104 | 3300035090 | Ga0373949_0049099 | Ga0373949_0049099_49_867 | 264 |
| 105 | 3300035691 | Ga0373931_0088119 | Ga0373931_0088119_14_832 | 264 |
| 106 | 3300045051 | Ga0451576_0026470 | Ga0451576_0026470_20_838 | 264 |
| 107 | 3300045051 | Ga0451576_0320070 | Ga0451576_0320070_769_1587 | 264 |
| 108 | 3300046455 | Ga0495603_0043372 | Ga0495603_0043372_296_1114 | 264 |
| 109 | 3300046499 | Ga0495594_0078085 | Ga0495594_0078085_753_1571 | 264 |
| 110 | 3300046684 | Ga0495669_0097681 | Ga0495669_0097681_469_1287 | 264 |
| 111 | 3300048909 | Ga0496106_0164475 | Ga0496106_0164475_214_1029 | 264 |
| 112 | 3300049741 | Ga0501079_0126301 | Ga0501079_0126301_1073_1891 | 264 |
| 113 | 3300050507 | nmdc:mga05p37_12706_c1 | nmdc:mga05p37_12706_c1_2054_2872 | 264 |
| 114 | 3300050507 | nmdc:mga05p37_19887_c1 | nmdc:mga05p37_19887_c1_298_1116 | 264 |
| 115 | 3300050507 | nmdc:mga05p37_43813_c1 | nmdc:mga05p37_43813_c1_2661_3479 | 264 |
| 116 | 3300050508 | nmdc:mga09592_32647_c1 | nmdc:mga09592_32647_c1_2653_3471 | 264 |
| 117 | 3300050508 | nmdc:mga09592_4575_c1 | nmdc:mga09592_4575_c1_7579_8397 | 264 |
| 118 | 3300050508 | nmdc:mga09592_59360_c1 | nmdc:mga09592_59360_c1_2222_3040 | 264 |
| 119 | 3300050509 | nmdc:mga0qj67_25488_c1 | nmdc:mga0qj67_25488_c1_3558_4376 | 264 |
| 120 | 3300050509 | nmdc:mga0qj67_446232_c1 | nmdc:mga0qj67_446232_c1_160_978 | 264 |
| 121 | 3300050510 | nmdc:mga06r32_122830_c1 | nmdc:mga06r32_122830_c1_1429_2247 | 264 |
| 122 | 3300050510 | nmdc:mga06r32_4690_c1 | nmdc:mga06r32_4690_c1_671_1489 | 264 |
| 123 | 3300050511 | nmdc:mga08y16_19917_c1 | nmdc:mga08y16_19917_c1_4181_4999 | 264 |
| 124 | 3300050511 | nmdc:mga08y16_52344_c1 | nmdc:mga08y16_52344_c1_1941_2759 | 264 |
| 125 | 3300050512 | nmdc:mga0n895_110674_c1 | nmdc:mga0n895_110674_c1_617_1435 | 264 |
| 126 | 3300050512 | nmdc:mga0n895_117785_c1 | nmdc:mga0n895_117785_c1_1402_2220 | 264 |
| 127 | 3300050512 | nmdc:mga0n895_151713_c1 | nmdc:mga0n895_151713_c1_164_982 | 264 |
| 128 | 3300050512 | nmdc:mga0n895_41370_c1 | nmdc:mga0n895_41370_c1_2096_2914 | 264 |
| 129 | 3300050513 | nmdc:mga0rr50_146214_c1 | nmdc:mga0rr50_146214_c1_375_1193 | 264 |
| 130 | 3300050513 | nmdc:mga0rr50_20685_c1 | nmdc:mga0rr50_20685_c1_3624_4442 | 264 |
| 131 | 3300050513 | nmdc:mga0rr50_340608_c1 | nmdc:mga0rr50_340608_c1_62_877 | 264 |
| 132 | 3300050514 | nmdc:mga08x19_18788_c1 | nmdc:mga08x19_18788_c1_2888_3706 | 264 |
| 133 | 3300050515 | nmdc:mga0a205_280652_c1 | nmdc:mga0a205_280652_c1_443_1261 | 264 |
| 134 | 3300050515 | nmdc:mga0a205_7552_c1 | nmdc:mga0a205_7552_c1_1178_1996 | 264 |
| 135 | 3300053139 | Ga0500568_0003463 | Ga0500568_0003463_5165_5986 | 264 |
| 136 | 3300005328 | Ga0070676_10010241 | Ga0070676_100102413 | 265 |
| 137 | 3300005334 | Ga0068869_100040060 | Ga0068869_1000400603 | 265 |
| 138 | 3300005336 | Ga0070680_100046099 | Ga0070680_1000460994 | 265 |
| 139 | 3300005336 | Ga0070680_100072225 | Ga0070680_1000722251 | 265 |
| 140 | 3300005337 | Ga0070682_100031718 | Ga0070682_1000317183 | 265 |
| 141 | 3300005339 | Ga0070660_100009836 | Ga0070660_1000098364 | 265 |
| 142 | 3300005341 | Ga0070691_10048273 | Ga0070691_100482733 | 265 |
| 143 | 3300005344 | Ga0070661_100002434 | Ga0070661_10000243412 | 265 |
| 144 | 3300005347 | Ga0070668_100237243 | Ga0070668_1002372432 | 265 |
| 145 | 3300005353 | Ga0070669_100132882 | Ga0070669_1001328821 | 265 |
| 146 | 3300005366 | Ga0070659_100004245 | Ga0070659_1000042459 | 265 |
| 147 | 3300005406 | Ga0070703_10015958 | Ga0070703_100159583 | 265 |
| 148 | 3300005434 | Ga0070709_10056477 | Ga0070709_100564771 | 265 |
| 149 | 3300005437 | Ga0070710_10220804 | Ga0070710_102208042 | 265 |
| 150 | 3300005440 | Ga0070705_100035136 | Ga0070705_1000351363 | 265 |
| 151 | 3300005444 | Ga0070694_100007032 | Ga0070694_1000070323 | 265 |
| 152 | 3300005444 | Ga0070694_100068033 | Ga0070694_1000680333 | 265 |
| 153 | 3300005445 | Ga0070708_100041368 | Ga0070708_1000413683 | 265 |
| 154 | 3300005445 | Ga0070708_100087120 | Ga0070708_1000871203 | 265 |
| 155 | 3300005445 | Ga0070708_100216269 | Ga0070708_1002162692 | 265 |
| 156 | 3300005445 | Ga0070708_100520776 | Ga0070708_1005207761 | 265 |
| 157 | 3300005445 | Ga0070708_100650257 | Ga0070708_1006502571 | 265 |
| 158 | 3300005455 | Ga0070663_100051009 | Ga0070663_1000510093 | 265 |
| 159 | 3300005458 | Ga0070681_10200719 | Ga0070681_102007192 | 265 |
| 160 | 3300005459 | Ga0068867_100218259 | Ga0068867_1002182592 | 265 |
| 161 | 3300005467 | Ga0070706_100109729 | Ga0070706_1001097292 | 265 |
| 162 | 3300005467 | Ga0070706_100339977 | Ga0070706_1003399772 | 265 |
| 163 | 3300005467 | Ga0070706_100515253 | Ga0070706_1005152532 | 265 |
| 164 | 3300005468 | Ga0070707_100254299 | Ga0070707_1002542992 | 265 |
| 165 | 3300005468 | Ga0070707_100427788 | Ga0070707_1004277882 | 265 |
| 166 | 3300005468 | Ga0070707_100438053 | Ga0070707_1004380532 | 265 |
| 167 | 3300005471 | Ga0070698_100322916 | Ga0070698_1003229162 | 265 |
| 168 | 3300005471 | Ga0070698_100468672 | Ga0070698_1004686721 | 265 |
| 169 | 3300005518 | Ga0070699_100028026 | Ga0070699_1000280265 | 265 |
| 170 | 3300005518 | Ga0070699_100248333 | Ga0070699_1002483332 | 265 |
| 171 | 3300005530 | Ga0070679_100055490 | Ga0070679_1000554903 | 265 |
| 172 | 3300005536 | Ga0070697_100085500 | Ga0070697_1000855002 | 265 |
| 173 | 3300005544 | Ga0070686_100107972 | Ga0070686_1001079723 | 265 |
| 174 | 3300005545 | Ga0070695_100024657 | Ga0070695_1000246572 | 265 |
| 175 | 3300005545 | Ga0070695_100165669 | Ga0070695_1001656691 | 265 |
| 176 | 3300005547 | Ga0070693_100010662 | Ga0070693_1000106624 | 265 |
| 177 | 3300005549 | Ga0070704_100221121 | Ga0070704_1002211212 | 265 |
| 178 | 3300005549 | Ga0070704_100614379 | Ga0070704_1006143791 | 265 |
| 179 | 3300005563 | Ga0068855_100001465 | Ga0068855_10000146513 | 265 |
| 180 | 3300005564 | Ga0070664_100021732 | Ga0070664_1000217324 | 265 |
| 181 | 3300005577 | Ga0068857_100038738 | Ga0068857_1000387383 | 265 |
| 182 | 3300005578 | Ga0068854_100050887 | Ga0068854_1000508874 | 265 |
| 183 | 3300005614 | Ga0068856_100001138 | Ga0068856_10000113810 | 265 |
| 184 | 3300005615 | Ga0070702_100031846 | Ga0070702_1000318464 | 265 |
| 185 | 3300005617 | Ga0068859_100023978 | Ga0068859_1000239784 | 265 |
| 186 | 3300005617 | Ga0068859_100107528 | Ga0068859_1001075284 | 265 |
| 187 | 3300005617 | Ga0068859_100251400 | Ga0068859_1002514002 | 265 |
| 188 | 3300005617 | Ga0068859_100284162 | Ga0068859_1002841622 | 265 |
| 189 | 3300005618 | Ga0068864_100049049 | Ga0068864_1000490494 | 265 |
| 190 | 3300005719 | Ga0068861_100113019 | Ga0068861_1001130192 | 265 |
| 191 | 3300005841 | Ga0068863_100088941 | Ga0068863_1000889413 | 265 |
| 192 | 3300005841 | Ga0068863_100302880 | Ga0068863_1003028803 | 265 |
| 193 | 3300005843 | Ga0068860_100030891 | Ga0068860_1000308912 | 265 |
| 194 | 3300005843 | Ga0068860_100166466 | Ga0068860_1001664663 | 265 |
| 195 | 3300005843 | Ga0068860_100402964 | Ga0068860_1004029641 | 265 |
| 196 | 3300005844 | Ga0068862_100052686 | Ga0068862_1000526863 | 265 |
| 197 | 3300005844 | Ga0068862_100580697 | Ga0068862_1005806972 | 265 |
| 198 | 3300005937 | Ga0081455_10000824 | Ga0081455_1000082430 | 265 |
| 199 | 3300005981 | Ga0081538_10006853 | Ga0081538_100068536 | 265 |
| 200 | 3300005983 | Ga0081540_1011768 | Ga0081540_10117683 | 265 |
| 201 | 3300005983 | Ga0081540_1035896 | Ga0081540_10358962 | 265 |
| 202 | 3300005985 | Ga0081539_10000021 | Ga0081539_10000021178 | 265 |
| 203 | 3300005985 | Ga0081539_10031167 | Ga0081539_100311673 | 265 |
| 204 | 3300006058 | Ga0075432_10049483 | Ga0075432_100494832 | 265 |
| 205 | 3300006173 | Ga0070716_100015635 | Ga0070716_1000156352 | 265 |
| 206 | 3300006844 | Ga0075428_100001389 | Ga0075428_10000138918 | 265 |
| 207 | 3300006844 | Ga0075428_100003715 | Ga0075428_10000371511 | 265 |
| 208 | 3300006844 | Ga0075428_100210594 | Ga0075428_1002105942 | 265 |
| 209 | 3300006844 | Ga0075428_100272958 | Ga0075428_1002729582 | 265 |
| 210 | 3300006844 | Ga0075428_100284701 | Ga0075428_1002847012 | 265 |
| 211 | 3300006844 | Ga0075428_100362548 | Ga0075428_1003625482 | 265 |
| 212 | 3300006844 | Ga0075428_100531309 | Ga0075428_1005313092 | 265 |
| 213 | 3300006846 | Ga0075430_100001172 | Ga0075430_1000011726 | 265 |
| 214 | 3300006846 | Ga0075430_100002301 | Ga0075430_10000230111 | 265 |
| 215 | 3300006846 | Ga0075430_100008431 | Ga0075430_1000084318 | 265 |
| 216 | 3300006846 | Ga0075430_100334713 | Ga0075430_1003347131 | 265 |
| 217 | 3300006847 | Ga0075431_100002712 | Ga0075431_1000027126 | 265 |
| 218 | 3300006847 | Ga0075431_100008045 | Ga0075431_1000080456 | 265 |
| 219 | 3300006847 | Ga0075431_100161077 | Ga0075431_1001610773 | 265 |
| 220 | 3300006847 | Ga0075431_100310306 | Ga0075431_1003103062 | 265 |
| 221 | 3300006852 | Ga0075433_10001404 | Ga0075433_1000140416 | 265 |
| 222 | 3300006852 | Ga0075433_10028008 | Ga0075433_100280083 | 265 |
| 223 | 3300006852 | Ga0075433_10055198 | Ga0075433_100551983 | 265 |
| 224 | 3300006852 | Ga0075433_10246277 | Ga0075433_102462774 | 265 |
| 225 | 3300006852 | Ga0075433_10379228 | Ga0075433_103792282 | 265 |
| 226 | 3300006871 | Ga0075434_100037372 | Ga0075434_1000373726 | 265 |
| 227 | 3300006871 | Ga0075434_100071271 | Ga0075434_1000712712 | 265 |
| 228 | 3300006871 | Ga0075434_100097029 | Ga0075434_1000970293 | 265 |
| 229 | 3300006871 | Ga0075434_100205158 | Ga0075434_1002051582 | 265 |
| 230 | 3300006871 | Ga0075434_100261864 | Ga0075434_1002618642 | 265 |
| 231 | 3300006871 | Ga0075434_100519922 | Ga0075434_1005199221 | 265 |
| 232 | 3300006871 | Ga0075434_100565560 | Ga0075434_1005655602 | 265 |
| 233 | 3300006880 | Ga0075429_100007420 | Ga0075429_1000074203 | 265 |
| 234 | 3300006880 | Ga0075429_100019832 | Ga0075429_1000198324 | 265 |
| 235 | 3300006880 | Ga0075429_100023371 | Ga0075429_1000233716 | 265 |
| 236 | 3300006880 | Ga0075429_100047238 | Ga0075429_1000472383 | 265 |
| 237 | 3300006880 | Ga0075429_100324454 | Ga0075429_1003244541 | 265 |
| 238 | 3300006881 | Ga0068865_100490423 | Ga0068865_1004904232 | 265 |
| 239 | 3300006914 | Ga0075436_100001877 | Ga0075436_10000187712 | 265 |
| 240 | 3300006914 | Ga0075436_100015732 | Ga0075436_1000157322 | 265 |
| 241 | 3300006931 | Ga0097620_100023979 | Ga0097620_1000239793 | 265 |
| 242 | 3300006931 | Ga0097620_100107527 | Ga0097620_1001075274 | 265 |
| 243 | 3300006931 | Ga0097620_100251393 | Ga0097620_1002513932 | 265 |
| 244 | 3300006931 | Ga0097620_100284149 | Ga0097620_1002841492 | 265 |
| 245 | 3300007076 | Ga0075435_100062156 | Ga0075435_1000621563 | 265 |
| 246 | 3300007076 | Ga0075435_100081720 | Ga0075435_1000817202 | 265 |
| 247 | 3300007076 | Ga0075435_100232970 | Ga0075435_1002329703 | 265 |
| 248 | 3300007265 | Ga0099794_10003016 | Ga0099794_100030163 | 265 |
| 249 | 3300009093 | Ga0105240_10360659 | Ga0105240_103606591 | 265 |
| 250 | 3300009093 | Ga0105240_10526218 | Ga0105240_105262181 | 265 |
| 251 | 3300009094 | Ga0111539_10000098 | Ga0111539_1000009885 | 265 |
| 252 | 3300009094 | Ga0111539_10006099 | Ga0111539_100060997 | 265 |
| 253 | 3300009094 | Ga0111539_10015171 | Ga0111539_1001517110 | 265 |
| 254 | 3300009094 | Ga0111539_10039864 | Ga0111539_100398641 | 265 |
| 255 | 3300009094 | Ga0111539_10163362 | Ga0111539_101633621 | 265 |
| 256 | 3300009147 | Ga0114129_10005514 | Ga0114129_1000551411 | 265 |
| 257 | 3300009147 | Ga0114129_10021159 | Ga0114129_100211598 | 265 |
| 258 | 3300009147 | Ga0114129_10222938 | Ga0114129_102229381 | 265 |
| 259 | 3300009148 | Ga0105243_10075714 | Ga0105243_100757143 | 265 |
| 260 | 3300009174 | Ga0105241_10010697 | Ga0105241_100106975 | 265 |
| 261 | 3300009553 | Ga0105249_10438533 | Ga0105249_104385332 | 265 |
| 262 | 3300013102 | Ga0157371_10375909 | Ga0157371_103759091 | 265 |
| 263 | 3300013104 | Ga0157370_10067301 | Ga0157370_100673013 | 265 |
| 264 | 3300013297 | Ga0157378_10250837 | Ga0157378_102508371 | 265 |
| 265 | 3300013307 | Ga0157372_10000612 | Ga0157372_1000061225 | 265 |
| 266 | 3300013307 | Ga0157372_10178659 | Ga0157372_101786592 | 265 |
| 267 | 3300013308 | Ga0157375_10593522 | Ga0157375_105935222 | 265 |
| 268 | 3300014325 | Ga0163163_10022085 | Ga0163163_100220854 | 265 |
| 269 | 3300014968 | Ga0157379_10007151 | Ga0157379_1000715115 | 265 |
| 270 | 3300014968 | Ga0157379_10266603 | Ga0157379_102666032 | 265 |
| 271 | 3300014968 | Ga0157379_10378844 | Ga0157379_103788441 | 265 |
| 272 | 3300014969 | Ga0157376_10807938 | Ga0157376_108079381 | 265 |
| 273 | 3300017792 | Ga0163161_10169085 | Ga0163161_101690852 | 265 |
| 274 | 3300025899 | Ga0207642_10064976 | Ga0207642_100649762 | 265 |
| 275 | 3300025900 | Ga0207710_10034098 | Ga0207710_100340983 | 265 |
| 276 | 3300025901 | Ga0207688_10008445 | Ga0207688_100084457 | 265 |
| 277 | 3300025904 | Ga0207647_10026791 | Ga0207647_100267912 | 265 |
| 278 | 3300025907 | Ga0207645_10145964 | Ga0207645_101459641 | 265 |
| 279 | 3300025908 | Ga0207643_10012683 | Ga0207643_100126834 | 265 |
| 280 | 3300025910 | Ga0207684_10008329 | Ga0207684_100083295 | 265 |
| 281 | 3300025910 | Ga0207684_10048374 | Ga0207684_100483743 | 265 |
| 282 | 3300025910 | Ga0207684_10251054 | Ga0207684_102510542 | 265 |
| 283 | 3300025910 | Ga0207684_10571499 | Ga0207684_105714991 | 265 |
| 284 | 3300025911 | Ga0207654_10010924 | Ga0207654_100109243 | 265 |
| 285 | 3300025912 | Ga0207707_10000170 | Ga0207707_1000017021 | 265 |
| 286 | 3300025912 | Ga0207707_10158782 | Ga0207707_101587822 | 265 |
| 287 | 3300025913 | Ga0207695_10440586 | Ga0207695_104405862 | 265 |
| 288 | 3300025915 | Ga0207693_10019858 | Ga0207693_100198585 | 265 |
| 289 | 3300025916 | Ga0207663_10040687 | Ga0207663_100406872 | 265 |
| 290 | 3300025917 | Ga0207660_10013858 | Ga0207660_100138584 | 265 |
| 291 | 3300025917 | Ga0207660_10084372 | Ga0207660_100843722 | 265 |
| 292 | 3300025919 | Ga0207657_10001106 | Ga0207657_1000110620 | 265 |
| 293 | 3300025920 | Ga0207649_10014769 | Ga0207649_100147696 | 265 |
| 294 | 3300025921 | Ga0207652_10004264 | Ga0207652_1000426411 | 265 |
| 295 | 3300025922 | Ga0207646_10055267 | Ga0207646_100552675 | 265 |
| 296 | 3300025922 | Ga0207646_10063838 | Ga0207646_100638383 | 265 |
| 297 | 3300025922 | Ga0207646_10095143 | Ga0207646_100951434 | 265 |
| 298 | 3300025922 | Ga0207646_10361026 | Ga0207646_103610262 | 265 |
| 299 | 3300025923 | Ga0207681_10300442 | Ga0207681_103004422 | 265 |
| 300 | 3300025925 | Ga0207650_10024111 | Ga0207650_100241114 | 265 |
| 301 | 3300025932 | Ga0207690_10002071 | Ga0207690_1000207111 | 265 |
| 302 | 3300025933 | Ga0207706_10023768 | Ga0207706_100237684 | 265 |
| 303 | 3300025934 | Ga0207686_10228659 | Ga0207686_102286592 | 265 |
| 304 | 3300025936 | Ga0207670_10022880 | Ga0207670_100228803 | 265 |
| 305 | 3300025939 | Ga0207665_10019498 | Ga0207665_100194984 | 265 |
| 306 | 3300025941 | Ga0207711_10221628 | Ga0207711_102216282 | 265 |
| 307 | 3300025942 | Ga0207689_10027704 | Ga0207689_100277041 | 265 |
| 308 | 3300025942 | Ga0207689_10084832 | Ga0207689_100848323 | 265 |
| 309 | 3300025945 | Ga0207679_10000523 | Ga0207679_1000052321 | 265 |
| 310 | 3300025949 | Ga0207667_10100023 | Ga0207667_101000232 | 265 |
| 311 | 3300025981 | Ga0207640_10069230 | Ga0207640_100692302 | 265 |
| 312 | 3300026023 | Ga0207677_10425041 | Ga0207677_104250412 | 265 |
| 313 | 3300026035 | Ga0207703_10581367 | Ga0207703_105813671 | 265 |
| 314 | 3300026075 | Ga0207708_10176607 | Ga0207708_101766073 | 265 |
| 315 | 3300026078 | Ga0207702_10000493 | Ga0207702_1000049311 | 265 |
| 316 | 3300026088 | Ga0207641_10272596 | Ga0207641_102725962 | 265 |
| 317 | 3300026089 | Ga0207648_10077191 | Ga0207648_100771913 | 265 |
| 318 | 3300026095 | Ga0207676_10091394 | Ga0207676_100913943 | 265 |
| 319 | 3300026116 | Ga0207674_10001680 | Ga0207674_1000168016 | 265 |
| 320 | 3300026116 | Ga0207674_10072516 | Ga0207674_100725166 | 265 |
| 321 | 3300026142 | Ga0207698_10647175 | Ga0207698_106471752 | 265 |
| 322 | 3300027395 | Ga0209996_1000557 | Ga0209996_10005572 | 265 |
| 323 | 3300027471 | Ga0209995_1006153 | Ga0209995_10061532 | 265 |
| 324 | 3300027526 | Ga0209968_1000802 | Ga0209968_10008022 | 265 |
| 325 | 3300027543 | Ga0209999_1009513 | Ga0209999_10095132 | 265 |
| 326 | 3300027614 | Ga0209970_1030826 | Ga0209970_10308261 | 265 |
| 327 | 3300027665 | Ga0209983_1010399 | Ga0209983_10103992 | 265 |
| 328 | 3300027682 | Ga0209971_1000574 | Ga0209971_100057410 | 265 |
| 329 | 3300027695 | Ga0209966_1000416 | Ga0209966_10004163 | 265 |
| 330 | 3300027717 | Ga0209998_10001841 | Ga0209998_100018412 | 265 |
| 331 | 3300027876 | Ga0209974_10001363 | Ga0209974_100013632 | 265 |
| 332 | 3300027907 | Ga0207428_10000341 | Ga0207428_1000034137 | 265 |
| 333 | 3300027907 | Ga0207428_10003164 | Ga0207428_1000316414 | 265 |
| 334 | 3300027907 | Ga0207428_10010024 | Ga0207428_100100243 | 265 |
| 335 | 3300027907 | Ga0207428_10164161 | Ga0207428_101641612 | 265 |
| 336 | 3300028380 | Ga0268265_10106556 | Ga0268265_101065563 | 265 |
| 337 | 3300028380 | Ga0268265_10369773 | Ga0268265_103697731 | 265 |
| 338 | 3300028381 | Ga0268264_10130543 | Ga0268264_101305432 | 265 |
| 339 | 3300028381 | Ga0268264_10242771 | Ga0268264_102427711 | 265 |
| 340 | 3300031548 | Ga0307408_100007449 | Ga0307408_1000074495 | 265 |
| 341 | 3300032005 | Ga0307411_10242894 | Ga0307411_102428942 | 265 |
| 342 | 3300034818 | Ga0373950_0020086 | Ga0373950_0020086_143_961 | 265 |
| 343 | 3300035121 | Ga0373960_0010057 | Ga0373960_0010057_1283_2101 | 265 |
| 344 | 3300035171 | Ga0373946_0060724 | Ga0373946_0060724_433_1248 | 265 |
| 345 | 3300035241 | Ga0373961_0011996 | Ga0373961_0011996_222_1040 | 265 |
| 346 | 3300035695 | Ga0373927_0257915 | Ga0373927_0257915_243_1058 | 265 |
| 347 | 3300035724 | Ga0373933_0124382 | Ga0373933_0124382_771_1586 | 265 |
| 348 | 3300035725 | Ga0373947_0121834 | Ga0373947_0121834_481_1296 | 265 |
| 349 | 3300036401 | Ga0373937_0101362 | Ga0373937_0101362_1011_1823 | 265 |
| 350 | 3300037068 | Ga0373925_0025637 | Ga0373925_0025637_1068_1883 | 265 |
| 351 | 3300037471 | Ga0395905_0154660 | Ga0395905_0154660_1114_1932 | 265 |
| 352 | 3300038698 | Ga0242419_000774 | Ga0242419_000774_864_1682 | 265 |
| 353 | 3300039437 | Ga0436365_0469844 | Ga0436365_0469844_279_1100 | 265 |
| 354 | 3300042003 | Ga0439443_007911 | Ga0439443_007911_395_1213 | 265 |
| 355 | 3300042005 | Ga0439448_0004733 | Ga0439448_0004733_2533_3363 | 265 |
| 356 | 3300042005 | Ga0439448_0062803 | Ga0439448_0062803_223_1041 | 265 |
| 357 | 3300042011 | Ga0439454_002012 | Ga0439454_002012_1136_1954 | 265 |
| 358 | 3300042012 | Ga0439455_0007857 | Ga0439455_0007857_23_841 | 265 |
| 359 | 3300042013 | Ga0439456_020830 | Ga0439456_020830_221_1039 | 265 |
| 360 | 3300042157 | Ga0439458_0003476 | Ga0439458_0003476_1748_2566 | 265 |
| 361 | 3300042157 | Ga0439458_0032782 | Ga0439458_0032782_90_908 | 265 |
| 362 | 3300042437 | Ga0439444_0015911 | Ga0439444_0015911_314_1132 | 265 |
| 363 | 3300042461 | Ga0439460_0061952 | Ga0439460_0061952_275_1093 | 265 |
| 364 | 3300042876 | Ga0451577_0008310 | Ga0451577_0008310_1437_2255 | 265 |
| 365 | 3300042876 | Ga0451577_0034237 | Ga0451577_0034237_2738_3556 | 265 |
| 366 | 3300044673 | Ga0453683_0105723 | Ga0453683_0105723_249_1067 | 265 |
| 367 | 3300044673 | Ga0453683_0168758 | Ga0453683_0168758_182_1000 | 265 |
| 368 | 3300044673 | Ga0453683_0169769 | Ga0453683_0169769_491_1309 | 265 |
| 369 | 3300044712 | Ga0453684_0441454 | Ga0453684_0441454_485_1303 | 265 |
| 370 | 3300044901 | Ga0466960_0017701 | Ga0466960_0017701_818_1636 | 265 |
| 371 | 3300045051 | Ga0451576_0038151 | Ga0451576_0038151_939_1757 | 265 |
| 372 | 3300045051 | Ga0451576_0075915 | Ga0451576_0075915_348_1166 | 265 |
| 373 | 3300045051 | Ga0451576_0096233 | Ga0451576_0096233_1052_1870 | 265 |
| 374 | 3300045051 | Ga0451576_0241924 | Ga0451576_0241924_542_1372 | 265 |
| 375 | 3300045051 | Ga0451576_0301506 | Ga0451576_0301506_118_936 | 265 |
| 376 | 3300046472 | Ga0495580_0034280 | Ga0495580_0034280_599_1417 | 265 |
| 377 | 3300046472 | Ga0495580_0109918 | Ga0495580_0109918_201_1019 | 265 |
| 378 | 3300046492 | Ga0495585_0020518 | Ga0495585_0020518_2884_3702 | 265 |
| 379 | 3300046537 | Ga0495598_0042554 | Ga0495598_0042554_230_1048 | 265 |
| 380 | 3300046538 | Ga0495609_0083286 | Ga0495609_0083286_160_978 | 265 |
| 381 | 3300046615 | Ga0495656_0022506 | Ga0495656_0022506_155_973 | 265 |
| 382 | 3300046691 | Ga0495670_0117994 | Ga0495670_0117994_286_1104 | 265 |
| 383 | 3300048905 | Ga0496102_0213606 | Ga0496102_0213606_236_1054 | 265 |
| 384 | 3300048905 | Ga0496102_0430062 | Ga0496102_0430062_47_865 | 265 |
| 385 | 3300048906 | Ga0496103_0181678 | Ga0496103_0181678_275_1093 | 265 |
| 386 | 3300048910 | Ga0496107_0093032 | Ga0496107_0093032_588_1406 | 265 |
| 387 | 3300048912 | Ga0496109_0284093 | Ga0496109_0284093_620_1438 | 265 |
| 388 | 3300049568 | Ga0501031_0055022 | Ga0501031_0055022_1373_2191 | 265 |
| 389 | 3300049569 | Ga0501032_0284764 | Ga0501032_0284764_217_1035 | 265 |
| 390 | 3300049570 | Ga0501033_0028100 | Ga0501033_0028100_3027_3845 | 265 |
| 391 | 3300049576 | Ga0501040_0011967 | Ga0501040_0011967_1360_2178 | 265 |
| 392 | 3300049576 | Ga0501040_0097457 | Ga0501040_0097457_950_1765 | 265 |
| 393 | 3300049578 | Ga0501042_0437871 | Ga0501042_0437871_25_861 | 265 |
| 394 | 3300049580 | Ga0501046_0008696 | Ga0501046_0008696_717_1535 | 265 |
| 395 | 3300049580 | Ga0501046_0216241 | Ga0501046_0216241_76_888 | 265 |
| 396 | 3300049581 | Ga0501047_0229759 | Ga0501047_0229759_20_838 | 265 |
| 397 | 3300049587 | Ga0501071_0095327 | Ga0501071_0095327_312_1127 | 265 |
| 398 | 3300049588 | Ga0501072_0165654 | Ga0501072_0165654_515_1333 | 265 |
| 399 | 3300049590 | Ga0501074_0155600 | Ga0501074_0155600_269_1087 | 265 |
| 400 | 3300049591 | Ga0501075_0019807 | Ga0501075_0019807_3546_4364 | 265 |
| 401 | 3300049591 | Ga0501075_0267581 | Ga0501075_0267581_18_836 | 265 |
| 402 | 3300049592 | Ga0501076_0009174 | Ga0501076_0009174_4068_4886 | 265 |
| 403 | 3300049592 | Ga0501076_0051075 | Ga0501076_0051075_1460_2275 | 265 |
| 404 | 3300049593 | Ga0501077_0043878 | Ga0501077_0043878_599_1417 | 265 |
| 405 | 3300049742 | Ga0501080_0105835 | Ga0501080_0105835_990_1808 | 265 |
| 406 | 3300049743 | Ga0501081_0069521 | Ga0501081_0069521_381_1196 | 265 |
| 407 | 3300049743 | Ga0501081_0103034 | Ga0501081_0103034_198_1016 | 265 |
| 408 | 3300049824 | Ga0501045_0004695 | Ga0501045_0004695_2895_3713 | 265 |
| 409 | 3300049824 | Ga0501045_0091395 | Ga0501045_0091395_912_1727 | 265 |
| 410 | 3300050507 | nmdc:mga05p37_11702_c1 | nmdc:mga05p37_11702_c1_9341_10159 | 265 |
| 411 | 3300050507 | nmdc:mga05p37_13953_c1 | nmdc:mga05p37_13953_c1_2628_3446 | 265 |
| 412 | 3300050507 | nmdc:mga05p37_18613_c1 | nmdc:mga05p37_18613_c1_7540_8358 | 265 |
| 413 | 3300050507 | nmdc:mga05p37_187746_c1 | nmdc:mga05p37_187746_c1_1190_2008 | 265 |
| 414 | 3300050507 | nmdc:mga05p37_3695_c1 | nmdc:mga05p37_3695_c1_12027_12848 | 265 |
| 415 | 3300050507 | nmdc:mga05p37_49599_c1 | nmdc:mga05p37_49599_c1_3697_4515 | 265 |
| 416 | 3300050507 | nmdc:mga05p37_497203_c1 | nmdc:mga05p37_497203_c1_425_1243 | 265 |
| 417 | 3300050507 | nmdc:mga05p37_50609_c1 | nmdc:mga05p37_50609_c1_48_866 | 265 |
| 418 | 3300050507 | nmdc:mga05p37_72066_c1 | nmdc:mga05p37_72066_c1_2272_3090 | 265 |
| 419 | 3300050507 | nmdc:mga05p37_93333_c1 | nmdc:mga05p37_93333_c1_2293_3111 | 265 |
| 420 | 3300050508 | nmdc:mga09592_11845_c1 | nmdc:mga09592_11845_c1_1164_1982 | 265 |
| 421 | 3300050508 | nmdc:mga09592_4575_c1 | nmdc:mga09592_4575_c1_1696_2514 | 265 |
| 422 | 3300050508 | nmdc:mga09592_9333_c1 | nmdc:mga09592_9333_c1_6928_7746 | 265 |
| 423 | 3300050509 | nmdc:mga0qj67_181262_c1 | nmdc:mga0qj67_181262_c1_309_1127 | 265 |
| 424 | 3300050509 | nmdc:mga0qj67_28136_c1 | nmdc:mga0qj67_28136_c1_868_1686 | 265 |
| 425 | 3300050509 | nmdc:mga0qj67_306405_c1 | nmdc:mga0qj67_306405_c1_192_1010 | 265 |
| 426 | 3300050509 | nmdc:mga0qj67_4500_c1 | nmdc:mga0qj67_4500_c1_4964_5785 | 265 |
| 427 | 3300050509 | nmdc:mga0qj67_6292_c1 | nmdc:mga0qj67_6292_c1_6488_7312 | 265 |
| 428 | 3300050510 | nmdc:mga06r32_15165_c1 | nmdc:mga06r32_15165_c1_3059_3880 | 265 |
| 429 | 3300050510 | nmdc:mga06r32_15543_c1 | nmdc:mga06r32_15543_c1_1318_2136 | 265 |
| 430 | 3300050510 | nmdc:mga06r32_3616_c1 | nmdc:mga06r32_3616_c1_9459_10277 | 265 |
| 431 | 3300050510 | nmdc:mga06r32_38249_c1 | nmdc:mga06r32_38249_c1_2943_3761 | 265 |
| 432 | 3300050510 | nmdc:mga06r32_51413_c1 | nmdc:mga06r32_51413_c1_82_900 | 265 |
| 433 | 3300050511 | nmdc:mga08y16_2072_c1 | nmdc:mga08y16_2072_c1_16677_17495 | 265 |
| 434 | 3300050511 | nmdc:mga08y16_2077_c1 | nmdc:mga08y16_2077_c1_781_1599 | 265 |
| 435 | 3300050511 | nmdc:mga08y16_271415_c1 | nmdc:mga08y16_271415_c1_714_1532 | 265 |
| 436 | 3300050511 | nmdc:mga08y16_318024_c1 | nmdc:mga08y16_318024_c1_417_1235 | 265 |
| 437 | 3300050511 | nmdc:mga08y16_424193_c1 | nmdc:mga08y16_424193_c1_78_926 | 265 |
| 438 | 3300050511 | nmdc:mga08y16_61788_c1 | nmdc:mga08y16_61788_c1_1268_2086 | 265 |
| 439 | 3300050512 | nmdc:mga0n895_15352_c1 | nmdc:mga0n895_15352_c1_5312_6130 | 265 |
| 440 | 3300050512 | nmdc:mga0n895_160407_c1 | nmdc:mga0n895_160407_c1_511_1329 | 265 |
| 441 | 3300050512 | nmdc:mga0n895_199044_c1 | nmdc:mga0n895_199044_c1_82_900 | 265 |
| 442 | 3300050512 | nmdc:mga0n895_335478_c1 | nmdc:mga0n895_335478_c1_515_1333 | 265 |
| 443 | 3300050512 | nmdc:mga0n895_462276_c1 | nmdc:mga0n895_462276_c1_117_950 | 265 |
| 444 | 3300050512 | nmdc:mga0n895_531656_c1 | nmdc:mga0n895_531656_c1_152_970 | 265 |
| 445 | 3300050512 | nmdc:mga0n895_62339_c1 | nmdc:mga0n895_62339_c1_455_1273 | 265 |
| 446 | 3300050512 | nmdc:mga0n895_96721_c1 | nmdc:mga0n895_96721_c1_1493_2311 | 265 |
| 447 | 3300050513 | nmdc:mga0rr50_21612_c1 | nmdc:mga0rr50_21612_c1_11_829 | 265 |
| 448 | 3300050513 | nmdc:mga0rr50_221421_c1 | nmdc:mga0rr50_221421_c1_191_1009 | 265 |
| 449 | 3300050513 | nmdc:mga0rr50_2510_c1 | nmdc:mga0rr50_2510_c1_2328_3146 | 265 |
| 450 | 3300050514 | nmdc:mga08x19_11850_c1 | nmdc:mga08x19_11850_c1_911_1729 | 265 |
| 451 | 3300050514 | nmdc:mga08x19_275225_c1 | nmdc:mga08x19_275225_c1_326_1144 | 265 |
| 452 | 3300050514 | nmdc:mga08x19_292274_c1 | nmdc:mga08x19_292274_c1_261_1079 | 265 |
| 453 | 3300050514 | nmdc:mga08x19_7456_c1 | nmdc:mga08x19_7456_c1_724_1542 | 265 |
| 454 | 3300050515 | nmdc:mga0a205_1834_c1 | nmdc:mga0a205_1834_c1_4527_5345 | 265 |
| 455 | 3300050515 | nmdc:mga0a205_317331_c1 | nmdc:mga0a205_317331_c1_32_850 | 265 |
| 456 | 3300050515 | nmdc:mga0a205_33040_c1 | nmdc:mga0a205_33040_c1_1879_2697 | 265 |
| 457 | 3300050515 | nmdc:mga0a205_33041_c1 | nmdc:mga0a205_33041_c1_1175_1993 | 265 |
| 458 | 3300050515 | nmdc:mga0a205_502448_c1 | nmdc:mga0a205_502448_c1_16_834 | 265 |
| 459 | 3300050515 | nmdc:mga0a205_61211_c1 | nmdc:mga0a205_61211_c1_299_1117 | 265 |
| 460 | 3300050515 | nmdc:mga0a205_7552_c1 | nmdc:mga0a205_7552_c1_7061_7879 | 265 |
| 461 | 3300050515 | nmdc:mga0a205_83920_c1 | nmdc:mga0a205_83920_c1_465_1313 | 265 |
| 462 | 3300054114 | Ga0501084_0092355 | Ga0501084_0092355_1441_2259 | 265 |
| 463 | 3300060353 | Ga0501082_0009040 | Ga0501082_0009040_4591_5409 | 265 |
| 464 | 3300060353 | Ga0501082_0500421 | Ga0501082_0500421_143_961 | 265 |
| 465 | 3300061734 | Ga0530510_0038180 | Ga0530510_0038180_204_1022 | 265 |
| 466 | 3300061734 | Ga0530510_0080309 | Ga0530510_0080309_88_906 | 265 |
| 467 | 3300061734 | Ga0530510_0103036 | Ga0530510_0103036_368_1183 | 265 |
| 468 | 3300005330 | Ga0070690_100119716 | Ga0070690_1001197163 | 266 |
| 469 | 3300005355 | Ga0070671_100353110 | Ga0070671_1003531102 | 266 |
| 470 | 3300005440 | Ga0070705_100089981 | Ga0070705_1000899812 | 266 |
| 471 | 3300005444 | Ga0070694_100070908 | Ga0070694_1000709082 | 266 |
| 472 | 3300005518 | Ga0070699_100002124 | Ga0070699_10000212414 | 266 |
| 473 | 3300005545 | Ga0070695_100013796 | Ga0070695_1000137962 | 266 |
| 474 | 3300005546 | Ga0070696_100083525 | Ga0070696_1000835252 | 266 |
| 475 | 3300005549 | Ga0070704_100137386 | Ga0070704_1001373862 | 266 |
| 476 | 3300005617 | Ga0068859_100232191 | Ga0068859_1002321912 | 266 |
| 477 | 3300005983 | Ga0081540_1009575 | Ga0081540_10095754 | 266 |
| 478 | 3300006028 | Ga0070717_10043316 | Ga0070717_100433166 | 266 |
| 479 | 3300006844 | Ga0075428_100000103 | Ga0075428_10000010354 | 266 |
| 480 | 3300006844 | Ga0075428_100472058 | Ga0075428_1004720582 | 266 |
| 481 | 3300006846 | Ga0075430_100008431 | Ga0075430_1000084319 | 266 |
| 482 | 3300006880 | Ga0075429_100056275 | Ga0075429_1000562754 | 266 |
| 483 | 3300006931 | Ga0097620_100232183 | Ga0097620_1002321832 | 266 |
| 484 | 3300009094 | Ga0111539_10000527 | Ga0111539_1000052729 | 266 |
| 485 | 3300009147 | Ga0114129_10221888 | Ga0114129_102218882 | 266 |
| 486 | 3300025931 | Ga0207644_10231329 | Ga0207644_102313292 | 266 |
| 487 | 3300025961 | Ga0207712_10265123 | Ga0207712_102651232 | 266 |
| 488 | 3300027907 | Ga0207428_10010492 | Ga0207428_100104928 | 266 |
| 489 | 3300039438 | Ga0436360_0479510 | Ga0436360_0479510_59_904 | 266 |
| 490 | 3300039450 | Ga0436363_1130753 | Ga0436363_1130753_379_1197 | 266 |
| 491 | 3300046454 | Ga0495592_0071975 | Ga0495592_0071975_1474_2289 | 266 |
| 492 | 3300049572 | Ga0501036_0039695 | Ga0501036_0039695_3116_3931 | 266 |
| 493 | 3300049572 | Ga0501036_0378370 | Ga0501036_0378370_52_876 | 266 |
| 494 | 3300050507 | nmdc:mga05p37_275468_c1 | nmdc:mga05p37_275468_c1_309_1109 | 266 |
| 495 | 3300050508 | nmdc:mga09592_7598_c1 | nmdc:mga09592_7598_c1_6433_7257 | 266 |
| 496 | 3300050509 | nmdc:mga0qj67_6292_c1 | nmdc:mga0qj67_6292_c1_7399_8226 | 266 |
| 497 | 3300050511 | nmdc:mga08y16_1374_c1 | nmdc:mga08y16_1374_c1_18687_19511 | 266 |
| 498 | 3300050511 | nmdc:mga08y16_174421_c1 | nmdc:mga08y16_174421_c1_1307_2125 | 266 |
| 499 | 3300053077 | Ga0495601_0004617 | Ga0495601_0004617_5414_6229 | 266 |
| 500 | 3300053085 | Ga0495619_0001776 | Ga0495619_0001776_9806_10621 | 266 |
| 501 | 3300005295 | Ga0065707_10171061 | Ga0065707_101710612 | 267 |
| 502 | 3300005328 | Ga0070676_10000139 | Ga0070676_100001395 | 267 |
| 503 | 3300005329 | Ga0070683_100031139 | Ga0070683_1000311392 | 267 |
| 504 | 3300005329 | Ga0070683_100216685 | Ga0070683_1002166853 | 267 |
| 505 | 3300005330 | Ga0070690_100108173 | Ga0070690_1001081732 | 267 |
| 506 | 3300005331 | Ga0070670_100009863 | Ga0070670_1000098636 | 267 |
| 507 | 3300005334 | Ga0068869_100008319 | Ga0068869_1000083194 | 267 |
| 508 | 3300005336 | Ga0070680_100015720 | Ga0070680_1000157204 | 267 |
| 509 | 3300005336 | Ga0070680_100018671 | Ga0070680_1000186714 | 267 |
| 510 | 3300005337 | Ga0070682_100002778 | Ga0070682_1000027787 | 267 |
| 511 | 3300005338 | Ga0068868_100058978 | Ga0068868_1000589781 | 267 |
| 512 | 3300005338 | Ga0068868_100560568 | Ga0068868_1005605681 | 267 |
| 513 | 3300005339 | Ga0070660_100003858 | Ga0070660_10000385810 | 267 |
| 514 | 3300005340 | Ga0070689_100014713 | Ga0070689_1000147133 | 267 |
| 515 | 3300005341 | Ga0070691_10006870 | Ga0070691_100068703 | 267 |
| 516 | 3300005344 | Ga0070661_100003154 | Ga0070661_10000315412 | 267 |
| 517 | 3300005345 | Ga0070692_10000852 | Ga0070692_1000085210 | 267 |
| 518 | 3300005345 | Ga0070692_10038767 | Ga0070692_100387671 | 267 |
| 519 | 3300005347 | Ga0070668_100238987 | Ga0070668_1002389872 | 267 |
| 520 | 3300005353 | Ga0070669_100018188 | Ga0070669_1000181884 | 267 |
| 521 | 3300005353 | Ga0070669_100047314 | Ga0070669_1000473142 | 267 |
| 522 | 3300005353 | Ga0070669_100219121 | Ga0070669_1002191212 | 267 |
| 523 | 3300005355 | Ga0070671_100028581 | Ga0070671_1000285817 | 267 |
| 524 | 3300005355 | Ga0070671_100335524 | Ga0070671_1003355241 | 267 |
| 525 | 3300005364 | Ga0070673_100089595 | Ga0070673_1000895953 | 267 |
| 526 | 3300005366 | Ga0070659_100000845 | Ga0070659_10000084519 | 267 |
| 527 | 3300005406 | Ga0070703_10012015 | Ga0070703_100120152 | 267 |
| 528 | 3300005434 | Ga0070709_10044346 | Ga0070709_100443462 | 267 |
| 529 | 3300005434 | Ga0070709_10174078 | Ga0070709_101740782 | 267 |
| 530 | 3300005435 | Ga0070714_100046847 | Ga0070714_1000468473 | 267 |
| 531 | 3300005435 | Ga0070714_100084675 | Ga0070714_1000846752 | 267 |
| 532 | 3300005435 | Ga0070714_100598110 | Ga0070714_1005981101 | 267 |
| 533 | 3300005436 | Ga0070713_100215916 | Ga0070713_1002159162 | 267 |
| 534 | 3300005436 | Ga0070713_100410993 | Ga0070713_1004109932 | 267 |
| 535 | 3300005437 | Ga0070710_10008505 | Ga0070710_100085052 | 267 |
| 536 | 3300005439 | Ga0070711_100025659 | Ga0070711_1000256593 | 267 |
| 537 | 3300005439 | Ga0070711_100099749 | Ga0070711_1000997492 | 267 |
| 538 | 3300005440 | Ga0070705_100007634 | Ga0070705_1000076345 | 267 |
| 539 | 3300005441 | Ga0070700_100003634 | Ga0070700_1000036347 | 267 |
| 540 | 3300005444 | Ga0070694_100008535 | Ga0070694_1000085356 | 267 |
| 541 | 3300005444 | Ga0070694_100019525 | Ga0070694_1000195252 | 267 |
| 542 | 3300005444 | Ga0070694_100090621 | Ga0070694_1000906212 | 267 |
| 543 | 3300005445 | Ga0070708_100392260 | Ga0070708_1003922602 | 267 |
| 544 | 3300005445 | Ga0070708_100454447 | Ga0070708_1004544472 | 267 |
| 545 | 3300005455 | Ga0070663_100002361 | Ga0070663_1000023617 | 267 |
| 546 | 3300005456 | Ga0070678_100178491 | Ga0070678_1001784911 | 267 |
| 547 | 3300005457 | Ga0070662_100006420 | Ga0070662_1000064206 | 267 |
| 548 | 3300005458 | Ga0070681_10069882 | Ga0070681_100698822 | 267 |
| 549 | 3300005458 | Ga0070681_10360246 | Ga0070681_103602462 | 267 |
| 550 | 3300005459 | Ga0068867_100002041 | Ga0068867_10000204112 | 267 |
| 551 | 3300005467 | Ga0070706_100035549 | Ga0070706_1000355493 | 267 |
| 552 | 3300005467 | Ga0070706_100046033 | Ga0070706_1000460335 | 267 |
| 553 | 3300005467 | Ga0070706_100064868 | Ga0070706_1000648683 | 267 |
| 554 | 3300005467 | Ga0070706_100125561 | Ga0070706_1001255614 | 267 |
| 555 | 3300005467 | Ga0070706_100137790 | Ga0070706_1001377902 | 267 |
| 556 | 3300005467 | Ga0070706_100217239 | Ga0070706_1002172392 | 267 |
| 557 | 3300005468 | Ga0070707_100024547 | Ga0070707_1000245473 | 267 |
| 558 | 3300005468 | Ga0070707_100028956 | Ga0070707_1000289562 | 267 |
| 559 | 3300005468 | Ga0070707_100032796 | Ga0070707_1000327963 | 267 |
| 560 | 3300005468 | Ga0070707_100108925 | Ga0070707_1001089252 | 267 |
| 561 | 3300005468 | Ga0070707_100164163 | Ga0070707_1001641632 | 267 |
| 562 | 3300005468 | Ga0070707_100312867 | Ga0070707_1003128672 | 267 |
| 563 | 3300005471 | Ga0070698_100019850 | Ga0070698_1000198504 | 267 |
| 564 | 3300005471 | Ga0070698_100386797 | Ga0070698_1003867971 | 267 |
| 565 | 3300005518 | Ga0070699_100020265 | Ga0070699_1000202652 | 267 |
| 566 | 3300005518 | Ga0070699_100049292 | Ga0070699_1000492923 | 267 |
| 567 | 3300005518 | Ga0070699_100056610 | Ga0070699_1000566102 | 267 |
| 568 | 3300005518 | Ga0070699_100512462 | Ga0070699_1005124622 | 267 |
| 569 | 3300005530 | Ga0070679_100001475 | Ga0070679_10000147514 | 267 |
| 570 | 3300005530 | Ga0070679_100044379 | Ga0070679_1000443794 | 267 |
| 571 | 3300005530 | Ga0070679_100140190 | Ga0070679_1001401902 | 267 |
| 572 | 3300005530 | Ga0070679_100300361 | Ga0070679_1003003612 | 267 |
| 573 | 3300005535 | Ga0070684_100205850 | Ga0070684_1002058502 | 267 |
| 574 | 3300005535 | Ga0070684_100506100 | Ga0070684_1005061001 | 267 |
| 575 | 3300005536 | Ga0070697_100088887 | Ga0070697_1000888872 | 267 |
| 576 | 3300005539 | Ga0068853_100000232 | Ga0068853_1000002321 | 267 |
| 577 | 3300005543 | Ga0070672_100013035 | Ga0070672_1000130355 | 267 |
| 578 | 3300005544 | Ga0070686_100046147 | Ga0070686_1000461472 | 267 |
| 579 | 3300005546 | Ga0070696_100002075 | Ga0070696_1000020753 | 267 |
| 580 | 3300005547 | Ga0070693_100000028 | Ga0070693_10000002822 | 267 |
| 581 | 3300005549 | Ga0070704_100007578 | Ga0070704_1000075786 | 267 |
| 582 | 3300005549 | Ga0070704_100033340 | Ga0070704_1000333405 | 267 |
| 583 | 3300005549 | Ga0070704_100178648 | Ga0070704_1001786482 | 267 |
| 584 | 3300005549 | Ga0070704_100482713 | Ga0070704_1004827132 | 267 |
| 585 | 3300005563 | Ga0068855_100001875 | Ga0068855_1000018753 | 267 |
| 586 | 3300005564 | Ga0070664_100036938 | Ga0070664_1000369386 | 267 |
| 587 | 3300005564 | Ga0070664_100219696 | Ga0070664_1002196963 | 267 |
| 588 | 3300005614 | Ga0068856_100044583 | Ga0068856_1000445832 | 267 |
| 589 | 3300005614 | Ga0068856_100522601 | Ga0068856_1005226012 | 267 |
| 590 | 3300005617 | Ga0068859_100042516 | Ga0068859_1000425165 | 267 |
| 591 | 3300005617 | Ga0068859_100149416 | Ga0068859_1001494162 | 267 |
| 592 | 3300005618 | Ga0068864_100045652 | Ga0068864_1000456522 | 267 |
| 593 | 3300005719 | Ga0068861_100003774 | Ga0068861_1000037746 | 267 |
| 594 | 3300005719 | Ga0068861_100118513 | Ga0068861_1001185131 | 267 |
| 595 | 3300005719 | Ga0068861_100568862 | Ga0068861_1005688621 | 267 |
| 596 | 3300005840 | Ga0068870_10000446 | Ga0068870_100004465 | 267 |
| 597 | 3300005841 | Ga0068863_100032204 | Ga0068863_1000322045 | 267 |
| 598 | 3300005841 | Ga0068863_100094075 | Ga0068863_1000940752 | 267 |
| 599 | 3300005842 | Ga0068858_100010646 | Ga0068858_1000106468 | 267 |
| 600 | 3300005842 | Ga0068858_100144238 | Ga0068858_1001442382 | 267 |
| 601 | 3300005842 | Ga0068858_100220348 | Ga0068858_1002203481 | 267 |
| 602 | 3300005843 | Ga0068860_100029232 | Ga0068860_1000292323 | 267 |
| 603 | 3300005843 | Ga0068860_100080148 | Ga0068860_1000801483 | 267 |
| 604 | 3300005843 | Ga0068860_100098090 | Ga0068860_1000980903 | 267 |
| 605 | 3300005843 | Ga0068860_100098138 | Ga0068860_1000981381 | 267 |
| 606 | 3300005844 | Ga0068862_100022721 | Ga0068862_1000227213 | 267 |
| 607 | 3300005844 | Ga0068862_100334577 | Ga0068862_1003345772 | 267 |
| 608 | 3300005981 | Ga0081538_10148360 | Ga0081538_101483601 | 267 |
| 609 | 3300005983 | Ga0081540_1018443 | Ga0081540_10184433 | 267 |
| 610 | 3300005983 | Ga0081540_1019705 | Ga0081540_10197056 | 267 |
| 611 | 3300006028 | Ga0070717_10000606 | Ga0070717_1000060622 | 267 |
| 612 | 3300006028 | Ga0070717_10158959 | Ga0070717_101589592 | 267 |
| 613 | 3300006175 | Ga0070712_100043204 | Ga0070712_1000432043 | 267 |
| 614 | 3300006175 | Ga0070712_100055130 | Ga0070712_1000551303 | 267 |
| 615 | 3300006844 | Ga0075428_100021808 | Ga0075428_1000218086 | 267 |
| 616 | 3300006844 | Ga0075428_100048068 | Ga0075428_1000480685 | 267 |
| 617 | 3300006844 | Ga0075428_100163361 | Ga0075428_1001633612 | 267 |
| 618 | 3300006846 | Ga0075430_100000499 | Ga0075430_1000004993 | 267 |
| 619 | 3300006846 | Ga0075430_100023489 | Ga0075430_1000234895 | 267 |
| 620 | 3300006847 | Ga0075431_100000226 | Ga0075431_10000022622 | 267 |
| 621 | 3300006847 | Ga0075431_100029890 | Ga0075431_1000298905 | 267 |
| 622 | 3300006847 | Ga0075431_100087432 | Ga0075431_1000874322 | 267 |
| 623 | 3300006847 | Ga0075431_100114244 | Ga0075431_1001142442 | 267 |
| 624 | 3300006847 | Ga0075431_100324704 | Ga0075431_1003247041 | 267 |
| 625 | 3300006847 | Ga0075431_100396183 | Ga0075431_1003961832 | 267 |
| 626 | 3300006852 | Ga0075433_10067526 | Ga0075433_100675262 | 267 |
| 627 | 3300006871 | Ga0075434_100013019 | Ga0075434_1000130196 | 267 |
| 628 | 3300006871 | Ga0075434_100085679 | Ga0075434_1000856794 | 267 |
| 629 | 3300006880 | Ga0075429_100304858 | Ga0075429_1003048582 | 267 |
| 630 | 3300006881 | Ga0068865_100057926 | Ga0068865_1000579262 | 267 |
| 631 | 3300006914 | Ga0075436_100030743 | Ga0075436_1000307433 | 267 |
| 632 | 3300006914 | Ga0075436_100198765 | Ga0075436_1001987652 | 267 |
| 633 | 3300006914 | Ga0075436_100256477 | Ga0075436_1002564772 | 267 |
| 634 | 3300006931 | Ga0097620_100042510 | Ga0097620_1000425105 | 267 |
| 635 | 3300006931 | Ga0097620_100149416 | Ga0097620_1001494162 | 267 |
| 636 | 3300007076 | Ga0075435_100019967 | Ga0075435_1000199672 | 267 |
| 637 | 3300007265 | Ga0099794_10013628 | Ga0099794_100136284 | 267 |
| 638 | 3300007788 | Ga0099795_10005301 | Ga0099795_100053014 | 267 |
| 639 | 3300007788 | Ga0099795_10009925 | Ga0099795_100099252 | 267 |
| 640 | 3300009094 | Ga0111539_10002606 | Ga0111539_100026065 | 267 |
| 641 | 3300009094 | Ga0111539_10060175 | Ga0111539_100601755 | 267 |
| 642 | 3300009094 | Ga0111539_10074985 | Ga0111539_100749852 | 267 |
| 643 | 3300009094 | Ga0111539_10204378 | Ga0111539_102043782 | 267 |
| 644 | 3300009094 | Ga0111539_10776358 | Ga0111539_107763581 | 267 |
| 645 | 3300009101 | Ga0105247_10033597 | Ga0105247_100335972 | 267 |
| 646 | 3300009147 | Ga0114129_10016188 | Ga0114129_100161889 | 267 |
| 647 | 3300009147 | Ga0114129_10108451 | Ga0114129_101084514 | 267 |
| 648 | 3300009147 | Ga0114129_10125258 | Ga0114129_101252584 | 267 |
| 649 | 3300009147 | Ga0114129_10129442 | Ga0114129_101294422 | 267 |
| 650 | 3300009147 | Ga0114129_10286869 | Ga0114129_102868692 | 267 |
| 651 | 3300009147 | Ga0114129_10406786 | Ga0114129_104067862 | 267 |
| 652 | 3300009147 | Ga0114129_10427732 | Ga0114129_104277322 | 267 |
| 653 | 3300009147 | Ga0114129_10524625 | Ga0114129_105246252 | 267 |
| 654 | 3300009147 | Ga0114129_10587358 | Ga0114129_105873582 | 267 |
| 655 | 3300009148 | Ga0105243_10097265 | Ga0105243_100972652 | 267 |
| 656 | 3300009148 | Ga0105243_10203983 | Ga0105243_102039832 | 267 |
| 657 | 3300009174 | Ga0105241_10000273 | Ga0105241_1000027332 | 267 |
| 658 | 3300009174 | Ga0105241_10035951 | Ga0105241_100359514 | 267 |
| 659 | 3300009176 | Ga0105242_10152176 | Ga0105242_101521763 | 267 |
| 660 | 3300009177 | Ga0105248_10287617 | Ga0105248_102876172 | 267 |
| 661 | 3300009553 | Ga0105249_10276401 | Ga0105249_102764011 | 267 |
| 662 | 3300009553 | Ga0105249_10660940 | Ga0105249_106609402 | 267 |
| 663 | 3300010159 | Ga0099796_10117199 | Ga0099796_101171991 | 267 |
| 664 | 3300010159 | Ga0099796_10124771 | Ga0099796_101247711 | 267 |
| 665 | 3300010375 | Ga0105239_10221860 | Ga0105239_102218601 | 267 |
| 666 | 3300011119 | Ga0105246_10030220 | Ga0105246_100302204 | 267 |
| 667 | 3300011119 | Ga0105246_10032792 | Ga0105246_100327925 | 267 |
| 668 | 3300013100 | Ga0157373_10000408 | Ga0157373_1000040825 | 267 |
| 669 | 3300013100 | Ga0157373_10146911 | Ga0157373_101469112 | 267 |
| 670 | 3300013296 | Ga0157374_10257913 | Ga0157374_102579132 | 267 |
| 671 | 3300013306 | Ga0163162_10020700 | Ga0163162_100207003 | 267 |
| 672 | 3300013306 | Ga0163162_10436605 | Ga0163162_104366052 | 267 |
| 673 | 3300013307 | Ga0157372_10000827 | Ga0157372_1000082725 | 267 |
| 674 | 3300013308 | Ga0157375_10114421 | Ga0157375_101144212 | 267 |
| 675 | 3300013308 | Ga0157375_10241638 | Ga0157375_102416382 | 267 |
| 676 | 3300013308 | Ga0157375_10245732 | Ga0157375_102457323 | 267 |
| 677 | 3300014325 | Ga0163163_10033352 | Ga0163163_100333524 | 267 |
| 678 | 3300014325 | Ga0163163_10089171 | Ga0163163_100891711 | 267 |
| 679 | 3300014326 | Ga0157380_10442423 | Ga0157380_104424232 | 267 |
| 680 | 3300014497 | Ga0182008_10042430 | Ga0182008_100424302 | 267 |
| 681 | 3300014497 | Ga0182008_10047793 | Ga0182008_100477932 | 267 |
| 682 | 3300014497 | Ga0182008_10055650 | Ga0182008_100556503 | 267 |
| 683 | 3300014497 | Ga0182008_10199216 | Ga0182008_101992162 | 267 |
| 684 | 3300014968 | Ga0157379_10000856 | Ga0157379_1000085615 | 267 |
| 685 | 3300014968 | Ga0157379_10442055 | Ga0157379_104420552 | 267 |
| 686 | 3300015262 | Ga0182007_10018621 | Ga0182007_100186214 | 267 |
| 687 | 3300021388 | Ga0213875_10000844 | Ga0213875_1000084411 | 267 |
| 688 | 3300021388 | Ga0213875_10029477 | Ga0213875_100294772 | 267 |
| 689 | 3300024227 | Ga0228598_1011879 | Ga0228598_10118792 | 267 |
| 690 | 3300025885 | Ga0207653_10000704 | Ga0207653_100007044 | 267 |
| 691 | 3300025901 | Ga0207688_10142830 | Ga0207688_101428302 | 267 |
| 692 | 3300025903 | Ga0207680_10075290 | Ga0207680_100752903 | 267 |
| 693 | 3300025907 | Ga0207645_10003491 | Ga0207645_100034918 | 267 |
| 694 | 3300025908 | Ga0207643_10001164 | Ga0207643_1000116412 | 267 |
| 695 | 3300025910 | Ga0207684_10031376 | Ga0207684_100313765 | 267 |
| 696 | 3300025910 | Ga0207684_10058899 | Ga0207684_100588993 | 267 |
| 697 | 3300025910 | Ga0207684_10128648 | Ga0207684_101286484 | 267 |
| 698 | 3300025910 | Ga0207684_10182167 | Ga0207684_101821672 | 267 |
| 699 | 3300025910 | Ga0207684_10315369 | Ga0207684_103153692 | 267 |
| 700 | 3300025911 | Ga0207654_10000814 | Ga0207654_100008145 | 267 |
| 701 | 3300025912 | Ga0207707_10000198 | Ga0207707_1000019848 | 267 |
| 702 | 3300025912 | Ga0207707_10101457 | Ga0207707_101014572 | 267 |
| 703 | 3300025915 | Ga0207693_10014693 | Ga0207693_100146935 | 267 |
| 704 | 3300025915 | Ga0207693_10027641 | Ga0207693_100276413 | 267 |
| 705 | 3300025915 | Ga0207693_10030564 | Ga0207693_100305643 | 267 |
| 706 | 3300025915 | Ga0207693_10037494 | Ga0207693_100374943 | 267 |
| 707 | 3300025915 | Ga0207693_10073922 | Ga0207693_100739224 | 267 |
| 708 | 3300025915 | Ga0207693_10131210 | Ga0207693_101312102 | 267 |
| 709 | 3300025915 | Ga0207693_10145600 | Ga0207693_101456002 | 267 |
| 710 | 3300025916 | Ga0207663_10156875 | Ga0207663_101568752 | 267 |
| 711 | 3300025917 | Ga0207660_10000236 | Ga0207660_100002368 | 267 |
| 712 | 3300025919 | Ga0207657_10000113 | Ga0207657_1000011339 | 267 |
| 713 | 3300025920 | Ga0207649_10004063 | Ga0207649_100040639 | 267 |
| 714 | 3300025921 | Ga0207652_10000284 | Ga0207652_1000028416 | 267 |
| 715 | 3300025922 | Ga0207646_10075082 | Ga0207646_100750822 | 267 |
| 716 | 3300025923 | Ga0207681_10236486 | Ga0207681_102364862 | 267 |
| 717 | 3300025925 | Ga0207650_10020994 | Ga0207650_100209943 | 267 |
| 718 | 3300025928 | Ga0207700_10027855 | Ga0207700_100278553 | 267 |
| 719 | 3300025928 | Ga0207700_10056067 | Ga0207700_100560674 | 267 |
| 720 | 3300025928 | Ga0207700_10130259 | Ga0207700_101302592 | 267 |
| 721 | 3300025928 | Ga0207700_10205402 | Ga0207700_102054022 | 267 |
| 722 | 3300025929 | Ga0207664_10036700 | Ga0207664_100367001 | 267 |
| 723 | 3300025929 | Ga0207664_10093140 | Ga0207664_100931401 | 267 |
| 724 | 3300025929 | Ga0207664_10125702 | Ga0207664_101257022 | 267 |
| 725 | 3300025929 | Ga0207664_10452246 | Ga0207664_104522462 | 267 |
| 726 | 3300025931 | Ga0207644_10398703 | Ga0207644_103987031 | 267 |
| 727 | 3300025932 | Ga0207690_10022024 | Ga0207690_100220245 | 267 |
| 728 | 3300025933 | Ga0207706_10000622 | Ga0207706_100006224 | 267 |
| 729 | 3300025933 | Ga0207706_10097940 | Ga0207706_100979402 | 267 |
| 730 | 3300025935 | Ga0207709_10109508 | Ga0207709_101095084 | 267 |
| 731 | 3300025935 | Ga0207709_10118634 | Ga0207709_101186342 | 267 |
| 732 | 3300025936 | Ga0207670_10009414 | Ga0207670_100094147 | 267 |
| 733 | 3300025936 | Ga0207670_10211650 | Ga0207670_102116502 | 267 |
| 734 | 3300025940 | Ga0207691_10030698 | Ga0207691_100306985 | 267 |
| 735 | 3300025941 | Ga0207711_10092712 | Ga0207711_100927124 | 267 |
| 736 | 3300025942 | Ga0207689_10000839 | Ga0207689_1000083926 | 267 |
| 737 | 3300025942 | Ga0207689_10095104 | Ga0207689_100951042 | 267 |
| 738 | 3300025942 | Ga0207689_10192365 | Ga0207689_101923651 | 267 |
| 739 | 3300025944 | Ga0207661_10518363 | Ga0207661_105183631 | 267 |
| 740 | 3300025945 | Ga0207679_10001316 | Ga0207679_1000131616 | 267 |
| 741 | 3300025945 | Ga0207679_10048362 | Ga0207679_100483624 | 267 |
| 742 | 3300025949 | Ga0207667_10014534 | Ga0207667_100145347 | 267 |
| 743 | 3300025960 | Ga0207651_10022636 | Ga0207651_100226362 | 267 |
| 744 | 3300025981 | Ga0207640_10086432 | Ga0207640_100864323 | 267 |
| 745 | 3300026035 | Ga0207703_10006818 | Ga0207703_100068189 | 267 |
| 746 | 3300026035 | Ga0207703_10243764 | Ga0207703_102437642 | 267 |
| 747 | 3300026041 | Ga0207639_10026015 | Ga0207639_100260155 | 267 |
| 748 | 3300026067 | Ga0207678_10002857 | Ga0207678_100028575 | 267 |
| 749 | 3300026075 | Ga0207708_10014915 | Ga0207708_100149153 | 267 |
| 750 | 3300026075 | Ga0207708_10232429 | Ga0207708_102324291 | 267 |
| 751 | 3300026078 | Ga0207702_10006470 | Ga0207702_100064709 | 267 |
| 752 | 3300026078 | Ga0207702_10211977 | Ga0207702_102119771 | 267 |
| 753 | 3300026088 | Ga0207641_10641714 | Ga0207641_106417141 | 267 |
| 754 | 3300026089 | Ga0207648_10004641 | Ga0207648_1000464112 | 267 |
| 755 | 3300026089 | Ga0207648_10279462 | Ga0207648_102794622 | 267 |
| 756 | 3300026095 | Ga0207676_10015865 | Ga0207676_100158653 | 267 |
| 757 | 3300026095 | Ga0207676_10599486 | Ga0207676_105994862 | 267 |
| 758 | 3300026116 | Ga0207674_10000197 | Ga0207674_100001975 | 267 |
| 759 | 3300026118 | Ga0207675_100014032 | Ga0207675_1000140324 | 267 |
| 760 | 3300026118 | Ga0207675_100367778 | Ga0207675_1003677782 | 267 |
| 761 | 3300027671 | Ga0209588_1014131 | Ga0209588_10141313 | 267 |
| 762 | 3300027907 | Ga0207428_10101501 | Ga0207428_101015011 | 267 |
| 763 | 3300027907 | Ga0207428_10184064 | Ga0207428_101840642 | 267 |
| 764 | 3300028379 | Ga0268266_10287547 | Ga0268266_102875473 | 267 |
| 765 | 3300028380 | Ga0268265_10188039 | Ga0268265_101880392 | 267 |
| 766 | 3300028380 | Ga0268265_10367717 | Ga0268265_103677172 | 267 |
| 767 | 3300028381 | Ga0268264_10015033 | Ga0268264_100150335 | 267 |
| 768 | 3300028381 | Ga0268264_10031539 | Ga0268264_100315393 | 267 |
| 769 | 3300028800 | Ga0265338_10027357 | Ga0265338_100273572 | 267 |
| 770 | 3300031241 | Ga0265325_10119049 | Ga0265325_101190492 | 267 |
| 771 | 3300031548 | Ga0307408_100084504 | Ga0307408_1000845042 | 267 |
| 772 | 3300031901 | Ga0307406_10039957 | Ga0307406_100399572 | 267 |
| 773 | 3300031903 | Ga0307407_10169463 | Ga0307407_101694631 | 267 |
| 774 | 3300032002 | Ga0307416_100221576 | Ga0307416_1002215762 | 267 |
| 775 | 3300034957 | Ga0373938_0026974 | Ga0373938_0026974_23_886 | 267 |
| 776 | 3300035083 | Ga0373926_0007148 | Ga0373926_0007148_1400_2227 | 267 |
| 777 | 3300035085 | Ga0373929_0022726 | Ga0373929_0022726_98_925 | 267 |
| 778 | 3300035086 | Ga0373934_0028976 | Ga0373934_0028976_923_1741 | 267 |
| 779 | 3300035091 | Ga0373951_0005728 | Ga0373951_0005728_35_859 | 267 |
| 780 | 3300035111 | Ga0373923_0020635 | Ga0373923_0020635_561_1388 | 267 |
| 781 | 3300035113 | Ga0373936_0063772 | Ga0373936_0063772_30_857 | 267 |
| 782 | 3300035119 | Ga0373956_0038538 | Ga0373956_0038538_570_1397 | 267 |
| 783 | 3300035120 | Ga0373957_0035248 | Ga0373957_0035248_102_929 | 267 |
| 784 | 3300035170 | Ga0373943_0130526 | Ga0373943_0130526_295_1122 | 267 |
| 785 | 3300035172 | Ga0373955_0077248 | Ga0373955_0077248_608_1426 | 267 |
| 786 | 3300035207 | Ga0373942_0022149 | Ga0373942_0022149_167_997 | 267 |
| 787 | 3300035410 | Ga0373924_0055530 | Ga0373924_0055530_38_865 | 267 |
| 788 | 3300035691 | Ga0373931_0008533 | Ga0373931_0008533_45_866 | 267 |
| 789 | 3300035691 | Ga0373931_0049612 | Ga0373931_0049612_1079_1942 | 267 |
| 790 | 3300035691 | Ga0373931_0085842 | Ga0373931_0085842_516_1346 | 267 |
| 791 | 3300035691 | Ga0373931_0144230 | Ga0373931_0144230_57_881 | 267 |
| 792 | 3300035692 | Ga0373935_0095173 | Ga0373935_0095173_647_1474 | 267 |
| 793 | 3300035692 | Ga0373935_0369581 | Ga0373935_0369581_27_854 | 267 |
| 794 | 3300035695 | Ga0373927_0073687 | Ga0373927_0073687_924_1751 | 267 |
| 795 | 3300035695 | Ga0373927_0081288 | Ga0373927_0081288_882_1718 | 267 |
| 796 | 3300035695 | Ga0373927_0144962 | Ga0373927_0144962_334_1161 | 267 |
| 797 | 3300035724 | Ga0373933_0008687 | Ga0373933_0008687_1771_2589 | 267 |
| 798 | 3300035724 | Ga0373933_0018196 | Ga0373933_0018196_2222_3049 | 267 |
| 799 | 3300035724 | Ga0373933_0018425 | Ga0373933_0018425_767_1609 | 267 |
| 800 | 3300035724 | Ga0373933_0054050 | Ga0373933_0054050_738_1565 | 267 |
| 801 | 3300035724 | Ga0373933_0205150 | Ga0373933_0205150_30_857 | 267 |
| 802 | 3300035725 | Ga0373947_0030927 | Ga0373947_0030927_1775_2602 | 267 |
| 803 | 3300035725 | Ga0373947_0186845 | Ga0373947_0186845_351_1178 | 267 |
| 804 | 3300035725 | Ga0373947_0274760 | Ga0373947_0274760_151_972 | 267 |
| 805 | 3300036401 | Ga0373937_0010067 | Ga0373937_0010067_3604_4542 | 267 |
| 806 | 3300036401 | Ga0373937_0022237 | Ga0373937_0022237_490_1317 | 267 |
| 807 | 3300036401 | Ga0373937_0047215 | Ga0373937_0047215_2348_3175 | 267 |
| 808 | 3300036401 | Ga0373937_0048067 | Ga0373937_0048067_1685_2527 | 267 |
| 809 | 3300036401 | Ga0373937_0070697 | Ga0373937_0070697_146_973 | 267 |
| 810 | 3300036401 | Ga0373937_0083428 | Ga0373937_0083428_145_972 | 267 |
| 811 | 3300036401 | Ga0373937_0121415 | Ga0373937_0121415_781_1608 | 267 |
| 812 | 3300036401 | Ga0373937_0262237 | Ga0373937_0262237_623_1450 | 267 |
| 813 | 3300037068 | Ga0373925_0014791 | Ga0373925_0014791_1454_2281 | 267 |
| 814 | 3300037068 | Ga0373925_0026815 | Ga0373925_0026815_1102_1929 | 267 |
| 815 | 3300037068 | Ga0373925_0090722 | Ga0373925_0090722_12_839 | 267 |
| 816 | 3300037068 | Ga0373925_0185614 | Ga0373925_0185614_620_1447 | 267 |
| 817 | 3300037418 | Ga0395900_0002247 | Ga0395900_0002247_13509_14360 | 267 |
| 818 | 3300037466 | Ga0395898_0052997 | Ga0395898_0052997_1390_2241 | 267 |
| 819 | 3300037853 | Ga0436364_0080442 | Ga0436364_0080442_546_1391 | 267 |
| 820 | 3300037853 | Ga0436364_0639322 | Ga0436364_0639322_152_979 | 267 |
| 821 | 3300037853 | Ga0436364_0722137 | Ga0436364_0722137_15072_15890 | 267 |
| 822 | 3300037853 | Ga0436364_0874567 | Ga0436364_0874567_161_979 | 267 |
| 823 | 3300037853 | Ga0436364_1034225 | Ga0436364_1034225_188_1006 | 267 |
| 824 | 3300037853 | Ga0436364_1278604 | Ga0436364_1278604_516_1343 | 267 |
| 825 | 3300037853 | Ga0436364_1430783 | Ga0436364_1430783_1442_2269 | 267 |
| 826 | 3300038443 | Ga0395901_0004315 | Ga0395901_0004315_11063_11914 | 267 |
| 827 | 3300039437 | Ga0436365_0043846 | Ga0436365_0043846_39_857 | 267 |
| 828 | 3300039437 | Ga0436365_1004606 | Ga0436365_1004606_13202_14020 | 267 |
| 829 | 3300039438 | Ga0436360_0109953 | Ga0436360_0109953_312_1151 | 267 |
| 830 | 3300039438 | Ga0436360_0292686 | Ga0436360_0292686_610_1446 | 267 |
| 831 | 3300039438 | Ga0436360_0987873 | Ga0436360_0987873_972_1799 | 267 |
| 832 | 3300039447 | Ga0436361_0619205 | Ga0436361_0619205_861_1688 | 267 |
| 833 | 3300039447 | Ga0436361_0731630 | Ga0436361_0731630_926_1762 | 267 |
| 834 | 3300039450 | Ga0436363_0709230 | Ga0436363_0709230_823_1641 | 267 |
| 835 | 3300039450 | Ga0436363_1397028 | Ga0436363_1397028_1501_2328 | 267 |
| 836 | 3300039453 | Ga0436362_0360447 | Ga0436362_0360447_297_1142 | 267 |
| 837 | 3300039453 | Ga0436362_0874942 | Ga0436362_0874942_192_1010 | 267 |
| 838 | 3300039453 | Ga0436362_1275549 | Ga0436362_1275549_658_1497 | 267 |
| 839 | 3300042008 | Ga0439450_036298 | Ga0439450_036298_53_880 | 267 |
| 840 | 3300042157 | Ga0439458_0029822 | Ga0439458_0029822_444_1268 | 267 |
| 841 | 3300042438 | Ga0439459_0000622 | Ga0439459_0000622_2527_3351 | 267 |
| 842 | 3300042461 | Ga0439460_0019695 | Ga0439460_0019695_861_1709 | 267 |
| 843 | 3300042876 | Ga0451577_0022382 | Ga0451577_0022382_2279_3103 | 267 |
| 844 | 3300042876 | Ga0451577_0114449 | Ga0451577_0114449_712_1542 | 267 |
| 845 | 3300044673 | Ga0453683_0139472 | Ga0453683_0139472_520_1347 | 267 |
| 846 | 3300044712 | Ga0453684_0207778 | Ga0453684_0207778_1355_2179 | 267 |
| 847 | 3300045051 | Ga0451576_0046180 | Ga0451576_0046180_2354_3178 | 267 |
| 848 | 3300046454 | Ga0495592_0028281 | Ga0495592_0028281_697_1524 | 267 |
| 849 | 3300046459 | Ga0495629_0200696 | Ga0495629_0200696_351_1178 | 267 |
| 850 | 3300046462 | Ga0495651_0002425 | Ga0495651_0002425_9644_10471 | 267 |
| 851 | 3300046462 | Ga0495651_0043748 | Ga0495651_0043748_2507_3334 | 267 |
| 852 | 3300046462 | Ga0495651_0294272 | Ga0495651_0294272_11_838 | 267 |
| 853 | 3300046476 | Ga0495662_0175629 | Ga0495662_0175629_194_1021 | 267 |
| 854 | 3300046477 | Ga0495664_0004201 | Ga0495664_0004201_6451_7278 | 267 |
| 855 | 3300046511 | Ga0495608_0002946 | Ga0495608_0002946_791_1618 | 267 |
| 856 | 3300046511 | Ga0495608_0131967 | Ga0495608_0131967_222_1040 | 267 |
| 857 | 3300046514 | Ga0495618_0235909 | Ga0495618_0235909_228_1055 | 267 |
| 858 | 3300046516 | Ga0495628_0020266 | Ga0495628_0020266_3304_4131 | 267 |
| 859 | 3300046533 | Ga0495640_0109722 | Ga0495640_0109722_53_880 | 267 |
| 860 | 3300046533 | Ga0495640_0127170 | Ga0495640_0127170_79_921 | 267 |
| 861 | 3300046536 | Ga0495587_0039338 | Ga0495587_0039338_1087_1914 | 267 |
| 862 | 3300046543 | Ga0495645_0019796 | Ga0495645_0019796_3868_4695 | 267 |
| 863 | 3300046543 | Ga0495645_0182413 | Ga0495645_0182413_423_1250 | 267 |
| 864 | 3300046559 | Ga0495667_0055717 | Ga0495667_0055717_1666_2493 | 267 |
| 865 | 3300046559 | Ga0495667_0237094 | Ga0495667_0237094_217_1044 | 267 |
| 866 | 3300046642 | Ga0495634_0023101 | Ga0495634_0023101_1851_2678 | 267 |
| 867 | 3300046663 | Ga0495635_0004464 | Ga0495635_0004464_53_880 | 267 |
| 868 | 3300046664 | Ga0495659_0135100 | Ga0495659_0135100_92_916 | 267 |
| 869 | 3300046674 | Ga0495588_0109904 | Ga0495588_0109904_404_1228 | 267 |
| 870 | 3300046678 | Ga0495599_0016495 | Ga0495599_0016495_592_1419 | 267 |
| 871 | 3300046680 | Ga0495646_0008364 | Ga0495646_0008364_4964_5791 | 267 |
| 872 | 3300046684 | Ga0495669_0097101 | Ga0495669_0097101_131_955 | 267 |
| 873 | 3300046809 | Ga0495600_0086227 | Ga0495600_0086227_879_1706 | 267 |
| 874 | 3300047317 | Ga0495604_0001943 | Ga0495604_0001943_5060_5887 | 267 |
| 875 | 3300047319 | Ga0495674_0052106 | Ga0495674_0052106_2065_2892 | 267 |
| 876 | 3300047319 | Ga0495674_0412013 | Ga0495674_0412013_64_900 | 267 |
| 877 | 3300047322 | Ga0495680_0056648 | Ga0495680_0056648_1045_1872 | 267 |
| 878 | 3300047322 | Ga0495680_0292495 | Ga0495680_0292495_13_840 | 267 |
| 879 | 3300047444 | Ga0495675_0006262 | Ga0495675_0006262_4392_5219 | 267 |
| 880 | 3300048088 | Ga0495602_0005445 | Ga0495602_0005445_12379_13206 | 267 |
| 881 | 3300048088 | Ga0495602_0397476 | Ga0495602_0397476_146_973 | 267 |
| 882 | 3300048905 | Ga0496102_0034282 | Ga0496102_0034282_3015_3839 | 267 |
| 883 | 3300048905 | Ga0496102_0088469 | Ga0496102_0088469_671_1501 | 267 |
| 884 | 3300048906 | Ga0496103_0066394 | Ga0496103_0066394_458_1282 | 267 |
| 885 | 3300048907 | Ga0496104_0118569 | Ga0496104_0118569_521_1339 | 267 |
| 886 | 3300048913 | Ga0496110_0087763 | Ga0496110_0087763_1102_1920 | 267 |
| 887 | 3300048915 | Ga0496112_0082970 | Ga0496112_0082970_2266_3084 | 267 |
| 888 | 3300048915 | Ga0496112_0683189 | Ga0496112_0683189_43_867 | 267 |
| 889 | 3300048916 | Ga0496113_0149933 | Ga0496113_0149933_464_1282 | 267 |
| 890 | 3300049575 | Ga0501039_0089993 | Ga0501039_0089993_229_1047 | 267 |
| 891 | 3300049576 | Ga0501040_0002455 | Ga0501040_0002455_5905_6741 | 267 |
| 892 | 3300049577 | Ga0501041_0008299 | Ga0501041_0008299_3360_4178 | 267 |
| 893 | 3300049577 | Ga0501041_0032102 | Ga0501041_0032102_2144_2971 | 267 |
| 894 | 3300049578 | Ga0501042_0175111 | Ga0501042_0175111_71_889 | 267 |
| 895 | 3300049580 | Ga0501046_0260939 | Ga0501046_0260939_19_867 | 267 |
| 896 | 3300049581 | Ga0501047_0401916 | Ga0501047_0401916_146_973 | 267 |
| 897 | 3300049582 | Ga0501048_0134367 | Ga0501048_0134367_162_989 | 267 |
| 898 | 3300049584 | Ga0501068_0152179 | Ga0501068_0152179_528_1346 | 267 |
| 899 | 3300049588 | Ga0501072_0056903 | Ga0501072_0056903_1030_1872 | 267 |
| 900 | 3300049588 | Ga0501072_0076295 | Ga0501072_0076295_1702_2520 | 267 |
| 901 | 3300049588 | Ga0501072_0227828 | Ga0501072_0227828_149_976 | 267 |
| 902 | 3300049590 | Ga0501074_0113378 | Ga0501074_0113378_947_1765 | 267 |
| 903 | 3300049591 | Ga0501075_0020845 | Ga0501075_0020845_1525_2352 | 267 |
| 904 | 3300049592 | Ga0501076_0032859 | Ga0501076_0032859_2990_3808 | 267 |
| 905 | 3300049593 | Ga0501077_0047733 | Ga0501077_0047733_1847_2665 | 267 |
| 906 | 3300049741 | Ga0501079_0115962 | Ga0501079_0115962_833_1675 | 267 |
| 907 | 3300049824 | Ga0501045_0159169 | Ga0501045_0159169_676_1503 | 267 |
| 908 | 3300050507 | nmdc:mga05p37_110366_c1 | nmdc:mga05p37_110366_c1_722_1663 | 267 |
| 909 | 3300050507 | nmdc:mga05p37_111467_c1 | nmdc:mga05p37_111467_c1_2082_2885 | 267 |
| 910 | 3300050507 | nmdc:mga05p37_11702_c1 | nmdc:mga05p37_11702_c1_274_1125 | 267 |
| 911 | 3300050507 | nmdc:mga05p37_362807_c1 | nmdc:mga05p37_362807_c1_575_1417 | 267 |
| 912 | 3300050507 | nmdc:mga05p37_411742_c1 | nmdc:mga05p37_411742_c1_386_1216 | 267 |
| 913 | 3300050507 | nmdc:mga05p37_43013_c1 | nmdc:mga05p37_43013_c1_802_1629 | 267 |
| 914 | 3300050507 | nmdc:mga05p37_463416_c1 | nmdc:mga05p37_463416_c1_594_1418 | 267 |
| 915 | 3300050507 | nmdc:mga05p37_5872_c1 | nmdc:mga05p37_5872_c1_13395_14237 | 267 |
| 916 | 3300050507 | nmdc:mga05p37_5938_c1 | nmdc:mga05p37_5938_c1_11253_12080 | 267 |
| 917 | 3300050508 | nmdc:mga09592_211939_c1 | nmdc:mga09592_211939_c1_766_1593 | 267 |
| 918 | 3300050508 | nmdc:mga09592_254965_c1 | nmdc:mga09592_254965_c1_10_837 | 267 |
| 919 | 3300050508 | nmdc:mga09592_287554_c1 | nmdc:mga09592_287554_c1_400_1224 | 267 |
| 920 | 3300050508 | nmdc:mga09592_298468_c1 | nmdc:mga09592_298468_c1_418_1260 | 267 |
| 921 | 3300050508 | nmdc:mga09592_60059_c1 | nmdc:mga09592_60059_c1_2101_2931 | 267 |
| 922 | 3300050509 | nmdc:mga0qj67_13254_c1 | nmdc:mga0qj67_13254_c1_1118_1960 | 267 |
| 923 | 3300050510 | nmdc:mga06r32_1480_c1 | nmdc:mga06r32_1480_c1_1961_2803 | 267 |
| 924 | 3300050510 | nmdc:mga06r32_216085_c1 | nmdc:mga06r32_216085_c1_671_1498 | 267 |
| 925 | 3300050510 | nmdc:mga06r32_53_c1 | nmdc:mga06r32_53_c1_13044_13868 | 267 |
| 926 | 3300050510 | nmdc:mga06r32_670757_c1 | nmdc:mga06r32_670757_c1_150_986 | 267 |
| 927 | 3300050511 | nmdc:mga08y16_146409_c1 | nmdc:mga08y16_146409_c1_378_1205 | 267 |
| 928 | 3300050511 | nmdc:mga08y16_181260_c1 | nmdc:mga08y16_181260_c1_710_1513 | 267 |
| 929 | 3300050511 | nmdc:mga08y16_4905_c1 | nmdc:mga08y16_4905_c1_8723_9547 | 267 |
| 930 | 3300050511 | nmdc:mga08y16_888683_c1 | nmdc:mga08y16_888683_c1_10_837 | 267 |
| 931 | 3300050512 | nmdc:mga0n895_20267_c1 | nmdc:mga0n895_20267_c1_3580_4383 | 267 |
| 932 | 3300050512 | nmdc:mga0n895_231009_c1 | nmdc:mga0n895_231009_c1_177_1001 | 267 |
| 933 | 3300050512 | nmdc:mga0n895_66054_c1 | nmdc:mga0n895_66054_c1_136_1020 | 267 |
| 934 | 3300050513 | nmdc:mga0rr50_211050_c1 | nmdc:mga0rr50_211050_c1_145_948 | 267 |
| 935 | 3300050513 | nmdc:mga0rr50_469172_c1 | nmdc:mga0rr50_469172_c1_170_973 | 267 |
| 936 | 3300050513 | nmdc:mga0rr50_60161_c1 | nmdc:mga0rr50_60161_c1_58_897 | 267 |
| 937 | 3300050514 | nmdc:mga08x19_163629_c1 | nmdc:mga08x19_163629_c1_377_1225 | 267 |
| 938 | 3300050514 | nmdc:mga08x19_225253_c1 | nmdc:mga08x19_225253_c1_174_992 | 267 |
| 939 | 3300050514 | nmdc:mga08x19_5839_c1 | nmdc:mga08x19_5839_c1_297_1124 | 267 |
| 940 | 3300050515 | nmdc:mga0a205_22841_c1 | nmdc:mga0a205_22841_c1_1973_2857 | 267 |
| 941 | 3300050515 | nmdc:mga0a205_230090_c1 | nmdc:mga0a205_230090_c1_342_1145 | 267 |
| 942 | 3300050515 | nmdc:mga0a205_280511_c1 | nmdc:mga0a205_280511_c1_419_1246 | 267 |
| 943 | 3300050515 | nmdc:mga0a205_34800_c1 | nmdc:mga0a205_34800_c1_985_1809 | 267 |
| 944 | 3300050515 | nmdc:mga0a205_56763_c1 | nmdc:mga0a205_56763_c1_962_1786 | 267 |
| 945 | 3300053077 | Ga0495601_0037130 | Ga0495601_0037130_43_870 | 267 |
| 946 | 3300053077 | Ga0495601_0055492 | Ga0495601_0055492_1185_2012 | 267 |
| 947 | 3300053078 | Ga0495612_0004119 | Ga0495612_0004119_135_962 | 267 |
| 948 | 3300053085 | Ga0495619_0023030 | Ga0495619_0023030_1694_2521 | 267 |
| 949 | 3300053085 | Ga0495619_0028172 | Ga0495619_0028172_596_1417 | 267 |
| 950 | 3300053085 | Ga0495619_0099727 | Ga0495619_0099727_720_1556 | 267 |
| 951 | 3300053085 | Ga0495619_0124931 | Ga0495619_0124931_255_1097 | 267 |
| 952 | 3300053085 | Ga0495619_0141600 | Ga0495619_0141600_514_1341 | 267 |
| 953 | 3300053085 | Ga0495619_0167358 | Ga0495619_0167358_654_1481 | 267 |
| 954 | 3300053085 | Ga0495619_0376198 | Ga0495619_0376198_39_866 | 267 |
| 955 | 3300054114 | Ga0501084_0337865 | Ga0501084_0337865_15_833 | 267 |
| 956 | 3300061734 | Ga0530510_0001282 | Ga0530510_0001282_12996_13814 | 267 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4do7-assembly2.cif.gz_B | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 | 0.8379 | 1 | 264 |
| 4dnm-assembly1.cif.gz_A | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 | 0.8362 | 1 | 264 |
| 4do7-assembly2.cif.gz_B | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 | 0.8264 | 1 | 264 |
| 4dnm-assembly1.cif.gz_A | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 | 0.8248 | 1 | 264 |
| 2ffi-assembly2.cif.gz_B | crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23. | 0.8183 | 2 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0W9I9_79_364_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8573 | 2 | 260 | 3.20.20.140 |
| 4do7B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8379 | 1 | 264 | 3.20.20.140 |
| af_A0A0P0W9I9_79_364_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8303 | 2 | 260 | 3.20.20.140 |
| 4do7B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8264 | 1 | 264 | 3.20.20.140 |
| 2ffiA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8099 | 2 | 266 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7CJM0-F1-model_v4 | Amidohydrolase | 0.9938 | 1 | 267 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A2V7CQG8-F1-model_v4 | Amidohydrolase | 0.9924 | 1 | 264 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A2V7CJM0-F1-model_v4 | Amidohydrolase | 0.9901 | 1 | 267 |
GO:0005737
GO:0016787 GO:0016831 GO:0019748 |
| AF-A0A2V6SQI5-F1-model_v4 | Amidohydrolase | 0.9871 | 174 | 265 |
GO:0016787
|
| AF-A0A2V7I645-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9826 | 1 | 264 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar