F486582

General Info

Members Datasets Scaffolds Average Seq Length
951 356 1902 207

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10001326|Ga0075433_1000132617
Length 250
Sequence MLCVRVFDVVLSPLGRCMSTGYSDRINHALAFAAKHHDQQVRKGTRLPYLTHPANVAIILTRYGQDEETIVAGILHDVIEDCVRDGYTREMLESRIADKFGHDVLATVLAVTNRKLDDDGIELSSDERKEDYLARLAQASDRARWVCAADKVHNASTIVADLKRTDYPETVWGRFHVGREGTIRWYRRVHDRLREVGFDAPIMRELDNVARALELWERNNQLDAEASRRPLESAPDHAGDRIGHPPSANY

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
326 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
327 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
328 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
329 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
330 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
334 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
335 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
336 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
337 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
338 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 2.1
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 5.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10001326 3300006852 Bacteria 18119
2 MRS1b_contig_4345944 2162886011 Bacteria 1312
3 MBSR1b_contig_12820842 2162886012 Bacteria 2416
4 LJQas_1009368 3300000549 Bacteria 1180
5 JGI24737J22298_10007042 3300001990 Bacteria 3814
6 JGI24750J21931_1017645 3300002070 Bacteria 977
7 JGI26129J50193_1000056 3300003349 Bacteria 6480
8 Ga0058863_11858270 3300004799 Bacteria 1913
9 Ga0058861_12029262 3300004800 Bacteria 1888
10 Ga0058862_12851645 3300004803 Bacteria 1483
11 Ga0065704_10111315 3300005289 Bacteria 1960
12 Ga0065712_10071488 3300005290 Bacteria 5235
13 Ga0065715_10091110 3300005293 Bacteria 6100
14 Ga0065707_10083014 3300005295 Bacteria 10854
15 Ga0070658_10001628 3300005327 Bacteria 18986
16 Ga0070658_10006330 3300005327 Bacteria 9595
17 Ga0070658_10024256 3300005327 Bacteria 4866
18 Ga0070658_10163784 3300005327 Bacteria 1866
19 Ga0070658_10289338 3300005327 Bacteria 1396
20 Ga0070658_10306361 3300005327 Bacteria 1355
21 Ga0070676_10000196 3300005328 Bacteria 25358
22 Ga0070676_10019332 3300005328 Bacteria 3788
23 Ga0070676_10049480 3300005328 Bacteria 2461
24 Ga0070676_10061782 3300005328 Bacteria 2227
25 Ga0070676_10092459 3300005328 Unclassified 1855
26 Ga0070676_10553496 3300005328 Bacteria 824
27 Ga0070683_100007689 3300005329 Bacteria 9120
28 Ga0070683_100008849 3300005329 Bacteria 8569
29 Ga0070683_100009980 3300005329 Bacteria 8142
30 Ga0070683_100056675 3300005329 Bacteria 3639
31 Ga0070683_100068777 3300005329 Bacteria 3300
32 Ga0070683_100087233 3300005329 Bacteria 2926
33 Ga0070683_100236139 3300005329 Bacteria 1738
34 Ga0070683_100678646 3300005329 Bacteria 986
35 Ga0070690_100013602 3300005330 Bacteria 4814
36 Ga0070670_100000138 3300005331 Bacteria 68361
37 Ga0070670_100068010 3300005331 Bacteria 3057
38 Ga0070670_100161084 3300005331 Bacteria 1944
39 Ga0070677_10027432 3300005333 Bacteria 2144
40 Ga0068869_100010590 3300005334 Bacteria 6019
41 Ga0068869_100035908 3300005334 Bacteria 3516
42 Ga0070666_10061943 3300005335 Bacteria 2533
43 Ga0070666_10216851 3300005335 Bacteria 1349
44 Ga0070680_100000013 3300005336 Bacteria 93815
45 Ga0070680_100000046 3300005336 Bacteria 63865
46 Ga0070680_100000169 3300005336 Bacteria 41532
47 Ga0070680_100003738 3300005336 Bacteria 11372
48 Ga0070680_100015472 3300005336 Bacteria 5982
49 Ga0070680_100152848 3300005336 Bacteria 1938
50 Ga0070680_100216452 3300005336 Bacteria 1616
51 Ga0070682_100000899 3300005337 Bacteria 17364
52 Ga0070682_100005099 3300005337 Bacteria 7301
53 Ga0070682_100566054 3300005337 Bacteria 892
54 Ga0068868_100001284 3300005338 Bacteria 17289
55 Ga0068868_100002264 3300005338 Bacteria 13300
56 Ga0068868_100022692 3300005338 Bacteria 4741
57 Ga0068868_100078949 3300005338 Bacteria 2636
58 Ga0068868_100110729 3300005338 Bacteria 2231
59 Ga0068868_100905277 3300005338 Bacteria 802
60 Ga0070660_100025295 3300005339 Bacteria 4411
61 Ga0070660_100120344 3300005339 Bacteria 2095
62 Ga0070660_100167620 3300005339 Bacteria 1772
63 Ga0070689_100014767 3300005340 Bacteria 5682
64 Ga0070687_100010958 3300005343 Bacteria 3947
65 Ga0070687_100012682 3300005343 Bacteria 3728
66 Ga0070661_100005103 3300005344 Bacteria 9050
67 Ga0070661_100023300 3300005344 Bacteria 4437
68 Ga0070661_100048790 3300005344 Bacteria 3099
69 Ga0070661_100056707 3300005344 Bacteria 2870
70 Ga0070661_100076429 3300005344 Bacteria 2468
71 Ga0070661_100109068 3300005344 Bacteria 2066
72 Ga0070661_100423412 3300005344 Bacteria 1056
73 Ga0070692_10010415 3300005345 Bacteria 4229
74 Ga0070692_10022581 3300005345 Bacteria 3074
75 Ga0070692_10028543 3300005345 Unclassified 2773
76 Ga0070692_10090683 3300005345 Bacteria 1661
77 Ga0070692_10263448 3300005345 Bacteria 1037
78 Ga0070668_100000199 3300005347 Bacteria 39363
79 Ga0070668_100002845 3300005347 Bacteria 12748
80 Ga0070668_100008458 3300005347 Bacteria 7642
81 Ga0070668_100010394 3300005347 Bacteria 6915
82 Ga0070669_100002223 3300005353 Bacteria 14041
83 Ga0070669_100012523 3300005353 Bacteria 6018
84 Ga0070669_100091689 3300005353 Bacteria 2279
85 Ga0070669_100405102 3300005353 Bacteria 1117
86 Ga0070675_100000226 3300005354 Bacteria 36107
87 Ga0070675_100000950 3300005354 Bacteria 20666
88 Ga0070675_100012191 3300005354 Bacteria 6740
89 Ga0070675_100554184 3300005354 Bacteria 1040
90 Ga0070671_100053246 3300005355 Bacteria 3364
91 Ga0070671_100063849 3300005355 Bacteria 3067
92 Ga0070674_100017292 3300005356 Bacteria 4533
93 Ga0070674_100057312 3300005356 Bacteria 2704
94 Ga0070674_100064987 3300005356 Bacteria 2559
95 Ga0070674_100071838 3300005356 Bacteria 2449
96 Ga0070674_100149475 3300005356 Bacteria 1761
97 Ga0070673_100003269 3300005364 Bacteria 10057
98 Ga0070673_100012354 3300005364 Bacteria 5862
99 Ga0070673_100124328 3300005364 Bacteria 2156
100 Ga0070673_100255838 3300005364 Bacteria 1528
101 Ga0070688_100005670 3300005365 Bacteria 6591
102 Ga0070688_100031376 3300005365 Bacteria 3196
103 Ga0070659_100005204 3300005366 Bacteria 9337
104 Ga0070659_100005536 3300005366 Bacteria 9075
105 Ga0070659_100009118 3300005366 Bacteria 7276
106 Ga0070659_100037038 3300005366 Bacteria 3803
107 Ga0070659_100196334 3300005366 Bacteria 1660
108 Ga0070659_100650773 3300005366 Bacteria 909
109 Ga0070667_100008187 3300005367 Bacteria 8665
110 Ga0070667_100016287 3300005367 Bacteria 6148
111 Ga0070667_100072655 3300005367 Bacteria 2932
112 Ga0070667_100085735 3300005367 Bacteria 2701
113 Ga0070667_100116290 3300005367 Bacteria 2323
114 Ga0070667_100120597 3300005367 Bacteria 2281
115 Ga0070667_100315735 3300005367 Bacteria 1409
116 Ga0070703_10009157 3300005406 Bacteria 2793
117 Ga0070709_10000120 3300005434 Bacteria 52179
118 Ga0070709_10009461 3300005434 Bacteria 5379
119 Ga0070714_100006235 3300005435 Bacteria 9183
120 Ga0070714_100007274 3300005435 Bacteria 8604
121 Ga0070714_100015449 3300005435 Bacteria 6144
122 Ga0070714_100094754 3300005435 Bacteria 2621
123 Ga0070713_100000095 3300005436 Bacteria 56677
124 Ga0070713_100095302 3300005436 Bacteria 2567
125 Ga0070710_10140836 3300005437 Bacteria 1479
126 Ga0070701_10007201 3300005438 Bacteria 4735
127 Ga0070701_10143490 3300005438 Bacteria 1368
128 Ga0070711_100028681 3300005439 Bacteria 3665
129 Ga0070711_100063315 3300005439 Bacteria 2581
130 Ga0070711_100207251 3300005439 Bacteria 1516
131 Ga0070705_100097583 3300005440 Unclassified 1847
132 Ga0070705_100438111 3300005440 Bacteria 977
133 Ga0070700_100017205 3300005441 Bacteria 4129
134 Ga0070700_100024864 3300005441 Bacteria 3521
135 Ga0070700_100078058 3300005441 Bacteria 2131
136 Ga0070700_100239011 3300005441 Bacteria 1297
137 Ga0070694_100001889 3300005444 Bacteria 12406
138 Ga0070694_100040814 3300005444 Bacteria 3094
139 Ga0070708_100005015 3300005445 Bacteria 10471
140 Ga0070708_100177020 3300005445 Bacteria 1993
141 Ga0070663_100113517 3300005455 Bacteria 2039
142 Ga0070663_100578665 3300005455 Archaea 942
143 Ga0070678_100038943 3300005456 Bacteria 3350
144 Ga0070678_100217972 3300005456 Bacteria 1585
145 Ga0070678_100610350 3300005456 Unclassified 975
146 Ga0070662_100002076 3300005457 Bacteria 12280
147 Ga0070662_100037390 3300005457 Bacteria 3442
148 Ga0070662_100073471 3300005457 Bacteria 2527
149 Ga0070662_100682353 3300005457 Unclassified 868
150 Ga0070662_100892194 3300005457 Unclassified 758
151 Ga0070681_10000126 3300005458 Bacteria 57455
152 Ga0070681_10000161 3300005458 Bacteria 50572
153 Ga0070681_10015670 3300005458 Bacteria 7552
154 Ga0070681_10053819 3300005458 Bacteria 4010
155 Ga0070681_10086264 3300005458 Bacteria 3092
156 Ga0070681_10115334 3300005458 Bacteria 2624
157 Ga0070681_10121664 3300005458 Bacteria 2544
158 Ga0070681_10201394 3300005458 Unclassified 1909
159 Ga0068867_100006244 3300005459 Bacteria 8433
160 Ga0068867_100009208 3300005459 Bacteria 6971
161 Ga0068867_100170612 3300005459 Bacteria 1723
162 Ga0068867_100325269 3300005459 Bacteria 1275
163 Ga0070685_10032164 3300005466 Bacteria 2937
164 Ga0070685_10042519 3300005466 Bacteria 2593
165 Ga0070707_100000294 3300005468 Bacteria 48476
166 Ga0070707_100330535 3300005468 Bacteria 1481
167 Ga0070707_101351952 3300005468 Bacteria 679
168 Ga0070698_100077500 3300005471 Bacteria 3324
169 Ga0070698_100249167 3300005471 Bacteria 1709
170 Ga0070698_100642529 3300005471 Bacteria 1002
171 Ga0070699_100082753 3300005518 Bacteria 2798
172 Ga0070699_100105730 3300005518 Bacteria 2469
173 Ga0070699_100694841 3300005518 Unclassified 929
174 Ga0070679_100000080 3300005530 Bacteria 72275
175 Ga0070679_100000192 3300005530 Bacteria 49686
176 Ga0070679_100003529 3300005530 Bacteria 14319
177 Ga0070679_100025937 3300005530 Bacteria 5751
178 Ga0070679_100029468 3300005530 Bacteria 5415
179 Ga0070679_100037391 3300005530 Bacteria 4822
180 Ga0070679_100053867 3300005530 Bacteria 4005
181 Ga0070679_100157503 3300005530 Bacteria 2245
182 Ga0070679_100216423 3300005530 Unclassified 1878
183 Ga0070684_100003014 3300005535 Bacteria 12541
184 Ga0070684_100014960 3300005535 Bacteria 6299
185 Ga0070684_100041326 3300005535 Bacteria 3974
186 Ga0070684_100082913 3300005535 Bacteria 2840
187 Ga0070684_100191562 3300005535 Bacteria 1861
188 Ga0070684_100943404 3300005535 Bacteria 809
189 Ga0070697_100230674 3300005536 Bacteria 1579
190 Ga0068853_100007144 3300005539 Bacteria 8932
191 Ga0068853_100010830 3300005539 Bacteria 7387
192 Ga0068853_100025180 3300005539 Bacteria 4992
193 Ga0068853_100451179 3300005539 Bacteria 1209
194 Ga0070672_100005106 3300005543 Bacteria 8659
195 Ga0070672_100047010 3300005543 Bacteria 3347
196 Ga0070672_100422072 3300005543 Bacteria 1146
197 Ga0070686_100000894 3300005544 Bacteria 17322
198 Ga0070686_100096061 3300005544 Bacteria 1992
199 Ga0070686_100496090 3300005544 Bacteria 947
200 Ga0070695_100001111 3300005545 Bacteria 14736
201 Ga0070695_100105395 3300005545 Bacteria 1905
202 Ga0070695_100252425 3300005545 Bacteria 1284
203 Ga0070695_100506632 3300005545 Unclassified 934
204 Ga0070693_100021502 3300005547 Bacteria 3418
205 Ga0070693_100180311 3300005547 Unclassified 1359
206 Ga0070693_100276382 3300005547 Bacteria 1123
207 Ga0070665_100013759 3300005548 Bacteria 8140
208 Ga0070665_100044916 3300005548 Bacteria 4435
209 Ga0070665_100565897 3300005548 Bacteria 1149
210 Ga0070704_100004226 3300005549 Bacteria 8295
211 Ga0070704_100029066 3300005549 Bacteria 3685
212 Ga0068855_100000365 3300005563 Bacteria 55984
213 Ga0068855_100008239 3300005563 Bacteria 12599
214 Ga0068855_100014935 3300005563 Bacteria 9356
215 Ga0068855_100056484 3300005563 Bacteria 4606
216 Ga0068855_100056669 3300005563 Bacteria 4597
217 Ga0068855_100092414 3300005563 Bacteria 3490
218 Ga0068855_100225814 3300005563 Bacteria 2099
219 Ga0070664_100006003 3300005564 Bacteria 9819
220 Ga0070664_100006401 3300005564 Bacteria 9496
221 Ga0070664_100007572 3300005564 Bacteria 8767
222 Ga0070664_100011505 3300005564 Bacteria 7182
223 Ga0070664_100120557 3300005564 Bacteria 2296
224 Ga0070664_100178444 3300005564 Bacteria 1887
225 Ga0068857_100007749 3300005577 Bacteria 9253
226 Ga0068857_100014467 3300005577 Bacteria 6885
227 Ga0068857_100290974 3300005577 Bacteria 1504
228 Ga0068854_100014528 3300005578 Bacteria 5194
229 Ga0068854_100027135 3300005578 Bacteria 3944
230 Ga0068854_100058550 3300005578 Bacteria 2782
231 Ga0068854_100198817 3300005578 Unclassified 1574
232 Ga0068854_100332189 3300005578 Unclassified 1239
233 Ga0068854_100575124 3300005578 Bacteria 959
234 Ga0068856_100042993 3300005614 Bacteria 4445
235 Ga0068856_100267022 3300005614 Bacteria 1727
236 Ga0070702_100415198 3300005615 Bacteria 967
237 Ga0068852_100021930 3300005616 Bacteria 5111
238 Ga0068852_100060732 3300005616 Bacteria 3282
239 Ga0068852_100446891 3300005616 Bacteria 1279
240 Ga0068859_100104748 3300005617 Bacteria 2888
241 Ga0068859_101564786 3300005617 Unclassified 728
242 Ga0068864_100030249 3300005618 Bacteria 4589
243 Ga0068864_100034396 3300005618 Bacteria 4310
244 Ga0068864_100095293 3300005618 Bacteria 2632
245 Ga0068864_100095677 3300005618 Bacteria 2627
246 Ga0068866_10019629 3300005718 Unclassified 3082
247 Ga0068866_10057633 3300005718 Bacteria 2003
248 Ga0068861_100000050 3300005719 Bacteria 54921
249 Ga0068861_100123696 3300005719 Bacteria 2090
250 Ga0068861_100237157 3300005719 Bacteria 1550
251 Ga0068851_10012604 3300005834 Bacteria 3989
252 Ga0068851_10031995 3300005834 Bacteria 2616
253 Ga0068870_10010298 3300005840 Bacteria 4290
254 Ga0068870_10102050 3300005840 Bacteria 1623
255 Ga0068870_10226636 3300005840 Bacteria 1147
256 Ga0068863_100036752 3300005841 Bacteria 4665
257 Ga0068863_100037525 3300005841 Bacteria 4613
258 Ga0068863_100778401 3300005841 Unclassified 954
259 Ga0068858_100025417 3300005842 Bacteria 5510
260 Ga0068858_100221844 3300005842 Bacteria 1791
261 Ga0068860_100005607 3300005843 Bacteria 12682
262 Ga0068860_100337703 3300005843 Bacteria 1481
263 Ga0068860_100436908 3300005843 Bacteria 1299
264 Ga0068862_100001155 3300005844 Bacteria 24966
265 Ga0068862_100111821 3300005844 Bacteria 2398
266 Ga0081539_10029337 3300005985 Bacteria 3438
267 Ga0070717_10080571 3300006028 Bacteria 2732
268 Ga0070717_10123875 3300006028 Bacteria 2217
269 Ga0070716_100000852 3300006173 Bacteria 13141
270 Ga0070712_100164477 3300006175 Bacteria 1716
271 Ga0070712_100207542 3300006175 Bacteria 1543
272 Ga0097621_100018805 3300006237 Bacteria 5288
273 Ga0068871_100531991 3300006358 Bacteria 1063
274 Ga0075428_100003762 3300006844 Bacteria 16623
275 Ga0075428_100255288 3300006844 Bacteria 1889
276 Ga0075430_100001111 3300006846 Bacteria 21393
277 Ga0075430_100022996 3300006846 Bacteria 5301
278 Ga0075430_100049092 3300006846 Bacteria 3562
279 Ga0075431_100097409 3300006847 Bacteria 3037
280 Ga0075431_100120656 3300006847 Bacteria 2705
281 Ga0075431_100245139 3300006847 Bacteria 1822
282 Ga0075431_100329703 3300006847 Bacteria 1537
283 Ga0075431_100347412 3300006847 Bacteria 1492
284 Ga0075431_100691301 3300006847 Bacteria 998
285 Ga0075434_100002429 3300006871 Bacteria 16375
286 Ga0075434_100024476 3300006871 Bacteria 5902
287 Ga0075429_100068583 3300006880 Bacteria 3087
288 Ga0075429_100164490 3300006880 Bacteria 1944
289 Ga0075429_100187549 3300006880 Bacteria 1812
290 Ga0075429_100446864 3300006880 Bacteria 1133
291 Ga0068865_100001898 3300006881 Bacteria 12287
292 Ga0068865_100011405 3300006881 Bacteria 5560
293 Ga0068865_100014249 3300006881 Bacteria 5049
294 Ga0068865_100041974 3300006881 Bacteria 3116
295 Ga0068865_100049475 3300006881 Bacteria 2898
296 Ga0075436_100000677 3300006914 Bacteria 22463
297 Ga0097620_100104734 3300006931 Bacteria 2888
298 Ga0097620_101565036 3300006931 Unclassified 728
299 Ga0075435_100067932 3300007076 Bacteria 2903
300 Ga0105240_10014723 3300009093 Bacteria 10670
301 Ga0105240_10083572 3300009093 Bacteria 3917
302 Ga0105240_10097401 3300009093 Bacteria 3584
303 Ga0111539_10055838 3300009094 Bacteria 4695
304 Ga0105245_10005996 3300009098 Bacteria 10683
305 Ga0105245_10006649 3300009098 Bacteria 10151
306 Ga0105245_10116463 3300009098 Bacteria 2492
307 Ga0105245_10124316 3300009098 Bacteria 2413
308 Ga0105245_10185708 3300009098 Bacteria 1989
309 Ga0105245_10497190 3300009098 Unclassified 1235
310 Ga0105247_10620075 3300009101 Unclassified 804
311 Ga0114129_10068636 3300009147 Bacteria 4943
312 Ga0114129_10078733 3300009147 Unclassified 4584
313 Ga0114129_10303567 3300009147 Bacteria 2127
314 Ga0114129_10375812 3300009147 Bacteria 1878
315 Ga0114129_10735683 3300009147 Bacteria 1264
316 Ga0114129_10915098 3300009147 Bacteria 1110
317 Ga0105243_10076242 3300009148 Bacteria 2724
318 Ga0105243_10290705 3300009148 Bacteria 1476
319 Ga0105241_10105827 3300009174 Bacteria 2244
320 Ga0105242_10007914 3300009176 Bacteria 8182
321 Ga0105242_10585475 3300009176 Bacteria 1075
322 Ga0105248_10010292 3300009177 Bacteria 10296
323 Ga0105248_10031112 3300009177 Bacteria 5964
324 Ga0105248_10043841 3300009177 Bacteria 5017
325 Ga0105248_10083894 3300009177 Bacteria 3584
326 Ga0105248_10113681 3300009177 Bacteria 3053
327 Ga0105248_10524124 3300009177 Bacteria 1336
328 Ga0105237_10148130 3300009545 Bacteria 2343
329 Ga0105238_10087278 3300009551 Bacteria 3107
330 Ga0105238_10183975 3300009551 Bacteria 2066
331 Ga0105238_10552905 3300009551 Unclassified 1155
332 Ga0105238_10621146 3300009551 Bacteria 1089
333 Ga0105249_10000009 3300009553 Bacteria 313866
334 Ga0105249_10000188 3300009553 Bacteria 71137
335 Ga0105249_10001121 3300009553 Bacteria 23842
336 Ga0105249_10120209 3300009553 Bacteria 2496
337 Ga0105249_10750706 3300009553 Bacteria 1038
338 Ga0099796_10064635 3300010159 Bacteria 1306
339 Ga0099796_10195555 3300010159 Unclassified 818
340 Ga0105239_10008413 3300010375 Bacteria 11745
341 Ga0105239_10727250 3300010375 Bacteria 1136
342 Ga0105246_10092442 3300011119 Bacteria 2183
343 Ga0105246_10235064 3300011119 Bacteria 1445
344 Ga0157373_10027498 3300013100 Bacteria 4104
345 Ga0157373_10050604 3300013100 Bacteria 2958
346 Ga0157373_10093380 3300013100 Bacteria 2119
347 Ga0157371_10002454 3300013102 Bacteria 17667
348 Ga0157371_10003251 3300013102 Bacteria 14906
349 Ga0157371_10081954 3300013102 Bacteria 2284
350 Ga0157370_10012724 3300013104 Bacteria 8707
351 Ga0157370_10049047 3300013104 Bacteria 4043
352 Ga0157370_10200664 3300013104 Bacteria 1850
353 Ga0157370_10433737 3300013104 Bacteria 1208
354 Ga0157370_10740649 3300013104 Bacteria 896
355 Ga0157369_10010138 3300013105 Bacteria 10756
356 Ga0157369_10013119 3300013105 Bacteria 9378
357 Ga0157369_10021013 3300013105 Bacteria 7298
358 Ga0157369_10041643 3300013105 Bacteria 5013
359 Ga0157369_10047415 3300013105 Bacteria 4665
360 Ga0157369_10082371 3300013105 Bacteria 3442
361 Ga0157369_10129924 3300013105 Bacteria 2670
362 Ga0157369_10188609 3300013105 Bacteria 2167
363 Ga0157369_10193919 3300013105 Bacteria 2134
364 Ga0157374_10091747 3300013296 Bacteria 2897
365 Ga0157374_10199205 3300013296 Bacteria 1960
366 Ga0157374_10818580 3300013296 Bacteria 947
367 Ga0157378_10004341 3300013297 Bacteria 12470
368 Ga0157378_10011548 3300013297 Bacteria 7734
369 Ga0157378_10029471 3300013297 Bacteria 4845
370 Ga0157378_10115681 3300013297 Bacteria 2465
371 Ga0157378_10156347 3300013297 Bacteria 2129
372 Ga0157378_10243234 3300013297 Bacteria 1720
373 Ga0157378_10347588 3300013297 Bacteria 1448
374 Ga0157378_10697921 3300013297 Unclassified 1034
375 Ga0163162_10000292 3300013306 Bacteria 45993
376 Ga0163162_10028577 3300013306 Bacteria 5519
377 Ga0163162_10048666 3300013306 Bacteria 4248
378 Ga0157372_10000154 3300013307 Bacteria 74779
379 Ga0157372_10003316 3300013307 Bacteria 17392
380 Ga0157372_10008745 3300013307 Bacteria 10751
381 Ga0157372_10009950 3300013307 Bacteria 10112
382 Ga0157372_10025005 3300013307 Bacteria 6489
383 Ga0157372_10025263 3300013307 Bacteria 6458
384 Ga0157372_10026810 3300013307 Bacteria 6273
385 Ga0157372_10228731 3300013307 Bacteria 2156
386 Ga0157372_10425290 3300013307 Bacteria 1548
387 Ga0157372_10427885 3300013307 Bacteria 1543
388 Ga0157372_10519909 3300013307 Bacteria 1387
389 Ga0157372_10956057 3300013307 Bacteria 993
390 Ga0157372_11341004 3300013307 Unclassified 825
391 Ga0157375_10004744 3300013308 Bacteria 11814
392 Ga0157375_10025731 3300013308 Bacteria 5475
393 Ga0157375_10038058 3300013308 Bacteria 4615
394 Ga0157375_10090011 3300013308 Bacteria 3126
395 Ga0157375_10132977 3300013308 Bacteria 2609
396 Ga0157375_10233993 3300013308 Bacteria 1996
397 Ga0163163_10013078 3300014325 Bacteria 7582
398 Ga0163163_10109495 3300014325 Bacteria 2790
399 Ga0163163_10180285 3300014325 Bacteria 2159
400 Ga0163163_11046096 3300014325 Bacteria 880
401 Ga0157380_10002402 3300014326 Bacteria 12592
402 Ga0157380_10775162 3300014326 Bacteria 973
403 Ga0182008_10006015 3300014497 Bacteria 6832
404 Ga0157377_10106134 3300014745 Bacteria 1682
405 Ga0157379_10004531 3300014968 Bacteria 11918
406 Ga0157379_11216295 3300014968 Unclassified 725
407 Ga0157376_10111954 3300014969 Bacteria 2404
408 Ga0163161_10036642 3300017792 Bacteria 3514
409 Ga0207697_10002303 3300025315 Bacteria 9968
410 Ga0207656_10014799 3300025321 Bacteria 3013
411 Ga0207692_10005344 3300025898 Bacteria 5141
412 Ga0207692_10415941 3300025898 Bacteria 841
413 Ga0207642_10123028 3300025899 Bacteria 1342
414 Ga0207688_10025721 3300025901 Bacteria 3235
415 Ga0207680_10015022 3300025903 Bacteria 4029
416 Ga0207680_10188707 3300025903 Bacteria 1398
417 Ga0207680_10419794 3300025903 Bacteria 947
418 Ga0207647_10396764 3300025904 Unclassified 778
419 Ga0207699_10001785 3300025906 Bacteria 10122
420 Ga0207699_10002628 3300025906 Bacteria 8488
421 Ga0207699_10022865 3300025906 Bacteria 3394
422 Ga0207645_10000120 3300025907 Bacteria 59056
423 Ga0207645_10002253 3300025907 Bacteria 15349
424 Ga0207645_10025979 3300025907 Bacteria 3787
425 Ga0207645_10048860 3300025907 Bacteria 2702
426 Ga0207645_10050751 3300025907 Bacteria 2649
427 Ga0207645_10068603 3300025907 Bacteria 2268
428 Ga0207645_10083493 3300025907 Bacteria 2049
429 Ga0207643_10003056 3300025908 Bacteria 8996
430 Ga0207643_10145533 3300025908 Bacteria 1418
431 Ga0207705_10001492 3300025909 Bacteria 18595
432 Ga0207705_10004560 3300025909 Bacteria 10460
433 Ga0207705_10043828 3300025909 Bacteria 3214
434 Ga0207705_10056268 3300025909 Bacteria 2836
435 Ga0207705_10098767 3300025909 Bacteria 2145
436 Ga0207705_10156198 3300025909 Bacteria 1712
437 Ga0207705_10236519 3300025909 Bacteria 1390
438 Ga0207684_10107285 3300025910 Bacteria 2389
439 Ga0207654_10067383 3300025911 Bacteria 2114
440 Ga0207707_10000291 3300025912 Bacteria 53460
441 Ga0207707_10009665 3300025912 Bacteria 8368
442 Ga0207707_10012141 3300025912 Bacteria 7486
443 Ga0207707_10015156 3300025912 Bacteria 6711
444 Ga0207707_10018483 3300025912 Bacteria 6075
445 Ga0207707_10029122 3300025912 Bacteria 4826
446 Ga0207707_10067373 3300025912 Bacteria 3118
447 Ga0207707_10344173 3300025912 Bacteria 1285
448 Ga0207695_10001619 3300025913 Bacteria 36517
449 Ga0207695_10055667 3300025913 Bacteria 4120
450 Ga0207695_10404233 3300025913 Bacteria 1250
451 Ga0207671_10314133 3300025914 Bacteria 1239
452 Ga0207693_10074451 3300025915 Bacteria 2660
453 Ga0207693_10161249 3300025915 Bacteria 1764
454 Ga0207693_10311010 3300025915 Unclassified 1234
455 Ga0207663_10039695 3300025916 Bacteria 2855
456 Ga0207663_10227430 3300025916 Bacteria 1361
457 Ga0207660_10000202 3300025917 Bacteria 38268
458 Ga0207660_10000293 3300025917 Bacteria 33032
459 Ga0207660_10011805 3300025917 Bacteria 5695
460 Ga0207660_10031627 3300025917 Bacteria 3647
461 Ga0207660_10096969 3300025917 Bacteria 2196
462 Ga0207660_10506259 3300025917 Bacteria 980
463 Ga0207662_10005349 3300025918 Bacteria 6835
464 Ga0207662_10016921 3300025918 Bacteria 4119
465 Ga0207662_10020472 3300025918 Bacteria 3775
466 Ga0207657_10000322 3300025919 Bacteria 50910
467 Ga0207657_10005540 3300025919 Bacteria 13182
468 Ga0207657_10008298 3300025919 Bacteria 10567
469 Ga0207657_10125337 3300025919 Bacteria 2110
470 Ga0207657_10126808 3300025919 Bacteria 2096
471 Ga0207649_10013231 3300025920 Bacteria 4604
472 Ga0207649_10026119 3300025920 Bacteria 3414
473 Ga0207649_10122305 3300025920 Unclassified 1756
474 Ga0207649_10156016 3300025920 Bacteria 1577
475 Ga0207652_10001846 3300025921 Bacteria 18378
476 Ga0207652_10004621 3300025921 Bacteria 11157
477 Ga0207652_10022412 3300025921 Bacteria 5225
478 Ga0207652_10084835 3300025921 Bacteria 2775
479 Ga0207652_10135626 3300025921 Bacteria 2198
480 Ga0207652_10142007 3300025921 Bacteria 2148
481 Ga0207652_10143843 3300025921 Bacteria 2133
482 Ga0207652_10218865 3300025921 Bacteria 1715
483 Ga0207652_10523270 3300025921 Bacteria 1067
484 Ga0207652_10553275 3300025921 Unclassified 1034
485 Ga0207652_10590166 3300025921 Bacteria 997
486 Ga0207646_10000322 3300025922 Bacteria 64767
487 Ga0207646_10005351 3300025922 Bacteria 13521
488 Ga0207646_10796517 3300025922 Bacteria 842
489 Ga0207681_10000721 3300025923 Bacteria 21712
490 Ga0207681_10002880 3300025923 Bacteria 10875
491 Ga0207681_10008683 3300025923 Bacteria 6204
492 Ga0207681_10073113 3300025923 Bacteria 2397
493 Ga0207694_10004498 3300025924 Bacteria 10882
494 Ga0207650_10000842 3300025925 Bacteria 23235
495 Ga0207650_10043023 3300025925 Bacteria 3314
496 Ga0207650_10120592 3300025925 Bacteria 2041
497 Ga0207659_10002944 3300025926 Bacteria 10139
498 Ga0207659_10005050 3300025926 Bacteria 8002
499 Ga0207659_10055476 3300025926 Bacteria 2834
500 Ga0207659_10106209 3300025926 Bacteria 2126
501 Ga0207659_10194535 3300025926 Bacteria 1616
502 Ga0207687_10177032 3300025927 Bacteria 1650
503 Ga0207700_10000264 3300025928 Bacteria 31234
504 Ga0207700_10060653 3300025928 Bacteria 2866
505 Ga0207700_10086620 3300025928 Bacteria 2462
506 Ga0207700_10098555 3300025928 Bacteria 2325
507 Ga0207664_10001593 3300025929 Bacteria 14915
508 Ga0207664_10005655 3300025929 Bacteria 8543
509 Ga0207664_10006567 3300025929 Bacteria 8008
510 Ga0207644_10097410 3300025931 Bacteria 2203
511 Ga0207690_10018462 3300025932 Bacteria 4278
512 Ga0207690_10030609 3300025932 Bacteria 3435
513 Ga0207690_10238470 3300025932 Bacteria 1399
514 Ga0207690_10378018 3300025932 Unclassified 1125
515 Ga0207706_10000083 3300025933 Bacteria 98149
516 Ga0207706_10000169 3300025933 Bacteria 72350
517 Ga0207706_10055266 3300025933 Bacteria 3502
518 Ga0207706_10069751 3300025933 Unclassified 3091
519 Ga0207706_10073669 3300025933 Bacteria 3003
520 Ga0207706_10145954 3300025933 Bacteria 2081
521 Ga0207706_10656752 3300025933 Unclassified 898
522 Ga0207686_10006555 3300025934 Bacteria 6269
523 Ga0207686_10382933 3300025934 Unclassified 1067
524 Ga0207686_10487971 3300025934 Bacteria 954
525 Ga0207686_10621500 3300025934 Unclassified 852
526 Ga0207709_10094635 3300025935 Bacteria 1961
527 Ga0207670_10020828 3300025936 Bacteria 4035
528 Ga0207669_10058976 3300025937 Bacteria 2345
529 Ga0207669_10586348 3300025937 Unclassified 904
530 Ga0207669_10599103 3300025937 Unclassified 895
531 Ga0207704_10004977 3300025938 Bacteria 6109
532 Ga0207704_10008732 3300025938 Bacteria 4861
533 Ga0207704_10012273 3300025938 Bacteria 4249
534 Ga0207704_10026405 3300025938 Bacteria 3186
535 Ga0207704_10058118 3300025938 Bacteria 2380
536 Ga0207704_10086776 3300025938 Bacteria 2042
537 Ga0207704_10308361 3300025938 Bacteria 1216
538 Ga0207665_10000150 3300025939 Bacteria 47176
539 Ga0207691_10001327 3300025940 Bacteria 24691
540 Ga0207691_10001331 3300025940 Bacteria 24658
541 Ga0207691_10039051 3300025940 Bacteria 4393
542 Ga0207691_10094134 3300025940 Bacteria 2681
543 Ga0207691_10285398 3300025940 Bacteria 1420
544 Ga0207691_10397511 3300025940 Unclassified 1176
545 Ga0207691_10825968 3300025940 Bacteria 778
546 Ga0207711_10046196 3300025941 Bacteria 3721
547 Ga0207711_10091428 3300025941 Bacteria 2677
548 Ga0207711_10113593 3300025941 Bacteria 2411
549 Ga0207711_10124830 3300025941 Bacteria 2301
550 Ga0207711_10151695 3300025941 Bacteria 2091
551 Ga0207711_10366462 3300025941 Bacteria 1336
552 Ga0207689_10014298 3300025942 Bacteria 6755
553 Ga0207661_10016821 3300025944 Bacteria 5400
554 Ga0207661_10031304 3300025944 Bacteria 4107
555 Ga0207661_10059260 3300025944 Bacteria 3084
556 Ga0207661_10073412 3300025944 Bacteria 2801
557 Ga0207661_10095602 3300025944 Bacteria 2484
558 Ga0207661_10100181 3300025944 Bacteria 2431
559 Ga0207661_10131328 3300025944 Bacteria 2145
560 Ga0207661_10249675 3300025944 Bacteria 1576
561 Ga0207679_10001051 3300025945 Bacteria 17574
562 Ga0207679_10001967 3300025945 Bacteria 12733
563 Ga0207679_10007333 3300025945 Bacteria 6990
564 Ga0207679_10008893 3300025945 Bacteria 6409
565 Ga0207679_10027934 3300025945 Bacteria 3909
566 Ga0207679_10281481 3300025945 Bacteria 1426
567 Ga0207667_10067317 3300025949 Bacteria 3731
568 Ga0207667_10103103 3300025949 Unclassified 2943
569 Ga0207667_10174930 3300025949 Bacteria 2206
570 Ga0207667_10240272 3300025949 Bacteria 1854
571 Ga0207651_10038586 3300025960 Bacteria 3141
572 Ga0207651_10054203 3300025960 Bacteria 2746
573 Ga0207651_10197285 3300025960 Bacteria 1610
574 Ga0207651_10306301 3300025960 Unclassified 1323
575 Ga0207651_10549250 3300025960 Bacteria 1004
576 Ga0207712_10000080 3300025961 Bacteria 114486
577 Ga0207712_10000604 3300025961 Bacteria 28470
578 Ga0207712_10000789 3300025961 Bacteria 23503
579 Ga0207668_10001000 3300025972 Bacteria 16933
580 Ga0207668_10002344 3300025972 Bacteria 11053
581 Ga0207668_10150321 3300025972 Bacteria 1802
582 Ga0207640_10022130 3300025981 Bacteria 3799
583 Ga0207640_10134160 3300025981 Bacteria 1794
584 Ga0207640_10448409 3300025981 Bacteria 1063
585 Ga0207640_10526735 3300025981 Bacteria 989
586 Ga0207658_10088508 3300025986 Bacteria 2394
587 Ga0207658_10155457 3300025986 Bacteria 1868
588 Ga0207658_10784415 3300025986 Bacteria 864
589 Ga0207677_10004918 3300026023 Bacteria 7215
590 Ga0207677_10076932 3300026023 Bacteria 2378
591 Ga0207677_10114208 3300026023 Bacteria 2017
592 Ga0207703_10021263 3300026035 Bacteria 5080
593 Ga0207703_10241983 3300026035 Bacteria 1622
594 Ga0207639_10007792 3300026041 Bacteria 7314
595 Ga0207639_10022427 3300026041 Bacteria 4548
596 Ga0207639_10076830 3300026041 Bacteria 2630
597 Ga0207639_10113890 3300026041 Bacteria 2209
598 Ga0207639_10280154 3300026041 Bacteria 1466
599 Ga0207678_10296497 3300026067 Bacteria 1389
600 Ga0207678_10542649 3300026067 Bacteria 1016
601 Ga0207708_10003839 3300026075 Bacteria 11075
602 Ga0207708_10005107 3300026075 Bacteria 9683
603 Ga0207708_10058843 3300026075 Bacteria 2932
604 Ga0207702_10268669 3300026078 Bacteria 1608
605 Ga0207702_10412800 3300026078 Bacteria 1304
606 Ga0207702_10960723 3300026078 Bacteria 847
607 Ga0207641_10071223 3300026088 Bacteria 2989
608 Ga0207641_10202444 3300026088 Bacteria 1831
609 Ga0207648_10009618 3300026089 Bacteria 9245
610 Ga0207648_10009904 3300026089 Bacteria 9086
611 Ga0207648_10011662 3300026089 Bacteria 8272
612 Ga0207648_10033266 3300026089 Bacteria 4548
613 Ga0207648_10065679 3300026089 Bacteria 3163
614 Ga0207648_10076882 3300026089 Bacteria 2910
615 Ga0207648_10235751 3300026089 Bacteria 1628
616 Ga0207676_10016806 3300026095 Bacteria 5298
617 Ga0207676_10167563 3300026095 Bacteria 1910
618 Ga0207676_10220739 3300026095 Bacteria 1688
619 Ga0207676_10394604 3300026095 Bacteria 1292
620 Ga0207674_10000044 3300026116 Bacteria 123506
621 Ga0207674_10000889 3300026116 Bacteria 39068
622 Ga0207674_10010440 3300026116 Bacteria 10517
623 Ga0207674_10022308 3300026116 Bacteria 6799
624 Ga0207674_10051973 3300026116 Bacteria 4180
625 Ga0207674_10378945 3300026116 Bacteria 1368
626 Ga0207675_100000132 3300026118 Bacteria 62776
627 Ga0207675_100025606 3300026118 Bacteria 5490
628 Ga0207675_100074945 3300026118 Bacteria 3167
629 Ga0207675_100120064 3300026118 Bacteria 2486
630 Ga0207675_100121643 3300026118 Bacteria 2470
631 Ga0207683_10003148 3300026121 Bacteria 14420
632 Ga0207683_10041875 3300026121 Bacteria 3999
633 Ga0207683_10151276 3300026121 Bacteria 2094
634 Ga0207683_10182074 3300026121 Bacteria 1905
635 Ga0207683_10315414 3300026121 Bacteria 1431
636 Ga0207698_10009866 3300026142 Bacteria 6105
637 Ga0207698_10056237 3300026142 Bacteria 3037
638 Ga0207698_10194020 3300026142 Unclassified 1812
639 Ga0207698_10210005 3300026142 Unclassified 1751
640 Ga0207698_10646897 3300026142 Bacteria 1047
641 Ga0209969_1002266 3300027360 Bacteria 2651
642 Ga0209969_1004685 3300027360 Bacteria 1911
643 Ga0209981_1001532 3300027378 Bacteria 2924
644 Ga0209996_1002203 3300027395 Bacteria 2401
645 Ga0209984_1001356 3300027424 Bacteria 2645
646 Ga0209995_1000109 3300027471 Bacteria 12884
647 Ga0209995_1006289 3300027471 Bacteria 1908
648 Ga0209968_1001620 3300027526 Bacteria 3390
649 Ga0209999_1000063 3300027543 Bacteria 12120
650 Ga0209999_1000110 3300027543 Bacteria 10136
651 Ga0209970_1005986 3300027614 Bacteria 1996
652 Ga0210002_1002567 3300027617 Bacteria 2625
653 Ga0209971_1002823 3300027682 Bacteria 4150
654 Ga0209971_1022980 3300027682 Bacteria 1486
655 Ga0209966_1000462 3300027695 Bacteria 11109
656 Ga0209998_10000026 3300027717 Bacteria 60645
657 Ga0209974_10000165 3300027876 Bacteria 20120
658 Ga0207428_10032505 3300027907 Bacteria 4290
659 Ga0207428_10079356 3300027907 Bacteria 2566
660 Ga0268266_10071391 3300028379 Bacteria 3009
661 Ga0268266_10509034 3300028379 Bacteria 1150
662 Ga0268265_10000860 3300028380 Bacteria 28381
663 Ga0268265_10007370 3300028380 Bacteria 7427
664 Ga0268265_10572188 3300028380 Bacteria 1075
665 Ga0268264_10019421 3300028381 Bacteria 5554
666 Ga0268264_10132376 3300028381 Bacteria 2213
667 Ga0316182_1013122 3300030745 Bacteria 983
668 Ga0307408_100001240 3300031548 Bacteria 19162
669 Ga0307408_100026037 3300031548 Bacteria 4011
670 Ga0307408_100041463 3300031548 Bacteria 3264
671 Ga0307405_10001005 3300031731 Bacteria 11374
672 Ga0307405_10003342 3300031731 Bacteria 7348
673 Ga0307405_10033527 3300031731 Bacteria 3047
674 Ga0307405_10055454 3300031731 Bacteria 2480
675 Ga0307413_10002253 3300031824 Bacteria 7786
676 Ga0307413_10042197 3300031824 Bacteria 2678
677 Ga0307413_10152393 3300031824 Bacteria 1613
678 Ga0307413_10209424 3300031824 Bacteria 1415
679 Ga0307413_10266737 3300031824 Bacteria 1279
680 Ga0307410_10002519 3300031852 Bacteria 8859
681 Ga0307410_10107627 3300031852 Bacteria 2011
682 Ga0307410_10296137 3300031852 Bacteria 1275
683 Ga0307406_10001692 3300031901 Bacteria 12112
684 Ga0307406_10002911 3300031901 Bacteria 9327
685 Ga0307406_10016465 3300031901 Bacteria 4297
686 Ga0307406_10060691 3300031901 Bacteria 2439
687 Ga0307407_10000508 3300031903 Bacteria 12021
688 Ga0307407_10051285 3300031903 Bacteria 2364
689 Ga0307407_10099175 3300031903 Unclassified 1804
690 Ga0307407_10213521 3300031903 Bacteria 1300
691 Ga0307412_10250700 3300031911 Bacteria 1374
692 Ga0307412_10393286 3300031911 Bacteria 1126
693 Ga0307412_10468887 3300031911 Bacteria 1041
694 Ga0307409_100000906 3300031995 Bacteria 13737
695 Ga0307409_100027867 3300031995 Bacteria 4012
696 Ga0307409_100028621 3300031995 Bacteria 3973
697 Ga0307409_100076832 3300031995 Bacteria 2679
698 Ga0307416_100000749 3300032002 Bacteria 16988
699 Ga0307416_100027306 3300032002 Bacteria 4224
700 Ga0307416_100204654 3300032002 Bacteria 1876
701 Ga0307416_100209468 3300032002 Unclassified 1858
702 Ga0307416_100695885 3300032002 Bacteria 1105
703 Ga0307416_101024597 3300032002 Bacteria 929
704 Ga0307414_10014782 3300032004 Bacteria 4691
705 Ga0307411_10002243 3300032005 Bacteria 8440
706 Ga0307411_10010325 3300032005 Bacteria 4970
707 Ga0307411_10666849 3300032005 Bacteria 902
708 Ga0307415_100057199 3300032126 Bacteria 2678
709 Ga0307415_100075712 3300032126 Unclassified 2383
710 Ga0307415_100977917 3300032126 Bacteria 785
711 Ga0373959_0003512 3300034820 Bacteria 2500
712 Ga0373934_0000506 3300035086 Bacteria 13684
713 Ga0373944_0006613 3300035089 Bacteria 3079
714 Ga0373944_0155008 3300035089 Unclassified 809
715 Ga0373945_0003728 3300035116 Bacteria 4803
716 Ga0373953_0007584 3300035117 Bacteria 3642
717 Ga0373954_0002646 3300035118 Bacteria 7538
718 Ga0373956_0000240 3300035119 Bacteria 21690
719 Ga0373960_0045927 3300035121 Bacteria 1280
720 Ga0373943_0002262 3300035170 Bacteria 8738
721 Ga0373943_0020377 3300035170 Bacteria 3056
722 Ga0373946_0095525 3300035171 Bacteria 1324
723 Ga0373946_0100269 3300035171 Unclassified 1297
724 Ga0373924_0010613 3300035410 Bacteria 3405
725 Ga0373935_0002849 3300035692 Bacteria 9954
726 Ga0373935_0082412 3300035692 Bacteria 2093
727 Ga0373935_0167367 3300035692 Bacteria 1502
728 Ga0373927_0003500 3300035695 Bacteria 11238
729 Ga0373933_0000091 3300035724 Bacteria 56608
730 Ga0373947_0000257 3300035725 Bacteria 29941
731 Ga0373947_0053912 3300035725 Bacteria 2426
732 Ga0373947_0085620 3300035725 Bacteria 1958
733 Ga0373947_0356651 3300035725 Unclassified 982
734 Ga0373937_0000104 3300036401 Bacteria 80334
735 Ga0373937_0018105 3300036401 Bacteria 6285
736 Ga0373937_0053248 3300036401 Bacteria 3712
737 Ga0373937_0110690 3300036401 Bacteria 2554
738 Ga0373937_0525510 3300036401 Bacteria 1124
739 Ga0373937_1061884 3300036401 Unclassified 759
740 Ga0373925_0000876 3300037068 Bacteria 27492
741 Ga0395905_0387054 3300037471 Bacteria 1293
742 Ga0395905_0522317 3300037471 Bacteria 1088
743 Ga0436364_1339967 3300037853 Bacteria 1219
744 Ga0436365_1923651 3300039437 Bacteria 2441
745 Ga0451853_1709214 3300041512 Bacteria 2037
746 Ga0439450_050603 3300042008 Bacteria 986
747 Ga0439446_0032648 3300042156 Bacteria 1511
748 Ga0451577_0011965 3300042876 Bacteria 8175
749 Ga0466961_0133600 3300044693 Bacteria 1555
750 Ga0466963_0330467 3300044694 Bacteria 1073
751 Ga0453684_0000455 3300044712 Bacteria 165080
752 Ga0466959_0047246 3300045049 Bacteria 3166
753 Ga0451576_0339504 3300045051 Bacteria 1572
754 Ga0466958_0252008 3300045836 Bacteria 1129
755 Ga0495592_0001993 3300046454 Bacteria 14402
756 Ga0495592_0244448 3300046454 Bacteria 1189
757 Ga0495603_0047944 3300046455 Bacteria 2544
758 Ga0495590_0029254 3300046457 Bacteria 1932
759 Ga0495629_0009170 3300046459 Bacteria 7244
760 Ga0495629_0078564 3300046459 Bacteria 2304
761 Ga0495629_0119523 3300046459 Bacteria 1836
762 Ga0495629_0192302 3300046459 Bacteria 1412
763 Ga0495651_0002399 3300046462 Bacteria 14466
764 Ga0495651_0069053 3300046462 Bacteria 2692
765 Ga0495653_0000064 3300046463 Bacteria 92950
766 Ga0495653_0103048 3300046463 Bacteria 2064
767 Ga0495653_0415300 3300046463 Bacteria 852
768 Ga0495580_0003769 3300046472 Bacteria 12832
769 Ga0495582_0002258 3300046473 Bacteria 10777
770 Ga0495639_0000281 3300046475 Bacteria 25099
771 Ga0495639_0055477 3300046475 Bacteria 1807
772 Ga0495639_0189469 3300046475 Bacteria 1004
773 Ga0495664_0060476 3300046477 Bacteria 2255
774 Ga0495664_0223407 3300046477 Bacteria 1140
775 Ga0495584_0112024 3300046491 Bacteria 1381
776 Ga0495594_0003515 3300046499 Bacteria 8074
777 Ga0495594_0036618 3300046499 Unclassified 2676
778 Ga0495594_0122240 3300046499 Bacteria 1472
779 Ga0495594_0149043 3300046499 Bacteria 1328
780 Ga0495608_0000200 3300046511 Bacteria 42536
781 Ga0495608_0080656 3300046511 Bacteria 2115
782 Ga0495628_0000571 3300046516 Bacteria 33828
783 Ga0495628_0035576 3300046516 Bacteria 4001
784 Ga0495628_0036916 3300046516 Bacteria 3919
785 Ga0495630_0004824 3300046517 Bacteria 9458
786 Ga0495630_0047804 3300046517 Bacteria 3201
787 Ga0495630_0065644 3300046517 Bacteria 2727
788 Ga0495630_0108176 3300046517 Bacteria 2106
789 Ga0495652_0002046 3300046529 Bacteria 21375
790 Ga0495652_0011735 3300046529 Bacteria 7915
791 Ga0495652_0090509 3300046529 Bacteria 2503
792 Ga0495652_0130538 3300046529 Bacteria 1990
793 Ga0495665_0000269 3300046531 Bacteria 26394
794 Ga0495665_0098270 3300046531 Bacteria 1537
795 Ga0495665_0233455 3300046531 Bacteria 949
796 Ga0495640_0130325 3300046533 Bacteria 1628
797 Ga0495586_0006575 3300046535 Bacteria 6211
798 Ga0495586_0110521 3300046535 Bacteria 1529
799 Ga0495587_0000557 3300046536 Bacteria 25724
800 Ga0495587_0019626 3300046536 Bacteria 4182
801 Ga0495587_0149720 3300046536 Bacteria 1330
802 Ga0495598_0037454 3300046537 Unclassified 1399
803 Ga0495645_0000675 3300046543 Bacteria 23469
804 Ga0495645_0009513 3300046543 Bacteria 6795
805 Ga0495645_0060178 3300046543 Bacteria 2753
806 Ga0495645_0075374 3300046543 Bacteria 2428
807 Ga0495645_0110272 3300046543 Bacteria 1948
808 Ga0495667_0000234 3300046559 Bacteria 36417
809 Ga0495667_0019152 3300046559 Bacteria 4619
810 Ga0495667_0030428 3300046559 Bacteria 3627
811 Ga0495635_0000027 3300046663 Bacteria 123782
812 Ga0495635_0009497 3300046663 Bacteria 6798
813 Ga0495635_0182266 3300046663 Bacteria 1427
814 Ga0495635_0240456 3300046663 Unclassified 1222
815 Ga0495635_0382473 3300046663 Bacteria 936
816 Ga0495588_0000605 3300046674 Bacteria 16885
817 Ga0495588_0015248 3300046674 Bacteria 3695
818 Ga0495657_0000129 3300046675 Bacteria 67136
819 Ga0495657_0034363 3300046675 Bacteria 3522
820 Ga0495657_0205967 3300046675 Archaea 1197
821 Ga0495599_0000121 3300046678 Bacteria 52373
822 Ga0495599_0043404 3300046678 Bacteria 2821
823 Ga0495623_0000470 3300046679 Bacteria 26614
824 Ga0495623_0248745 3300046679 Bacteria 1001
825 Ga0495646_0004308 3300046680 Bacteria 8967
826 Ga0495646_0026832 3300046680 Bacteria 3615
827 Ga0495647_0021045 3300046681 Bacteria 2346
828 Ga0495658_0000078 3300046683 Bacteria 48561
829 Ga0495658_0049087 3300046683 Bacteria 2383
830 Ga0495658_0175517 3300046683 Bacteria 1328
831 Ga0495669_0299731 3300046684 Unclassified 775
832 Ga0495613_0028794 3300046689 Bacteria 4131
833 Ga0495613_0119985 3300046689 Bacteria 1888
834 Ga0495613_0144171 3300046689 Bacteria 1700
835 Ga0495600_0000038 3300046809 Bacteria 77979
836 Ga0495581_0000461 3300047315 Bacteria 20789
837 Ga0495581_0012251 3300047315 Bacteria 4966
838 Ga0495581_0294715 3300047315 Bacteria 948
839 Ga0495604_0003741 3300047317 Bacteria 12120
840 Ga0495604_0056766 3300047317 Bacteria 3012
841 Ga0495604_0058576 3300047317 Bacteria 2957
842 Ga0495604_0359755 3300047317 Bacteria 965
843 Ga0495674_0000649 3300047319 Bacteria 32671
844 Ga0495674_0009521 3300047319 Bacteria 9230
845 Ga0495674_0015725 3300047319 Bacteria 7064
846 Ga0495674_0121410 3300047319 Bacteria 2207
847 Ga0495680_0006631 3300047322 Bacteria 10720
848 Ga0495680_0010779 3300047322 Bacteria 8142
849 Ga0495680_0016537 3300047322 Bacteria 6333
850 Ga0495675_0005579 3300047444 Bacteria 7679
851 Ga0495675_0010312 3300047444 Bacteria 5839
852 Ga0495675_0089495 3300047444 Bacteria 1932
853 Ga0495675_0139374 3300047444 Bacteria 1504
854 Ga0495684_0000805 3300047471 Bacteria 25405
855 Ga0495684_0003546 3300047471 Bacteria 12197
856 Ga0495684_0028261 3300047471 Bacteria 4306
857 Ga0495684_0055311 3300047471 Bacteria 3026
858 Ga0495593_0001622 3300047673 Bacteria 13313
859 Ga0495593_0065967 3300047673 Bacteria 1887
860 Ga0495602_0000377 3300048088 Bacteria 41583
861 Ga0495602_0024716 3300048088 Bacteria 5826
862 Ga0495602_0056954 3300048088 Bacteria 3433
863 Ga0495614_0000127 3300048089 Bacteria 26520
864 Ga0496100_0327932 3300048903 Bacteria 1151
865 Ga0496101_0049062 3300048904 Bacteria 3035
866 Ga0496104_0332229 3300048907 Bacteria 1433
867 Ga0496104_0406668 3300048907 Bacteria 1273
868 Ga0496105_0047313 3300048908 Bacteria 3550
869 Ga0496106_0041880 3300048909 Bacteria 3433
870 Ga0496106_0297559 3300048909 Bacteria 1294
871 Ga0496107_0081294 3300048910 Bacteria 2363
872 Ga0496108_0098759 3300048911 Bacteria 2488
873 Ga0496108_0107404 3300048911 Bacteria 2383
874 Ga0496109_0077667 3300048912 Bacteria 3056
875 Ga0496109_0079917 3300048912 Bacteria 3013
876 Ga0496109_0162554 3300048912 Bacteria 2092
877 Ga0496109_0488425 3300048912 Bacteria 1162
878 Ga0496110_0059057 3300048913 Bacteria 3379
879 Ga0496112_0007703 3300048915 Bacteria 9578
880 Ga0496112_0507381 3300048915 Bacteria 1141
881 Ga0496112_0791619 3300048915 Bacteria 873
882 Ga0496113_0008973 3300048916 Bacteria 6546
883 Ga0496115_0296945 3300048918 Bacteria 1324
884 Ga0501031_0008140 3300049568 Bacteria 6827
885 Ga0501034_0025096 3300049571 Bacteria 6067
886 Ga0501036_0091943 3300049572 Bacteria 2563
887 Ga0501038_0023773 3300049574 Bacteria 5475
888 Ga0501038_0099860 3300049574 Bacteria 2419
889 Ga0501039_0068118 3300049575 Bacteria 2764
890 Ga0501040_0225358 3300049576 Bacteria 1334
891 Ga0501042_0080240 3300049578 Bacteria 2338
892 Ga0501043_0071084 3300049579 Bacteria 2734
893 Ga0501043_0288353 3300049579 Bacteria 1257
894 Ga0501043_0486790 3300049579 Bacteria 923
895 Ga0501047_0322852 3300049581 Bacteria 1383
896 Ga0501047_1016282 3300049581 Bacteria 642
897 Ga0501069_0093863 3300049585 Bacteria 1698
898 Ga0501072_0199511 3300049588 Bacteria 1595
899 Ga0501073_0038483 3300049589 Bacteria 3392
900 Ga0501076_0141124 3300049592 Bacteria 1957
901 Ga0501216_043413 3300049660 Unclassified 866
902 Ga0501249_002790 3300049679 Bacteria 3518
903 Ga0501251_025379 3300049681 Bacteria 814
904 Ga0501253_000218 3300049683 Bacteria 4377
905 Ga0501253_031957 3300049683 Bacteria 1010
906 Ga0501261_001301 3300049690 Bacteria 3062
907 Ga0501225_0004013 3300049705 Bacteria 4404
908 Ga0501079_0064527 3300049741 Bacteria 2825
909 Ga0501079_0250183 3300049741 Bacteria 1385
910 Ga0501079_0596840 3300049741 Bacteria 869
911 Ga0501080_0019645 3300049742 Bacteria 6259
912 Ga0501232_001678 3300049757 Bacteria 1808
913 Ga0501262_029153 3300049759 Bacteria 789
914 Ga0501265_005344 3300049762 Bacteria 1479
915 Ga0501268_013481 3300049765 Bacteria 1321
916 Ga0501268_047737 3300049765 Unclassified 822
917 Ga0501272_018652 3300049769 Bacteria 823
918 Ga0501273_006109 3300049770 Bacteria 1383
919 Ga0501035_0021882 3300049822 Bacteria 5874
920 Ga0501044_0073178 3300049823 Bacteria 3483
921 Ga0501044_0109261 3300049823 Bacteria 2775
922 Ga0501045_0036937 3300049824 Bacteria 3549
923 Ga0501212_000092 3300049851 Bacteria 6798
924 nmdc:mga05p37_115965_c1 3300050507 Bacteria 3292
925 nmdc:mga05p37_174517_c1 3300050507 Bacteria 2619
926 nmdc:mga05p37_192204_c2 3300050507 Unclassified 1119
927 nmdc:mga09592_25013_c1 3300050508 Bacteria 4939
928 nmdc:mga0qj67_1019_c1 3300050509 Bacteria 19352
929 nmdc:mga0qj67_11483_c1 3300050509 Bacteria 6637
930 nmdc:mga0qj67_5187_c1 3300050509 Bacteria 9509
931 nmdc:mga06r32_348995_c1 3300050510 Bacteria 1464
932 nmdc:mga06r32_35655_c1 3300050510 Bacteria 4694
933 nmdc:mga06r32_551359_c1 3300050510 Bacteria 1127
934 nmdc:mga06r32_60943_c1 3300050510 Bacteria 3631
935 nmdc:mga06r32_633572_c1 3300050510 Bacteria 1038
936 nmdc:mga06r32_690779_c1 3300050510 Bacteria 987
937 nmdc:mga08y16_286113_c1 3300050511 Bacteria 1700
938 nmdc:mga0n895_1236_c1 3300050512 Bacteria 18851
939 nmdc:mga0n895_14333_c1 3300050512 Bacteria 7196
940 nmdc:mga0n895_157989_c1 3300050512 Bacteria 2298
941 nmdc:mga0rr50_90931_c1 3300050513 Bacteria 2376
942 nmdc:mga08x19_2711_c1 3300050514 Bacteria 10710
943 nmdc:mga0a205_28910_c1 3300050515 Bacteria 5301
944 nmdc:mga0a205_391_c1 3300050515 Bacteria 17525
945 Ga0495601_0011009 3300053077 Bacteria 5404
946 Ga0495601_0460796 3300053077 Bacteria 822
947 Ga0495612_0001647 3300053078 Bacteria 9191
948 Ga0495619_0000293 3300053085 Bacteria 35547
949 Ga0500596_006091 3300053735 Bacteria 2068
950 Ga0590071_026926 3300059421 Unclassified 1365
951 Ga0590071_031805 3300059421 Bacteria 1258
952 Ga0075433_10001326
953 MRS1b_contig_4345944
954 MBSR1b_contig_12820842
955 LJQas_1009368
956 JGI24737J22298_10007042
957 JGI24750J21931_1017645
958 JGI26129J50193_1000056
959 Ga0058863_11858270
960 Ga0058861_12029262
961 Ga0058862_12851645
962 Ga0065704_10111315
963 Ga0065712_10071488
964 Ga0065715_10091110
965 Ga0065707_10083014
966 Ga0070658_10001628
967 Ga0070658_10006330
968 Ga0070658_10024256
969 Ga0070658_10163784
970 Ga0070658_10289338
971 Ga0070658_10306361
972 Ga0070676_10000196
973 Ga0070676_10019332
974 Ga0070676_10049480
975 Ga0070676_10061782
976 Ga0070676_10092459
977 Ga0070676_10553496
978 Ga0070683_100007689
979 Ga0070683_100008849
980 Ga0070683_100009980
981 Ga0070683_100056675
982 Ga0070683_100068777
983 Ga0070683_100087233
984 Ga0070683_100236139
985 Ga0070683_100678646
986 Ga0070690_100013602
987 Ga0070670_100000138
988 Ga0070670_100068010
989 Ga0070670_100161084
990 Ga0070677_10027432
991 Ga0068869_100010590
992 Ga0068869_100035908
993 Ga0070666_10061943
994 Ga0070666_10216851
995 Ga0070680_100000013
996 Ga0070680_100000046
997 Ga0070680_100000169
998 Ga0070680_100003738
999 Ga0070680_100015472
1000 Ga0070680_100152848
1001 Ga0070680_100216452
1002 Ga0070682_100000899
1003 Ga0070682_100005099
1004 Ga0070682_100566054
1005 Ga0068868_100001284
1006 Ga0068868_100002264
1007 Ga0068868_100022692
1008 Ga0068868_100078949
1009 Ga0068868_100110729
1010 Ga0068868_100905277
1011 Ga0070660_100025295
1012 Ga0070660_100120344
1013 Ga0070660_100167620
1014 Ga0070689_100014767
1015 Ga0070687_100010958
1016 Ga0070687_100012682
1017 Ga0070661_100005103
1018 Ga0070661_100023300
1019 Ga0070661_100048790
1020 Ga0070661_100056707
1021 Ga0070661_100076429
1022 Ga0070661_100109068
1023 Ga0070661_100423412
1024 Ga0070692_10010415
1025 Ga0070692_10022581
1026 Ga0070692_10028543
1027 Ga0070692_10090683
1028 Ga0070692_10263448
1029 Ga0070668_100000199
1030 Ga0070668_100002845
1031 Ga0070668_100008458
1032 Ga0070668_100010394
1033 Ga0070669_100002223
1034 Ga0070669_100012523
1035 Ga0070669_100091689
1036 Ga0070669_100405102
1037 Ga0070675_100000226
1038 Ga0070675_100000950
1039 Ga0070675_100012191
1040 Ga0070675_100554184
1041 Ga0070671_100053246
1042 Ga0070671_100063849
1043 Ga0070674_100017292
1044 Ga0070674_100057312
1045 Ga0070674_100064987
1046 Ga0070674_100071838
1047 Ga0070674_100149475
1048 Ga0070673_100003269
1049 Ga0070673_100012354
1050 Ga0070673_100124328
1051 Ga0070673_100255838
1052 Ga0070688_100005670
1053 Ga0070688_100031376
1054 Ga0070659_100005204
1055 Ga0070659_100005536
1056 Ga0070659_100009118
1057 Ga0070659_100037038
1058 Ga0070659_100196334
1059 Ga0070659_100650773
1060 Ga0070667_100008187
1061 Ga0070667_100016287
1062 Ga0070667_100072655
1063 Ga0070667_100085735
1064 Ga0070667_100116290
1065 Ga0070667_100120597
1066 Ga0070667_100315735
1067 Ga0070703_10009157
1068 Ga0070709_10000120
1069 Ga0070709_10009461
1070 Ga0070714_100006235
1071 Ga0070714_100007274
1072 Ga0070714_100015449
1073 Ga0070714_100094754
1074 Ga0070713_100000095
1075 Ga0070713_100095302
1076 Ga0070710_10140836
1077 Ga0070701_10007201
1078 Ga0070701_10143490
1079 Ga0070711_100028681
1080 Ga0070711_100063315
1081 Ga0070711_100207251
1082 Ga0070705_100097583
1083 Ga0070705_100438111
1084 Ga0070700_100017205
1085 Ga0070700_100024864
1086 Ga0070700_100078058
1087 Ga0070700_100239011
1088 Ga0070694_100001889
1089 Ga0070694_100040814
1090 Ga0070708_100005015
1091 Ga0070708_100177020
1092 Ga0070663_100113517
1093 Ga0070663_100578665
1094 Ga0070678_100038943
1095 Ga0070678_100217972
1096 Ga0070678_100610350
1097 Ga0070662_100002076
1098 Ga0070662_100037390
1099 Ga0070662_100073471
1100 Ga0070662_100682353
1101 Ga0070662_100892194
1102 Ga0070681_10000126
1103 Ga0070681_10000161
1104 Ga0070681_10015670
1105 Ga0070681_10053819
1106 Ga0070681_10086264
1107 Ga0070681_10115334
1108 Ga0070681_10121664
1109 Ga0070681_10201394
1110 Ga0068867_100006244
1111 Ga0068867_100009208
1112 Ga0068867_100170612
1113 Ga0068867_100325269
1114 Ga0070685_10032164
1115 Ga0070685_10042519
1116 Ga0070707_100000294
1117 Ga0070707_100330535
1118 Ga0070707_101351952
1119 Ga0070698_100077500
1120 Ga0070698_100249167
1121 Ga0070698_100642529
1122 Ga0070699_100082753
1123 Ga0070699_100105730
1124 Ga0070699_100694841
1125 Ga0070679_100000080
1126 Ga0070679_100000192
1127 Ga0070679_100003529
1128 Ga0070679_100025937
1129 Ga0070679_100029468
1130 Ga0070679_100037391
1131 Ga0070679_100053867
1132 Ga0070679_100157503
1133 Ga0070679_100216423
1134 Ga0070684_100003014
1135 Ga0070684_100014960
1136 Ga0070684_100041326
1137 Ga0070684_100082913
1138 Ga0070684_100191562
1139 Ga0070684_100943404
1140 Ga0070697_100230674
1141 Ga0068853_100007144
1142 Ga0068853_100010830
1143 Ga0068853_100025180
1144 Ga0068853_100451179
1145 Ga0070672_100005106
1146 Ga0070672_100047010
1147 Ga0070672_100422072
1148 Ga0070686_100000894
1149 Ga0070686_100096061
1150 Ga0070686_100496090
1151 Ga0070695_100001111
1152 Ga0070695_100105395
1153 Ga0070695_100252425
1154 Ga0070695_100506632
1155 Ga0070693_100021502
1156 Ga0070693_100180311
1157 Ga0070693_100276382
1158 Ga0070665_100013759
1159 Ga0070665_100044916
1160 Ga0070665_100565897
1161 Ga0070704_100004226
1162 Ga0070704_100029066
1163 Ga0068855_100000365
1164 Ga0068855_100008239
1165 Ga0068855_100014935
1166 Ga0068855_100056484
1167 Ga0068855_100056669
1168 Ga0068855_100092414
1169 Ga0068855_100225814
1170 Ga0070664_100006003
1171 Ga0070664_100006401
1172 Ga0070664_100007572
1173 Ga0070664_100011505
1174 Ga0070664_100120557
1175 Ga0070664_100178444
1176 Ga0068857_100007749
1177 Ga0068857_100014467
1178 Ga0068857_100290974
1179 Ga0068854_100014528
1180 Ga0068854_100027135
1181 Ga0068854_100058550
1182 Ga0068854_100198817
1183 Ga0068854_100332189
1184 Ga0068854_100575124
1185 Ga0068856_100042993
1186 Ga0068856_100267022
1187 Ga0070702_100415198
1188 Ga0068852_100021930
1189 Ga0068852_100060732
1190 Ga0068852_100446891
1191 Ga0068859_100104748
1192 Ga0068859_101564786
1193 Ga0068864_100030249
1194 Ga0068864_100034396
1195 Ga0068864_100095293
1196 Ga0068864_100095677
1197 Ga0068866_10019629
1198 Ga0068866_10057633
1199 Ga0068861_100000050
1200 Ga0068861_100123696
1201 Ga0068861_100237157
1202 Ga0068851_10012604
1203 Ga0068851_10031995
1204 Ga0068870_10010298
1205 Ga0068870_10102050
1206 Ga0068870_10226636
1207 Ga0068863_100036752
1208 Ga0068863_100037525
1209 Ga0068863_100778401
1210 Ga0068858_100025417
1211 Ga0068858_100221844
1212 Ga0068860_100005607
1213 Ga0068860_100337703
1214 Ga0068860_100436908
1215 Ga0068862_100001155
1216 Ga0068862_100111821
1217 Ga0081539_10029337
1218 Ga0070717_10080571
1219 Ga0070717_10123875
1220 Ga0070716_100000852
1221 Ga0070712_100164477
1222 Ga0070712_100207542
1223 Ga0097621_100018805
1224 Ga0068871_100531991
1225 Ga0075428_100003762
1226 Ga0075428_100255288
1227 Ga0075430_100001111
1228 Ga0075430_100022996
1229 Ga0075430_100049092
1230 Ga0075431_100097409
1231 Ga0075431_100120656
1232 Ga0075431_100245139
1233 Ga0075431_100329703
1234 Ga0075431_100347412
1235 Ga0075431_100691301
1236 Ga0075434_100002429
1237 Ga0075434_100024476
1238 Ga0075429_100068583
1239 Ga0075429_100164490
1240 Ga0075429_100187549
1241 Ga0075429_100446864
1242 Ga0068865_100001898
1243 Ga0068865_100011405
1244 Ga0068865_100014249
1245 Ga0068865_100041974
1246 Ga0068865_100049475
1247 Ga0075436_100000677
1248 Ga0097620_100104734
1249 Ga0097620_101565036
1250 Ga0075435_100067932
1251 Ga0105240_10014723
1252 Ga0105240_10083572
1253 Ga0105240_10097401
1254 Ga0111539_10055838
1255 Ga0105245_10005996
1256 Ga0105245_10006649
1257 Ga0105245_10116463
1258 Ga0105245_10124316
1259 Ga0105245_10185708
1260 Ga0105245_10497190
1261 Ga0105247_10620075
1262 Ga0114129_10068636
1263 Ga0114129_10078733
1264 Ga0114129_10303567
1265 Ga0114129_10375812
1266 Ga0114129_10735683
1267 Ga0114129_10915098
1268 Ga0105243_10076242
1269 Ga0105243_10290705
1270 Ga0105241_10105827
1271 Ga0105242_10007914
1272 Ga0105242_10585475
1273 Ga0105248_10010292
1274 Ga0105248_10031112
1275 Ga0105248_10043841
1276 Ga0105248_10083894
1277 Ga0105248_10113681
1278 Ga0105248_10524124
1279 Ga0105237_10148130
1280 Ga0105238_10087278
1281 Ga0105238_10183975
1282 Ga0105238_10552905
1283 Ga0105238_10621146
1284 Ga0105249_10000009
1285 Ga0105249_10000188
1286 Ga0105249_10001121
1287 Ga0105249_10120209
1288 Ga0105249_10750706
1289 Ga0099796_10064635
1290 Ga0099796_10195555
1291 Ga0105239_10008413
1292 Ga0105239_10727250
1293 Ga0105246_10092442
1294 Ga0105246_10235064
1295 Ga0157373_10027498
1296 Ga0157373_10050604
1297 Ga0157373_10093380
1298 Ga0157371_10002454
1299 Ga0157371_10003251
1300 Ga0157371_10081954
1301 Ga0157370_10012724
1302 Ga0157370_10049047
1303 Ga0157370_10200664
1304 Ga0157370_10433737
1305 Ga0157370_10740649
1306 Ga0157369_10010138
1307 Ga0157369_10013119
1308 Ga0157369_10021013
1309 Ga0157369_10041643
1310 Ga0157369_10047415
1311 Ga0157369_10082371
1312 Ga0157369_10129924
1313 Ga0157369_10188609
1314 Ga0157369_10193919
1315 Ga0157374_10091747
1316 Ga0157374_10199205
1317 Ga0157374_10818580
1318 Ga0157378_10004341
1319 Ga0157378_10011548
1320 Ga0157378_10029471
1321 Ga0157378_10115681
1322 Ga0157378_10156347
1323 Ga0157378_10243234
1324 Ga0157378_10347588
1325 Ga0157378_10697921
1326 Ga0163162_10000292
1327 Ga0163162_10028577
1328 Ga0163162_10048666
1329 Ga0157372_10000154
1330 Ga0157372_10003316
1331 Ga0157372_10008745
1332 Ga0157372_10009950
1333 Ga0157372_10025005
1334 Ga0157372_10025263
1335 Ga0157372_10026810
1336 Ga0157372_10228731
1337 Ga0157372_10425290
1338 Ga0157372_10427885
1339 Ga0157372_10519909
1340 Ga0157372_10956057
1341 Ga0157372_11341004
1342 Ga0157375_10004744
1343 Ga0157375_10025731
1344 Ga0157375_10038058
1345 Ga0157375_10090011
1346 Ga0157375_10132977
1347 Ga0157375_10233993
1348 Ga0163163_10013078
1349 Ga0163163_10109495
1350 Ga0163163_10180285
1351 Ga0163163_11046096
1352 Ga0157380_10002402
1353 Ga0157380_10775162
1354 Ga0182008_10006015
1355 Ga0157377_10106134
1356 Ga0157379_10004531
1357 Ga0157379_11216295
1358 Ga0157376_10111954
1359 Ga0163161_10036642
1360 Ga0207697_10002303
1361 Ga0207656_10014799
1362 Ga0207692_10005344
1363 Ga0207692_10415941
1364 Ga0207642_10123028
1365 Ga0207688_10025721
1366 Ga0207680_10015022
1367 Ga0207680_10188707
1368 Ga0207680_10419794
1369 Ga0207647_10396764
1370 Ga0207699_10001785
1371 Ga0207699_10002628
1372 Ga0207699_10022865
1373 Ga0207645_10000120
1374 Ga0207645_10002253
1375 Ga0207645_10025979
1376 Ga0207645_10048860
1377 Ga0207645_10050751
1378 Ga0207645_10068603
1379 Ga0207645_10083493
1380 Ga0207643_10003056
1381 Ga0207643_10145533
1382 Ga0207705_10001492
1383 Ga0207705_10004560
1384 Ga0207705_10043828
1385 Ga0207705_10056268
1386 Ga0207705_10098767
1387 Ga0207705_10156198
1388 Ga0207705_10236519
1389 Ga0207684_10107285
1390 Ga0207654_10067383
1391 Ga0207707_10000291
1392 Ga0207707_10009665
1393 Ga0207707_10012141
1394 Ga0207707_10015156
1395 Ga0207707_10018483
1396 Ga0207707_10029122
1397 Ga0207707_10067373
1398 Ga0207707_10344173
1399 Ga0207695_10001619
1400 Ga0207695_10055667
1401 Ga0207695_10404233
1402 Ga0207671_10314133
1403 Ga0207693_10074451
1404 Ga0207693_10161249
1405 Ga0207693_10311010
1406 Ga0207663_10039695
1407 Ga0207663_10227430
1408 Ga0207660_10000202
1409 Ga0207660_10000293
1410 Ga0207660_10011805
1411 Ga0207660_10031627
1412 Ga0207660_10096969
1413 Ga0207660_10506259
1414 Ga0207662_10005349
1415 Ga0207662_10016921
1416 Ga0207662_10020472
1417 Ga0207657_10000322
1418 Ga0207657_10005540
1419 Ga0207657_10008298
1420 Ga0207657_10125337
1421 Ga0207657_10126808
1422 Ga0207649_10013231
1423 Ga0207649_10026119
1424 Ga0207649_10122305
1425 Ga0207649_10156016
1426 Ga0207652_10001846
1427 Ga0207652_10004621
1428 Ga0207652_10022412
1429 Ga0207652_10084835
1430 Ga0207652_10135626
1431 Ga0207652_10142007
1432 Ga0207652_10143843
1433 Ga0207652_10218865
1434 Ga0207652_10523270
1435 Ga0207652_10553275
1436 Ga0207652_10590166
1437 Ga0207646_10000322
1438 Ga0207646_10005351
1439 Ga0207646_10796517
1440 Ga0207681_10000721
1441 Ga0207681_10002880
1442 Ga0207681_10008683
1443 Ga0207681_10073113
1444 Ga0207694_10004498
1445 Ga0207650_10000842
1446 Ga0207650_10043023
1447 Ga0207650_10120592
1448 Ga0207659_10002944
1449 Ga0207659_10005050
1450 Ga0207659_10055476
1451 Ga0207659_10106209
1452 Ga0207659_10194535
1453 Ga0207687_10177032
1454 Ga0207700_10000264
1455 Ga0207700_10060653
1456 Ga0207700_10086620
1457 Ga0207700_10098555
1458 Ga0207664_10001593
1459 Ga0207664_10005655
1460 Ga0207664_10006567
1461 Ga0207644_10097410
1462 Ga0207690_10018462
1463 Ga0207690_10030609
1464 Ga0207690_10238470
1465 Ga0207690_10378018
1466 Ga0207706_10000083
1467 Ga0207706_10000169
1468 Ga0207706_10055266
1469 Ga0207706_10069751
1470 Ga0207706_10073669
1471 Ga0207706_10145954
1472 Ga0207706_10656752
1473 Ga0207686_10006555
1474 Ga0207686_10382933
1475 Ga0207686_10487971
1476 Ga0207686_10621500
1477 Ga0207709_10094635
1478 Ga0207670_10020828
1479 Ga0207669_10058976
1480 Ga0207669_10586348
1481 Ga0207669_10599103
1482 Ga0207704_10004977
1483 Ga0207704_10008732
1484 Ga0207704_10012273
1485 Ga0207704_10026405
1486 Ga0207704_10058118
1487 Ga0207704_10086776
1488 Ga0207704_10308361
1489 Ga0207665_10000150
1490 Ga0207691_10001327
1491 Ga0207691_10001331
1492 Ga0207691_10039051
1493 Ga0207691_10094134
1494 Ga0207691_10285398
1495 Ga0207691_10397511
1496 Ga0207691_10825968
1497 Ga0207711_10046196
1498 Ga0207711_10091428
1499 Ga0207711_10113593
1500 Ga0207711_10124830
1501 Ga0207711_10151695
1502 Ga0207711_10366462
1503 Ga0207689_10014298
1504 Ga0207661_10016821
1505 Ga0207661_10031304
1506 Ga0207661_10059260
1507 Ga0207661_10073412
1508 Ga0207661_10095602
1509 Ga0207661_10100181
1510 Ga0207661_10131328
1511 Ga0207661_10249675
1512 Ga0207679_10001051
1513 Ga0207679_10001967
1514 Ga0207679_10007333
1515 Ga0207679_10008893
1516 Ga0207679_10027934
1517 Ga0207679_10281481
1518 Ga0207667_10067317
1519 Ga0207667_10103103
1520 Ga0207667_10174930
1521 Ga0207667_10240272
1522 Ga0207651_10038586
1523 Ga0207651_10054203
1524 Ga0207651_10197285
1525 Ga0207651_10306301
1526 Ga0207651_10549250
1527 Ga0207712_10000080
1528 Ga0207712_10000604
1529 Ga0207712_10000789
1530 Ga0207668_10001000
1531 Ga0207668_10002344
1532 Ga0207668_10150321
1533 Ga0207640_10022130
1534 Ga0207640_10134160
1535 Ga0207640_10448409
1536 Ga0207640_10526735
1537 Ga0207658_10088508
1538 Ga0207658_10155457
1539 Ga0207658_10784415
1540 Ga0207677_10004918
1541 Ga0207677_10076932
1542 Ga0207677_10114208
1543 Ga0207703_10021263
1544 Ga0207703_10241983
1545 Ga0207639_10007792
1546 Ga0207639_10022427
1547 Ga0207639_10076830
1548 Ga0207639_10113890
1549 Ga0207639_10280154
1550 Ga0207678_10296497
1551 Ga0207678_10542649
1552 Ga0207708_10003839
1553 Ga0207708_10005107
1554 Ga0207708_10058843
1555 Ga0207702_10268669
1556 Ga0207702_10412800
1557 Ga0207702_10960723
1558 Ga0207641_10071223
1559 Ga0207641_10202444
1560 Ga0207648_10009618
1561 Ga0207648_10009904
1562 Ga0207648_10011662
1563 Ga0207648_10033266
1564 Ga0207648_10065679
1565 Ga0207648_10076882
1566 Ga0207648_10235751
1567 Ga0207676_10016806
1568 Ga0207676_10167563
1569 Ga0207676_10220739
1570 Ga0207676_10394604
1571 Ga0207674_10000044
1572 Ga0207674_10000889
1573 Ga0207674_10010440
1574 Ga0207674_10022308
1575 Ga0207674_10051973
1576 Ga0207674_10378945
1577 Ga0207675_100000132
1578 Ga0207675_100025606
1579 Ga0207675_100074945
1580 Ga0207675_100120064
1581 Ga0207675_100121643
1582 Ga0207683_10003148
1583 Ga0207683_10041875
1584 Ga0207683_10151276
1585 Ga0207683_10182074
1586 Ga0207683_10315414
1587 Ga0207698_10009866
1588 Ga0207698_10056237
1589 Ga0207698_10194020
1590 Ga0207698_10210005
1591 Ga0207698_10646897
1592 Ga0209969_1002266
1593 Ga0209969_1004685
1594 Ga0209981_1001532
1595 Ga0209996_1002203
1596 Ga0209984_1001356
1597 Ga0209995_1000109
1598 Ga0209995_1006289
1599 Ga0209968_1001620
1600 Ga0209999_1000063
1601 Ga0209999_1000110
1602 Ga0209970_1005986
1603 Ga0210002_1002567
1604 Ga0209971_1002823
1605 Ga0209971_1022980
1606 Ga0209966_1000462
1607 Ga0209998_10000026
1608 Ga0209974_10000165
1609 Ga0207428_10032505
1610 Ga0207428_10079356
1611 Ga0268266_10071391
1612 Ga0268266_10509034
1613 Ga0268265_10000860
1614 Ga0268265_10007370
1615 Ga0268265_10572188
1616 Ga0268264_10019421
1617 Ga0268264_10132376
1618 Ga0316182_1013122
1619 Ga0307408_100001240
1620 Ga0307408_100026037
1621 Ga0307408_100041463
1622 Ga0307405_10001005
1623 Ga0307405_10003342
1624 Ga0307405_10033527
1625 Ga0307405_10055454
1626 Ga0307413_10002253
1627 Ga0307413_10042197
1628 Ga0307413_10152393
1629 Ga0307413_10209424
1630 Ga0307413_10266737
1631 Ga0307410_10002519
1632 Ga0307410_10107627
1633 Ga0307410_10296137
1634 Ga0307406_10001692
1635 Ga0307406_10002911
1636 Ga0307406_10016465
1637 Ga0307406_10060691
1638 Ga0307407_10000508
1639 Ga0307407_10051285
1640 Ga0307407_10099175
1641 Ga0307407_10213521
1642 Ga0307412_10250700
1643 Ga0307412_10393286
1644 Ga0307412_10468887
1645 Ga0307409_100000906
1646 Ga0307409_100027867
1647 Ga0307409_100028621
1648 Ga0307409_100076832
1649 Ga0307416_100000749
1650 Ga0307416_100027306
1651 Ga0307416_100204654
1652 Ga0307416_100209468
1653 Ga0307416_100695885
1654 Ga0307416_101024597
1655 Ga0307414_10014782
1656 Ga0307411_10002243
1657 Ga0307411_10010325
1658 Ga0307411_10666849
1659 Ga0307415_100057199
1660 Ga0307415_100075712
1661 Ga0307415_100977917
1662 Ga0373959_0003512
1663 Ga0373934_0000506
1664 Ga0373944_0006613
1665 Ga0373944_0155008
1666 Ga0373945_0003728
1667 Ga0373953_0007584
1668 Ga0373954_0002646
1669 Ga0373956_0000240
1670 Ga0373960_0045927
1671 Ga0373943_0002262
1672 Ga0373943_0020377
1673 Ga0373946_0095525
1674 Ga0373946_0100269
1675 Ga0373924_0010613
1676 Ga0373935_0002849
1677 Ga0373935_0082412
1678 Ga0373935_0167367
1679 Ga0373927_0003500
1680 Ga0373933_0000091
1681 Ga0373947_0000257
1682 Ga0373947_0053912
1683 Ga0373947_0085620
1684 Ga0373947_0356651
1685 Ga0373937_0000104
1686 Ga0373937_0018105
1687 Ga0373937_0053248
1688 Ga0373937_0110690
1689 Ga0373937_0525510
1690 Ga0373937_1061884
1691 Ga0373925_0000876
1692 Ga0395905_0387054
1693 Ga0395905_0522317
1694 Ga0436364_1339967
1695 Ga0436365_1923651
1696 Ga0451853_1709214
1697 Ga0439450_050603
1698 Ga0439446_0032648
1699 Ga0451577_0011965
1700 Ga0466961_0133600
1701 Ga0466963_0330467
1702 Ga0453684_0000455
1703 Ga0466959_0047246
1704 Ga0451576_0339504
1705 Ga0466958_0252008
1706 Ga0495592_0001993
1707 Ga0495592_0244448
1708 Ga0495603_0047944
1709 Ga0495590_0029254
1710 Ga0495629_0009170
1711 Ga0495629_0078564
1712 Ga0495629_0119523
1713 Ga0495629_0192302
1714 Ga0495651_0002399
1715 Ga0495651_0069053
1716 Ga0495653_0000064
1717 Ga0495653_0103048
1718 Ga0495653_0415300
1719 Ga0495580_0003769
1720 Ga0495582_0002258
1721 Ga0495639_0000281
1722 Ga0495639_0055477
1723 Ga0495639_0189469
1724 Ga0495664_0060476
1725 Ga0495664_0223407
1726 Ga0495584_0112024
1727 Ga0495594_0003515
1728 Ga0495594_0036618
1729 Ga0495594_0122240
1730 Ga0495594_0149043
1731 Ga0495608_0000200
1732 Ga0495608_0080656
1733 Ga0495628_0000571
1734 Ga0495628_0035576
1735 Ga0495628_0036916
1736 Ga0495630_0004824
1737 Ga0495630_0047804
1738 Ga0495630_0065644
1739 Ga0495630_0108176
1740 Ga0495652_0002046
1741 Ga0495652_0011735
1742 Ga0495652_0090509
1743 Ga0495652_0130538
1744 Ga0495665_0000269
1745 Ga0495665_0098270
1746 Ga0495665_0233455
1747 Ga0495640_0130325
1748 Ga0495586_0006575
1749 Ga0495586_0110521
1750 Ga0495587_0000557
1751 Ga0495587_0019626
1752 Ga0495587_0149720
1753 Ga0495598_0037454
1754 Ga0495645_0000675
1755 Ga0495645_0009513
1756 Ga0495645_0060178
1757 Ga0495645_0075374
1758 Ga0495645_0110272
1759 Ga0495667_0000234
1760 Ga0495667_0019152
1761 Ga0495667_0030428
1762 Ga0495635_0000027
1763 Ga0495635_0009497
1764 Ga0495635_0182266
1765 Ga0495635_0240456
1766 Ga0495635_0382473
1767 Ga0495588_0000605
1768 Ga0495588_0015248
1769 Ga0495657_0000129
1770 Ga0495657_0034363
1771 Ga0495657_0205967
1772 Ga0495599_0000121
1773 Ga0495599_0043404
1774 Ga0495623_0000470
1775 Ga0495623_0248745
1776 Ga0495646_0004308
1777 Ga0495646_0026832
1778 Ga0495647_0021045
1779 Ga0495658_0000078
1780 Ga0495658_0049087
1781 Ga0495658_0175517
1782 Ga0495669_0299731
1783 Ga0495613_0028794
1784 Ga0495613_0119985
1785 Ga0495613_0144171
1786 Ga0495600_0000038
1787 Ga0495581_0000461
1788 Ga0495581_0012251
1789 Ga0495581_0294715
1790 Ga0495604_0003741
1791 Ga0495604_0056766
1792 Ga0495604_0058576
1793 Ga0495604_0359755
1794 Ga0495674_0000649
1795 Ga0495674_0009521
1796 Ga0495674_0015725
1797 Ga0495674_0121410
1798 Ga0495680_0006631
1799 Ga0495680_0010779
1800 Ga0495680_0016537
1801 Ga0495675_0005579
1802 Ga0495675_0010312
1803 Ga0495675_0089495
1804 Ga0495675_0139374
1805 Ga0495684_0000805
1806 Ga0495684_0003546
1807 Ga0495684_0028261
1808 Ga0495684_0055311
1809 Ga0495593_0001622
1810 Ga0495593_0065967
1811 Ga0495602_0000377
1812 Ga0495602_0024716
1813 Ga0495602_0056954
1814 Ga0495614_0000127
1815 Ga0496100_0327932
1816 Ga0496101_0049062
1817 Ga0496104_0332229
1818 Ga0496104_0406668
1819 Ga0496105_0047313
1820 Ga0496106_0041880
1821 Ga0496106_0297559
1822 Ga0496107_0081294
1823 Ga0496108_0098759
1824 Ga0496108_0107404
1825 Ga0496109_0077667
1826 Ga0496109_0079917
1827 Ga0496109_0162554
1828 Ga0496109_0488425
1829 Ga0496110_0059057
1830 Ga0496112_0007703
1831 Ga0496112_0507381
1832 Ga0496112_0791619
1833 Ga0496113_0008973
1834 Ga0496115_0296945
1835 Ga0501031_0008140
1836 Ga0501034_0025096
1837 Ga0501036_0091943
1838 Ga0501038_0023773
1839 Ga0501038_0099860
1840 Ga0501039_0068118
1841 Ga0501040_0225358
1842 Ga0501042_0080240
1843 Ga0501043_0071084
1844 Ga0501043_0288353
1845 Ga0501043_0486790
1846 Ga0501047_0322852
1847 Ga0501047_1016282
1848 Ga0501069_0093863
1849 Ga0501072_0199511
1850 Ga0501073_0038483
1851 Ga0501076_0141124
1852 Ga0501216_043413
1853 Ga0501249_002790
1854 Ga0501251_025379
1855 Ga0501253_000218
1856 Ga0501253_031957
1857 Ga0501261_001301
1858 Ga0501225_0004013
1859 Ga0501079_0064527
1860 Ga0501079_0250183
1861 Ga0501079_0596840
1862 Ga0501080_0019645
1863 Ga0501232_001678
1864 Ga0501262_029153
1865 Ga0501265_005344
1866 Ga0501268_013481
1867 Ga0501268_047737
1868 Ga0501272_018652
1869 Ga0501273_006109
1870 Ga0501035_0021882
1871 Ga0501044_0073178
1872 Ga0501044_0109261
1873 Ga0501045_0036937
1874 Ga0501212_000092
1875 nmdc:mga05p37_115965_c1
1876 nmdc:mga05p37_174517_c1
1877 nmdc:mga05p37_192204_c2
1878 nmdc:mga09592_25013_c1
1879 nmdc:mga0qj67_1019_c1
1880 nmdc:mga0qj67_11483_c1
1881 nmdc:mga0qj67_5187_c1
1882 nmdc:mga06r32_348995_c1
1883 nmdc:mga06r32_35655_c1
1884 nmdc:mga06r32_551359_c1
1885 nmdc:mga06r32_60943_c1
1886 nmdc:mga06r32_633572_c1
1887 nmdc:mga06r32_690779_c1
1888 nmdc:mga08y16_286113_c1
1889 nmdc:mga0n895_1236_c1
1890 nmdc:mga0n895_14333_c1
1891 nmdc:mga0n895_157989_c1
1892 nmdc:mga0rr50_90931_c1
1893 nmdc:mga08x19_2711_c1
1894 nmdc:mga0a205_28910_c1
1895 nmdc:mga0a205_391_c1
1896 Ga0495601_0011009
1897 Ga0495601_0460796
1898 Ga0495612_0001647
1899 Ga0495619_0000293
1900 Ga0500596_006091
1901 Ga0590071_026926
1902 Ga0590071_031805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13328

HD_4

HD domain

29

175

0.82

PF01966

HD

HD domain

49

155

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yf1-assembly2.cif.gz_D 1.85 angstrom crystal structure of lmo0812 from listeria monocytogenes egd-e 0.8616 35 199
4yf1-assembly2.cif.gz_D 1.85 angstrom crystal structure of lmo0812 from listeria monocytogenes egd-e 0.8513 35 199
7qoc-assembly1.cif.gz_B se-met derivative structure of a small alarmone hydrolase (relh) from corynebacterium glutamicum 0.8502 7 199
4yf1-assembly1.cif.gz_C 1.85 angstrom crystal structure of lmo0812 from listeria monocytogenes egd-e 0.8489 35 199
4yf1-assembly2.cif.gz_B 1.85 angstrom crystal structure of lmo0812 from listeria monocytogenes egd-e 0.8421 30 199
ID Description Score Start End Superfamily
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7793 8 197 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7714 9 194 1.10.3210.10
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7631 8 197 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7423 9 194 1.10.3210.10
af_Q2FXU1_3_195_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7407 8 197 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A257RUN4-F1-model_v4 HD domain-containing protein 0.9886 44 201
AF-A0A7Y5QKA6-F1-model_v4 HD domain-containing protein 0.956 3 158 GO:0008893
AF-A0A7Y5QKA6-F1-model_v4 HD domain-containing protein 0.9384 3 158 GO:0008893
AF-A0A257RUN4-F1-model_v4 HD domain-containing protein 0.9302 44 201
AF-A0A6J4MDR5-F1-model_v4 GTP pyrophosphokinase (EC 2.7.6.5) 0.9268 27 200 GO:0008728
GO:0008893
GO:0016301

Map