F486604

General Info

Members Datasets Scaffolds Average Seq Length
951 328 1902 301

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_113916_c1|nmdc:mga06r32_113916_c1_1246_2283
Length 345
Sequence MARRTPAGRGAGARSSQSPRRATRELRSXXXXDARRARQASLKLSLAKGDPRSKRARAGQPFIILTGLSGSGKSQAIRALEDLGYFCVDNLPTTLIPTLAKLSLRAGVDIEKVAIVVDVREGGFLSSFPKIFRQLRKMPKLNPVLIFLEADHAALVRRFSETRRPHPLAPDRSVTEGIRDERSRLNVIRDMADEIVDTSDMTVHELRQFFMGLSRDRARARLVITVLSFGFKHGVPVDADLVFDVRCLPNPHFVPTLRRRTGRDKAVADFLERDESTHQFMDRLEEYLRYLVPFYVAEGKSYLTIAIGCTGGRHRSVMIAERLKRALSEVGVARVRVRHRDLAHA

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
209 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
236 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
237 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
238 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
302 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
303 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
304 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
310 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
311 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.36
Rhizosphere 95.79
Stem 0
Stem Tuber 0
Unclassified 7.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_113916_c1 3300050510 Bacteria 2662
2 LJQas_1001341 3300000549 Unclassified 3697
3 JGI25406J46586_10001324 3300003203 Bacteria 11656
4 rootL2_10181840 3300003322 Bacteria 2429
5 Ga0065712_10000348 3300005290 Bacteria 13104
6 Ga0065712_10096226 3300005290 Bacteria 2191
7 Ga0065712_10103744 3300005290 Bacteria 1970
8 Ga0065712_10150193 3300005290 Bacteria 1376
9 Ga0065712_10154177 3300005290 Bacteria 1347
10 Ga0065715_10001316 3300005293 Bacteria 9516
11 Ga0065715_10184506 3300005293 Bacteria 1454
12 Ga0065707_10083684 3300005295 Bacteria 8478
13 Ga0065707_10097516 3300005295 Bacteria 3168
14 Ga0070676_10038414 3300005328 Bacteria 2765
15 Ga0070676_10338562 3300005328 Bacteria 1031
16 Ga0070683_100011637 3300005329 Bacteria 7616
17 Ga0070683_100512535 3300005329 Bacteria 1146
18 Ga0070690_100005062 3300005330 Bacteria 7389
19 Ga0070690_100022217 3300005330 Bacteria 3880
20 Ga0070670_100003865 3300005331 Bacteria 12488
21 Ga0070670_100020208 3300005331 Bacteria 5722
22 Ga0070670_100025364 3300005331 Bacteria 5101
23 Ga0070670_100027876 3300005331 Bacteria 4860
24 Ga0070670_100156027 3300005331 Bacteria 1977
25 Ga0070670_100194508 3300005331 Bacteria 1762
26 Ga0070670_100232111 3300005331 Unclassified 1606
27 Ga0070670_100418249 3300005331 Bacteria 1185
28 Ga0068869_100023268 3300005334 Bacteria 4276
29 Ga0068869_100047562 3300005334 Bacteria 3098
30 Ga0070666_10027898 3300005335 Bacteria 3701
31 Ga0070680_100025848 3300005336 Bacteria 4694
32 Ga0070680_100267937 3300005336 Bacteria 1446
33 Ga0068868_100029345 3300005338 Bacteria 4211
34 Ga0068868_100149135 3300005338 Bacteria 1925
35 Ga0068868_100267013 3300005338 Bacteria 1445
36 Ga0070660_100005945 3300005339 Bacteria 8437
37 Ga0070660_100119175 3300005339 Bacteria 2105
38 Ga0070689_100059215 3300005340 Bacteria 2976
39 Ga0070689_100059859 3300005340 Bacteria 2960
40 Ga0070689_100062513 3300005340 Bacteria 2897
41 Ga0070689_100316363 3300005340 Bacteria 1302
42 Ga0070687_100048131 3300005343 Bacteria 2191
43 Ga0070661_100077919 3300005344 Bacteria 2444
44 Ga0070661_100080174 3300005344 Bacteria 2409
45 Ga0070661_100395170 3300005344 Unclassified 1092
46 Ga0070668_100054782 3300005347 Bacteria 3077
47 Ga0070668_100202053 3300005347 Bacteria 1631
48 Ga0070669_100000773 3300005353 Bacteria 23226
49 Ga0070669_100003970 3300005353 Bacteria 10702
50 Ga0070669_100033654 3300005353 Bacteria 3708
51 Ga0070669_100052508 3300005353 Bacteria 2983
52 Ga0070669_100085598 3300005353 Bacteria 2354
53 Ga0070669_100172644 3300005353 Bacteria 1686
54 Ga0070669_100317170 3300005353 Bacteria 1258
55 Ga0070675_100000679 3300005354 Bacteria 23598
56 Ga0070675_100009110 3300005354 Bacteria 7709
57 Ga0070675_100019786 3300005354 Bacteria 5368
58 Ga0070675_100040163 3300005354 Bacteria 3819
59 Ga0070675_100056971 3300005354 Bacteria 3222
60 Ga0070675_100074548 3300005354 Bacteria 2819
61 Ga0070675_100095704 3300005354 Bacteria 2494
62 Ga0070675_100490737 3300005354 Unclassified 1106
63 Ga0070671_100006629 3300005355 Bacteria 9252
64 Ga0070671_100026059 3300005355 Bacteria 4802
65 Ga0070671_100105782 3300005355 Bacteria 2362
66 Ga0070674_100069924 3300005356 Bacteria 2478
67 Ga0070674_100101106 3300005356 Bacteria 2101
68 Ga0070674_100183152 3300005356 Bacteria 1606
69 Ga0070673_100007935 3300005364 Bacteria 7037
70 Ga0070673_100032272 3300005364 Bacteria 3941
71 Ga0070673_100049076 3300005364 Bacteria 3294
72 Ga0070673_100086298 3300005364 Bacteria 2557
73 Ga0070673_100111109 3300005364 Bacteria 2273
74 Ga0070673_100122229 3300005364 Bacteria 2174
75 Ga0070673_100217500 3300005364 Bacteria 1652
76 Ga0070673_100255839 3300005364 Bacteria 1528
77 Ga0070673_100410851 3300005364 Bacteria 1212
78 Ga0070673_100427832 3300005364 Bacteria 1188
79 Ga0070688_100002842 3300005365 Bacteria 8825
80 Ga0070688_100066681 3300005365 Unclassified 2291
81 Ga0070688_100132095 3300005365 Bacteria 1686
82 Ga0070688_100175065 3300005365 Bacteria 1484
83 Ga0070688_100176493 3300005365 Bacteria 1479
84 Ga0070659_100029768 3300005366 Bacteria 4221
85 Ga0070659_100073090 3300005366 Unclassified 2729
86 Ga0070667_100126926 3300005367 Bacteria 2223
87 Ga0070714_100056074 3300005435 Bacteria 3369
88 Ga0070713_100012645 3300005436 Bacteria 6201
89 Ga0070701_10039600 3300005438 Bacteria 2392
90 Ga0070701_10072412 3300005438 Bacteria 1845
91 Ga0070701_10098093 3300005438 Bacteria 1618
92 Ga0070705_100003008 3300005440 Bacteria 8338
93 Ga0070705_100028204 3300005440 Bacteria 3073
94 Ga0070700_100016440 3300005441 Bacteria 4214
95 Ga0070700_100077048 3300005441 Bacteria 2143
96 Ga0070700_100228352 3300005441 Bacteria 1323
97 Ga0070694_100037834 3300005444 Bacteria 3202
98 Ga0070694_100093330 3300005444 Bacteria 2116
99 Ga0070694_100149367 3300005444 Bacteria 1705
100 Ga0070694_100431559 3300005444 Bacteria 1037
101 Ga0070708_100332277 3300005445 Bacteria 1432
102 Ga0070708_100405200 3300005445 Bacteria 1286
103 Ga0070663_100075007 3300005455 Bacteria 2471
104 Ga0070678_100057369 3300005456 Bacteria 2853
105 Ga0070678_100167727 3300005456 Bacteria 1785
106 Ga0070678_100378402 3300005456 Bacteria 1224
107 Ga0070662_100020423 3300005457 Bacteria 4510
108 Ga0070662_100062689 3300005457 Unclassified 2717
109 Ga0070681_10001941 3300005458 Bacteria 18666
110 Ga0070681_10012562 3300005458 Bacteria 8402
111 Ga0068867_100020042 3300005459 Bacteria 4766
112 Ga0068867_100025403 3300005459 Bacteria 4250
113 Ga0068867_100040362 3300005459 Unclassified 3406
114 Ga0068867_100256049 3300005459 Bacteria 1425
115 Ga0068867_100270484 3300005459 Bacteria 1389
116 Ga0068867_100363040 3300005459 Bacteria 1212
117 Ga0070685_10058350 3300005466 Bacteria 2249
118 Ga0070685_10065325 3300005466 Bacteria 2141
119 Ga0070685_10070003 3300005466 Bacteria 2076
120 Ga0070685_10177463 3300005466 Bacteria 1369
121 Ga0070685_10302118 3300005466 Bacteria 1079
122 Ga0070706_100124253 3300005467 Unclassified 2406
123 Ga0070707_100033059 3300005468 Unclassified 4930
124 Ga0070707_100047218 3300005468 Bacteria 4122
125 Ga0070707_100179953 3300005468 Bacteria 2061
126 Ga0070707_100184913 3300005468 Bacteria 2032
127 Ga0070707_100274178 3300005468 Bacteria 1640
128 Ga0070707_100388153 3300005468 Bacteria 1356
129 Ga0070707_100403575 3300005468 Bacteria 1327
130 Ga0070707_100497108 3300005468 Unclassified 1181
131 Ga0070707_100553021 3300005468 Bacteria 1113
132 Ga0070698_100019939 3300005471 Bacteria 7033
133 Ga0070698_100041326 3300005471 Bacteria 4733
134 Ga0070698_100066414 3300005471 Bacteria 3631
135 Ga0070698_100090895 3300005471 Bacteria 3036
136 Ga0070698_100242938 3300005471 Bacteria 1734
137 Ga0070698_100374809 3300005471 Bacteria 1356
138 Ga0070699_100037807 3300005518 Bacteria 4178
139 Ga0070699_100378025 3300005518 Bacteria 1279
140 Ga0070679_100015065 3300005530 Bacteria 7430
141 Ga0070684_100052411 3300005535 Bacteria 3549
142 Ga0070684_100550273 3300005535 Bacteria 1071
143 Ga0070697_100015405 3300005536 Bacteria 6002
144 Ga0070697_100034376 3300005536 Unclassified 4087
145 Ga0070697_100057895 3300005536 Bacteria 3153
146 Ga0070697_100372387 3300005536 Bacteria 1236
147 Ga0068853_100002787 3300005539 Bacteria 13213
148 Ga0068853_100048961 3300005539 Unclassified 3630
149 Ga0068853_100051234 3300005539 Bacteria 3553
150 Ga0068853_100121675 3300005539 Bacteria 2329
151 Ga0068853_100183578 3300005539 Bacteria 1898
152 Ga0068853_100795672 3300005539 Unclassified 905
153 Ga0070672_100008124 3300005543 Bacteria 7172
154 Ga0070672_100034130 3300005543 Bacteria 3860
155 Ga0070672_100092493 3300005543 Bacteria 2442
156 Ga0070672_100222286 3300005543 Bacteria 1584
157 Ga0070672_100229394 3300005543 Bacteria 1559
158 Ga0070672_100233850 3300005543 Bacteria 1544
159 Ga0070686_100001645 3300005544 Bacteria 12493
160 Ga0070686_100014470 3300005544 Bacteria 4551
161 Ga0070695_100045792 3300005545 Bacteria 2789
162 Ga0070695_100058328 3300005545 Unclassified 2496
163 Ga0070696_100016045 3300005546 Bacteria 5038
164 Ga0070696_100129603 3300005546 Bacteria 1834
165 Ga0070665_100002473 3300005548 Bacteria 20373
166 Ga0070665_100003554 3300005548 Bacteria 16537
167 Ga0070665_100038740 3300005548 Bacteria 4792
168 Ga0070665_100053705 3300005548 Bacteria 4040
169 Ga0070665_100311224 3300005548 Bacteria 1579
170 Ga0070704_100011292 3300005549 Bacteria 5471
171 Ga0070704_100032592 3300005549 Bacteria 3516
172 Ga0070704_100440964 3300005549 Bacteria 1119
173 Ga0068855_100058599 3300005563 Bacteria 4509
174 Ga0068855_100253258 3300005563 Unclassified 1963
175 Ga0070664_100002119 3300005564 Bacteria 15883
176 Ga0070664_100019604 3300005564 Bacteria 5566
177 Ga0070664_100176114 3300005564 Unclassified 1899
178 Ga0070664_100209526 3300005564 Bacteria 1741
179 Ga0070664_100390252 3300005564 Bacteria 1272
180 Ga0070664_100428643 3300005564 Bacteria 1212
181 Ga0068857_100064873 3300005577 Bacteria 3247
182 Ga0068854_100012110 3300005578 Bacteria 5641
183 Ga0068854_100052811 3300005578 Bacteria 2916
184 Ga0068854_100094365 3300005578 Bacteria 2232
185 Ga0068854_100211569 3300005578 Bacteria 1530
186 Ga0068854_100446664 3300005578 Unclassified 1079
187 Ga0068856_100124485 3300005614 Bacteria 2581
188 Ga0068856_100206636 3300005614 Bacteria 1978
189 Ga0070702_100003607 3300005615 Bacteria 6956
190 Ga0068852_100073131 3300005616 Bacteria 3015
191 Ga0068852_100099971 3300005616 Bacteria 2616
192 Ga0068859_100010204 3300005617 Bacteria 9454
193 Ga0068859_100017177 3300005617 Bacteria 7266
194 Ga0068859_100020666 3300005617 Bacteria 6607
195 Ga0068859_100028363 3300005617 Bacteria 5612
196 Ga0068859_100150282 3300005617 Bacteria 2404
197 Ga0068859_100438389 3300005617 Bacteria 1402
198 Ga0068859_100558039 3300005617 Bacteria 1239
199 Ga0068859_100741768 3300005617 Bacteria 1071
200 Ga0068859_100755646 3300005617 Bacteria 1061
201 Ga0068864_100014256 3300005618 Bacteria 6600
202 Ga0068864_100021441 3300005618 Bacteria 5413
203 Ga0068864_100023671 3300005618 Bacteria 5159
204 Ga0068864_100027551 3300005618 Bacteria 4800
205 Ga0068864_100070826 3300005618 Bacteria 3035
206 Ga0068864_100427401 3300005618 Bacteria 1263
207 Ga0068866_10128740 3300005718 Bacteria 1437
208 Ga0068861_100049839 3300005719 Bacteria 3172
209 Ga0068851_10129260 3300005834 Bacteria 1365
210 Ga0068851_10140997 3300005834 Bacteria 1311
211 Ga0068870_10047628 3300005840 Bacteria 2254
212 Ga0068870_10055909 3300005840 Bacteria 2104
213 Ga0068863_100010240 3300005841 Bacteria 9116
214 Ga0068863_100023151 3300005841 Bacteria 5936
215 Ga0068863_100079148 3300005841 Unclassified 3113
216 Ga0068863_100120337 3300005841 Bacteria 2503
217 Ga0068863_100356216 3300005841 Bacteria 1426
218 Ga0068863_100441919 3300005841 Bacteria 1276
219 Ga0068863_100466737 3300005841 Bacteria 1240
220 Ga0068863_100516528 3300005841 Bacteria 1177
221 Ga0068858_100001318 3300005842 Bacteria 25636
222 Ga0068858_100004306 3300005842 Bacteria 13990
223 Ga0068858_100038352 3300005842 Bacteria 4444
224 Ga0068858_100055186 3300005842 Bacteria 3672
225 Ga0068858_100084067 3300005842 Unclassified 2960
226 Ga0068858_100118605 3300005842 Bacteria 2473
227 Ga0068858_100385682 3300005842 Bacteria 1345
228 Ga0068858_100412796 3300005842 Bacteria 1298
229 Ga0068860_100109498 3300005843 Bacteria 2640
230 Ga0068860_100123294 3300005843 Bacteria 2483
231 Ga0068862_100024984 3300005844 Bacteria 5015
232 Ga0068862_100026171 3300005844 Bacteria 4904
233 Ga0068862_100031931 3300005844 Bacteria 4448
234 Ga0068862_100074844 3300005844 Bacteria 2928
235 Ga0068862_100080703 3300005844 Bacteria 2821
236 Ga0068862_100103227 3300005844 Bacteria 2496
237 Ga0068862_100104595 3300005844 Bacteria 2480
238 Ga0068862_100398683 3300005844 Bacteria 1287
239 Ga0081455_10029065 3300005937 Bacteria 5044
240 Ga0081455_10135547 3300005937 Bacteria 1919
241 Ga0081540_1023739 3300005983 Unclassified 3577
242 Ga0081539_10002652 3300005985 Bacteria 24407
243 Ga0081539_10064517 3300005985 Bacteria 1992
244 Ga0070717_10220693 3300006028 Bacteria 1666
245 Ga0070715_10060823 3300006163 Bacteria 1657
246 Ga0070716_100041083 3300006173 Bacteria 2575
247 Ga0097621_100003679 3300006237 Bacteria 10602
248 Ga0097621_100004412 3300006237 Bacteria 9790
249 Ga0097621_100012194 3300006237 Bacteria 6359
250 Ga0097621_100038998 3300006237 Bacteria 3814
251 Ga0097621_100106165 3300006237 Bacteria 2369
252 Ga0097621_100114766 3300006237 Bacteria 2279
253 Ga0097621_100266108 3300006237 Bacteria 1505
254 Ga0068871_100001757 3300006358 Bacteria 14602
255 Ga0068871_100021321 3300006358 Bacteria 4978
256 Ga0068871_100045731 3300006358 Bacteria 3524
257 Ga0068871_100160218 3300006358 Bacteria 1924
258 Ga0068871_100205378 3300006358 Bacteria 1702
259 Ga0075428_100000011 3300006844 Bacteria 194129
260 Ga0075428_100000965 3300006844 Bacteria 30443
261 Ga0075428_100006470 3300006844 Bacteria 13030
262 Ga0075428_100040497 3300006844 Bacteria 5125
263 Ga0075428_100287929 3300006844 Bacteria 1767
264 Ga0075428_100302459 3300006844 Bacteria 1720
265 Ga0075430_100004187 3300006846 Bacteria 12175
266 Ga0075430_100010964 3300006846 Bacteria 7679
267 Ga0075430_100170331 3300006846 Bacteria 1812
268 Ga0075431_100005675 3300006847 Bacteria 12336
269 Ga0075431_100008784 3300006847 Bacteria 10125
270 Ga0075431_100130080 3300006847 Bacteria 2597
271 Ga0075431_100579982 3300006847 Bacteria 1107
272 Ga0075433_10015027 3300006852 Bacteria 6337
273 Ga0075433_10017535 3300006852 Bacteria 5935
274 Ga0075433_10045932 3300006852 Bacteria 3798
275 Ga0075433_10093233 3300006852 Bacteria 2664
276 Ga0075434_100002887 3300006871 Bacteria 15253
277 Ga0075434_100019758 3300006871 Bacteria 6523
278 Ga0075434_100059097 3300006871 Bacteria 3811
279 Ga0075434_100083047 3300006871 Bacteria 3201
280 Ga0075429_100014584 3300006880 Bacteria 6811
281 Ga0075429_100028918 3300006880 Bacteria 4814
282 Ga0075429_100070189 3300006880 Bacteria 3050
283 Ga0075429_100227694 3300006880 Bacteria 1633
284 Ga0075429_100242104 3300006880 Bacteria 1580
285 Ga0075429_100259070 3300006880 Bacteria 1523
286 Ga0068865_100059589 3300006881 Bacteria 2671
287 Ga0068865_100104370 3300006881 Bacteria 2080
288 Ga0068865_100117334 3300006881 Bacteria 1973
289 Ga0075436_100010831 3300006914 Bacteria 6255
290 Ga0075436_100013077 3300006914 Bacteria 5689
291 Ga0075436_100024293 3300006914 Bacteria 4166
292 Ga0075436_100053002 3300006914 Bacteria 2800
293 Ga0097620_100010204 3300006931 Bacteria 9454
294 Ga0097620_100017175 3300006931 Bacteria 7266
295 Ga0097620_100020666 3300006931 Bacteria 6607
296 Ga0097620_100028365 3300006931 Bacteria 5612
297 Ga0097620_100150286 3300006931 Bacteria 2404
298 Ga0097620_100438387 3300006931 Bacteria 1402
299 Ga0097620_100558041 3300006931 Bacteria 1239
300 Ga0097620_100741761 3300006931 Bacteria 1071
301 Ga0097620_100755668 3300006931 Bacteria 1061
302 Ga0075435_100000469 3300007076 Bacteria 24538
303 Ga0075435_100008965 3300007076 Bacteria 7212
304 Ga0075435_100009617 3300007076 Bacteria 7017
305 Ga0075435_100062309 3300007076 Bacteria 3027
306 Ga0075435_100194208 3300007076 Bacteria 1719
307 Ga0075435_100326478 3300007076 Bacteria 1314
308 Ga0105251_10032163 3300009011 Bacteria 2617
309 Ga0105240_10017684 3300009093 Bacteria 9599
310 Ga0105240_10025608 3300009093 Bacteria 7748
311 Ga0105240_10086412 3300009093 Bacteria 3841
312 Ga0111539_10000011 3300009094 Bacteria 356900
313 Ga0111539_10001886 3300009094 Bacteria 27864
314 Ga0111539_10004497 3300009094 Bacteria 18235
315 Ga0111539_10011090 3300009094 Bacteria 11340
316 Ga0111539_10037224 3300009094 Bacteria 5878
317 Ga0111539_10055534 3300009094 Bacteria 4708
318 Ga0111539_10082814 3300009094 Bacteria 3774
319 Ga0111539_10084944 3300009094 Bacteria 3720
320 Ga0111539_10120933 3300009094 Bacteria 3068
321 Ga0111539_10209550 3300009094 Bacteria 2271
322 Ga0105245_10010963 3300009098 Bacteria 7887
323 Ga0105245_10090636 3300009098 Bacteria 2812
324 Ga0105245_10305230 3300009098 Bacteria 1563
325 Ga0105247_10003428 3300009101 Bacteria 10343
326 Ga0105247_10014547 3300009101 Bacteria 4720
327 Ga0105247_10081761 3300009101 Bacteria 2037
328 Ga0105247_10102190 3300009101 Bacteria 1834
329 Ga0105247_10109502 3300009101 Bacteria 1776
330 Ga0114129_10002052 3300009147 Bacteria 27655
331 Ga0114129_10003114 3300009147 Bacteria 23265
332 Ga0114129_10007103 3300009147 Bacteria 15934
333 Ga0114129_10015787 3300009147 Bacteria 10738
334 Ga0114129_10022778 3300009147 Bacteria 8882
335 Ga0114129_10035148 3300009147 Bacteria 7080
336 Ga0114129_10035666 3300009147 Bacteria 7026
337 Ga0114129_10035804 3300009147 Bacteria 7011
338 Ga0114129_10041791 3300009147 Bacteria 6456
339 Ga0114129_10087370 3300009147 Bacteria 4323
340 Ga0114129_10116212 3300009147 Bacteria 3687
341 Ga0114129_10157063 3300009147 Bacteria 3109
342 Ga0114129_10186149 3300009147 Bacteria 2822
343 Ga0105243_10023088 3300009148 Bacteria 4732
344 Ga0105243_10125402 3300009148 Bacteria 2171
345 Ga0105241_10071468 3300009174 Bacteria 2694
346 Ga0105241_10125061 3300009174 Unclassified 2076
347 Ga0105242_10002076 3300009176 Bacteria 15787
348 Ga0105242_10005026 3300009176 Bacteria 10216
349 Ga0105242_10028317 3300009176 Bacteria 4459
350 Ga0105242_10045105 3300009176 Bacteria 3572
351 Ga0105242_10109673 3300009176 Bacteria 2350
352 Ga0105242_10221055 3300009176 Bacteria 1693
353 Ga0105248_10008235 3300009177 Bacteria 11454
354 Ga0105248_10051267 3300009177 Bacteria 4631
355 Ga0105248_10061692 3300009177 Bacteria 4210
356 Ga0105248_10072811 3300009177 Unclassified 3862
357 Ga0105248_10118852 3300009177 Bacteria 2981
358 Ga0105248_10144191 3300009177 Bacteria 2687
359 Ga0105248_10153236 3300009177 Bacteria 2600
360 Ga0105248_10478632 3300009177 Unclassified 1403
361 Ga0105238_10273026 3300009551 Bacteria 1671
362 Ga0105249_10011115 3300009553 Bacteria 7908
363 Ga0105249_10083451 3300009553 Bacteria 2974
364 Ga0105249_10242257 3300009553 Bacteria 1783
365 Ga0105249_10263066 3300009553 Bacteria 1715
366 Ga0105249_10460757 3300009553 Bacteria 1311
367 Ga0105249_10480273 3300009553 Bacteria 1285
368 Ga0105239_10649601 3300010375 Unclassified 1205
369 Ga0157373_10090197 3300013100 Unclassified 2159
370 Ga0157373_10099204 3300013100 Unclassified 2050
371 Ga0157371_10050647 3300013102 Unclassified 2951
372 Ga0157370_10034126 3300013104 Bacteria 4957
373 Ga0157369_10670723 3300013105 Unclassified 1068
374 Ga0157374_10002657 3300013296 Bacteria 15054
375 Ga0157374_10014578 3300013296 Bacteria 6881
376 Ga0157374_10015607 3300013296 Bacteria 6667
377 Ga0157374_10074989 3300013296 Bacteria 3196
378 Ga0157374_10604828 3300013296 Unclassified 1106
379 Ga0157378_10008558 3300013297 Bacteria 8904
380 Ga0157378_10043922 3300013297 Unclassified 3967
381 Ga0157378_10049337 3300013297 Unclassified 3745
382 Ga0157378_10059913 3300013297 Bacteria 3397
383 Ga0157378_10110615 3300013297 Bacteria 2518
384 Ga0157378_10157369 3300013297 Unclassified 2122
385 Ga0157378_10159531 3300013297 Unclassified 2108
386 Ga0157378_10190318 3300013297 Bacteria 1935
387 Ga0157378_10265033 3300013297 Bacteria 1650
388 Ga0157378_10796439 3300013297 Bacteria 971
389 Ga0163162_10009040 3300013306 Bacteria 9684
390 Ga0163162_10022019 3300013306 Bacteria 6279
391 Ga0163162_10022628 3300013306 Bacteria 6196
392 Ga0163162_10040189 3300013306 Unclassified 4677
393 Ga0163162_10076020 3300013306 Bacteria 3420
394 Ga0163162_10098360 3300013306 Bacteria 3015
395 Ga0163162_10130584 3300013306 Unclassified 2621
396 Ga0163162_10224176 3300013306 Bacteria 2009
397 Ga0163162_10863642 3300013306 Bacteria 1019
398 Ga0157372_10050738 3300013307 Unclassified 4615
399 Ga0157372_10539151 3300013307 Bacteria 1360
400 Ga0157372_10791796 3300013307 Bacteria 1102
401 Ga0157372_10804208 3300013307 Bacteria 1092
402 Ga0157375_10005600 3300013308 Bacteria 10930
403 Ga0157375_10018590 3300013308 Bacteria 6305
404 Ga0157375_10029638 3300013308 Bacteria 5150
405 Ga0157375_10082831 3300013308 Bacteria 3251
406 Ga0157375_10110953 3300013308 Bacteria 2841
407 Ga0157375_10134651 3300013308 Bacteria 2593
408 Ga0157375_10227873 3300013308 Bacteria 2022
409 Ga0163163_10013598 3300014325 Bacteria 7454
410 Ga0163163_10026496 3300014325 Bacteria 5543
411 Ga0163163_10027396 3300014325 Bacteria 5459
412 Ga0163163_10097519 3300014325 Unclassified 2960
413 Ga0163163_10214583 3300014325 Bacteria 1973
414 Ga0163163_10492998 3300014325 Bacteria 1287
415 Ga0157380_10002485 3300014326 Bacteria 12425
416 Ga0157380_10007729 3300014326 Bacteria 7653
417 Ga0157380_10027668 3300014326 Bacteria 4313
418 Ga0157380_10049528 3300014326 Bacteria 3314
419 Ga0157380_10074924 3300014326 Bacteria 2749
420 Ga0157380_10094225 3300014326 Unclassified 2478
421 Ga0157380_10226052 3300014326 Bacteria 1677
422 Ga0157377_10040208 3300014745 Bacteria 2588
423 Ga0157377_10269631 3300014745 Bacteria 1111
424 Ga0157379_10008109 3300014968 Bacteria 9120
425 Ga0157379_10066274 3300014968 Bacteria 3228
426 Ga0157379_10112968 3300014968 Bacteria 2441
427 Ga0157379_10218928 3300014968 Bacteria 1725
428 Ga0157379_10497694 3300014968 Bacteria 1129
429 Ga0157376_10011761 3300014969 Bacteria 6464
430 Ga0157376_10020857 3300014969 Bacteria 5079
431 Ga0157376_10100603 3300014969 Bacteria 2525
432 Ga0157376_10115617 3300014969 Bacteria 2369
433 Ga0157376_10154920 3300014969 Bacteria 2070
434 Ga0157376_10189409 3300014969 Bacteria 1885
435 Ga0157376_10212976 3300014969 Bacteria 1785
436 Ga0157376_10214468 3300014969 Bacteria 1779
437 Ga0157376_10389409 3300014969 Bacteria 1345
438 Ga0163161_10004301 3300017792 Bacteria 9919
439 Ga0163161_10010764 3300017792 Bacteria 6339
440 Ga0163161_10282080 3300017792 Bacteria 1303
441 Ga0213876_10013511 3300021384 Bacteria 4334
442 Ga0213875_10002329 3300021388 Bacteria 11491
443 Ga0207692_10191061 3300025898 Unclassified 1198
444 Ga0207642_10018548 3300025899 Bacteria 2674
445 Ga0207642_10035241 3300025899 Bacteria 2136
446 Ga0207642_10091772 3300025899 Bacteria 1502
447 Ga0207710_10058892 3300025900 Bacteria 1738
448 Ga0207710_10075761 3300025900 Bacteria 1551
449 Ga0207688_10025365 3300025901 Bacteria 3255
450 Ga0207688_10088620 3300025901 Bacteria 1775
451 Ga0207680_10003030 3300025903 Bacteria 7876
452 Ga0207680_10220557 3300025903 Bacteria 1300
453 Ga0207647_10081611 3300025904 Unclassified 1937
454 Ga0207685_10077220 3300025905 Bacteria 1367
455 Ga0207699_10011847 3300025906 Bacteria 4419
456 Ga0207645_10001664 3300025907 Bacteria 18110
457 Ga0207643_10029024 3300025908 Bacteria 3076
458 Ga0207643_10062736 3300025908 Bacteria 2123
459 Ga0207643_10076941 3300025908 Bacteria 1928
460 Ga0207684_10019295 3300025910 Bacteria 5832
461 Ga0207684_10099501 3300025910 Unclassified 2484
462 Ga0207654_10186249 3300025911 Unclassified 1357
463 Ga0207707_10007362 3300025912 Bacteria 9585
464 Ga0207707_10010881 3300025912 Bacteria 7907
465 Ga0207707_10432170 3300025912 Bacteria 1128
466 Ga0207695_10344296 3300025913 Bacteria 1378
467 Ga0207695_10399028 3300025913 Bacteria 1260
468 Ga0207671_10119060 3300025914 Bacteria 2017
469 Ga0207660_10025469 3300025917 Bacteria 4015
470 Ga0207660_10025610 3300025917 Bacteria 4007
471 Ga0207662_10008759 3300025918 Bacteria 5549
472 Ga0207662_10037831 3300025918 Bacteria 2826
473 Ga0207662_10056122 3300025918 Bacteria 2351
474 Ga0207662_10126672 3300025918 Bacteria 1606
475 Ga0207657_10001144 3300025919 Bacteria 28206
476 Ga0207657_10434009 3300025919 Bacteria 1032
477 Ga0207649_10025067 3300025920 Bacteria 3473
478 Ga0207649_10187174 3300025920 Bacteria 1453
479 Ga0207649_10341784 3300025920 Unclassified 1105
480 Ga0207652_10023067 3300025921 Bacteria 5155
481 Ga0207652_10089166 3300025921 Bacteria 2708
482 Ga0207646_10011845 3300025922 Bacteria 8413
483 Ga0207646_10033917 3300025922 Bacteria 4613
484 Ga0207646_10042888 3300025922 Bacteria 4065
485 Ga0207646_10436481 3300025922 Bacteria 1182
486 Ga0207646_10569696 3300025922 Bacteria 1017
487 Ga0207681_10018031 3300025923 Bacteria 4441
488 Ga0207681_10021243 3300025923 Bacteria 4124
489 Ga0207681_10037333 3300025923 Bacteria 3210
490 Ga0207681_10093732 3300025923 Bacteria 2150
491 Ga0207681_10114762 3300025923 Unclassified 1965
492 Ga0207681_10532688 3300025923 Bacteria 965
493 Ga0207650_10001004 3300025925 Bacteria 21226
494 Ga0207650_10017891 3300025925 Bacteria 4965
495 Ga0207650_10032808 3300025925 Bacteria 3757
496 Ga0207650_10032837 3300025925 Bacteria 3756
497 Ga0207650_10124238 3300025925 Archaea 2013
498 Ga0207650_10128320 3300025925 Bacteria 1982
499 Ga0207650_10133823 3300025925 Unclassified 1943
500 Ga0207650_10264911 3300025925 Bacteria 1395
501 Ga0207659_10005490 3300025926 Bacteria 7692
502 Ga0207659_10008493 3300025926 Bacteria 6379
503 Ga0207659_10017227 3300025926 Bacteria 4715
504 Ga0207659_10018041 3300025926 Bacteria 4620
505 Ga0207659_10022966 3300025926 Bacteria 4160
506 Ga0207659_10125618 3300025926 Bacteria 1972
507 Ga0207659_10148019 3300025926 Bacteria 1831
508 Ga0207659_10352911 3300025926 Bacteria 1221
509 Ga0207687_10031366 3300025927 Bacteria 3591
510 Ga0207687_10061638 3300025927 Bacteria 2649
511 Ga0207700_10016230 3300025928 Bacteria 4942
512 Ga0207664_10212208 3300025929 Bacteria 1675
513 Ga0207644_10079846 3300025931 Bacteria 2415
514 Ga0207644_10135139 3300025931 Bacteria 1892
515 Ga0207690_10088390 3300025932 Bacteria 2183
516 Ga0207690_10112450 3300025932 Bacteria 1964
517 Ga0207706_10063090 3300025933 Bacteria 3263
518 Ga0207706_10086569 3300025933 Unclassified 2754
519 Ga0207706_10253039 3300025933 Bacteria 1538
520 Ga0207706_10320012 3300025933 Bacteria 1350
521 Ga0207686_10006631 3300025934 Bacteria 6243
522 Ga0207686_10012507 3300025934 Bacteria 4667
523 Ga0207686_10030169 3300025934 Bacteria 3208
524 Ga0207686_10182944 3300025934 Bacteria 1487
525 Ga0207686_10280094 3300025934 Bacteria 1230
526 Ga0207709_10151816 3300025935 Bacteria 1605
527 Ga0207670_10026502 3300025936 Bacteria 3653
528 Ga0207670_10036604 3300025936 Bacteria 3193
529 Ga0207670_10157789 3300025936 Bacteria 1690
530 Ga0207670_10203469 3300025936 Bacteria 1506
531 Ga0207669_10023051 3300025937 Bacteria 3318
532 Ga0207669_10070899 3300025937 Bacteria 2187
533 Ga0207669_10084912 3300025937 Bacteria 2042
534 Ga0207704_10015029 3300025938 Bacteria 3932
535 Ga0207704_10105527 3300025938 Bacteria 1890
536 Ga0207704_10255075 3300025938 Bacteria 1319
537 Ga0207665_10069765 3300025939 Bacteria 2397
538 Ga0207665_10157547 3300025939 Bacteria 1631
539 Ga0207691_10008279 3300025940 Bacteria 9984
540 Ga0207691_10036189 3300025940 Bacteria 4574
541 Ga0207691_10050142 3300025940 Unclassified 3822
542 Ga0207691_10051172 3300025940 Bacteria 3778
543 Ga0207691_10085015 3300025940 Bacteria 2839
544 Ga0207691_10118331 3300025940 Bacteria 2350
545 Ga0207691_10121067 3300025940 Bacteria 2319
546 Ga0207691_10252367 3300025940 Bacteria 1522
547 Ga0207691_10254316 3300025940 Bacteria 1516
548 Ga0207711_10010381 3300025941 Bacteria 7732
549 Ga0207711_10042203 3300025941 Bacteria 3887
550 Ga0207711_10062420 3300025941 Bacteria 3214
551 Ga0207711_10099877 3300025941 Bacteria 2566
552 Ga0207711_10101521 3300025941 Bacteria 2546
553 Ga0207711_10298325 3300025941 Bacteria 1486
554 Ga0207711_10319863 3300025941 Bacteria 1434
555 Ga0207689_10059301 3300025942 Bacteria 3148
556 Ga0207661_10044622 3300025944 Bacteria 3505
557 Ga0207661_10159821 3300025944 Bacteria 1954
558 Ga0207679_10004179 3300025945 Bacteria 8972
559 Ga0207679_10028883 3300025945 Bacteria 3856
560 Ga0207679_10032427 3300025945 Unclassified 3667
561 Ga0207679_10063690 3300025945 Bacteria 2753
562 Ga0207679_10075557 3300025945 Bacteria 2557
563 Ga0207679_10141412 3300025945 Bacteria 1946
564 Ga0207679_10154103 3300025945 Bacteria 1874
565 Ga0207679_10220172 3300025945 Bacteria 1597
566 Ga0207679_10335105 3300025945 Bacteria 1314
567 Ga0207679_10385558 3300025945 Bacteria 1229
568 Ga0207651_10002408 3300025960 Bacteria 8933
569 Ga0207651_10049616 3300025960 Bacteria 2845
570 Ga0207651_10087180 3300025960 Bacteria 2271
571 Ga0207651_10161968 3300025960 Bacteria 1755
572 Ga0207651_10280390 3300025960 Bacteria 1377
573 Ga0207651_10331062 3300025960 Bacteria 1276
574 Ga0207712_10011268 3300025961 Bacteria 5691
575 Ga0207712_10178352 3300025961 Unclassified 1666
576 Ga0207712_10321543 3300025961 Bacteria 1277
577 Ga0207640_10006492 3300025981 Bacteria 6423
578 Ga0207640_10081313 3300025981 Unclassified 2215
579 Ga0207640_10256402 3300025981 Unclassified 1360
580 Ga0207658_10108186 3300025986 Bacteria 2192
581 Ga0207658_10177577 3300025986 Bacteria 1760
582 Ga0207677_10030099 3300026023 Bacteria 3460
583 Ga0207703_10013580 3300026035 Bacteria 6346
584 Ga0207703_10042474 3300026035 Unclassified 3647
585 Ga0207703_10069718 3300026035 Bacteria 2900
586 Ga0207703_10077296 3300026035 Bacteria 2763
587 Ga0207703_10082024 3300026035 Bacteria 2690
588 Ga0207703_10327309 3300026035 Bacteria 1405
589 Ga0207703_10424470 3300026035 Unclassified 1238
590 Ga0207703_10464246 3300026035 Bacteria 1184
591 Ga0207639_10055478 3300026041 Unclassified 3033
592 Ga0207639_10190357 3300026041 Unclassified 1752
593 Ga0207678_10095228 3300026067 Bacteria 2544
594 Ga0207708_10037635 3300026075 Bacteria 3685
595 Ga0207708_10052002 3300026075 Bacteria 3120
596 Ga0207708_10052714 3300026075 Bacteria 3099
597 Ga0207708_10080180 3300026075 Bacteria 2508
598 Ga0207708_10269628 3300026075 Unclassified 1376
599 Ga0207702_10517964 3300026078 Bacteria 1164
600 Ga0207641_10005481 3300026088 Bacteria 10822
601 Ga0207641_10010225 3300026088 Bacteria 7716
602 Ga0207648_10037255 3300026089 Bacteria 4283
603 Ga0207648_10037562 3300026089 Bacteria 4267
604 Ga0207648_10068757 3300026089 Bacteria 3086
605 Ga0207648_10153888 3300026089 Bacteria 2029
606 Ga0207648_10360586 3300026089 Bacteria 1311
607 Ga0207676_10003579 3300026095 Bacteria 10978
608 Ga0207676_10013448 3300026095 Bacteria 5878
609 Ga0207676_10045974 3300026095 Bacteria 3375
610 Ga0207676_10111816 3300026095 Bacteria 2287
611 Ga0207676_10311148 3300026095 Unclassified 1442
612 Ga0207676_10579993 3300026095 Bacteria 1075
613 Ga0207674_10075481 3300026116 Bacteria 3381
614 Ga0207674_10133520 3300026116 Bacteria 2445
615 Ga0207674_10172783 3300026116 Bacteria 2114
616 Ga0207675_100054271 3300026118 Bacteria 3738
617 Ga0207675_100071953 3300026118 Bacteria 3233
618 Ga0207675_100185068 3300026118 Bacteria 1996
619 Ga0207683_10021528 3300026121 Bacteria 5522
620 Ga0207698_10039325 3300026142 Bacteria 3503
621 Ga0207698_10205715 3300026142 Unclassified 1766
622 Ga0207698_10558671 3300026142 Bacteria 1123
623 Ga0207698_10653787 3300026142 Bacteria 1042
624 Ga0209974_10008853 3300027876 Unclassified 3429
625 Ga0207428_10000212 3300027907 Bacteria 80663
626 Ga0207428_10003506 3300027907 Bacteria 15192
627 Ga0207428_10015830 3300027907 Bacteria 6508
628 Ga0207428_10056638 3300027907 Bacteria 3114
629 Ga0207428_10076496 3300027907 Bacteria 2621
630 Ga0207428_10172694 3300027907 Bacteria 1636
631 Ga0268266_10055151 3300028379 Bacteria 3416
632 Ga0268266_10168907 3300028379 Bacteria 1984
633 Ga0268265_10061290 3300028380 Bacteria 2886
634 Ga0268265_10291945 3300028380 Bacteria 1464
635 Ga0268265_10367474 3300028380 Bacteria 1319
636 Ga0268264_10006620 3300028381 Bacteria 9745
637 Ga0268264_10021587 3300028381 Bacteria 5256
638 Ga0268264_10107997 3300028381 Bacteria 2432
639 Ga0268264_10269881 3300028381 Bacteria 1589
640 Ga0268264_10376997 3300028381 Bacteria 1358
641 Ga0268264_10419732 3300028381 Bacteria 1290
642 Ga0268264_10526632 3300028381 Bacteria 1156
643 Ga0265336_10024112 3300028666 Bacteria 1924
644 Ga0265338_10005701 3300028800 Bacteria 16110
645 Ga0265330_10111880 3300031235 Bacteria 1166
646 Ga0265328_10035075 3300031239 Bacteria 1855
647 Ga0265325_10062521 3300031241 Bacteria 1886
648 Ga0265331_10000019 3300031250 Bacteria 258837
649 Ga0265327_10000928 3300031251 Bacteria 42902
650 Ga0265316_10090801 3300031344 Bacteria 2331
651 Ga0307408_100027682 3300031548 Bacteria 3909
652 Ga0307408_100355518 3300031548 Bacteria 1244
653 Ga0265313_10018774 3300031595 Bacteria 3872
654 Ga0316579_10027018 3300031691 Unclassified 2603
655 Ga0265314_10080232 3300031711 Bacteria 2155
656 Ga0316576_10003605 3300031727 Bacteria 9127
657 Ga0307405_10013002 3300031731 Bacteria 4428
658 Ga0307405_10015803 3300031731 Bacteria 4097
659 Ga0316577_10060616 3300031733 Unclassified 2111
660 Ga0307413_10000067 3300031824 Bacteria 25867
661 Ga0307413_10006459 3300031824 Bacteria 5357
662 Ga0307413_10023032 3300031824 Viruses 3369
663 Ga0307413_10024370 3300031824 Unclassified 3298
664 Ga0307413_10099702 3300031824 Bacteria 1916
665 Ga0307410_10002843 3300031852 Bacteria 8509
666 Ga0307410_10018786 3300031852 Bacteria 4186
667 Ga0307410_10018996 3300031852 Bacteria 4169
668 Ga0307410_10021983 3300031852 Bacteria 3934
669 Ga0307410_10022118 3300031852 Bacteria 3925
670 Ga0307410_10163496 3300031852 Bacteria 1670
671 Ga0307406_10013088 3300031901 Bacteria 4744
672 Ga0307406_10280044 3300031901 Unclassified 1272
673 Ga0307406_10289348 3300031901 Bacteria 1253
674 Ga0307407_10000762 3300031903 Bacteria 10590
675 Ga0307407_10022255 3300031903 Bacteria 3285
676 Ga0307407_10084214 3300031903 Bacteria 1931
677 Ga0307407_10120996 3300031903 Bacteria 1659
678 Ga0307407_10361782 3300031903 Bacteria 1030
679 Ga0307409_100002800 3300031995 Bacteria 9214
680 Ga0307409_100019588 3300031995 Bacteria 4586
681 Ga0307409_100091216 3300031995 Viruses 2496
682 Ga0307409_100419064 3300031995 Bacteria 1284
683 Ga0307416_100044726 3300032002 Bacteria 3479
684 Ga0307416_100071428 3300032002 Bacteria 2884
685 Ga0307416_100099177 3300032002 Bacteria 2529
686 Ga0307416_100263706 3300032002 Bacteria 1686
687 Ga0307416_100826944 3300032002 Bacteria 1023
688 Ga0307414_10013362 3300032004 Bacteria 4885
689 Ga0307414_10042322 3300032004 Bacteria 3094
690 Ga0307411_10003266 3300032005 Bacteria 7484
691 Ga0307411_10008118 3300032005 Bacteria 5412
692 Ga0307411_10015975 3300032005 Bacteria 4237
693 Ga0307411_10021082 3300032005 Bacteria 3805
694 Ga0307411_10027026 3300032005 Bacteria 3465
695 Ga0307411_10253063 3300032005 Bacteria 1386
696 Ga0307411_10390528 3300032005 Bacteria 1147
697 Ga0307415_100043760 3300032126 Viruses 2989
698 Ga0307415_100164559 3300032126 Bacteria 1723
699 Ga0307415_100233911 3300032126 Bacteria 1482
700 Ga0373930_0006267 3300034816 Bacteria 2006
701 Ga0373950_0001013 3300034818 Bacteria 3575
702 Ga0373958_0003163 3300034819 Bacteria 2360
703 Ga0373951_0001547 3300035091 Bacteria 6024
704 Ga0373952_0000309 3300035092 Bacteria 8134
705 Ga0373923_0051265 3300035111 Bacteria 1731
706 Ga0373932_0000219 3300035112 Bacteria 16992
707 Ga0373932_0043053 3300035112 Bacteria 1312
708 Ga0373941_0000159 3300035115 Bacteria 12239
709 Ga0373941_0020639 3300035115 Bacteria 1850
710 Ga0373943_0055478 3300035170 Bacteria 1963
711 Ga0373943_0069603 3300035170 Bacteria 1779
712 Ga0373946_0028358 3300035171 Bacteria 2220
713 Ga0373955_0125127 3300035172 Bacteria 1497
714 Ga0373942_0000994 3300035207 Bacteria 7710
715 Ga0373961_0002956 3300035241 Bacteria 4296
716 Ga0373961_0017709 3300035241 Bacteria 1853
717 Ga0373962_0001234 3300035242 Bacteria 5992
718 Ga0373935_0073370 3300035692 Bacteria 2211
719 Ga0373927_0204731 3300035695 Bacteria 1296
720 Ga0373947_0003820 3300035725 Bacteria 8871
721 Ga0373947_0081809 3300035725 Bacteria 2000
722 Ga0373937_0024873 3300036401 Bacteria 5405
723 Ga0373937_0052844 3300036401 Bacteria 3727
724 Ga0373937_0280788 3300036401 Bacteria 1573
725 Ga0373937_0309175 3300036401 Bacteria 1495
726 Ga0316582_0007537 3300036647 Bacteria 5798
727 Ga0316582_0178321 3300036647 Bacteria 1445
728 Ga0316584_0003783 3300036712 Bacteria 9919
729 Ga0373925_0027048 3300037068 Bacteria 4200
730 Ga0373925_0036211 3300037068 Bacteria 3642
731 Ga0395900_0275797 3300037418 Bacteria 1675
732 Ga0395905_0143907 3300037471 Bacteria 2243
733 Ga0436364_0206790 3300037853 Bacteria 49437
734 Ga0436364_0678765 3300037853 Unclassified 1576
735 Ga0436365_0508744 3300039437 Bacteria 1428
736 Ga0436365_1722120 3300039437 Bacteria 10768
737 Ga0436362_1082312 3300039453 Bacteria 3174
738 Ga0451837_1559242 3300041494 Bacteria 2724
739 Ga0450894_001496 3300042131 Bacteria 3325
740 Ga0450895_000120 3300042132 Bacteria 3325
741 Ga0450908_002747 3300042184 Bacteria 3436
742 Ga0439464_0017513 3300042439 Bacteria 1944
743 Ga0451577_0071095 3300042876 Bacteria 3103
744 Ga0453683_0025479 3300044673 Bacteria 3757
745 Ga0453684_0517772 3300044712 Bacteria 1318
746 Ga0451576_0045540 3300045051 Bacteria 4619
747 Ga0451576_0213379 3300045051 Bacteria 2016
748 Ga0466967_0280766 3300045976 Bacteria 1598
749 Ga0495592_0045759 3300046454 Bacteria 3264
750 Ga0495629_0037572 3300046459 Bacteria 3413
751 Ga0495629_0125654 3300046459 Bacteria 1787
752 Ga0495580_0056725 3300046472 Bacteria 2758
753 Ga0495580_0080795 3300046472 Bacteria 2266
754 Ga0495582_0086555 3300046473 Bacteria 1744
755 Ga0495594_0040802 3300046499 Bacteria 2541
756 Ga0495608_0013304 3300046511 Bacteria 5708
757 Ga0495628_0109965 3300046516 Bacteria 2121
758 Ga0495628_0167209 3300046516 Bacteria 1669
759 Ga0495628_0293799 3300046516 Bacteria 1204
760 Ga0495630_0012238 3300046517 Bacteria 6223
761 Ga0495630_0175050 3300046517 Bacteria 1636
762 Ga0495587_0016887 3300046536 Bacteria 4539
763 Ga0495598_0021765 3300046537 Bacteria 1709
764 Ga0495598_0040426 3300046537 Bacteria 1360
765 Ga0495621_0077591 3300046539 Bacteria 1234
766 Ga0495645_0023750 3300046543 Bacteria 4443
767 Ga0495668_0005084 3300046616 Bacteria 9048
768 Ga0495599_0037970 3300046678 Bacteria 3026
769 Ga0495647_0052945 3300046681 Bacteria 1582
770 Ga0495647_0101339 3300046681 Unclassified 1193
771 Ga0495658_0024459 3300046683 Bacteria 3218
772 Ga0495658_0087781 3300046683 Bacteria 1837
773 Ga0495658_0201323 3300046683 Bacteria 1241
774 Ga0495658_0201339 3300046683 Bacteria 1241
775 Ga0495669_0031575 3300046684 Bacteria 2326
776 Ga0495613_0000598 3300046689 Bacteria 29033
777 Ga0495670_0289827 3300046691 Bacteria 876
778 Ga0495600_0370965 3300046809 Bacteria 894
779 Ga0495604_0138564 3300047317 Bacteria 1741
780 Ga0495674_0153612 3300047319 Bacteria 1929
781 Ga0495674_0361465 3300047319 Bacteria 1177
782 Ga0495674_0375124 3300047319 Bacteria 1152
783 Ga0495672_0000838 3300047320 Bacteria 32748
784 Ga0495675_0138642 3300047444 Bacteria 1509
785 Ga0495684_0003405 3300047471 Bacteria 12475
786 Ga0495602_0097752 3300048088 Bacteria 2418
787 Ga0496100_0002319 3300048903 Bacteria 9628
788 Ga0496100_0363464 3300048903 Bacteria 1096
789 Ga0496101_0001324 3300048904 Bacteria 14831
790 Ga0496101_0020965 3300048904 Bacteria 4485
791 Ga0496101_0048966 3300048904 Bacteria 3038
792 Ga0496104_0011087 3300048907 Bacteria 8067
793 Ga0496104_0102065 3300048907 Bacteria 2747
794 Ga0496104_0375431 3300048907 Bacteria 1334
795 Ga0496105_0035520 3300048908 Bacteria 4102
796 Ga0496105_0086424 3300048908 Bacteria 2592
797 Ga0496105_0199796 3300048908 Bacteria 1632
798 Ga0496108_0030258 3300048911 Bacteria 4487
799 Ga0496108_0061146 3300048911 Bacteria 3169
800 Ga0496108_0209148 3300048911 Bacteria 1693
801 Ga0496109_0004497 3300048912 Bacteria 11655
802 Ga0496109_0015865 3300048912 Bacteria 6577
803 Ga0496109_0445384 3300048912 Bacteria 1223
804 Ga0496110_0013630 3300048913 Bacteria 6730
805 Ga0496110_0133190 3300048913 Bacteria 2245
806 Ga0496112_0001320 3300048915 Bacteria 18863
807 Ga0496112_0013141 3300048915 Bacteria 7640
808 Ga0496112_0046733 3300048915 Bacteria 4247
809 Ga0496112_0184448 3300048915 Bacteria 2050
810 Ga0496112_0370538 3300048915 Bacteria 1374
811 Ga0496113_0015387 3300048916 Bacteria 5256
812 Ga0496113_0040590 3300048916 Bacteria 3430
813 Ga0496113_0339661 3300048916 Bacteria 1204
814 Ga0496114_0000128 3300048917 Bacteria 54547
815 Ga0496114_0002144 3300048917 Bacteria 15002
816 Ga0496114_0115808 3300048917 Bacteria 2300
817 Ga0496114_0282926 3300048917 Bacteria 1462
818 Ga0496115_0097466 3300048918 Bacteria 2408
819 Ga0501291_015782 3300049514 Bacteria 1145
820 Ga0501031_0199775 3300049568 Bacteria 1305
821 Ga0501033_0012185 3300049570 Bacteria 6564
822 Ga0501036_0002962 3300049572 Bacteria 13491
823 Ga0501036_0083539 3300049572 Bacteria 2700
824 Ga0501036_0435973 3300049572 Bacteria 1092
825 Ga0501037_0106402 3300049573 Bacteria 2021
826 Ga0501037_0435960 3300049573 Bacteria 895
827 Ga0501038_0080431 3300049574 Bacteria 2747
828 Ga0501038_0236113 3300049574 Bacteria 1453
829 Ga0501039_0020637 3300049575 Bacteria 5049
830 Ga0501040_0012274 3300049576 Bacteria 5612
831 Ga0501040_0170954 3300049576 Bacteria 1539
832 Ga0501041_0005712 3300049577 Bacteria 7269
833 Ga0501041_0008511 3300049577 Bacteria 6038
834 Ga0501042_0018275 3300049578 Bacteria 4853
835 Ga0501043_0022920 3300049579 Bacteria 4896
836 Ga0501046_0009634 3300049580 Bacteria 8328
837 Ga0501048_0057446 3300049582 Bacteria 2760
838 Ga0501071_0003706 3300049587 Bacteria 9593
839 Ga0501071_0113956 3300049587 Bacteria 2000
840 Ga0501071_0365578 3300049587 Bacteria 1099
841 Ga0501072_0005968 3300049588 Bacteria 9286
842 Ga0501072_0079039 3300049588 Bacteria 2604
843 Ga0501073_0184331 3300049589 Bacteria 1445
844 Ga0501075_0004678 3300049591 Bacteria 9294
845 Ga0501075_0095521 3300049591 Bacteria 2256
846 Ga0501075_0233166 3300049591 Bacteria 1403
847 Ga0501077_0015804 3300049593 Bacteria 4754
848 Ga0501077_0278810 3300049593 Bacteria 1064
849 Ga0501202_047930 3300049652 Bacteria 940
850 Ga0501223_017700 3300049663 Bacteria 1406
851 Ga0501224_028398 3300049664 Bacteria 837
852 Ga0501257_004513 3300049686 Bacteria 3043
853 Ga0501259_007494 3300049688 Bacteria 1749
854 Ga0501221_001900 3300049704 Bacteria 3488
855 Ga0501079_0000628 3300049741 Bacteria 23440
856 Ga0501079_0074214 3300049741 Bacteria 2629
857 Ga0501080_0046867 3300049742 Bacteria 4024
858 Ga0501081_0006908 3300049743 Bacteria 7374
859 Ga0501081_0097500 3300049743 Bacteria 2075
860 Ga0501081_0349513 3300049743 Bacteria 1089
861 Ga0501083_0203195 3300049744 Bacteria 1292
862 Ga0501263_000203 3300049760 Unclassified 3704
863 Ga0501268_005662 3300049765 Bacteria 1803
864 Ga0501273_001608 3300049770 Bacteria 2184
865 Ga0501035_0132064 3300049822 Bacteria 2176
866 Ga0501035_0325812 3300049822 Bacteria 1290
867 Ga0501044_0001483 3300049823 Bacteria 27518
868 Ga0501045_0002983 3300049824 Bacteria 11576
869 Ga0501045_0016713 3300049824 Bacteria 5212
870 Ga0501045_0038472 3300049824 Bacteria 3479
871 nmdc:mga05p37_10218_c1 3300050507 Bacteria 9446
872 nmdc:mga05p37_1133_c1 3300050507 Bacteria 30583
873 nmdc:mga05p37_118487_c1 3300050507 Bacteria 3253
874 nmdc:mga05p37_127649_c1 3300050507 Bacteria 3122
875 nmdc:mga05p37_14672_c1 3300050507 Bacteria 9412
876 nmdc:mga05p37_18442_c1 3300050507 Bacteria 8430
877 nmdc:mga05p37_24935_c1 3300050507 Bacteria 7269
878 nmdc:mga05p37_274342_c1 3300050507 Bacteria 2014
879 nmdc:mga05p37_55703_c1 3300050507 Bacteria 4867
880 nmdc:mga05p37_579586_c1 3300050507 Bacteria 1271
881 nmdc:mga05p37_60657_c1 3300050507 Bacteria 4656
882 nmdc:mga05p37_613799_c1 3300050507 Bacteria 1225
883 nmdc:mga05p37_65433_c1 3300050507 Unclassified 4473
884 nmdc:mga05p37_6560_c1 3300050507 Bacteria 13713
885 nmdc:mga05p37_89562_c1 3300050507 Bacteria 3792
886 nmdc:mga05p37_94269_c1 3300050507 Bacteria 3689
887 nmdc:mga09592_322497_c1 3300050508 Bacteria 1338
888 nmdc:mga09592_60803_c1 3300050508 Bacteria 3194
889 nmdc:mga09592_62946_c1 3300050508 Bacteria 3139
890 nmdc:mga0qj67_12411_c1 3300050509 Bacteria 6419
891 nmdc:mga0qj67_356891_c1 3300050509 Bacteria 1181
892 nmdc:mga0qj67_371106_c1 3300050509 Bacteria 1156
893 nmdc:mga06r32_19045_c1 3300050510 Bacteria 6293
894 nmdc:mga06r32_4839_c1 3300050510 Bacteria 12127
895 nmdc:mga06r32_512021_c1 3300050510 Bacteria 1176
896 nmdc:mga06r32_75870_c1 3300050510 Bacteria 3264
897 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
898 nmdc:mga08y16_15368_c1 3300050511 Bacteria 5481
899 nmdc:mga08y16_2009_c1 3300050511 Bacteria 20800
900 nmdc:mga08y16_24027_c1 3300050511 Bacteria 6437
901 nmdc:mga08y16_39765_c1 3300050511 Bacteria 4933
902 nmdc:mga08y16_528431_c1 3300050511 Bacteria 1196
903 nmdc:mga08y16_538067_c1 3300050511 Bacteria 1183
904 nmdc:mga08y16_66035_c1 3300050511 Bacteria 3776
905 nmdc:mga08y16_7519_c1 3300050511 Bacteria 11410
906 nmdc:mga0n895_118282_c1 3300050512 Bacteria 2670
907 nmdc:mga0n895_352265_c1 3300050512 Unclassified 1491
908 nmdc:mga0n895_399354_c1 3300050512 Bacteria 1390
909 nmdc:mga0n895_650_c1 3300050512 Bacteria 24250
910 nmdc:mga0n895_737550_c1 3300050512 Bacteria 979
911 nmdc:mga0rr50_15027_c1 3300050513 Bacteria 5100
912 nmdc:mga0rr50_257744_c1 3300050513 Bacteria 1450
913 nmdc:mga0rr50_26553_c1 3300050513 Bacteria 4042
914 nmdc:mga0rr50_3289_c1 3300050513 Bacteria 9278
915 nmdc:mga0rr50_49050_c1 3300050513 Bacteria 3124
916 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
917 nmdc:mga08x19_103054_c1 3300050514 Bacteria 1895
918 nmdc:mga08x19_10454_c1 3300050514 Bacteria 5573
919 nmdc:mga08x19_211376_c1 3300050514 Bacteria 1332
920 nmdc:mga08x19_25238_c1 3300050514 Bacteria 3701
921 nmdc:mga08x19_27690_c1 3300050514 Bacteria 3546
922 nmdc:mga08x19_33260_c1 3300050514 Bacteria 3254
923 nmdc:mga08x19_41321_c1 3300050514 Bacteria 2937
924 nmdc:mga08x19_906_c1 3300050514 Bacteria 18743
925 nmdc:mga0a205_108226_c1 3300050515 Bacteria 2678
926 nmdc:mga0a205_128541_c1 3300050515 Bacteria 2433
927 nmdc:mga0a205_146848_c1 3300050515 Bacteria 2258
928 nmdc:mga0a205_197448_c1 3300050515 Bacteria 1903
929 nmdc:mga0a205_200655_c1 3300050515 Bacteria 1885
930 nmdc:mga0a205_236452_c1 3300050515 Bacteria 1709
931 nmdc:mga0a205_25755_c1 3300050515 Bacteria 5604
932 nmdc:mga0a205_295513_c1 3300050515 Bacteria 1493
933 nmdc:mga0a205_306796_c1 3300050515 Bacteria 1459
934 nmdc:mga0a205_35160_c1 3300050515 Bacteria 4811
935 Ga0495601_0004887 3300053077 Bacteria 7780
936 Ga0495601_0017299 3300053077 Bacteria 4375
937 Ga0495595_0026620 3300053084 Bacteria 2571
938 Ga0495619_0004150 3300053085 Bacteria 9258
939 Ga0495619_0006496 3300053085 Bacteria 7399
940 Ga0495619_0077011 3300053085 Bacteria 2240
941 Ga0501084_0017927 3300054114 Bacteria 5895
942 Ga0501084_0286173 3300054114 Bacteria 1392
943 Ga0501084_0348304 3300054114 Bacteria 1251
944 Ga0501084_0543342 3300054114 Bacteria 982
945 Ga0501082_0002583 3300060353 Bacteria 15835
946 Ga0501082_0097545 3300060353 Bacteria 2541
947 Ga0501082_0115108 3300060353 Bacteria 2329
948 Ga0501082_0181308 3300060353 Bacteria 1832
949 Ga0530510_0000557 3300061734 Bacteria 24044
950 Ga0530510_0051304 3300061734 Bacteria 2980
951 Ga0530510_0379381 3300061734 Unclassified 1064
952 nmdc:mga06r32_113916_c1
953 LJQas_1001341
954 JGI25406J46586_10001324
955 rootL2_10181840
956 Ga0065712_10000348
957 Ga0065712_10096226
958 Ga0065712_10103744
959 Ga0065712_10150193
960 Ga0065712_10154177
961 Ga0065715_10001316
962 Ga0065715_10184506
963 Ga0065707_10083684
964 Ga0065707_10097516
965 Ga0070676_10038414
966 Ga0070676_10338562
967 Ga0070683_100011637
968 Ga0070683_100512535
969 Ga0070690_100005062
970 Ga0070690_100022217
971 Ga0070670_100003865
972 Ga0070670_100020208
973 Ga0070670_100025364
974 Ga0070670_100027876
975 Ga0070670_100156027
976 Ga0070670_100194508
977 Ga0070670_100232111
978 Ga0070670_100418249
979 Ga0068869_100023268
980 Ga0068869_100047562
981 Ga0070666_10027898
982 Ga0070680_100025848
983 Ga0070680_100267937
984 Ga0068868_100029345
985 Ga0068868_100149135
986 Ga0068868_100267013
987 Ga0070660_100005945
988 Ga0070660_100119175
989 Ga0070689_100059215
990 Ga0070689_100059859
991 Ga0070689_100062513
992 Ga0070689_100316363
993 Ga0070687_100048131
994 Ga0070661_100077919
995 Ga0070661_100080174
996 Ga0070661_100395170
997 Ga0070668_100054782
998 Ga0070668_100202053
999 Ga0070669_100000773
1000 Ga0070669_100003970
1001 Ga0070669_100033654
1002 Ga0070669_100052508
1003 Ga0070669_100085598
1004 Ga0070669_100172644
1005 Ga0070669_100317170
1006 Ga0070675_100000679
1007 Ga0070675_100009110
1008 Ga0070675_100019786
1009 Ga0070675_100040163
1010 Ga0070675_100056971
1011 Ga0070675_100074548
1012 Ga0070675_100095704
1013 Ga0070675_100490737
1014 Ga0070671_100006629
1015 Ga0070671_100026059
1016 Ga0070671_100105782
1017 Ga0070674_100069924
1018 Ga0070674_100101106
1019 Ga0070674_100183152
1020 Ga0070673_100007935
1021 Ga0070673_100032272
1022 Ga0070673_100049076
1023 Ga0070673_100086298
1024 Ga0070673_100111109
1025 Ga0070673_100122229
1026 Ga0070673_100217500
1027 Ga0070673_100255839
1028 Ga0070673_100410851
1029 Ga0070673_100427832
1030 Ga0070688_100002842
1031 Ga0070688_100066681
1032 Ga0070688_100132095
1033 Ga0070688_100175065
1034 Ga0070688_100176493
1035 Ga0070659_100029768
1036 Ga0070659_100073090
1037 Ga0070667_100126926
1038 Ga0070714_100056074
1039 Ga0070713_100012645
1040 Ga0070701_10039600
1041 Ga0070701_10072412
1042 Ga0070701_10098093
1043 Ga0070705_100003008
1044 Ga0070705_100028204
1045 Ga0070700_100016440
1046 Ga0070700_100077048
1047 Ga0070700_100228352
1048 Ga0070694_100037834
1049 Ga0070694_100093330
1050 Ga0070694_100149367
1051 Ga0070694_100431559
1052 Ga0070708_100332277
1053 Ga0070708_100405200
1054 Ga0070663_100075007
1055 Ga0070678_100057369
1056 Ga0070678_100167727
1057 Ga0070678_100378402
1058 Ga0070662_100020423
1059 Ga0070662_100062689
1060 Ga0070681_10001941
1061 Ga0070681_10012562
1062 Ga0068867_100020042
1063 Ga0068867_100025403
1064 Ga0068867_100040362
1065 Ga0068867_100256049
1066 Ga0068867_100270484
1067 Ga0068867_100363040
1068 Ga0070685_10058350
1069 Ga0070685_10065325
1070 Ga0070685_10070003
1071 Ga0070685_10177463
1072 Ga0070685_10302118
1073 Ga0070706_100124253
1074 Ga0070707_100033059
1075 Ga0070707_100047218
1076 Ga0070707_100179953
1077 Ga0070707_100184913
1078 Ga0070707_100274178
1079 Ga0070707_100388153
1080 Ga0070707_100403575
1081 Ga0070707_100497108
1082 Ga0070707_100553021
1083 Ga0070698_100019939
1084 Ga0070698_100041326
1085 Ga0070698_100066414
1086 Ga0070698_100090895
1087 Ga0070698_100242938
1088 Ga0070698_100374809
1089 Ga0070699_100037807
1090 Ga0070699_100378025
1091 Ga0070679_100015065
1092 Ga0070684_100052411
1093 Ga0070684_100550273
1094 Ga0070697_100015405
1095 Ga0070697_100034376
1096 Ga0070697_100057895
1097 Ga0070697_100372387
1098 Ga0068853_100002787
1099 Ga0068853_100048961
1100 Ga0068853_100051234
1101 Ga0068853_100121675
1102 Ga0068853_100183578
1103 Ga0068853_100795672
1104 Ga0070672_100008124
1105 Ga0070672_100034130
1106 Ga0070672_100092493
1107 Ga0070672_100222286
1108 Ga0070672_100229394
1109 Ga0070672_100233850
1110 Ga0070686_100001645
1111 Ga0070686_100014470
1112 Ga0070695_100045792
1113 Ga0070695_100058328
1114 Ga0070696_100016045
1115 Ga0070696_100129603
1116 Ga0070665_100002473
1117 Ga0070665_100003554
1118 Ga0070665_100038740
1119 Ga0070665_100053705
1120 Ga0070665_100311224
1121 Ga0070704_100011292
1122 Ga0070704_100032592
1123 Ga0070704_100440964
1124 Ga0068855_100058599
1125 Ga0068855_100253258
1126 Ga0070664_100002119
1127 Ga0070664_100019604
1128 Ga0070664_100176114
1129 Ga0070664_100209526
1130 Ga0070664_100390252
1131 Ga0070664_100428643
1132 Ga0068857_100064873
1133 Ga0068854_100012110
1134 Ga0068854_100052811
1135 Ga0068854_100094365
1136 Ga0068854_100211569
1137 Ga0068854_100446664
1138 Ga0068856_100124485
1139 Ga0068856_100206636
1140 Ga0070702_100003607
1141 Ga0068852_100073131
1142 Ga0068852_100099971
1143 Ga0068859_100010204
1144 Ga0068859_100017177
1145 Ga0068859_100020666
1146 Ga0068859_100028363
1147 Ga0068859_100150282
1148 Ga0068859_100438389
1149 Ga0068859_100558039
1150 Ga0068859_100741768
1151 Ga0068859_100755646
1152 Ga0068864_100014256
1153 Ga0068864_100021441
1154 Ga0068864_100023671
1155 Ga0068864_100027551
1156 Ga0068864_100070826
1157 Ga0068864_100427401
1158 Ga0068866_10128740
1159 Ga0068861_100049839
1160 Ga0068851_10129260
1161 Ga0068851_10140997
1162 Ga0068870_10047628
1163 Ga0068870_10055909
1164 Ga0068863_100010240
1165 Ga0068863_100023151
1166 Ga0068863_100079148
1167 Ga0068863_100120337
1168 Ga0068863_100356216
1169 Ga0068863_100441919
1170 Ga0068863_100466737
1171 Ga0068863_100516528
1172 Ga0068858_100001318
1173 Ga0068858_100004306
1174 Ga0068858_100038352
1175 Ga0068858_100055186
1176 Ga0068858_100084067
1177 Ga0068858_100118605
1178 Ga0068858_100385682
1179 Ga0068858_100412796
1180 Ga0068860_100109498
1181 Ga0068860_100123294
1182 Ga0068862_100024984
1183 Ga0068862_100026171
1184 Ga0068862_100031931
1185 Ga0068862_100074844
1186 Ga0068862_100080703
1187 Ga0068862_100103227
1188 Ga0068862_100104595
1189 Ga0068862_100398683
1190 Ga0081455_10029065
1191 Ga0081455_10135547
1192 Ga0081540_1023739
1193 Ga0081539_10002652
1194 Ga0081539_10064517
1195 Ga0070717_10220693
1196 Ga0070715_10060823
1197 Ga0070716_100041083
1198 Ga0097621_100003679
1199 Ga0097621_100004412
1200 Ga0097621_100012194
1201 Ga0097621_100038998
1202 Ga0097621_100106165
1203 Ga0097621_100114766
1204 Ga0097621_100266108
1205 Ga0068871_100001757
1206 Ga0068871_100021321
1207 Ga0068871_100045731
1208 Ga0068871_100160218
1209 Ga0068871_100205378
1210 Ga0075428_100000011
1211 Ga0075428_100000965
1212 Ga0075428_100006470
1213 Ga0075428_100040497
1214 Ga0075428_100287929
1215 Ga0075428_100302459
1216 Ga0075430_100004187
1217 Ga0075430_100010964
1218 Ga0075430_100170331
1219 Ga0075431_100005675
1220 Ga0075431_100008784
1221 Ga0075431_100130080
1222 Ga0075431_100579982
1223 Ga0075433_10015027
1224 Ga0075433_10017535
1225 Ga0075433_10045932
1226 Ga0075433_10093233
1227 Ga0075434_100002887
1228 Ga0075434_100019758
1229 Ga0075434_100059097
1230 Ga0075434_100083047
1231 Ga0075429_100014584
1232 Ga0075429_100028918
1233 Ga0075429_100070189
1234 Ga0075429_100227694
1235 Ga0075429_100242104
1236 Ga0075429_100259070
1237 Ga0068865_100059589
1238 Ga0068865_100104370
1239 Ga0068865_100117334
1240 Ga0075436_100010831
1241 Ga0075436_100013077
1242 Ga0075436_100024293
1243 Ga0075436_100053002
1244 Ga0097620_100010204
1245 Ga0097620_100017175
1246 Ga0097620_100020666
1247 Ga0097620_100028365
1248 Ga0097620_100150286
1249 Ga0097620_100438387
1250 Ga0097620_100558041
1251 Ga0097620_100741761
1252 Ga0097620_100755668
1253 Ga0075435_100000469
1254 Ga0075435_100008965
1255 Ga0075435_100009617
1256 Ga0075435_100062309
1257 Ga0075435_100194208
1258 Ga0075435_100326478
1259 Ga0105251_10032163
1260 Ga0105240_10017684
1261 Ga0105240_10025608
1262 Ga0105240_10086412
1263 Ga0111539_10000011
1264 Ga0111539_10001886
1265 Ga0111539_10004497
1266 Ga0111539_10011090
1267 Ga0111539_10037224
1268 Ga0111539_10055534
1269 Ga0111539_10082814
1270 Ga0111539_10084944
1271 Ga0111539_10120933
1272 Ga0111539_10209550
1273 Ga0105245_10010963
1274 Ga0105245_10090636
1275 Ga0105245_10305230
1276 Ga0105247_10003428
1277 Ga0105247_10014547
1278 Ga0105247_10081761
1279 Ga0105247_10102190
1280 Ga0105247_10109502
1281 Ga0114129_10002052
1282 Ga0114129_10003114
1283 Ga0114129_10007103
1284 Ga0114129_10015787
1285 Ga0114129_10022778
1286 Ga0114129_10035148
1287 Ga0114129_10035666
1288 Ga0114129_10035804
1289 Ga0114129_10041791
1290 Ga0114129_10087370
1291 Ga0114129_10116212
1292 Ga0114129_10157063
1293 Ga0114129_10186149
1294 Ga0105243_10023088
1295 Ga0105243_10125402
1296 Ga0105241_10071468
1297 Ga0105241_10125061
1298 Ga0105242_10002076
1299 Ga0105242_10005026
1300 Ga0105242_10028317
1301 Ga0105242_10045105
1302 Ga0105242_10109673
1303 Ga0105242_10221055
1304 Ga0105248_10008235
1305 Ga0105248_10051267
1306 Ga0105248_10061692
1307 Ga0105248_10072811
1308 Ga0105248_10118852
1309 Ga0105248_10144191
1310 Ga0105248_10153236
1311 Ga0105248_10478632
1312 Ga0105238_10273026
1313 Ga0105249_10011115
1314 Ga0105249_10083451
1315 Ga0105249_10242257
1316 Ga0105249_10263066
1317 Ga0105249_10460757
1318 Ga0105249_10480273
1319 Ga0105239_10649601
1320 Ga0157373_10090197
1321 Ga0157373_10099204
1322 Ga0157371_10050647
1323 Ga0157370_10034126
1324 Ga0157369_10670723
1325 Ga0157374_10002657
1326 Ga0157374_10014578
1327 Ga0157374_10015607
1328 Ga0157374_10074989
1329 Ga0157374_10604828
1330 Ga0157378_10008558
1331 Ga0157378_10043922
1332 Ga0157378_10049337
1333 Ga0157378_10059913
1334 Ga0157378_10110615
1335 Ga0157378_10157369
1336 Ga0157378_10159531
1337 Ga0157378_10190318
1338 Ga0157378_10265033
1339 Ga0157378_10796439
1340 Ga0163162_10009040
1341 Ga0163162_10022019
1342 Ga0163162_10022628
1343 Ga0163162_10040189
1344 Ga0163162_10076020
1345 Ga0163162_10098360
1346 Ga0163162_10130584
1347 Ga0163162_10224176
1348 Ga0163162_10863642
1349 Ga0157372_10050738
1350 Ga0157372_10539151
1351 Ga0157372_10791796
1352 Ga0157372_10804208
1353 Ga0157375_10005600
1354 Ga0157375_10018590
1355 Ga0157375_10029638
1356 Ga0157375_10082831
1357 Ga0157375_10110953
1358 Ga0157375_10134651
1359 Ga0157375_10227873
1360 Ga0163163_10013598
1361 Ga0163163_10026496
1362 Ga0163163_10027396
1363 Ga0163163_10097519
1364 Ga0163163_10214583
1365 Ga0163163_10492998
1366 Ga0157380_10002485
1367 Ga0157380_10007729
1368 Ga0157380_10027668
1369 Ga0157380_10049528
1370 Ga0157380_10074924
1371 Ga0157380_10094225
1372 Ga0157380_10226052
1373 Ga0157377_10040208
1374 Ga0157377_10269631
1375 Ga0157379_10008109
1376 Ga0157379_10066274
1377 Ga0157379_10112968
1378 Ga0157379_10218928
1379 Ga0157379_10497694
1380 Ga0157376_10011761
1381 Ga0157376_10020857
1382 Ga0157376_10100603
1383 Ga0157376_10115617
1384 Ga0157376_10154920
1385 Ga0157376_10189409
1386 Ga0157376_10212976
1387 Ga0157376_10214468
1388 Ga0157376_10389409
1389 Ga0163161_10004301
1390 Ga0163161_10010764
1391 Ga0163161_10282080
1392 Ga0213876_10013511
1393 Ga0213875_10002329
1394 Ga0207692_10191061
1395 Ga0207642_10018548
1396 Ga0207642_10035241
1397 Ga0207642_10091772
1398 Ga0207710_10058892
1399 Ga0207710_10075761
1400 Ga0207688_10025365
1401 Ga0207688_10088620
1402 Ga0207680_10003030
1403 Ga0207680_10220557
1404 Ga0207647_10081611
1405 Ga0207685_10077220
1406 Ga0207699_10011847
1407 Ga0207645_10001664
1408 Ga0207643_10029024
1409 Ga0207643_10062736
1410 Ga0207643_10076941
1411 Ga0207684_10019295
1412 Ga0207684_10099501
1413 Ga0207654_10186249
1414 Ga0207707_10007362
1415 Ga0207707_10010881
1416 Ga0207707_10432170
1417 Ga0207695_10344296
1418 Ga0207695_10399028
1419 Ga0207671_10119060
1420 Ga0207660_10025469
1421 Ga0207660_10025610
1422 Ga0207662_10008759
1423 Ga0207662_10037831
1424 Ga0207662_10056122
1425 Ga0207662_10126672
1426 Ga0207657_10001144
1427 Ga0207657_10434009
1428 Ga0207649_10025067
1429 Ga0207649_10187174
1430 Ga0207649_10341784
1431 Ga0207652_10023067
1432 Ga0207652_10089166
1433 Ga0207646_10011845
1434 Ga0207646_10033917
1435 Ga0207646_10042888
1436 Ga0207646_10436481
1437 Ga0207646_10569696
1438 Ga0207681_10018031
1439 Ga0207681_10021243
1440 Ga0207681_10037333
1441 Ga0207681_10093732
1442 Ga0207681_10114762
1443 Ga0207681_10532688
1444 Ga0207650_10001004
1445 Ga0207650_10017891
1446 Ga0207650_10032808
1447 Ga0207650_10032837
1448 Ga0207650_10124238
1449 Ga0207650_10128320
1450 Ga0207650_10133823
1451 Ga0207650_10264911
1452 Ga0207659_10005490
1453 Ga0207659_10008493
1454 Ga0207659_10017227
1455 Ga0207659_10018041
1456 Ga0207659_10022966
1457 Ga0207659_10125618
1458 Ga0207659_10148019
1459 Ga0207659_10352911
1460 Ga0207687_10031366
1461 Ga0207687_10061638
1462 Ga0207700_10016230
1463 Ga0207664_10212208
1464 Ga0207644_10079846
1465 Ga0207644_10135139
1466 Ga0207690_10088390
1467 Ga0207690_10112450
1468 Ga0207706_10063090
1469 Ga0207706_10086569
1470 Ga0207706_10253039
1471 Ga0207706_10320012
1472 Ga0207686_10006631
1473 Ga0207686_10012507
1474 Ga0207686_10030169
1475 Ga0207686_10182944
1476 Ga0207686_10280094
1477 Ga0207709_10151816
1478 Ga0207670_10026502
1479 Ga0207670_10036604
1480 Ga0207670_10157789
1481 Ga0207670_10203469
1482 Ga0207669_10023051
1483 Ga0207669_10070899
1484 Ga0207669_10084912
1485 Ga0207704_10015029
1486 Ga0207704_10105527
1487 Ga0207704_10255075
1488 Ga0207665_10069765
1489 Ga0207665_10157547
1490 Ga0207691_10008279
1491 Ga0207691_10036189
1492 Ga0207691_10050142
1493 Ga0207691_10051172
1494 Ga0207691_10085015
1495 Ga0207691_10118331
1496 Ga0207691_10121067
1497 Ga0207691_10252367
1498 Ga0207691_10254316
1499 Ga0207711_10010381
1500 Ga0207711_10042203
1501 Ga0207711_10062420
1502 Ga0207711_10099877
1503 Ga0207711_10101521
1504 Ga0207711_10298325
1505 Ga0207711_10319863
1506 Ga0207689_10059301
1507 Ga0207661_10044622
1508 Ga0207661_10159821
1509 Ga0207679_10004179
1510 Ga0207679_10028883
1511 Ga0207679_10032427
1512 Ga0207679_10063690
1513 Ga0207679_10075557
1514 Ga0207679_10141412
1515 Ga0207679_10154103
1516 Ga0207679_10220172
1517 Ga0207679_10335105
1518 Ga0207679_10385558
1519 Ga0207651_10002408
1520 Ga0207651_10049616
1521 Ga0207651_10087180
1522 Ga0207651_10161968
1523 Ga0207651_10280390
1524 Ga0207651_10331062
1525 Ga0207712_10011268
1526 Ga0207712_10178352
1527 Ga0207712_10321543
1528 Ga0207640_10006492
1529 Ga0207640_10081313
1530 Ga0207640_10256402
1531 Ga0207658_10108186
1532 Ga0207658_10177577
1533 Ga0207677_10030099
1534 Ga0207703_10013580
1535 Ga0207703_10042474
1536 Ga0207703_10069718
1537 Ga0207703_10077296
1538 Ga0207703_10082024
1539 Ga0207703_10327309
1540 Ga0207703_10424470
1541 Ga0207703_10464246
1542 Ga0207639_10055478
1543 Ga0207639_10190357
1544 Ga0207678_10095228
1545 Ga0207708_10037635
1546 Ga0207708_10052002
1547 Ga0207708_10052714
1548 Ga0207708_10080180
1549 Ga0207708_10269628
1550 Ga0207702_10517964
1551 Ga0207641_10005481
1552 Ga0207641_10010225
1553 Ga0207648_10037255
1554 Ga0207648_10037562
1555 Ga0207648_10068757
1556 Ga0207648_10153888
1557 Ga0207648_10360586
1558 Ga0207676_10003579
1559 Ga0207676_10013448
1560 Ga0207676_10045974
1561 Ga0207676_10111816
1562 Ga0207676_10311148
1563 Ga0207676_10579993
1564 Ga0207674_10075481
1565 Ga0207674_10133520
1566 Ga0207674_10172783
1567 Ga0207675_100054271
1568 Ga0207675_100071953
1569 Ga0207675_100185068
1570 Ga0207683_10021528
1571 Ga0207698_10039325
1572 Ga0207698_10205715
1573 Ga0207698_10558671
1574 Ga0207698_10653787
1575 Ga0209974_10008853
1576 Ga0207428_10000212
1577 Ga0207428_10003506
1578 Ga0207428_10015830
1579 Ga0207428_10056638
1580 Ga0207428_10076496
1581 Ga0207428_10172694
1582 Ga0268266_10055151
1583 Ga0268266_10168907
1584 Ga0268265_10061290
1585 Ga0268265_10291945
1586 Ga0268265_10367474
1587 Ga0268264_10006620
1588 Ga0268264_10021587
1589 Ga0268264_10107997
1590 Ga0268264_10269881
1591 Ga0268264_10376997
1592 Ga0268264_10419732
1593 Ga0268264_10526632
1594 Ga0265336_10024112
1595 Ga0265338_10005701
1596 Ga0265330_10111880
1597 Ga0265328_10035075
1598 Ga0265325_10062521
1599 Ga0265331_10000019
1600 Ga0265327_10000928
1601 Ga0265316_10090801
1602 Ga0307408_100027682
1603 Ga0307408_100355518
1604 Ga0265313_10018774
1605 Ga0316579_10027018
1606 Ga0265314_10080232
1607 Ga0316576_10003605
1608 Ga0307405_10013002
1609 Ga0307405_10015803
1610 Ga0316577_10060616
1611 Ga0307413_10000067
1612 Ga0307413_10006459
1613 Ga0307413_10023032
1614 Ga0307413_10024370
1615 Ga0307413_10099702
1616 Ga0307410_10002843
1617 Ga0307410_10018786
1618 Ga0307410_10018996
1619 Ga0307410_10021983
1620 Ga0307410_10022118
1621 Ga0307410_10163496
1622 Ga0307406_10013088
1623 Ga0307406_10280044
1624 Ga0307406_10289348
1625 Ga0307407_10000762
1626 Ga0307407_10022255
1627 Ga0307407_10084214
1628 Ga0307407_10120996
1629 Ga0307407_10361782
1630 Ga0307409_100002800
1631 Ga0307409_100019588
1632 Ga0307409_100091216
1633 Ga0307409_100419064
1634 Ga0307416_100044726
1635 Ga0307416_100071428
1636 Ga0307416_100099177
1637 Ga0307416_100263706
1638 Ga0307416_100826944
1639 Ga0307414_10013362
1640 Ga0307414_10042322
1641 Ga0307411_10003266
1642 Ga0307411_10008118
1643 Ga0307411_10015975
1644 Ga0307411_10021082
1645 Ga0307411_10027026
1646 Ga0307411_10253063
1647 Ga0307411_10390528
1648 Ga0307415_100043760
1649 Ga0307415_100164559
1650 Ga0307415_100233911
1651 Ga0373930_0006267
1652 Ga0373950_0001013
1653 Ga0373958_0003163
1654 Ga0373951_0001547
1655 Ga0373952_0000309
1656 Ga0373923_0051265
1657 Ga0373932_0000219
1658 Ga0373932_0043053
1659 Ga0373941_0000159
1660 Ga0373941_0020639
1661 Ga0373943_0055478
1662 Ga0373943_0069603
1663 Ga0373946_0028358
1664 Ga0373955_0125127
1665 Ga0373942_0000994
1666 Ga0373961_0002956
1667 Ga0373961_0017709
1668 Ga0373962_0001234
1669 Ga0373935_0073370
1670 Ga0373927_0204731
1671 Ga0373947_0003820
1672 Ga0373947_0081809
1673 Ga0373937_0024873
1674 Ga0373937_0052844
1675 Ga0373937_0280788
1676 Ga0373937_0309175
1677 Ga0316582_0007537
1678 Ga0316582_0178321
1679 Ga0316584_0003783
1680 Ga0373925_0027048
1681 Ga0373925_0036211
1682 Ga0395900_0275797
1683 Ga0395905_0143907
1684 Ga0436364_0206790
1685 Ga0436364_0678765
1686 Ga0436365_0508744
1687 Ga0436365_1722120
1688 Ga0436362_1082312
1689 Ga0451837_1559242
1690 Ga0450894_001496
1691 Ga0450895_000120
1692 Ga0450908_002747
1693 Ga0439464_0017513
1694 Ga0451577_0071095
1695 Ga0453683_0025479
1696 Ga0453684_0517772
1697 Ga0451576_0045540
1698 Ga0451576_0213379
1699 Ga0466967_0280766
1700 Ga0495592_0045759
1701 Ga0495629_0037572
1702 Ga0495629_0125654
1703 Ga0495580_0056725
1704 Ga0495580_0080795
1705 Ga0495582_0086555
1706 Ga0495594_0040802
1707 Ga0495608_0013304
1708 Ga0495628_0109965
1709 Ga0495628_0167209
1710 Ga0495628_0293799
1711 Ga0495630_0012238
1712 Ga0495630_0175050
1713 Ga0495587_0016887
1714 Ga0495598_0021765
1715 Ga0495598_0040426
1716 Ga0495621_0077591
1717 Ga0495645_0023750
1718 Ga0495668_0005084
1719 Ga0495599_0037970
1720 Ga0495647_0052945
1721 Ga0495647_0101339
1722 Ga0495658_0024459
1723 Ga0495658_0087781
1724 Ga0495658_0201323
1725 Ga0495658_0201339
1726 Ga0495669_0031575
1727 Ga0495613_0000598
1728 Ga0495670_0289827
1729 Ga0495600_0370965
1730 Ga0495604_0138564
1731 Ga0495674_0153612
1732 Ga0495674_0361465
1733 Ga0495674_0375124
1734 Ga0495672_0000838
1735 Ga0495675_0138642
1736 Ga0495684_0003405
1737 Ga0495602_0097752
1738 Ga0496100_0002319
1739 Ga0496100_0363464
1740 Ga0496101_0001324
1741 Ga0496101_0020965
1742 Ga0496101_0048966
1743 Ga0496104_0011087
1744 Ga0496104_0102065
1745 Ga0496104_0375431
1746 Ga0496105_0035520
1747 Ga0496105_0086424
1748 Ga0496105_0199796
1749 Ga0496108_0030258
1750 Ga0496108_0061146
1751 Ga0496108_0209148
1752 Ga0496109_0004497
1753 Ga0496109_0015865
1754 Ga0496109_0445384
1755 Ga0496110_0013630
1756 Ga0496110_0133190
1757 Ga0496112_0001320
1758 Ga0496112_0013141
1759 Ga0496112_0046733
1760 Ga0496112_0184448
1761 Ga0496112_0370538
1762 Ga0496113_0015387
1763 Ga0496113_0040590
1764 Ga0496113_0339661
1765 Ga0496114_0000128
1766 Ga0496114_0002144
1767 Ga0496114_0115808
1768 Ga0496114_0282926
1769 Ga0496115_0097466
1770 Ga0501291_015782
1771 Ga0501031_0199775
1772 Ga0501033_0012185
1773 Ga0501036_0002962
1774 Ga0501036_0083539
1775 Ga0501036_0435973
1776 Ga0501037_0106402
1777 Ga0501037_0435960
1778 Ga0501038_0080431
1779 Ga0501038_0236113
1780 Ga0501039_0020637
1781 Ga0501040_0012274
1782 Ga0501040_0170954
1783 Ga0501041_0005712
1784 Ga0501041_0008511
1785 Ga0501042_0018275
1786 Ga0501043_0022920
1787 Ga0501046_0009634
1788 Ga0501048_0057446
1789 Ga0501071_0003706
1790 Ga0501071_0113956
1791 Ga0501071_0365578
1792 Ga0501072_0005968
1793 Ga0501072_0079039
1794 Ga0501073_0184331
1795 Ga0501075_0004678
1796 Ga0501075_0095521
1797 Ga0501075_0233166
1798 Ga0501077_0015804
1799 Ga0501077_0278810
1800 Ga0501202_047930
1801 Ga0501223_017700
1802 Ga0501224_028398
1803 Ga0501257_004513
1804 Ga0501259_007494
1805 Ga0501221_001900
1806 Ga0501079_0000628
1807 Ga0501079_0074214
1808 Ga0501080_0046867
1809 Ga0501081_0006908
1810 Ga0501081_0097500
1811 Ga0501081_0349513
1812 Ga0501083_0203195
1813 Ga0501263_000203
1814 Ga0501268_005662
1815 Ga0501273_001608
1816 Ga0501035_0132064
1817 Ga0501035_0325812
1818 Ga0501044_0001483
1819 Ga0501045_0002983
1820 Ga0501045_0016713
1821 Ga0501045_0038472
1822 nmdc:mga05p37_10218_c1
1823 nmdc:mga05p37_1133_c1
1824 nmdc:mga05p37_118487_c1
1825 nmdc:mga05p37_127649_c1
1826 nmdc:mga05p37_14672_c1
1827 nmdc:mga05p37_18442_c1
1828 nmdc:mga05p37_24935_c1
1829 nmdc:mga05p37_274342_c1
1830 nmdc:mga05p37_55703_c1
1831 nmdc:mga05p37_579586_c1
1832 nmdc:mga05p37_60657_c1
1833 nmdc:mga05p37_613799_c1
1834 nmdc:mga05p37_65433_c1
1835 nmdc:mga05p37_6560_c1
1836 nmdc:mga05p37_89562_c1
1837 nmdc:mga05p37_94269_c1
1838 nmdc:mga09592_322497_c1
1839 nmdc:mga09592_60803_c1
1840 nmdc:mga09592_62946_c1
1841 nmdc:mga0qj67_12411_c1
1842 nmdc:mga0qj67_356891_c1
1843 nmdc:mga0qj67_371106_c1
1844 nmdc:mga06r32_19045_c1
1845 nmdc:mga06r32_4839_c1
1846 nmdc:mga06r32_512021_c1
1847 nmdc:mga06r32_75870_c1
1848 nmdc:mga08y16_12_c1
1849 nmdc:mga08y16_15368_c1
1850 nmdc:mga08y16_2009_c1
1851 nmdc:mga08y16_24027_c1
1852 nmdc:mga08y16_39765_c1
1853 nmdc:mga08y16_528431_c1
1854 nmdc:mga08y16_538067_c1
1855 nmdc:mga08y16_66035_c1
1856 nmdc:mga08y16_7519_c1
1857 nmdc:mga0n895_118282_c1
1858 nmdc:mga0n895_352265_c1
1859 nmdc:mga0n895_399354_c1
1860 nmdc:mga0n895_650_c1
1861 nmdc:mga0n895_737550_c1
1862 nmdc:mga0rr50_15027_c1
1863 nmdc:mga0rr50_257744_c1
1864 nmdc:mga0rr50_26553_c1
1865 nmdc:mga0rr50_3289_c1
1866 nmdc:mga0rr50_49050_c1
1867 nmdc:mga0rr50_8_c1
1868 nmdc:mga08x19_103054_c1
1869 nmdc:mga08x19_10454_c1
1870 nmdc:mga08x19_211376_c1
1871 nmdc:mga08x19_25238_c1
1872 nmdc:mga08x19_27690_c1
1873 nmdc:mga08x19_33260_c1
1874 nmdc:mga08x19_41321_c1
1875 nmdc:mga08x19_906_c1
1876 nmdc:mga0a205_108226_c1
1877 nmdc:mga0a205_128541_c1
1878 nmdc:mga0a205_146848_c1
1879 nmdc:mga0a205_197448_c1
1880 nmdc:mga0a205_200655_c1
1881 nmdc:mga0a205_236452_c1
1882 nmdc:mga0a205_25755_c1
1883 nmdc:mga0a205_295513_c1
1884 nmdc:mga0a205_306796_c1
1885 nmdc:mga0a205_35160_c1
1886 Ga0495601_0004887
1887 Ga0495601_0017299
1888 Ga0495595_0026620
1889 Ga0495619_0004150
1890 Ga0495619_0006496
1891 Ga0495619_0077011
1892 Ga0501084_0017927
1893 Ga0501084_0286173
1894 Ga0501084_0348304
1895 Ga0501084_0543342
1896 Ga0501082_0002583
1897 Ga0501082_0097545
1898 Ga0501082_0115108
1899 Ga0501082_0181308
1900 Ga0530510_0000557
1901 Ga0530510_0051304
1902 Ga0530510_0379381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

222

343

0.97

PF03668

RapZ-like_N

RapZ-like N-terminal domain

61

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9665 177 298
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9513 177 298
2dft-assembly1.cif.gz_B structure of shikimate kinase from mycobacterium tuberculosis complexed with adp and mg at 2.8 angstrons of resolution 0.6473 15 167
3vaa-assembly2.cif.gz_B 1.7 angstrom resolution crystal structure of shikimate kinase from bacteroides thetaiotaomicron 0.644 15 167
4y0a-assembly1.cif.gz_A shikimate kinase from acinetobacter baumannii in complex with shikimate 0.6412 10 167
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9848 184 296 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9056 184 296 3.40.50.720
af_P0A6E1_1_171_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6591 11 166 3.40.50.300
af_Q55C85_13_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.642 15 158 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6412 10 167 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A174LCA3-F1-model_v4 GlmZ(SRNA)-inactivating NTPase 0.9884 177 298 GO:0005524
AF-A0A644XCL4-F1-model_v4 Nucleotide-binding protein 0.9847 179 297 GO:0005524
AF-A0A662DSW2-F1-model_v4 RNase adaptor protein RapZ 0.9837 177 298 GO:0005524
AF-X0TVE7-F1-model_v4 RapZ C-terminal domain-containing protein 0.982 176 298 GO:0005524
AF-A0A2V8R537-F1-model_v4 RNase adaptor protein RapZ 0.9807 172 296 GO:0005524

Map