F486569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 950 | 570 | 759 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_056431|Ga0500595_056431_102_1034 |
| Length | 310 |
| Sequence | MLSCPAKAGHRVSVAARIIARVARLHRPVELGDDVRKIKWSVPTMQDLMKGKRGLIMGIANDHSIAWGIAKALATQGAELAFSYQGEAQSKRLKPLVQPFGFDIVLPCDVEDIASVDQMFAALRERWDRLDFLVHAIGFTEKNELRGRYADTTRENFSRTMLISCFSFTEIAKRAAGMMPATGGSMITLTYGASMRAMPNYNVMGVAKAALEASVRYLAADFGPQGVRVNAISAGPVRTLAGSVIGDARAMFAFQQKHSPLGRGVTLDELGGSALYLLSDLAGGVTGEIHYVDSGYNIVLQPRPENMAPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 22 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 23 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 24 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 25 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 26 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 32 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 33 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 34 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 35 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 36 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 37 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 41 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 42 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 43 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 44 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 45 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 46 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 47 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 48 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 49 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 50 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 51 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 52 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 53 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 54 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 55 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 56 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 57 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 58 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 59 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 60 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 61 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 62 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 63 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 64 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 65 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 66 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 67 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 68 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 69 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 70 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 71 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 72 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 73 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 74 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 75 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 76 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 77 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 78 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 79 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 80 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 81 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 82 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 83 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 84 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 85 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 86 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 87 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 88 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 89 | 2922368715 | |||
| 90 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 91 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 92 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 93 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 94 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 95 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 96 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 97 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 98 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 99 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 100 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 101 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 102 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 103 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 104 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 105 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 106 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 107 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 108 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 109 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 110 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 111 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 112 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 113 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 114 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 115 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 116 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 117 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 118 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 119 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 120 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 121 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 122 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 123 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 124 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 125 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 126 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 127 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 128 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 129 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 130 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 131 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 132 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 133 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 134 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 135 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 136 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 137 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 138 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 139 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 140 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 141 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 142 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 143 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 144 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 145 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 146 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 147 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 148 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 149 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 150 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 151 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 152 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 153 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 154 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 155 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 156 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 157 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 158 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 159 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 160 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 161 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 162 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 163 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 166 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 167 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 169 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 170 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 171 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 173 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 174 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 179 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 182 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 187 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 188 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 189 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 190 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 191 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 192 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 194 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 195 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 197 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 198 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 199 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 200 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 201 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 202 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 203 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 204 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 205 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 206 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 207 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 208 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 209 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 210 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 212 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 213 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 214 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 215 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 219 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 220 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 222 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 223 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 224 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 225 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 226 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 247 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 248 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 249 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 250 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 251 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 252 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 253 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 254 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 255 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 256 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 257 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 258 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 262 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 263 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 265 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 317 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 318 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 319 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 320 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 324 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 325 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 326 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 327 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 328 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 329 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 330 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 331 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 332 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 333 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 335 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 336 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 337 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 338 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 339 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 340 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 341 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 342 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 343 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 344 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 345 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 346 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 347 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 348 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 349 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 350 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 351 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 352 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 353 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 354 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 355 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 356 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 357 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 358 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 359 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 360 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 361 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 362 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 363 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 364 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 365 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 366 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 367 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 368 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 369 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 370 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 371 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 372 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 373 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 374 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 375 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 376 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 377 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 378 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 379 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 380 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 381 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 382 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 383 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 384 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 385 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 386 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 387 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 388 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 389 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 390 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 391 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 392 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 393 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 394 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 395 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 396 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 457 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 458 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 459 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 460 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 461 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 462 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 463 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 466 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 467 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 468 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 469 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 470 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 471 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 472 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 473 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 474 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 475 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 476 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 477 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 478 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 479 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 494 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 495 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 497 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 498 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 499 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 504 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 510 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 511 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 512 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 514 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 515 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 516 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 517 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 518 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 519 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 520 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 521 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 522 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 523 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 524 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 525 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 526 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 527 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 528 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 530 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 531 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 532 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 533 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 534 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 536 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 537 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 538 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 539 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 540 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 541 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 542 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 543 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 544 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 545 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 546 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 547 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 548 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 549 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 550 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 551 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 552 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 553 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 554 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 555 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 556 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 557 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 558 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 559 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 560 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 561 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 562 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 563 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 564 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 565 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 566 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 567 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 568 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 569 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 570 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.66 |
| Metatranscriptomes | 0.32 |
| Isolates | 20.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.32 |
| Nodule | 16.42 |
| Rhizoplane | 7.37 |
| Rhizosphere | 57.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10003121 | 3300003215 | Bacteria | 9344 |
| 2 | JGI25153J46596_10003625 | 3300003215 | Bacteria | 8573 |
| 3 | JGI25153J46596_10005115 | 3300003215 | Bacteria | 6918 |
| 4 | JGI25153J46596_10010926 | 3300003215 | Bacteria | 4058 |
| 5 | JGI25160J50197_1001001 | 3300003354 | Bacteria | 14647 |
| 6 | JGI25160J50197_1003544 | 3300003354 | Bacteria | 6950 |
| 7 | Ga0055531_10003282 | 3300003794 | Bacteria | 10366 |
| 8 | Ga0055543_1003105 | 3300004625 | Bacteria | 5088 |
| 9 | Ga0055543_1012639 | 3300004625 | Bacteria | 1689 |
| 10 | Ga0065165_1006509 | 3300005262 | Bacteria | 6097 |
| 11 | Ga0065165_1007472 | 3300005262 | Bacteria | 5358 |
| 12 | Ga0065715_10303924 | 3300005293 | Bacteria | 1035 |
| 13 | Ga0070658_10029625 | 3300005327 | Bacteria | 4398 |
| 14 | Ga0070658_10065949 | 3300005327 | Bacteria | 2956 |
| 15 | Ga0070658_10086288 | 3300005327 | Bacteria | 2582 |
| 16 | Ga0070676_10283124 | 3300005328 | Bacteria | 1118 |
| 17 | Ga0070683_100019421 | 3300005329 | Bacteria | 6036 |
| 18 | Ga0070683_100037636 | 3300005329 | Bacteria | 4429 |
| 19 | Ga0070683_100082862 | 3300005329 | Bacteria | 3004 |
| 20 | Ga0070683_100201118 | 3300005329 | Bacteria | 1892 |
| 21 | Ga0068869_100184781 | 3300005334 | Bacteria | 1636 |
| 22 | Ga0070666_10067804 | 3300005335 | Bacteria | 2423 |
| 23 | Ga0070666_10137472 | 3300005335 | Bacteria | 1701 |
| 24 | Ga0070680_100005994 | 3300005336 | Bacteria | 9221 |
| 25 | Ga0070680_100023189 | 3300005336 | Bacteria | 4948 |
| 26 | Ga0070680_100038993 | 3300005336 | Bacteria | 3843 |
| 27 | Ga0070680_100409143 | 3300005336 | Bacteria | 1157 |
| 28 | Ga0070682_100099940 | 3300005337 | Bacteria | 1913 |
| 29 | Ga0068868_100006519 | 3300005338 | Bacteria | 8266 |
| 30 | Ga0070660_100009116 | 3300005339 | Bacteria | 6963 |
| 31 | Ga0070689_100017799 | 3300005340 | Bacteria | 5224 |
| 32 | Ga0070691_10119312 | 3300005341 | Bacteria | 1327 |
| 33 | Ga0070661_100230067 | 3300005344 | Bacteria | 1424 |
| 34 | Ga0070675_100066168 | 3300005354 | Bacteria | 2989 |
| 35 | Ga0070671_100082907 | 3300005355 | Bacteria | 2682 |
| 36 | Ga0070671_100438802 | 3300005355 | Bacteria | 1119 |
| 37 | Ga0070673_100179111 | 3300005364 | Bacteria | 1814 |
| 38 | Ga0070688_100013010 | 3300005365 | Bacteria | 4682 |
| 39 | Ga0070688_100354506 | 3300005365 | Bacteria | 1075 |
| 40 | Ga0070667_100184122 | 3300005367 | Bacteria | 1848 |
| 41 | Ga0070709_10408689 | 3300005434 | Bacteria | 1015 |
| 42 | Ga0070710_10071421 | 3300005437 | Bacteria | 2002 |
| 43 | Ga0070711_100048433 | 3300005439 | Bacteria | 2906 |
| 44 | Ga0070711_100048890 | 3300005439 | Bacteria | 2894 |
| 45 | Ga0070711_100093270 | 3300005439 | Bacteria | 2174 |
| 46 | Ga0070711_100102626 | 3300005439 | Bacteria | 2083 |
| 47 | Ga0070700_100133379 | 3300005441 | Bacteria | 1679 |
| 48 | Ga0070663_100117697 | 3300005455 | Bacteria | 2004 |
| 49 | Ga0070678_100149557 | 3300005456 | Bacteria | 1879 |
| 50 | Ga0070681_10013547 | 3300005458 | Bacteria | 8109 |
| 51 | Ga0070681_10020781 | 3300005458 | Bacteria | 6576 |
| 52 | Ga0070681_10155095 | 3300005458 | Bacteria | 2215 |
| 53 | Ga0070685_10189807 | 3300005466 | Bacteria | 1328 |
| 54 | Ga0070679_100054647 | 3300005530 | Bacteria | 3976 |
| 55 | Ga0070679_100337085 | 3300005530 | Bacteria | 1456 |
| 56 | Ga0070684_100012686 | 3300005535 | Bacteria | 6762 |
| 57 | Ga0070684_100055646 | 3300005535 | Bacteria | 3450 |
| 58 | Ga0070684_100061498 | 3300005535 | Bacteria | 3287 |
| 59 | Ga0070697_100000586 | 3300005536 | Bacteria | 27495 |
| 60 | Ga0068853_100007407 | 3300005539 | Bacteria | 8778 |
| 61 | Ga0068853_100191638 | 3300005539 | Bacteria | 1857 |
| 62 | Ga0068853_100475340 | 3300005539 | Bacteria | 1178 |
| 63 | Ga0070665_100078771 | 3300005548 | Bacteria | 3302 |
| 64 | Ga0070704_100124084 | 3300005549 | Bacteria | 1989 |
| 65 | Ga0068855_100317504 | 3300005563 | Bacteria | 1723 |
| 66 | Ga0068855_100526079 | 3300005563 | Bacteria | 1282 |
| 67 | Ga0068855_100628085 | 3300005563 | Bacteria | 1156 |
| 68 | Ga0068855_100722856 | 3300005563 | Bacteria | 1064 |
| 69 | Ga0070664_100431590 | 3300005564 | Bacteria | 1208 |
| 70 | Ga0070664_100439030 | 3300005564 | Bacteria | 1197 |
| 71 | Ga0068857_100015264 | 3300005577 | Bacteria | 6704 |
| 72 | Ga0068857_100106530 | 3300005577 | Bacteria | 2518 |
| 73 | Ga0068854_100129752 | 3300005578 | Bacteria | 1923 |
| 74 | Ga0068856_100019802 | 3300005614 | Bacteria | 6532 |
| 75 | Ga0068856_100025298 | 3300005614 | Bacteria | 5786 |
| 76 | Ga0068856_100064181 | 3300005614 | Bacteria | 3629 |
| 77 | Ga0068852_100011334 | 3300005616 | Bacteria | 6707 |
| 78 | Ga0068852_100735459 | 3300005616 | Bacteria | 998 |
| 79 | Ga0068864_100024902 | 3300005618 | Bacteria | 5034 |
| 80 | Ga0068864_100072754 | 3300005618 | Bacteria | 2997 |
| 81 | Ga0068864_100583628 | 3300005618 | Bacteria | 1083 |
| 82 | Ga0068866_10025845 | 3300005718 | Bacteria | 2766 |
| 83 | Ga0068851_10192968 | 3300005834 | Bacteria | 1133 |
| 84 | Ga0068863_100287447 | 3300005841 | Bacteria | 1594 |
| 85 | Ga0068858_100051636 | 3300005842 | Bacteria | 3804 |
| 86 | Ga0068858_100379450 | 3300005842 | Bacteria | 1356 |
| 87 | Ga0068858_100544947 | 3300005842 | Bacteria | 1123 |
| 88 | Ga0068860_100001623 | 3300005843 | Bacteria | 24139 |
| 89 | Ga0068860_100100464 | 3300005843 | Bacteria | 2760 |
| 90 | Ga0068862_100412492 | 3300005844 | Bacteria | 1266 |
| 91 | Ga0068862_100640029 | 3300005844 | Bacteria | 1025 |
| 92 | Ga0081455_10002724 | 3300005937 | Bacteria | 20860 |
| 93 | Ga0081538_10073681 | 3300005981 | Bacteria | 1864 |
| 94 | Ga0081540_1005028 | 3300005983 | Bacteria | 9926 |
| 95 | Ga0081540_1097565 | 3300005983 | Bacteria | 1275 |
| 96 | Ga0081540_1148590 | 3300005983 | Bacteria | 928 |
| 97 | Ga0070717_10013327 | 3300006028 | Bacteria | 6296 |
| 98 | Ga0075365_10087924 | 3300006038 | Bacteria | 2113 |
| 99 | Ga0075365_10324439 | 3300006038 | Bacteria | 1084 |
| 100 | Ga0075368_10028712 | 3300006042 | Bacteria | 2150 |
| 101 | Ga0075363_100046693 | 3300006048 | Bacteria | 2299 |
| 102 | Ga0075363_100058425 | 3300006048 | Bacteria | 2072 |
| 103 | Ga0075364_10016682 | 3300006051 | Bacteria | 4572 |
| 104 | Ga0075364_10110569 | 3300006051 | Bacteria | 1833 |
| 105 | Ga0070715_10188242 | 3300006163 | Bacteria | 1040 |
| 106 | Ga0070716_100113562 | 3300006173 | Bacteria | 1683 |
| 107 | Ga0070712_100152731 | 3300006175 | Bacteria | 1774 |
| 108 | Ga0070712_100170594 | 3300006175 | Bacteria | 1688 |
| 109 | Ga0075367_10016821 | 3300006178 | Bacteria | 4000 |
| 110 | Ga0075367_10018650 | 3300006178 | Bacteria | 3832 |
| 111 | Ga0075367_10033232 | 3300006178 | Bacteria | 2972 |
| 112 | Ga0075366_10002189 | 3300006195 | Bacteria | 9977 |
| 113 | Ga0075366_10010105 | 3300006195 | Bacteria | 5291 |
| 114 | Ga0097621_100156763 | 3300006237 | Bacteria | 1955 |
| 115 | Ga0097621_100177899 | 3300006237 | Bacteria | 1837 |
| 116 | Ga0075370_10145107 | 3300006353 | Bacteria | 1389 |
| 117 | Ga0075370_10182249 | 3300006353 | Bacteria | 1236 |
| 118 | Ga0075434_100334058 | 3300006871 | Bacteria | 1536 |
| 119 | Ga0075436_100040321 | 3300006914 | Bacteria | 3223 |
| 120 | Ga0099824_1031610 | 3300006942 | Bacteria | 1988 |
| 121 | Ga0099823_1022934 | 3300006944 | Bacteria | 5747 |
| 122 | Ga0105240_10002261 | 3300009093 | Bacteria | 31223 |
| 123 | Ga0105240_10062622 | 3300009093 | Bacteria | 4630 |
| 124 | Ga0105245_10013837 | 3300009098 | Bacteria | 7028 |
| 125 | Ga0105245_10043050 | 3300009098 | Bacteria | 4028 |
| 126 | Ga0105247_10054065 | 3300009101 | Bacteria | 2478 |
| 127 | Ga0114129_10271364 | 3300009147 | Bacteria | 2269 |
| 128 | Ga0105241_10029766 | 3300009174 | Bacteria | 4076 |
| 129 | Ga0105241_10046596 | 3300009174 | Bacteria | 3293 |
| 130 | Ga0105241_10560854 | 3300009174 | Bacteria | 1027 |
| 131 | Ga0105242_10109173 | 3300009176 | Bacteria | 2356 |
| 132 | Ga0105242_10229813 | 3300009176 | Bacteria | 1662 |
| 133 | Ga0105242_10426952 | 3300009176 | Bacteria | 1243 |
| 134 | Ga0105248_10041110 | 3300009177 | Bacteria | 5183 |
| 135 | Ga0105248_10138209 | 3300009177 | Bacteria | 2748 |
| 136 | Ga0105248_10175253 | 3300009177 | Bacteria | 2417 |
| 137 | Ga0105248_10215497 | 3300009177 | Bacteria | 2163 |
| 138 | Ga0105237_10003763 | 3300009545 | Bacteria | 17858 |
| 139 | Ga0105237_10145812 | 3300009545 | Bacteria | 2362 |
| 140 | Ga0105237_10174664 | 3300009545 | Bacteria | 2149 |
| 141 | Ga0105237_10273079 | 3300009545 | Bacteria | 1693 |
| 142 | Ga0105237_10579255 | 3300009545 | Bacteria | 1129 |
| 143 | Ga0105237_10659413 | 3300009545 | Bacteria | 1053 |
| 144 | Ga0105238_10015969 | 3300009551 | Bacteria | 7597 |
| 145 | Ga0105238_10069807 | 3300009551 | Bacteria | 3514 |
| 146 | Ga0105238_10193609 | 3300009551 | Bacteria | 2009 |
| 147 | Ga0105238_10371555 | 3300009551 | Bacteria | 1420 |
| 148 | Ga0105239_10023195 | 3300010375 | Bacteria | 6839 |
| 149 | Ga0105239_10094285 | 3300010375 | Bacteria | 3306 |
| 150 | Ga0105239_10216930 | 3300010375 | Bacteria | 2145 |
| 151 | Ga0105246_10325764 | 3300011119 | Bacteria | 1250 |
| 152 | Ga0105246_10372420 | 3300011119 | Bacteria | 1177 |
| 153 | Ga0105246_10403074 | 3300011119 | Bacteria | 1136 |
| 154 | Ga0157370_10035814 | 3300013104 | Bacteria | 4820 |
| 155 | Ga0157370_10159270 | 3300013104 | Bacteria | 2101 |
| 156 | Ga0157370_10317136 | 3300013104 | Bacteria | 1438 |
| 157 | Ga0157369_10053722 | 3300013105 | Bacteria | 4352 |
| 158 | Ga0157369_10106099 | 3300013105 | Bacteria | 2990 |
| 159 | Ga0157374_10003265 | 3300013296 | Bacteria | 13623 |
| 160 | Ga0157374_10040674 | 3300013296 | Bacteria | 4282 |
| 161 | Ga0157378_10451639 | 3300013297 | Bacteria | 1276 |
| 162 | Ga0163162_10081555 | 3300013306 | Bacteria | 3305 |
| 163 | Ga0163162_10268331 | 3300013306 | Bacteria | 1838 |
| 164 | Ga0157372_10350627 | 3300013307 | Bacteria | 1720 |
| 165 | Ga0157372_10484785 | 3300013307 | Bacteria | 1441 |
| 166 | Ga0157375_10144815 | 3300013308 | Bacteria | 2506 |
| 167 | Ga0157375_10682301 | 3300013308 | Bacteria | 1182 |
| 168 | Ga0163163_10013126 | 3300014325 | Bacteria | 7568 |
| 169 | Ga0163163_10036751 | 3300014325 | Bacteria | 4759 |
| 170 | Ga0163163_10193639 | 3300014325 | Bacteria | 2081 |
| 171 | Ga0163163_10475585 | 3300014325 | Bacteria | 1310 |
| 172 | Ga0157376_10064439 | 3300014969 | Bacteria | 3091 |
| 173 | Ga0157376_10577463 | 3300014969 | Bacteria | 1116 |
| 174 | Ga0182007_10047038 | 3300015262 | Bacteria | 1427 |
| 175 | Ga0197907_10378139 | 3300020069 | Bacteria | 2098 |
| 176 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 177 | Ga0214544_1016313 | 3300021320 | Bacteria | 7228 |
| 178 | Ga0214542_1000071 | 3300021321 | Bacteria | 124568 |
| 179 | Ga0214542_1016361 | 3300021321 | Bacteria | 7226 |
| 180 | Ga0214545_1000033 | 3300021324 | Bacteria | 124568 |
| 181 | Ga0214545_1015478 | 3300021324 | Bacteria | 8323 |
| 182 | Ga0214543_1000105 | 3300021327 | Bacteria | 108404 |
| 183 | Ga0214543_1018322 | 3300021327 | Bacteria | 6472 |
| 184 | Ga0213874_10014038 | 3300021377 | Bacteria | 2088 |
| 185 | Ga0213876_10078817 | 3300021384 | Bacteria | 1741 |
| 186 | Ga0213876_10107567 | 3300021384 | Bacteria | 1480 |
| 187 | Ga0213871_10000532 | 3300021441 | Bacteria | 5293 |
| 188 | Ga0224712_10019051 | 3300022467 | Bacteria | 2307 |
| 189 | Ga0228598_1006636 | 3300024227 | Bacteria | 2390 |
| 190 | Ga0207425_1027375 | 3300025245 | Bacteria | 1163 |
| 191 | Ga0209148_1000308 | 3300025254 | Bacteria | 70131 |
| 192 | Ga0209233_1008097 | 3300025261 | Bacteria | 3281 |
| 193 | Ga0209455_1001786 | 3300025272 | Bacteria | 9080 |
| 194 | Ga0209673_1023416 | 3300025273 | Bacteria | 2103 |
| 195 | Ga0209564_1006612 | 3300025295 | Bacteria | 6206 |
| 196 | Ga0209758_1000182 | 3300025297 | Bacteria | 140630 |
| 197 | Ga0209758_1000293 | 3300025297 | Bacteria | 98643 |
| 198 | Ga0209758_1000363 | 3300025297 | Bacteria | 80753 |
| 199 | Ga0209758_1002068 | 3300025297 | Bacteria | 21433 |
| 200 | Ga0209758_1003509 | 3300025297 | Bacteria | 14159 |
| 201 | Ga0209758_1003517 | 3300025297 | Bacteria | 14133 |
| 202 | Ga0209758_1005730 | 3300025297 | Bacteria | 9361 |
| 203 | Ga0209758_1041376 | 3300025297 | Bacteria | 1723 |
| 204 | Ga0209256_1004270 | 3300025299 | Bacteria | 9131 |
| 205 | Ga0207426_1000628 | 3300025302 | Bacteria | 44820 |
| 206 | Ga0207426_1000992 | 3300025302 | Bacteria | 27820 |
| 207 | Ga0207426_1004958 | 3300025302 | Bacteria | 6274 |
| 208 | Ga0207426_1051290 | 3300025302 | Bacteria | 1226 |
| 209 | Ga0209257_1004239 | 3300025304 | Bacteria | 11331 |
| 210 | Ga0207682_10039152 | 3300025893 | Bacteria | 1926 |
| 211 | Ga0207692_10055491 | 3300025898 | Bacteria | 2028 |
| 212 | Ga0207710_10049316 | 3300025900 | Bacteria | 1886 |
| 213 | Ga0207688_10054132 | 3300025901 | Bacteria | 2251 |
| 214 | Ga0207680_10483967 | 3300025903 | Bacteria | 880 |
| 215 | Ga0207647_10025176 | 3300025904 | Bacteria | 3915 |
| 216 | Ga0207647_10071165 | 3300025904 | Bacteria | 2098 |
| 217 | Ga0207699_10006255 | 3300025906 | Bacteria | 5750 |
| 218 | Ga0207699_10060143 | 3300025906 | Bacteria | 2280 |
| 219 | Ga0207705_10120850 | 3300025909 | Bacteria | 1943 |
| 220 | Ga0207684_10036512 | 3300025910 | Bacteria | 4170 |
| 221 | Ga0207684_10710782 | 3300025910 | Bacteria | 853 |
| 222 | Ga0207654_10014572 | 3300025911 | Bacteria | 4063 |
| 223 | Ga0207654_10035456 | 3300025911 | Bacteria | 2780 |
| 224 | Ga0207654_10065304 | 3300025911 | Bacteria | 2142 |
| 225 | Ga0207707_10001497 | 3300025912 | Bacteria | 21565 |
| 226 | Ga0207707_10008114 | 3300025912 | Bacteria | 9117 |
| 227 | Ga0207707_10227578 | 3300025912 | Bacteria | 1623 |
| 228 | Ga0207707_10242364 | 3300025912 | Bacteria | 1567 |
| 229 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 230 | Ga0207695_10075896 | 3300025913 | Bacteria | 3419 |
| 231 | Ga0207695_10302167 | 3300025913 | Bacteria | 1491 |
| 232 | Ga0207671_10004749 | 3300025914 | Bacteria | 12824 |
| 233 | Ga0207671_10039127 | 3300025914 | Bacteria | 3513 |
| 234 | Ga0207671_10082792 | 3300025914 | Bacteria | 2408 |
| 235 | Ga0207671_10212429 | 3300025914 | Bacteria | 1514 |
| 236 | Ga0207693_10009900 | 3300025915 | Bacteria | 7752 |
| 237 | Ga0207693_10010117 | 3300025915 | Bacteria | 7662 |
| 238 | Ga0207693_10027198 | 3300025915 | Bacteria | 4522 |
| 239 | Ga0207693_10208324 | 3300025915 | Bacteria | 1537 |
| 240 | Ga0207693_10297614 | 3300025915 | Bacteria | 1264 |
| 241 | Ga0207663_10099417 | 3300025916 | Bacteria | 1950 |
| 242 | Ga0207663_10230344 | 3300025916 | Bacteria | 1353 |
| 243 | Ga0207663_10295252 | 3300025916 | Bacteria | 1209 |
| 244 | Ga0207663_10406573 | 3300025916 | Bacteria | 1042 |
| 245 | Ga0207660_10005316 | 3300025917 | Bacteria | 8367 |
| 246 | Ga0207660_10010250 | 3300025917 | Bacteria | 6075 |
| 247 | Ga0207660_10086834 | 3300025917 | Bacteria | 2310 |
| 248 | Ga0207662_10025921 | 3300025918 | Bacteria | 3379 |
| 249 | Ga0207657_10015131 | 3300025919 | Bacteria | 7492 |
| 250 | Ga0207657_10108627 | 3300025919 | Bacteria | 2293 |
| 251 | Ga0207652_10001692 | 3300025921 | Bacteria | 19294 |
| 252 | Ga0207652_10010419 | 3300025921 | Bacteria | 7483 |
| 253 | Ga0207652_10020006 | 3300025921 | Bacteria | 5511 |
| 254 | Ga0207652_10036040 | 3300025921 | Bacteria | 4181 |
| 255 | Ga0207652_10174700 | 3300025921 | Bacteria | 1929 |
| 256 | Ga0207646_10193674 | 3300025922 | Bacteria | 1836 |
| 257 | Ga0207694_10105768 | 3300025924 | Bacteria | 2234 |
| 258 | Ga0207694_10111282 | 3300025924 | Bacteria | 2179 |
| 259 | Ga0207694_10276473 | 3300025924 | Bacteria | 1378 |
| 260 | Ga0207694_10290509 | 3300025924 | Bacteria | 1344 |
| 261 | Ga0207659_10146537 | 3300025926 | Bacteria | 1839 |
| 262 | Ga0207687_10008035 | 3300025927 | Bacteria | 6906 |
| 263 | Ga0207687_10078731 | 3300025927 | Bacteria | 2374 |
| 264 | Ga0207700_10069113 | 3300025928 | Bacteria | 2710 |
| 265 | Ga0207644_10023803 | 3300025931 | Bacteria | 4199 |
| 266 | Ga0207686_10183825 | 3300025934 | Bacteria | 1484 |
| 267 | Ga0207686_10239349 | 3300025934 | Bacteria | 1320 |
| 268 | Ga0207709_10023155 | 3300025935 | Bacteria | 3532 |
| 269 | Ga0207709_10348394 | 3300025935 | Bacteria | 1117 |
| 270 | Ga0207670_10012150 | 3300025936 | Bacteria | 5026 |
| 271 | Ga0207665_10180376 | 3300025939 | Bacteria | 1529 |
| 272 | Ga0207665_10206960 | 3300025939 | Bacteria | 1432 |
| 273 | Ga0207691_10099020 | 3300025940 | Bacteria | 2604 |
| 274 | Ga0207711_10076621 | 3300025941 | Bacteria | 2913 |
| 275 | Ga0207689_10110600 | 3300025942 | Bacteria | 2258 |
| 276 | Ga0207689_10114552 | 3300025942 | Bacteria | 2216 |
| 277 | Ga0207661_10000579 | 3300025944 | Bacteria | 23347 |
| 278 | Ga0207661_10002114 | 3300025944 | Bacteria | 13669 |
| 279 | Ga0207661_10009038 | 3300025944 | Bacteria | 7139 |
| 280 | Ga0207661_10193615 | 3300025944 | Bacteria | 1784 |
| 281 | Ga0207667_10003118 | 3300025949 | Bacteria | 20511 |
| 282 | Ga0207667_10235698 | 3300025949 | Bacteria | 1873 |
| 283 | Ga0207651_10111548 | 3300025960 | Bacteria | 2054 |
| 284 | Ga0207640_10134797 | 3300025981 | Bacteria | 1791 |
| 285 | Ga0207640_10369666 | 3300025981 | Bacteria | 1158 |
| 286 | Ga0207677_10008707 | 3300026023 | Bacteria | 5681 |
| 287 | Ga0207703_10038775 | 3300026035 | Bacteria | 3805 |
| 288 | Ga0207639_10009580 | 3300026041 | Bacteria | 6687 |
| 289 | Ga0207639_10269549 | 3300026041 | Bacteria | 1493 |
| 290 | Ga0207639_10493629 | 3300026041 | Bacteria | 1117 |
| 291 | Ga0207639_10536094 | 3300026041 | Bacteria | 1073 |
| 292 | Ga0207639_10852155 | 3300026041 | Bacteria | 851 |
| 293 | Ga0207678_10196358 | 3300026067 | Bacteria | 1725 |
| 294 | Ga0207678_10214204 | 3300026067 | Bacteria | 1648 |
| 295 | Ga0207708_10047301 | 3300026075 | Bacteria | 3275 |
| 296 | Ga0207702_10000350 | 3300026078 | Bacteria | 52867 |
| 297 | Ga0207702_10143796 | 3300026078 | Bacteria | 2161 |
| 298 | Ga0207702_10363389 | 3300026078 | Bacteria | 1388 |
| 299 | Ga0207641_10122834 | 3300026088 | Bacteria | 2320 |
| 300 | Ga0207648_10616534 | 3300026089 | Bacteria | 1001 |
| 301 | Ga0207676_10095607 | 3300026095 | Bacteria | 2450 |
| 302 | Ga0207676_10132387 | 3300026095 | Bacteria | 2122 |
| 303 | Ga0207676_10541246 | 3300026095 | Bacteria | 1111 |
| 304 | Ga0207674_10011007 | 3300026116 | Bacteria | 10173 |
| 305 | Ga0207674_10117504 | 3300026116 | Bacteria | 2630 |
| 306 | Ga0207675_100137407 | 3300026118 | Bacteria | 2320 |
| 307 | Ga0207683_10019572 | 3300026121 | Bacteria | 5781 |
| 308 | Ga0207683_10058673 | 3300026121 | Bacteria | 3379 |
| 309 | Ga0207683_10299206 | 3300026121 | Bacteria | 1472 |
| 310 | Ga0207698_10018469 | 3300026142 | Bacteria | 4752 |
| 311 | Ga0207698_10318921 | 3300026142 | Bacteria | 1454 |
| 312 | Ga0207698_10530778 | 3300026142 | Bacteria | 1150 |
| 313 | Ga0207698_10628096 | 3300026142 | Bacteria | 1062 |
| 314 | Ga0209389_1000208 | 3300027296 | Bacteria | 42287 |
| 315 | Ga0209389_1000217 | 3300027296 | Bacteria | 39758 |
| 316 | Ga0209589_1000032 | 3300027357 | Bacteria | 141881 |
| 317 | Ga0209489_101970 | 3300027361 | Bacteria | 42287 |
| 318 | Ga0209489_102214 | 3300027361 | Bacteria | 39758 |
| 319 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 320 | Ga0209813_10010120 | 3300027866 | Bacteria | 2431 |
| 321 | Ga0268266_10369146 | 3300028379 | Bacteria | 1351 |
| 322 | Ga0268264_10000227 | 3300028381 | Bacteria | 109454 |
| 323 | Ga0265337_1028055 | 3300028556 | Bacteria | 1693 |
| 324 | Ga0265326_10016944 | 3300028558 | Bacteria | 2104 |
| 325 | Ga0265319_1005200 | 3300028563 | Bacteria | 6286 |
| 326 | Ga0265334_10015788 | 3300028573 | Bacteria | 3133 |
| 327 | Ga0265318_10008563 | 3300028577 | Bacteria | 4544 |
| 328 | Ga0265323_10001243 | 3300028653 | Bacteria | 12808 |
| 329 | Ga0265322_10014422 | 3300028654 | Bacteria | 2283 |
| 330 | Ga0265336_10000410 | 3300028666 | Bacteria | 26721 |
| 331 | Ga0265338_10000277 | 3300028800 | Bacteria | 93095 |
| 332 | Ga0265324_10005967 | 3300029957 | Bacteria | 5159 |
| 333 | Ga0265760_10037980 | 3300031090 | Bacteria | 1430 |
| 334 | Ga0265330_10039036 | 3300031235 | Bacteria | 2110 |
| 335 | Ga0265332_10019622 | 3300031238 | Bacteria | 2984 |
| 336 | Ga0265325_10000061 | 3300031241 | Bacteria | 75502 |
| 337 | Ga0265325_10079574 | 3300031241 | Bacteria | 1631 |
| 338 | Ga0265339_10022187 | 3300031249 | Bacteria | 3681 |
| 339 | Ga0265331_10032820 | 3300031250 | Bacteria | 2570 |
| 340 | Ga0265331_10071962 | 3300031250 | Bacteria | 1616 |
| 341 | Ga0265331_10076691 | 3300031250 | Bacteria | 1558 |
| 342 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 343 | Ga0307508_10226053 | 3300031616 | Bacteria | 1471 |
| 344 | Ga0265342_10022741 | 3300031712 | Bacteria | 3981 |
| 345 | Ga0307516_10035775 | 3300031730 | Bacteria | 4978 |
| 346 | Ga0307409_100639120 | 3300031995 | Bacteria | 1056 |
| 347 | Ga0307510_10006388 | 3300033180 | Bacteria | 14055 |
| 348 | Ga0307510_10145934 | 3300033180 | Bacteria | 1998 |
| 349 | Ga0373930_0041962 | 3300034816 | Bacteria | 978 |
| 350 | Ga0373934_0004728 | 3300035086 | Bacteria | 5034 |
| 351 | Ga0373934_0069340 | 3300035086 | Bacteria | 1409 |
| 352 | Ga0373923_0010717 | 3300035111 | Bacteria | 3344 |
| 353 | Ga0373923_0014593 | 3300035111 | Bacteria | 2954 |
| 354 | Ga0373923_0032775 | 3300035111 | Bacteria | 2100 |
| 355 | Ga0373932_0020906 | 3300035112 | Bacteria | 1721 |
| 356 | Ga0373936_0093673 | 3300035113 | Bacteria | 1261 |
| 357 | Ga0373945_0062313 | 3300035116 | Bacteria | 1394 |
| 358 | Ga0373953_0000653 | 3300035117 | Bacteria | 9634 |
| 359 | Ga0373953_0075295 | 3300035117 | Bacteria | 1397 |
| 360 | Ga0373954_0015067 | 3300035118 | Bacteria | 3453 |
| 361 | Ga0373956_0001298 | 3300035119 | Bacteria | 10347 |
| 362 | Ga0373957_0004778 | 3300035120 | Bacteria | 4150 |
| 363 | Ga0373957_0050678 | 3300035120 | Bacteria | 1587 |
| 364 | Ga0373960_0017880 | 3300035121 | Bacteria | 1842 |
| 365 | Ga0373943_0024874 | 3300035170 | Bacteria | 2795 |
| 366 | Ga0373946_0028416 | 3300035171 | Bacteria | 2218 |
| 367 | Ga0373955_0000648 | 3300035172 | Bacteria | 14857 |
| 368 | Ga0373955_0007599 | 3300035172 | Bacteria | 4992 |
| 369 | Ga0373924_0004102 | 3300035410 | Bacteria | 5069 |
| 370 | Ga0373924_0048843 | 3300035410 | Bacteria | 1749 |
| 371 | Ga0373924_0099467 | 3300035410 | Bacteria | 1250 |
| 372 | Ga0373931_0005720 | 3300035691 | Bacteria | 5776 |
| 373 | Ga0373935_0004102 | 3300035692 | Bacteria | 8522 |
| 374 | Ga0373935_0204600 | 3300035692 | Bacteria | 1365 |
| 375 | Ga0373935_0335606 | 3300035692 | Bacteria | 1075 |
| 376 | Ga0373927_0003439 | 3300035695 | Bacteria | 11340 |
| 377 | Ga0373927_0018648 | 3300035695 | Bacteria | 4555 |
| 378 | Ga0373927_0028077 | 3300035695 | Bacteria | 3672 |
| 379 | Ga0373927_0078821 | 3300035695 | Bacteria | 2133 |
| 380 | Ga0373927_0195756 | 3300035695 | Bacteria | 1326 |
| 381 | Ga0373933_0000655 | 3300035724 | Bacteria | 21529 |
| 382 | Ga0373947_0005223 | 3300035725 | Bacteria | 7588 |
| 383 | Ga0373947_0016157 | 3300035725 | Bacteria | 4289 |
| 384 | Ga0373947_0070390 | 3300035725 | Bacteria | 2143 |
| 385 | Ga0373937_0021124 | 3300036401 | Bacteria | 5842 |
| 386 | Ga0373937_0231133 | 3300036401 | Bacteria | 1742 |
| 387 | Ga0373937_0680877 | 3300036401 | Bacteria | 974 |
| 388 | Ga0373925_0003059 | 3300037068 | Bacteria | 13150 |
| 389 | Ga0373925_0022013 | 3300037068 | Bacteria | 4645 |
| 390 | Ga0373925_0168079 | 3300037068 | Bacteria | 1730 |
| 391 | Ga0373925_0247068 | 3300037068 | Bacteria | 1430 |
| 392 | Ga0395899_0080697 | 3300037312 | Bacteria | 2367 |
| 393 | Ga0395899_0134770 | 3300037312 | Bacteria | 1761 |
| 394 | Ga0395900_0001316 | 3300037418 | Bacteria | 30150 |
| 395 | Ga0395900_0166608 | 3300037418 | Bacteria | 2245 |
| 396 | Ga0395900_0314598 | 3300037418 | Bacteria | 1548 |
| 397 | Ga0395898_0010275 | 3300037466 | Bacteria | 9797 |
| 398 | Ga0395898_0261031 | 3300037466 | Bacteria | 1652 |
| 399 | Ga0395905_0019550 | 3300037471 | Bacteria | 6419 |
| 400 | Ga0395905_0060353 | 3300037471 | Bacteria | 3546 |
| 401 | Ga0395905_0417953 | 3300037471 | Bacteria | 1237 |
| 402 | Ga0395905_0539360 | 3300037471 | Bacteria | 1067 |
| 403 | Ga0436364_1211788 | 3300037853 | Bacteria | 1106 |
| 404 | Ga0395901_0002762 | 3300038443 | Bacteria | 17695 |
| 405 | Ga0395901_0256059 | 3300038443 | Bacteria | 1823 |
| 406 | Ga0395901_0516788 | 3300038443 | Bacteria | 1214 |
| 407 | Ga0436365_0478600 | 3300039437 | Bacteria | 4835 |
| 408 | Ga0436365_0766912 | 3300039437 | Bacteria | 1919 |
| 409 | Ga0436365_1108887 | 3300039437 | Bacteria | 1837 |
| 410 | Ga0436365_1246013 | 3300039437 | Bacteria | 3666 |
| 411 | Ga0436365_1695882 | 3300039437 | Bacteria | 3026 |
| 412 | Ga0436365_1830473 | 3300039437 | Bacteria | 2714 |
| 413 | Ga0436360_0784628 | 3300039438 | Bacteria | 1889 |
| 414 | Ga0436361_0734729 | 3300039447 | Bacteria | 2078 |
| 415 | Ga0436363_0071431 | 3300039450 | Bacteria | 2133 |
| 416 | Ga0436363_0532985 | 3300039450 | Bacteria | 7779 |
| 417 | Ga0436362_0566318 | 3300039453 | Bacteria | 1572 |
| 418 | Ga0439453_0006071 | 3300041408 | Bacteria | 1866 |
| 419 | Ga0451793_0431397 | 3300041452 | Bacteria | 1029 |
| 420 | Ga0451800_0533584 | 3300041459 | Bacteria | 1059 |
| 421 | Ga0451847_0528921 | 3300041503 | Bacteria | 851 |
| 422 | Ga0450923_022894 | 3300042125 | Bacteria | 1228 |
| 423 | Ga0466969_0030926 | 3300044656 | Bacteria | 2726 |
| 424 | Ga0466972_0000233 | 3300044658 | Bacteria | 38493 |
| 425 | Ga0466965_0080097 | 3300044683 | Bacteria | 1650 |
| 426 | Ga0466965_0208720 | 3300044683 | Bacteria | 1038 |
| 427 | Ga0466966_0002503 | 3300044684 | Bacteria | 12045 |
| 428 | Ga0466961_0003092 | 3300044693 | Bacteria | 10344 |
| 429 | Ga0466963_0026147 | 3300044694 | Bacteria | 3731 |
| 430 | Ga0466963_0167611 | 3300044694 | Bacteria | 1530 |
| 431 | Ga0466964_0099624 | 3300044706 | Bacteria | 1279 |
| 432 | Ga0466968_0003054 | 3300044735 | Bacteria | 6190 |
| 433 | Ga0466970_0043302 | 3300044765 | Bacteria | 2395 |
| 434 | Ga0466957_0023758 | 3300044842 | Bacteria | 3626 |
| 435 | Ga0466957_0122872 | 3300044842 | Bacteria | 1656 |
| 436 | Ga0466960_0141135 | 3300044901 | Bacteria | 1280 |
| 437 | Ga0466959_0002845 | 3300045049 | Bacteria | 11154 |
| 438 | Ga0466959_0178884 | 3300045049 | Bacteria | 1484 |
| 439 | Ga0466958_0042367 | 3300045836 | Bacteria | 2741 |
| 440 | Ga0466967_0073867 | 3300045976 | Bacteria | 3060 |
| 441 | Ga0466967_0230673 | 3300045976 | Bacteria | 1762 |
| 442 | Ga0466967_0236391 | 3300045976 | Bacteria | 1741 |
| 443 | Ga0466967_0286657 | 3300045976 | Bacteria | 1581 |
| 444 | Ga0495592_0000614 | 3300046454 | Bacteria | 25241 |
| 445 | Ga0495592_0008192 | 3300046454 | Bacteria | 7850 |
| 446 | Ga0495592_0038952 | 3300046454 | Bacteria | 3573 |
| 447 | Ga0495592_0079136 | 3300046454 | Bacteria | 2379 |
| 448 | Ga0495603_0000048 | 3300046455 | Bacteria | 51928 |
| 449 | Ga0495629_0000849 | 3300046459 | Bacteria | 24681 |
| 450 | Ga0495629_0001230 | 3300046459 | Bacteria | 20107 |
| 451 | Ga0495629_0008274 | 3300046459 | Bacteria | 7648 |
| 452 | Ga0495629_0061767 | 3300046459 | Bacteria | 2618 |
| 453 | Ga0495638_0002713 | 3300046460 | Bacteria | 14241 |
| 454 | Ga0495641_0001887 | 3300046461 | Bacteria | 17166 |
| 455 | Ga0495651_0001002 | 3300046462 | Bacteria | 21924 |
| 456 | Ga0495651_0030344 | 3300046462 | Bacteria | 4216 |
| 457 | Ga0495651_0322730 | 3300046462 | Bacteria | 1029 |
| 458 | Ga0495651_0401786 | 3300046462 | Bacteria | 894 |
| 459 | Ga0495653_0015208 | 3300046463 | Bacteria | 6272 |
| 460 | Ga0495653_0036319 | 3300046463 | Bacteria | 3882 |
| 461 | Ga0495653_0074237 | 3300046463 | Bacteria | 2535 |
| 462 | Ga0495653_0092087 | 3300046463 | Bacteria | 2214 |
| 463 | Ga0495650_0058010 | 3300046471 | Bacteria | 1565 |
| 464 | Ga0495580_0000084 | 3300046472 | Bacteria | 60217 |
| 465 | Ga0495580_0006567 | 3300046472 | Bacteria | 9456 |
| 466 | Ga0495580_0348048 | 3300046472 | Bacteria | 1004 |
| 467 | Ga0495580_0368426 | 3300046472 | Bacteria | 972 |
| 468 | Ga0495582_0002918 | 3300046473 | Bacteria | 9560 |
| 469 | Ga0495582_0013677 | 3300046473 | Bacteria | 4467 |
| 470 | Ga0495639_0000009 | 3300046475 | Bacteria | 94240 |
| 471 | Ga0495639_0023943 | 3300046475 | Bacteria | 2685 |
| 472 | Ga0495662_0004398 | 3300046476 | Bacteria | 7075 |
| 473 | Ga0495662_0117605 | 3300046476 | Bacteria | 1304 |
| 474 | Ga0495664_0010080 | 3300046477 | Bacteria | 5301 |
| 475 | Ga0495664_0040457 | 3300046477 | Bacteria | 2757 |
| 476 | Ga0495664_0178097 | 3300046477 | Bacteria | 1289 |
| 477 | Ga0495584_0221532 | 3300046491 | Bacteria | 962 |
| 478 | Ga0495594_0000603 | 3300046499 | Bacteria | 18524 |
| 479 | Ga0495594_0084913 | 3300046499 | Bacteria | 1771 |
| 480 | Ga0495606_0032899 | 3300046507 | Bacteria | 3585 |
| 481 | Ga0495608_0001026 | 3300046511 | Bacteria | 19595 |
| 482 | Ga0495620_0060542 | 3300046515 | Bacteria | 1578 |
| 483 | Ga0495628_0002528 | 3300046516 | Bacteria | 16449 |
| 484 | Ga0495628_0042727 | 3300046516 | Bacteria | 3614 |
| 485 | Ga0495628_0044189 | 3300046516 | Bacteria | 3546 |
| 486 | Ga0495628_0048772 | 3300046516 | Bacteria | 3355 |
| 487 | Ga0495628_0158703 | 3300046516 | Bacteria | 1719 |
| 488 | Ga0495630_0025806 | 3300046517 | Bacteria | 4346 |
| 489 | Ga0495630_0033567 | 3300046517 | Bacteria | 3828 |
| 490 | Ga0495643_0109135 | 3300046522 | Bacteria | 1408 |
| 491 | Ga0495648_0001769 | 3300046524 | Bacteria | 20843 |
| 492 | Ga0495648_0016435 | 3300046524 | Bacteria | 5337 |
| 493 | Ga0495666_0036789 | 3300046526 | Bacteria | 2383 |
| 494 | Ga0495666_0101122 | 3300046526 | Bacteria | 1358 |
| 495 | Ga0495652_0020043 | 3300046529 | Bacteria | 5948 |
| 496 | Ga0495652_0023863 | 3300046529 | Bacteria | 5418 |
| 497 | Ga0495652_0129656 | 3300046529 | Bacteria | 1998 |
| 498 | Ga0495652_0393116 | 3300046529 | Bacteria | 983 |
| 499 | Ga0495665_0016436 | 3300046531 | Bacteria | 3987 |
| 500 | Ga0495665_0039184 | 3300046531 | Bacteria | 2524 |
| 501 | Ga0495640_0006145 | 3300046533 | Bacteria | 9520 |
| 502 | Ga0495640_0013322 | 3300046533 | Bacteria | 6249 |
| 503 | Ga0495640_0017715 | 3300046533 | Bacteria | 5300 |
| 504 | Ga0495640_0043150 | 3300046533 | Bacteria | 3142 |
| 505 | Ga0495640_0330461 | 3300046533 | Bacteria | 943 |
| 506 | Ga0495586_0036735 | 3300046535 | Bacteria | 2630 |
| 507 | Ga0495587_0005697 | 3300046536 | Bacteria | 8116 |
| 508 | Ga0495587_0015864 | 3300046536 | Bacteria | 4694 |
| 509 | Ga0495587_0164813 | 3300046536 | Bacteria | 1260 |
| 510 | Ga0495597_0082949 | 3300046542 | Bacteria | 1369 |
| 511 | Ga0495645_0016024 | 3300046543 | Bacteria | 5343 |
| 512 | Ga0495645_0017296 | 3300046543 | Bacteria | 5164 |
| 513 | Ga0495645_0132541 | 3300046543 | Bacteria | 1745 |
| 514 | Ga0495645_0171734 | 3300046543 | Bacteria | 1492 |
| 515 | Ga0495622_0000771 | 3300046557 | Bacteria | 17886 |
| 516 | Ga0495667_0001358 | 3300046559 | Bacteria | 16077 |
| 517 | Ga0495667_0100245 | 3300046559 | Bacteria | 1874 |
| 518 | Ga0495667_0128869 | 3300046559 | Bacteria | 1632 |
| 519 | Ga0495634_0001541 | 3300046642 | Bacteria | 20331 |
| 520 | Ga0495634_0038726 | 3300046642 | Bacteria | 3249 |
| 521 | Ga0495634_0071770 | 3300046642 | Bacteria | 2278 |
| 522 | Ga0495634_0099512 | 3300046642 | Bacteria | 1880 |
| 523 | Ga0495634_0103258 | 3300046642 | Bacteria | 1840 |
| 524 | Ga0495634_0167516 | 3300046642 | Bacteria | 1382 |
| 525 | Ga0495635_0000119 | 3300046663 | Bacteria | 47408 |
| 526 | Ga0495635_0000809 | 3300046663 | Bacteria | 20486 |
| 527 | Ga0495635_0220597 | 3300046663 | Bacteria | 1282 |
| 528 | Ga0495657_0006732 | 3300046675 | Bacteria | 8961 |
| 529 | Ga0495657_0009585 | 3300046675 | Bacteria | 7335 |
| 530 | Ga0495657_0012863 | 3300046675 | Bacteria | 6200 |
| 531 | Ga0495599_0000513 | 3300046678 | Bacteria | 22163 |
| 532 | Ga0495599_0099618 | 3300046678 | Bacteria | 1811 |
| 533 | Ga0495599_0248148 | 3300046678 | Bacteria | 1084 |
| 534 | Ga0495623_0009766 | 3300046679 | Bacteria | 6224 |
| 535 | Ga0495623_0011049 | 3300046679 | Bacteria | 5841 |
| 536 | Ga0495623_0022025 | 3300046679 | Bacteria | 4116 |
| 537 | Ga0495646_0001869 | 3300046680 | Bacteria | 12662 |
| 538 | Ga0495646_0054721 | 3300046680 | Bacteria | 2399 |
| 539 | Ga0495646_0056971 | 3300046680 | Bacteria | 2341 |
| 540 | Ga0495646_0074070 | 3300046680 | Bacteria | 1999 |
| 541 | Ga0495658_0000420 | 3300046683 | Bacteria | 23768 |
| 542 | Ga0495658_0009910 | 3300046683 | Bacteria | 4753 |
| 543 | Ga0495613_0001484 | 3300046689 | Bacteria | 17888 |
| 544 | Ga0495613_0153011 | 3300046689 | Bacteria | 1644 |
| 545 | Ga0495624_0003095 | 3300046690 | Bacteria | 12447 |
| 546 | Ga0495649_0002747 | 3300046694 | Bacteria | 12249 |
| 547 | Ga0495649_0115963 | 3300046694 | Bacteria | 1418 |
| 548 | Ga0495600_0004615 | 3300046809 | Bacteria | 8256 |
| 549 | Ga0495600_0004930 | 3300046809 | Bacteria | 8013 |
| 550 | Ga0495600_0021201 | 3300046809 | Bacteria | 4160 |
| 551 | Ga0495600_0104968 | 3300046809 | Bacteria | 1841 |
| 552 | Ga0495581_0000103 | 3300047315 | Bacteria | 35265 |
| 553 | Ga0495581_0007321 | 3300047315 | Bacteria | 6387 |
| 554 | Ga0495581_0193376 | 3300047315 | Bacteria | 1190 |
| 555 | Ga0495604_0010711 | 3300047317 | Bacteria | 7277 |
| 556 | Ga0495604_0020575 | 3300047317 | Bacteria | 5269 |
| 557 | Ga0495604_0022153 | 3300047317 | Bacteria | 5071 |
| 558 | Ga0495604_0223845 | 3300047317 | Bacteria | 1294 |
| 559 | Ga0495674_0000367 | 3300047319 | Bacteria | 40173 |
| 560 | Ga0495674_0011448 | 3300047319 | Bacteria | 8369 |
| 561 | Ga0495674_0028981 | 3300047319 | Bacteria | 5043 |
| 562 | Ga0495674_0093154 | 3300047319 | Bacteria | 2571 |
| 563 | Ga0495674_0098456 | 3300047319 | Bacteria | 2490 |
| 564 | Ga0495674_0325532 | 3300047319 | Bacteria | 1251 |
| 565 | Ga0495672_0037918 | 3300047320 | Bacteria | 2945 |
| 566 | Ga0495676_0344750 | 3300047321 | Bacteria | 997 |
| 567 | Ga0495676_0387975 | 3300047321 | Bacteria | 928 |
| 568 | Ga0495680_0002243 | 3300047322 | Bacteria | 19932 |
| 569 | Ga0495680_0012531 | 3300047322 | Bacteria | 7457 |
| 570 | Ga0495687_110629 | 3300047443 | Bacteria | 1010 |
| 571 | Ga0495675_0000978 | 3300047444 | Bacteria | 17349 |
| 572 | Ga0495675_0014791 | 3300047444 | Bacteria | 4934 |
| 573 | Ga0495677_0083420 | 3300047445 | Bacteria | 1200 |
| 574 | Ga0495673_0017078 | 3300047469 | Bacteria | 3695 |
| 575 | Ga0495684_0000081 | 3300047471 | Bacteria | 65985 |
| 576 | Ga0495684_0021483 | 3300047471 | Bacteria | 4970 |
| 577 | Ga0495684_0110828 | 3300047471 | Bacteria | 2071 |
| 578 | Ga0495684_0160475 | 3300047471 | Bacteria | 1677 |
| 579 | Ga0495686_0053018 | 3300047472 | Bacteria | 2542 |
| 580 | Ga0495593_0000134 | 3300047673 | Bacteria | 35634 |
| 581 | Ga0495593_0006901 | 3300047673 | Bacteria | 6650 |
| 582 | Ga0495593_0017419 | 3300047673 | Bacteria | 4044 |
| 583 | Ga0495593_0054985 | 3300047673 | Bacteria | 2097 |
| 584 | Ga0495602_0002985 | 3300048088 | Bacteria | 17343 |
| 585 | Ga0495602_0015795 | 3300048088 | Bacteria | 7604 |
| 586 | Ga0495602_0021964 | 3300048088 | Bacteria | 6258 |
| 587 | Ga0495614_0051930 | 3300048089 | Bacteria | 1757 |
| 588 | Ga0495626_0064666 | 3300048091 | Bacteria | 1657 |
| 589 | Ga0496100_0076046 | 3300048903 | Bacteria | 2254 |
| 590 | Ga0496100_0088745 | 3300048903 | Bacteria | 2105 |
| 591 | Ga0496100_0139127 | 3300048903 | Bacteria | 1718 |
| 592 | Ga0496100_0284854 | 3300048903 | Bacteria | 1233 |
| 593 | Ga0496101_0036649 | 3300048904 | Bacteria | 3474 |
| 594 | Ga0496101_0070038 | 3300048904 | Bacteria | 2567 |
| 595 | Ga0496101_0074061 | 3300048904 | Bacteria | 2503 |
| 596 | Ga0496101_0107324 | 3300048904 | Bacteria | 2097 |
| 597 | Ga0496101_0120096 | 3300048904 | Bacteria | 1986 |
| 598 | Ga0496101_0332696 | 3300048904 | Bacteria | 1192 |
| 599 | Ga0496102_0061667 | 3300048905 | Bacteria | 3432 |
| 600 | Ga0496102_0172121 | 3300048905 | Bacteria | 2038 |
| 601 | Ga0496102_0181350 | 3300048905 | Bacteria | 1984 |
| 602 | Ga0496103_0009458 | 3300048906 | Bacteria | 5770 |
| 603 | Ga0496103_0072886 | 3300048906 | Bacteria | 2151 |
| 604 | Ga0496104_0020661 | 3300048907 | Bacteria | 6039 |
| 605 | Ga0496104_0023555 | 3300048907 | Bacteria | 5661 |
| 606 | Ga0496104_0170732 | 3300048907 | Bacteria | 2085 |
| 607 | Ga0496104_0187611 | 3300048907 | Bacteria | 1978 |
| 608 | Ga0496104_0191155 | 3300048907 | Bacteria | 1958 |
| 609 | Ga0496104_0295438 | 3300048907 | Bacteria | 1533 |
| 610 | Ga0496105_0009535 | 3300048908 | Bacteria | 7597 |
| 611 | Ga0496105_0073846 | 3300048908 | Bacteria | 2817 |
| 612 | Ga0496105_0248252 | 3300048908 | Bacteria | 1442 |
| 613 | Ga0496106_0001576 | 3300048909 | Bacteria | 17151 |
| 614 | Ga0496106_0007942 | 3300048909 | Bacteria | 7839 |
| 615 | Ga0496106_0014219 | 3300048909 | Bacteria | 5878 |
| 616 | Ga0496106_0108285 | 3300048909 | Bacteria | 2161 |
| 617 | Ga0496107_0003437 | 3300048910 | Bacteria | 10586 |
| 618 | Ga0496107_0012956 | 3300048910 | Bacteria | 5827 |
| 619 | Ga0496108_0000803 | 3300048911 | Bacteria | 24388 |
| 620 | Ga0496108_0035470 | 3300048911 | Bacteria | 4146 |
| 621 | Ga0496108_0059942 | 3300048911 | Bacteria | 3201 |
| 622 | Ga0496108_0082787 | 3300048911 | Bacteria | 2721 |
| 623 | Ga0496109_0017599 | 3300048912 | Bacteria | 6268 |
| 624 | Ga0496109_0035686 | 3300048912 | Bacteria | 4487 |
| 625 | Ga0496109_0180998 | 3300048912 | Bacteria | 1980 |
| 626 | Ga0496109_0207305 | 3300048912 | Bacteria | 1843 |
| 627 | Ga0496110_0033090 | 3300048913 | Bacteria | 4470 |
| 628 | Ga0496110_0035078 | 3300048913 | Bacteria | 4349 |
| 629 | Ga0496111_0034758 | 3300048914 | Bacteria | 3600 |
| 630 | Ga0496111_0081365 | 3300048914 | Bacteria | 2364 |
| 631 | Ga0496112_0002678 | 3300048915 | Bacteria | 14403 |
| 632 | Ga0496112_0031886 | 3300048915 | Bacteria | 5114 |
| 633 | Ga0496112_0041336 | 3300048915 | Bacteria | 4511 |
| 634 | Ga0496112_0059955 | 3300048915 | Bacteria | 3750 |
| 635 | Ga0496112_0065372 | 3300048915 | Bacteria | 3589 |
| 636 | Ga0496112_0084420 | 3300048915 | Bacteria | 3141 |
| 637 | Ga0496112_0122679 | 3300048915 | Bacteria | 2569 |
| 638 | Ga0496112_0174083 | 3300048915 | Bacteria | 2117 |
| 639 | Ga0496112_0276693 | 3300048915 | Bacteria | 1626 |
| 640 | Ga0496112_0403036 | 3300048915 | Bacteria | 1307 |
| 641 | Ga0496113_0006745 | 3300048916 | Bacteria | 7318 |
| 642 | Ga0496113_0030431 | 3300048916 | Bacteria | 3908 |
| 643 | Ga0496113_0076620 | 3300048916 | Bacteria | 2555 |
| 644 | Ga0496113_0333899 | 3300048916 | Bacteria | 1215 |
| 645 | Ga0496113_0417594 | 3300048916 | Bacteria | 1077 |
| 646 | Ga0496114_0122685 | 3300048917 | Bacteria | 2236 |
| 647 | Ga0496115_0030558 | 3300048918 | Bacteria | 4238 |
| 648 | Ga0496115_0034886 | 3300048918 | Bacteria | 3976 |
| 649 | Ga0496115_0051161 | 3300048918 | Bacteria | 3312 |
| 650 | Ga0496115_0073670 | 3300048918 | Bacteria | 2772 |
| 651 | Ga0496115_0078638 | 3300048918 | Bacteria | 2683 |
| 652 | Ga0496115_0087988 | 3300048918 | Bacteria | 2535 |
| 653 | Ga0496115_0132941 | 3300048918 | Bacteria | 2051 |
| 654 | Ga0496115_0185976 | 3300048918 | Bacteria | 1717 |
| 655 | Ga0496115_0256936 | 3300048918 | Bacteria | 1437 |
| 656 | Ga0496115_0376093 | 3300048918 | Bacteria | 1156 |
| 657 | Ga0496116_0010704 | 3300048919 | Bacteria | 7658 |
| 658 | Ga0496118_0091668 | 3300048921 | Bacteria | 2089 |
| 659 | Ga0496118_0099405 | 3300048921 | Bacteria | 1972 |
| 660 | Ga0496119_0008410 | 3300048922 | Bacteria | 9066 |
| 661 | Ga0496121_0000786 | 3300048924 | Bacteria | 57998 |
| 662 | Ga0496121_0027631 | 3300048924 | Bacteria | 5305 |
| 663 | Ga0496121_0048983 | 3300048924 | Bacteria | 3588 |
| 664 | Ga0496122_0024213 | 3300048925 | Bacteria | 5319 |
| 665 | Ga0496122_0177556 | 3300048925 | Bacteria | 1275 |
| 666 | Ga0496124_0128793 | 3300048927 | Bacteria | 2013 |
| 667 | Ga0496125_0016759 | 3300048928 | Bacteria | 7025 |
| 668 | Ga0496125_0120442 | 3300048928 | Bacteria | 1873 |
| 669 | Ga0496126_0003797 | 3300048929 | Bacteria | 18757 |
| 670 | Ga0496126_0008016 | 3300048929 | Bacteria | 11461 |
| 671 | Ga0496126_0088722 | 3300048929 | Bacteria | 2723 |
| 672 | Ga0496126_0130468 | 3300048929 | Bacteria | 2172 |
| 673 | Ga0501032_0000011 | 3300049569 | Bacteria | 198158 |
| 674 | Ga0501032_0006585 | 3300049569 | Bacteria | 8527 |
| 675 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 676 | Ga0501034_0080206 | 3300049571 | Bacteria | 3267 |
| 677 | Ga0501034_0284372 | 3300049571 | Bacteria | 1593 |
| 678 | Ga0501039_0000243 | 3300049575 | Bacteria | 39697 |
| 679 | Ga0501046_0163524 | 3300049580 | Bacteria | 1673 |
| 680 | Ga0501047_0024350 | 3300049581 | Bacteria | 5811 |
| 681 | Ga0501067_0021642 | 3300049583 | Bacteria | 3558 |
| 682 | Ga0501069_0025177 | 3300049585 | Bacteria | 3250 |
| 683 | Ga0501070_0354137 | 3300049586 | Bacteria | 1191 |
| 684 | Ga0501072_0137362 | 3300049588 | Bacteria | 1949 |
| 685 | Ga0501073_0320723 | 3300049589 | Bacteria | 1069 |
| 686 | Ga0501074_0029125 | 3300049590 | Bacteria | 4000 |
| 687 | Ga0501076_0460983 | 3300049592 | Bacteria | 1047 |
| 688 | Ga0501080_0085994 | 3300049742 | Bacteria | 2921 |
| 689 | Ga0501083_0187680 | 3300049744 | Bacteria | 1349 |
| 690 | Ga0501083_0212691 | 3300049744 | Bacteria | 1260 |
| 691 | nmdc:mga03n38_51196_c1 | 3300050490 | Bacteria | 1843 |
| 692 | nmdc:mga03n38_6973_c1 | 3300050490 | Bacteria | 3969 |
| 693 | nmdc:mga00v17_247168_c1 | 3300050491 | Bacteria | 1157 |
| 694 | nmdc:mga0yw44_264557_c1 | 3300050492 | Bacteria | 1147 |
| 695 | nmdc:mga0k408_10614_c1 | 3300050493 | Bacteria | 4987 |
| 696 | nmdc:mga0k408_68103_c1 | 3300050493 | Bacteria | 2076 |
| 697 | nmdc:mga06z11_161856_c1 | 3300050494 | Bacteria | 1280 |
| 698 | nmdc:mga06z11_275423_c1 | 3300050494 | Bacteria | 996 |
| 699 | nmdc:mga07m45_157538_c1 | 3300050496 | Bacteria | 1318 |
| 700 | nmdc:mga07m45_274344_c1 | 3300050496 | Bacteria | 981 |
| 701 | nmdc:mga05p37_736569_c1 | 3300050507 | Bacteria | 1089 |
| 702 | nmdc:mga08y16_56695_c1 | 3300050511 | Bacteria | 4094 |
| 703 | nmdc:mga08y16_891197_c1 | 3300050511 | Bacteria | 876 |
| 704 | nmdc:mga0n895_37552_c1 | 3300050512 | Bacteria | 4687 |
| 705 | nmdc:mga0rr50_125176_c1 | 3300050513 | Bacteria | 2051 |
| 706 | nmdc:mga0sz30_20473_c1 | 3300050516 | Bacteria | 2669 |
| 707 | Ga0495601_0004544 | 3300053077 | Bacteria | 8018 |
| 708 | Ga0495601_0122151 | 3300053077 | Bacteria | 1692 |
| 709 | Ga0495601_0244302 | 3300053077 | Bacteria | 1172 |
| 710 | Ga0495612_0108920 | 3300053078 | Bacteria | 1184 |
| 711 | Ga0500610_0194633 | 3300053079 | Bacteria | 982 |
| 712 | Ga0495595_0000924 | 3300053084 | Bacteria | 11325 |
| 713 | Ga0495595_0060631 | 3300053084 | Bacteria | 1771 |
| 714 | Ga0495619_0000761 | 3300053085 | Bacteria | 21031 |
| 715 | Ga0495619_0045971 | 3300053085 | Bacteria | 2869 |
| 716 | Ga0495619_0058480 | 3300053085 | Bacteria | 2559 |
| 717 | Ga0495619_0174706 | 3300053085 | Bacteria | 1486 |
| 718 | Ga0500643_000049 | 3300053087 | Bacteria | 147107 |
| 719 | Ga0500647_0011817 | 3300053091 | Bacteria | 3913 |
| 720 | Ga0500583_0053404 | 3300053092 | Bacteria | 1883 |
| 721 | Ga0500566_0000054 | 3300053094 | Bacteria | 54975 |
| 722 | Ga0500566_0002813 | 3300053094 | Bacteria | 10360 |
| 723 | Ga0500566_0204817 | 3300053094 | Bacteria | 993 |
| 724 | Ga0500640_124748 | 3300053095 | Bacteria | 1025 |
| 725 | Ga0500641_0023389 | 3300053096 | Bacteria | 2376 |
| 726 | Ga0500556_0013425 | 3300053104 | Bacteria | 2479 |
| 727 | Ga0500556_0051714 | 3300053104 | Bacteria | 1489 |
| 728 | Ga0500556_0127844 | 3300053104 | Bacteria | 994 |
| 729 | Ga0500557_000118 | 3300053105 | Bacteria | 22375 |
| 730 | Ga0500569_103259 | 3300053109 | Bacteria | 936 |
| 731 | Ga0500572_030574 | 3300053111 | Bacteria | 1498 |
| 732 | Ga0500592_013606 | 3300053116 | Bacteria | 1305 |
| 733 | Ga0500595_008077 | 3300053119 | Bacteria | 4318 |
| 734 | Ga0500595_014837 | 3300053119 | Bacteria | 2944 |
| 735 | Ga0500595_021175 | 3300053119 | Bacteria | 2325 |
| 736 | Ga0500595_056431 | 3300053119 | Bacteria | 1200 |
| 737 | Ga0500607_049118 | 3300053121 | Bacteria | 2252 |
| 738 | Ga0500614_022081 | 3300053123 | Bacteria | 1482 |
| 739 | Ga0500642_0000164 | 3300053130 | Bacteria | 27497 |
| 740 | Ga0500642_0030702 | 3300053130 | Bacteria | 2238 |
| 741 | Ga0500642_0093164 | 3300053130 | Bacteria | 1394 |
| 742 | Ga0500559_0014505 | 3300053136 | Bacteria | 3330 |
| 743 | Ga0500559_0020595 | 3300053136 | Bacteria | 2789 |
| 744 | Ga0500559_0038988 | 3300053136 | Bacteria | 2065 |
| 745 | Ga0500568_0014981 | 3300053139 | Bacteria | 3480 |
| 746 | Ga0500616_0011794 | 3300053153 | Bacteria | 5142 |
| 747 | Ga0500620_009505 | 3300053155 | Bacteria | 2513 |
| 748 | Ga0500638_004886 | 3300053162 | Bacteria | 5255 |
| 749 | Ga0500639_005653 | 3300053163 | Bacteria | 6412 |
| 750 | Ga0500639_158143 | 3300053163 | Bacteria | 1035 |
| 751 | Ga0500636_0068534 | 3300053177 | Bacteria | 2060 |
| 752 | Ga0500636_0131471 | 3300053177 | Bacteria | 1393 |
| 753 | Ga0500625_022233 | 3300053729 | Bacteria | 2994 |
| 754 | Ga0500596_001677 | 3300053735 | Bacteria | 4480 |
| 755 | Ga0500596_013825 | 3300053735 | Bacteria | 1216 |
| 756 | Ga0500601_012623 | 3300053737 | Bacteria | 954 |
| 757 | Ga0501084_0274526 | 3300054114 | Bacteria | 1423 |
| 758 | Ga0501084_0541863 | 3300054114 | Bacteria | 983 |
| 759 | Ga0500661_008628 | 3300055283 | Bacteria | 1875 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10029625 | Ga0070658_100296251 | 236 |
| 2 | 3300005530 | Ga0070679_100054647 | Ga0070679_1000546472 | 236 |
| 3 | 3300005530 | Ga0070679_100337085 | Ga0070679_1003370851 | 236 |
| 4 | 3300025921 | Ga0207652_10036040 | Ga0207652_100360402 | 236 |
| 5 | 3300044683 | Ga0466965_0080097 | Ga0466965_0080097_906_1634 | 241 |
| 6 | 3300044901 | Ga0466960_0141135 | Ga0466960_0141135_26_754 | 241 |
| 7 | 3300053136 | Ga0500559_0014505 | Ga0500559_0014505_26_754 | 241 |
| 8 | 3300025919 | Ga0207657_10108627 | Ga0207657_101086271 | 247 |
| 9 | iso_pu_bacteria | 8019608314 | 8019612278 | 248 |
| 10 | iso_pu_bacteria | 8019586578 | 8019595511 | 249 |
| 11 | 3300046526 | Ga0495666_0101122 | Ga0495666_0101122_580_1344 | 253 |
| 12 | 3300037312 | Ga0395899_0080697 | Ga0395899_0080697_1148_1939 | 255 |
| 13 | 3300037312 | Ga0395899_0134770 | Ga0395899_0134770_434_1225 | 255 |
| 14 | 3300037471 | Ga0395905_0539360 | Ga0395905_0539360_114_905 | 255 |
| 15 | 3300006163 | Ga0070715_10188242 | Ga0070715_101882422 | 256 |
| 16 | 3300044684 | Ga0466966_0002503 | Ga0466966_0002503_11183_11953 | 256 |
| 17 | iso_pu_bacteria | 8016511872 | 8016518371 | 256 |
| 18 | iso_pu_bacteria | 2508501009 | 2508539020 | 257 |
| 19 | iso_pu_bacteria | 2513237095 | 2513647741 | 257 |
| 20 | iso_pu_bacteria | 2513237098 | 2513677545 | 257 |
| 21 | iso_pu_bacteria | 2816332527 | 2818237504 | 257 |
| 22 | iso_pu_bacteria | 2824600985 | 2824608249 | 257 |
| 23 | iso_pu_bacteria | 2824609381 | 2824612177 | 257 |
| 24 | iso_pu_bacteria | 2824653114 | 2824655566 | 257 |
| 25 | iso_pu_bacteria | 2824661429 | 2824668988 | 257 |
| 26 | iso_pu_bacteria | 2824696289 | 2824701034 | 257 |
| 27 | iso_pu_bacteria | 2824704595 | 2824711025 | 257 |
| 28 | iso_pu_bacteria | 2824714736 | 2824718274 | 257 |
| 29 | iso_pu_bacteria | 2824732956 | 2824736205 | 257 |
| 30 | iso_pu_bacteria | 2824746037 | 2824751360 | 257 |
| 31 | iso_pu_bacteria | 2824753945 | 2824760397 | 257 |
| 32 | iso_pu_bacteria | 2824763712 | 2824770847 | 257 |
| 33 | iso_pu_bacteria | 2824773399 | 2824775673 | 257 |
| 34 | iso_pu_bacteria | 2838122688 | 2838124349 | 257 |
| 35 | iso_pu_bacteria | 2841941048 | 2841945042 | 257 |
| 36 | iso_pu_bacteria | 2841949485 | 2841951828 | 257 |
| 37 | iso_pu_bacteria | 2841966195 | 2841973796 | 257 |
| 38 | iso_pu_bacteria | 2841974524 | 2841980122 | 257 |
| 39 | iso_pu_bacteria | 2841983080 | 2841985305 | 257 |
| 40 | iso_pu_bacteria | 2842038055 | 2842043655 | 257 |
| 41 | iso_pu_bacteria | 2842045827 | 2842052355 | 257 |
| 42 | iso_pu_bacteria | 2847939898 | 2847941982 | 257 |
| 43 | iso_pu_bacteria | 2857509624 | 2857511777 | 257 |
| 44 | iso_pu_bacteria | 2874590934 | 2874597084 | 257 |
| 45 | iso_pu_bacteria | 2874612657 | 2874616678 | 257 |
| 46 | iso_pu_bacteria | 2874620515 | 2874624635 | 257 |
| 47 | iso_pu_bacteria | 2874628541 | 2874628965 | 257 |
| 48 | iso_pu_bacteria | 2874645413 | 2874648068 | 257 |
| 49 | iso_pu_bacteria | 2876771140 | 2876777548 | 257 |
| 50 | iso_pu_bacteria | 2876818435 | 2876825630 | 257 |
| 51 | iso_pu_bacteria | 2879074833 | 2879077756 | 257 |
| 52 | iso_pu_bacteria | 2879083081 | 2879089816 | 257 |
| 53 | iso_pu_bacteria | 2879099564 | 2879108724 | 257 |
| 54 | iso_pu_bacteria | 2879127579 | 2879130914 | 257 |
| 55 | iso_pu_bacteria | 2879142872 | 2879148851 | 257 |
| 56 | iso_pu_bacteria | 2881364244 | 2881365827 | 257 |
| 57 | iso_pu_bacteria | 2881665667 | 2881665916 | 257 |
| 58 | iso_pu_bacteria | 2888388044 | 2888390827 | 257 |
| 59 | iso_pu_bacteria | 2888419890 | 2888420463 | 257 |
| 60 | iso_pu_bacteria | 2904666416 | 2904670410 | 257 |
| 61 | iso_pu_bacteria | 2904711408 | 2904715736 | 257 |
| 62 | iso_pu_bacteria | 2906643746 | 2906648668 | 257 |
| 63 | iso_pu_bacteria | 2908775508 | 2908776078 | 257 |
| 64 | iso_pu_bacteria | 2922368715 | 2922368778 | 257 |
| 65 | iso_pu_bacteria | 2929615660 | 2929618421 | 257 |
| 66 | iso_pu_bacteria | 2929624759 | 2929628894 | 257 |
| 67 | iso_pu_bacteria | 2932794094 | 2932794475 | 257 |
| 68 | iso_pu_bacteria | 2932801729 | 2932806756 | 257 |
| 69 | iso_pu_bacteria | 2935608549 | 2935615339 | 257 |
| 70 | iso_pu_bacteria | 2935675223 | 2935680829 | 257 |
| 71 | iso_pu_bacteria | 2935684952 | 2935689847 | 257 |
| 72 | iso_pu_bacteria | 2935713505 | 2935717367 | 257 |
| 73 | iso_pu_bacteria | 2935722832 | 2935723964 | 257 |
| 74 | iso_pu_bacteria | 2935732158 | 2935740173 | 257 |
| 75 | iso_pu_bacteria | 2935741537 | 2935749436 | 257 |
| 76 | iso_pu_bacteria | 2935750917 | 2935757201 | 257 |
| 77 | iso_pu_bacteria | 2935819856 | 2935825283 | 257 |
| 78 | iso_pu_bacteria | 2935847175 | 2935853117 | 257 |
| 79 | iso_pu_bacteria | 2940556831 | 2940563115 | 257 |
| 80 | iso_pu_bacteria | 3005594810 | 3005594866 | 257 |
| 81 | iso_pu_bacteria | 3005710791 | 3005710848 | 257 |
| 82 | iso_pu_bacteria | 8016530956 | 8016539586 | 257 |
| 83 | iso_pu_bacteria | 8016539877 | 8016543883 | 257 |
| 84 | iso_pu_bacteria | 8016603502 | 8016606728 | 257 |
| 85 | iso_pu_bacteria | 8016613128 | 8016618628 | 257 |
| 86 | iso_pu_bacteria | 8019538911 | 8019540717 | 257 |
| 87 | iso_pu_bacteria | 8019687851 | 8019696456 | 257 |
| 88 | 3300021384 | Ga0213876_10078817 | Ga0213876_100788172 | 258 |
| 89 | iso_pu_bacteria | 2906626472 | 2906633438 | 258 |
| 90 | 3300031995 | Ga0307409_100639120 | Ga0307409_1006391201 | 259 |
| 91 | 3300045976 | Ga0466967_0236391 | Ga0466967_0236391_699_1502 | 259 |
| 92 | 3300009177 | Ga0105248_10138209 | Ga0105248_101382091 | 260 |
| 93 | 3300025915 | Ga0207693_10010117 | Ga0207693_100101172 | 260 |
| 94 | 3300050512 | nmdc:mga0n895_37552_c1 | nmdc:mga0n895_37552_c1_3843_4628 | 260 |
| 95 | 3300050513 | nmdc:mga0rr50_125176_c1 | nmdc:mga0rr50_125176_c1_654_1439 | 260 |
| 96 | iso_pu_bacteria | 2513237104 | 2513719842 | 260 |
| 97 | 3300004625 | Ga0055543_1012639 | Ga0055543_10126391 | 261 |
| 98 | 3300005262 | Ga0065165_1007472 | Ga0065165_10074724 | 261 |
| 99 | 3300005329 | Ga0070683_100019421 | Ga0070683_1000194212 | 261 |
| 100 | 3300005336 | Ga0070680_100005994 | Ga0070680_1000059947 | 261 |
| 101 | 3300005339 | Ga0070660_100009116 | Ga0070660_1000091166 | 261 |
| 102 | 3300005344 | Ga0070661_100230067 | Ga0070661_1002300672 | 261 |
| 103 | 3300005354 | Ga0070675_100066168 | Ga0070675_1000661684 | 261 |
| 104 | 3300005466 | Ga0070685_10189807 | Ga0070685_101898072 | 261 |
| 105 | 3300005535 | Ga0070684_100055646 | Ga0070684_1000556463 | 261 |
| 106 | 3300005539 | Ga0068853_100007407 | Ga0068853_1000074074 | 261 |
| 107 | 3300005577 | Ga0068857_100015264 | Ga0068857_1000152641 | 261 |
| 108 | 3300005618 | Ga0068864_100024902 | Ga0068864_1000249022 | 261 |
| 109 | 3300005841 | Ga0068863_100287447 | Ga0068863_1002874472 | 261 |
| 110 | 3300005843 | Ga0068860_100001623 | Ga0068860_10000162311 | 261 |
| 111 | 3300006237 | Ga0097621_100156763 | Ga0097621_1001567633 | 261 |
| 112 | 3300006353 | Ga0075370_10145107 | Ga0075370_101451072 | 261 |
| 113 | 3300006942 | Ga0099824_1031610 | Ga0099824_10316102 | 261 |
| 114 | 3300021320 | Ga0214544_1016313 | Ga0214544_10163132 | 261 |
| 115 | 3300021321 | Ga0214542_1016361 | Ga0214542_10163617 | 261 |
| 116 | 3300021324 | Ga0214545_1015478 | Ga0214545_10154787 | 261 |
| 117 | 3300021327 | Ga0214543_1018322 | Ga0214543_10183226 | 261 |
| 118 | 3300025297 | Ga0209758_1003509 | Ga0209758_10035097 | 261 |
| 119 | 3300025302 | Ga0207426_1051290 | Ga0207426_10512902 | 261 |
| 120 | 3300025901 | Ga0207688_10054132 | Ga0207688_100541323 | 261 |
| 121 | 3300025912 | Ga0207707_10001497 | Ga0207707_100014979 | 261 |
| 122 | 3300025913 | Ga0207695_10075896 | Ga0207695_100758962 | 261 |
| 123 | 3300025917 | Ga0207660_10005316 | Ga0207660_100053162 | 261 |
| 124 | 3300025918 | Ga0207662_10025921 | Ga0207662_100259212 | 261 |
| 125 | 3300025919 | Ga0207657_10015131 | Ga0207657_100151317 | 261 |
| 126 | 3300025921 | Ga0207652_10001692 | Ga0207652_100016929 | 261 |
| 127 | 3300025924 | Ga0207694_10105768 | Ga0207694_101057682 | 261 |
| 128 | 3300025926 | Ga0207659_10146537 | Ga0207659_101465372 | 261 |
| 129 | 3300025944 | Ga0207661_10009038 | Ga0207661_100090387 | 261 |
| 130 | 3300025949 | Ga0207667_10003118 | Ga0207667_1000311810 | 261 |
| 131 | 3300025960 | Ga0207651_10111548 | Ga0207651_101115483 | 261 |
| 132 | 3300026041 | Ga0207639_10009580 | Ga0207639_100095806 | 261 |
| 133 | 3300026067 | Ga0207678_10214204 | Ga0207678_102142042 | 261 |
| 134 | 3300026116 | Ga0207674_10011007 | Ga0207674_100110076 | 261 |
| 135 | 3300026121 | Ga0207683_10299206 | Ga0207683_102992062 | 261 |
| 136 | 3300026142 | Ga0207698_10018469 | Ga0207698_100184694 | 261 |
| 137 | 3300027296 | Ga0209389_1000217 | Ga0209389_10002176 | 261 |
| 138 | 3300027361 | Ga0209489_102214 | Ga0209489_1022146 | 261 |
| 139 | 3300028381 | Ga0268264_10000227 | Ga0268264_1000022712 | 261 |
| 140 | 3300035170 | Ga0373943_0024874 | Ga0373943_0024874_792_1586 | 261 |
| 141 | 3300035695 | Ga0373927_0003439 | Ga0373927_0003439_8393_9187 | 261 |
| 142 | 3300039438 | Ga0436360_0784628 | Ga0436360_0784628_1016_1804 | 261 |
| 143 | 3300041459 | Ga0451800_0533584 | Ga0451800_0533584_152_940 | 261 |
| 144 | 3300046455 | Ga0495603_0000048 | Ga0495603_0000048_8682_9476 | 261 |
| 145 | 3300046459 | Ga0495629_0001230 | Ga0495629_0001230_9027_9821 | 261 |
| 146 | 3300046461 | Ga0495641_0001887 | Ga0495641_0001887_8590_9384 | 261 |
| 147 | 3300046462 | Ga0495651_0401786 | Ga0495651_0401786_10_798 | 261 |
| 148 | 3300046463 | Ga0495653_0036319 | Ga0495653_0036319_3071_3865 | 261 |
| 149 | 3300046472 | Ga0495580_0000084 | Ga0495580_0000084_26298_27092 | 261 |
| 150 | 3300046473 | Ga0495582_0002918 | Ga0495582_0002918_8403_9197 | 261 |
| 151 | 3300046475 | Ga0495639_0000009 | Ga0495639_0000009_55924_56718 | 261 |
| 152 | 3300046476 | Ga0495662_0004398 | Ga0495662_0004398_5498_6292 | 261 |
| 153 | 3300046499 | Ga0495594_0000603 | Ga0495594_0000603_8705_9499 | 261 |
| 154 | 3300046517 | Ga0495630_0025806 | Ga0495630_0025806_1245_2039 | 261 |
| 155 | 3300046526 | Ga0495666_0036789 | Ga0495666_0036789_1235_2029 | 261 |
| 156 | 3300046529 | Ga0495652_0023863 | Ga0495652_0023863_2864_3658 | 261 |
| 157 | 3300046531 | Ga0495665_0016436 | Ga0495665_0016436_3065_3859 | 261 |
| 158 | 3300046533 | Ga0495640_0006145 | Ga0495640_0006145_7091_7885 | 261 |
| 159 | 3300046557 | Ga0495622_0000771 | Ga0495622_0000771_14957_15751 | 261 |
| 160 | 3300046559 | Ga0495667_0128869 | Ga0495667_0128869_128_922 | 261 |
| 161 | 3300046642 | Ga0495634_0001541 | Ga0495634_0001541_10860_11654 | 261 |
| 162 | 3300046680 | Ga0495646_0054721 | Ga0495646_0054721_988_1782 | 261 |
| 163 | 3300046680 | Ga0495646_0074070 | Ga0495646_0074070_11_799 | 261 |
| 164 | 3300046683 | Ga0495658_0000420 | Ga0495658_0000420_14335_15129 | 261 |
| 165 | 3300046689 | Ga0495613_0001484 | Ga0495613_0001484_1509_2303 | 261 |
| 166 | 3300047315 | Ga0495581_0000103 | Ga0495581_0000103_34130_34924 | 261 |
| 167 | 3300047319 | Ga0495674_0000367 | Ga0495674_0000367_38089_38883 | 261 |
| 168 | 3300047471 | Ga0495684_0021483 | Ga0495684_0021483_1189_1983 | 261 |
| 169 | 3300047673 | Ga0495593_0000134 | Ga0495593_0000134_1134_1928 | 261 |
| 170 | 3300048089 | Ga0495614_0051930 | Ga0495614_0051930_853_1647 | 261 |
| 171 | 3300048903 | Ga0496100_0139127 | Ga0496100_0139127_895_1707 | 261 |
| 172 | 3300048907 | Ga0496104_0170732 | Ga0496104_0170732_33_842 | 261 |
| 173 | 3300049583 | Ga0501067_0021642 | Ga0501067_0021642_1893_2711 | 261 |
| 174 | 3300050511 | nmdc:mga08y16_891197_c1 | nmdc:mga08y16_891197_c1_16_825 | 261 |
| 175 | 3300053091 | Ga0500647_0011817 | Ga0500647_0011817_268_1056 | 261 |
| 176 | 3300053737 | Ga0500601_012623 | Ga0500601_012623_119_907 | 261 |
| 177 | 3300054114 | Ga0501084_0541863 | Ga0501084_0541863_47_883 | 261 |
| 178 | iso_pu_bacteria | 2507262055 | 2507505085 | 261 |
| 179 | iso_pu_bacteria | 2508501042 | 2508695337 | 261 |
| 180 | iso_pu_bacteria | 2511231028 | 2511394522 | 261 |
| 181 | iso_pu_bacteria | 2513237092 | 2513623250 | 261 |
| 182 | iso_pu_bacteria | 2513237094 | 2513639769 | 261 |
| 183 | iso_pu_bacteria | 2513237102 | 2513699303 | 261 |
| 184 | iso_pu_bacteria | 2513237139 | 2513873690 | 261 |
| 185 | iso_pu_bacteria | 2513237141 | 2513888900 | 261 |
| 186 | iso_pu_bacteria | 2513237161 | 2514012325 | 261 |
| 187 | iso_pu_bacteria | 2515154112 | 2515625647 | 261 |
| 188 | iso_pu_bacteria | 2517093001 | 2517102134 | 261 |
| 189 | iso_pu_bacteria | 2524023205 | 2524435942 | 261 |
| 190 | iso_pu_bacteria | 2524023210 | 2524467358 | 261 |
| 191 | iso_pu_bacteria | 2528768022 | 2528852496 | 261 |
| 192 | iso_pu_bacteria | 2617270735 | 2617350949 | 261 |
| 193 | iso_pu_bacteria | 2617270741 | 2617373604 | 261 |
| 194 | iso_pu_bacteria | 2744054633 | 2745081538 | 261 |
| 195 | iso_pu_bacteria | 2791355196 | 2793064941 | 261 |
| 196 | iso_pu_bacteria | 2802429603 | 2805915773 | 261 |
| 197 | iso_pu_bacteria | 2824617872 | 2824620658 | 261 |
| 198 | iso_pu_bacteria | 2824626560 | 2824629915 | 261 |
| 199 | iso_pu_bacteria | 2824635225 | 2824640571 | 261 |
| 200 | iso_pu_bacteria | 2824644064 | 2824647486 | 261 |
| 201 | iso_pu_bacteria | 2824671348 | 2824675772 | 261 |
| 202 | iso_pu_bacteria | 2824679649 | 2824683796 | 261 |
| 203 | iso_pu_bacteria | 2824687955 | 2824691894 | 261 |
| 204 | iso_pu_bacteria | 2824723954 | 2824728544 | 261 |
| 205 | iso_pu_bacteria | 2844315083 | 2844315141 | 261 |
| 206 | iso_pu_bacteria | 2849076700 | 2849082891 | 261 |
| 207 | iso_pu_bacteria | 2876761206 | 2876765595 | 261 |
| 208 | iso_pu_bacteria | 2885366525 | 2885371189 | 261 |
| 209 | iso_pu_bacteria | 2885383462 | 2885389740 | 261 |
| 210 | iso_pu_bacteria | 2885409591 | 2885410547 | 261 |
| 211 | iso_pu_bacteria | 2888378607 | 2888379740 | 261 |
| 212 | iso_pu_bacteria | 2903727486 | 2903732043 | 261 |
| 213 | iso_pu_bacteria | 2906602504 | 2906603091 | 261 |
| 214 | iso_pu_bacteria | 2922361189 | 2922364140 | 261 |
| 215 | iso_pu_bacteria | 2922393267 | 2922396285 | 261 |
| 216 | iso_pu_bacteria | 2932784394 | 2932786599 | 261 |
| 217 | iso_pu_bacteria | 2932809354 | 2932812341 | 261 |
| 218 | iso_pu_bacteria | 2932818245 | 2932823333 | 261 |
| 219 | iso_pu_bacteria | 2932828146 | 2932829827 | 261 |
| 220 | iso_pu_bacteria | 2933577622 | 2933580866 | 261 |
| 221 | iso_pu_bacteria | 2935616580 | 2935618345 | 261 |
| 222 | iso_pu_bacteria | 2935638405 | 2935641257 | 261 |
| 223 | iso_pu_bacteria | 2935648319 | 2935654838 | 261 |
| 224 | iso_pu_bacteria | 2935656913 | 2935663729 | 261 |
| 225 | iso_pu_bacteria | 2935665750 | 2935670173 | 261 |
| 226 | iso_pu_bacteria | 2935694250 | 2935698368 | 261 |
| 227 | iso_pu_bacteria | 2935703347 | 2935707510 | 261 |
| 228 | iso_pu_bacteria | 2935760218 | 2935763711 | 261 |
| 229 | iso_pu_bacteria | 2935769743 | 2935773403 | 261 |
| 230 | iso_pu_bacteria | 2935777560 | 2935782276 | 261 |
| 231 | iso_pu_bacteria | 2935785616 | 2935789229 | 261 |
| 232 | iso_pu_bacteria | 2935793552 | 2935797166 | 261 |
| 233 | iso_pu_bacteria | 2935801545 | 2935804112 | 261 |
| 234 | iso_pu_bacteria | 2935810662 | 2935815196 | 261 |
| 235 | iso_pu_bacteria | 2935827899 | 2935830988 | 261 |
| 236 | iso_pu_bacteria | 2935837841 | 2935841599 | 261 |
| 237 | iso_pu_bacteria | 2935855204 | 2935862560 | 261 |
| 238 | iso_pu_bacteria | 2935864058 | 2935866512 | 261 |
| 239 | iso_pu_bacteria | 2935873716 | 2935874819 | 261 |
| 240 | iso_pu_bacteria | 2935883170 | 2935888527 | 261 |
| 241 | iso_pu_bacteria | 2935908558 | 2935910135 | 261 |
| 242 | iso_pu_bacteria | 2935916978 | 2935918568 | 261 |
| 243 | iso_pu_bacteria | 2935926038 | 2935927954 | 261 |
| 244 | iso_pu_bacteria | 2935934488 | 2935936174 | 261 |
| 245 | iso_pu_bacteria | 2935942939 | 2935944273 | 261 |
| 246 | iso_pu_bacteria | 2935951376 | 2935952710 | 261 |
| 247 | iso_pu_bacteria | 2935959822 | 2935962489 | 261 |
| 248 | iso_pu_bacteria | 2935967501 | 2935969550 | 261 |
| 249 | iso_pu_bacteria | 2935975950 | 2935977689 | 261 |
| 250 | iso_pu_bacteria | 2935984226 | 2935984995 | 261 |
| 251 | iso_pu_bacteria | 2935992306 | 2935994325 | 261 |
| 252 | iso_pu_bacteria | 2936002035 | 2936004697 | 261 |
| 253 | iso_pu_bacteria | 2936011229 | 2936017874 | 261 |
| 254 | iso_pu_bacteria | 2936019824 | 2936026377 | 261 |
| 255 | iso_pu_bacteria | 2936028420 | 2936031575 | 261 |
| 256 | iso_pu_bacteria | 2936037263 | 2936043263 | 261 |
| 257 | iso_pu_bacteria | 2936046547 | 2936053361 | 261 |
| 258 | iso_pu_bacteria | 2936055302 | 2936056164 | 261 |
| 259 | iso_pu_bacteria | 2941531003 | 2941532538 | 261 |
| 260 | iso_pu_bacteria | 2941538514 | 2941543031 | 261 |
| 261 | iso_pu_bacteria | 3005483717 | 3005486751 | 261 |
| 262 | iso_pu_bacteria | 3005587118 | 3005594058 | 261 |
| 263 | iso_pu_bacteria | 3005718088 | 3005718144 | 261 |
| 264 | iso_pu_bacteria | 8006926726 | 8006929807 | 261 |
| 265 | iso_pu_bacteria | 8006964411 | 8006969485 | 261 |
| 266 | iso_pu_bacteria | 8006994254 | 8006996739 | 261 |
| 267 | iso_pu_bacteria | 8016522445 | 8016525983 | 261 |
| 268 | iso_pu_bacteria | 8016548790 | 8016549421 | 261 |
| 269 | iso_pu_bacteria | 8016557553 | 8016557844 | 261 |
| 270 | iso_pu_bacteria | 8016575299 | 8016581913 | 261 |
| 271 | iso_pu_bacteria | 8016595262 | 8016595863 | 261 |
| 272 | iso_pu_bacteria | 8016622563 | 8016623375 | 261 |
| 273 | iso_pu_bacteria | 8016630954 | 8016635832 | 261 |
| 274 | iso_pu_bacteria | 8017057580 | 8017058289 | 261 |
| 275 | iso_pu_bacteria | 8019530166 | 8019530867 | 261 |
| 276 | iso_pu_bacteria | 8019547302 | 8019550395 | 261 |
| 277 | iso_pu_bacteria | 8019576017 | 8019577421 | 261 |
| 278 | iso_pu_bacteria | 8019597564 | 8019606251 | 261 |
| 279 | iso_pu_bacteria | 8019619141 | 8019622803 | 261 |
| 280 | iso_pu_bacteria | 8019629233 | 8019630303 | 261 |
| 281 | iso_pu_bacteria | 8019638758 | 8019640304 | 261 |
| 282 | iso_pu_bacteria | 8019648815 | 8019652641 | 261 |
| 283 | iso_pu_bacteria | 8019659431 | 8019667132 | 261 |
| 284 | iso_pu_bacteria | 8019668869 | 8019676920 | 261 |
| 285 | iso_pu_bacteria | 8019678201 | 8019679070 | 261 |
| 286 | iso_pu_bacteria | 8055742211 | 8055742272 | 261 |
| 287 | iso_pu_bacteria | 8056673599 | 8056675586 | 261 |
| 288 | iso_pu_bacteria | 8056681323 | 8056687543 | 261 |
| 289 | iso_pu_bacteria | 8056967851 | 8056971126 | 261 |
| 290 | 3300039437 | Ga0436365_1108887 | Ga0436365_1108887_758_1549 | 262 |
| 291 | 3300039437 | Ga0436365_1246013 | Ga0436365_1246013_763_1554 | 262 |
| 292 | 3300041503 | Ga0451847_0528921 | Ga0451847_0528921_36_839 | 262 |
| 293 | iso_pu_bacteria | 2841957949 | 2841964764 | 262 |
| 294 | 3300005536 | Ga0070697_100000586 | Ga0070697_10000058619 | 263 |
| 295 | 3300005335 | Ga0070666_10067804 | Ga0070666_100678042 | 264 |
| 296 | 3300005367 | Ga0070667_100184122 | Ga0070667_1001841223 | 264 |
| 297 | 3300005614 | Ga0068856_100019802 | Ga0068856_1000198022 | 264 |
| 298 | 3300005842 | Ga0068858_100544947 | Ga0068858_1005449472 | 264 |
| 299 | 3300005843 | Ga0068860_100100464 | Ga0068860_1001004642 | 264 |
| 300 | 3300006028 | Ga0070717_10013327 | Ga0070717_100133275 | 264 |
| 301 | 3300006237 | Ga0097621_100177899 | Ga0097621_1001778991 | 264 |
| 302 | 3300006871 | Ga0075434_100334058 | Ga0075434_1003340581 | 264 |
| 303 | 3300006914 | Ga0075436_100040321 | Ga0075436_1000403211 | 264 |
| 304 | 3300009098 | Ga0105245_10013837 | Ga0105245_100138376 | 264 |
| 305 | 3300009176 | Ga0105242_10229813 | Ga0105242_102298133 | 264 |
| 306 | 3300014325 | Ga0163163_10475585 | Ga0163163_104755852 | 264 |
| 307 | 3300024227 | Ga0228598_1006636 | Ga0228598_10066362 | 264 |
| 308 | 3300025915 | Ga0207693_10027198 | Ga0207693_100271983 | 264 |
| 309 | 3300025924 | Ga0207694_10111282 | Ga0207694_101112822 | 264 |
| 310 | 3300025927 | Ga0207687_10008035 | Ga0207687_100080353 | 264 |
| 311 | 3300025934 | Ga0207686_10183825 | Ga0207686_101838252 | 264 |
| 312 | 3300025935 | Ga0207709_10348394 | Ga0207709_103483942 | 264 |
| 313 | 3300026078 | Ga0207702_10000350 | Ga0207702_1000035035 | 264 |
| 314 | 3300031090 | Ga0265760_10037980 | Ga0265760_100379802 | 264 |
| 315 | 3300035120 | Ga0373957_0050678 | Ga0373957_0050678_220_1041 | 264 |
| 316 | 3300035410 | Ga0373924_0099467 | Ga0373924_0099467_347_1168 | 264 |
| 317 | 3300036401 | Ga0373937_0680877 | Ga0373937_0680877_108_929 | 264 |
| 318 | 3300037068 | Ga0373925_0168079 | Ga0373925_0168079_17_871 | 264 |
| 319 | 3300039437 | Ga0436365_0478600 | Ga0436365_0478600_3667_4494 | 264 |
| 320 | 3300044694 | Ga0466963_0167611 | Ga0466963_0167611_540_1367 | 264 |
| 321 | 3300044842 | Ga0466957_0122872 | Ga0466957_0122872_416_1243 | 264 |
| 322 | 3300045836 | Ga0466958_0042367 | Ga0466958_0042367_1113_1940 | 264 |
| 323 | 3300046454 | Ga0495592_0079136 | Ga0495592_0079136_850_1674 | 264 |
| 324 | 3300046463 | Ga0495653_0092087 | Ga0495653_0092087_895_1716 | 264 |
| 325 | 3300046516 | Ga0495628_0158703 | Ga0495628_0158703_25_846 | 264 |
| 326 | 3300046529 | Ga0495652_0393116 | Ga0495652_0393116_65_889 | 264 |
| 327 | 3300046536 | Ga0495587_0164813 | Ga0495587_0164813_350_1171 | 264 |
| 328 | 3300046543 | Ga0495645_0016024 | Ga0495645_0016024_4345_5166 | 264 |
| 329 | 3300046559 | Ga0495667_0100245 | Ga0495667_0100245_347_1168 | 264 |
| 330 | 3300046642 | Ga0495634_0103258 | Ga0495634_0103258_411_1232 | 264 |
| 331 | 3300046678 | Ga0495599_0099618 | Ga0495599_0099618_740_1561 | 264 |
| 332 | 3300046679 | Ga0495623_0022025 | Ga0495623_0022025_2934_3755 | 264 |
| 333 | 3300046809 | Ga0495600_0104968 | Ga0495600_0104968_675_1496 | 264 |
| 334 | 3300047317 | Ga0495604_0022153 | Ga0495604_0022153_3511_4332 | 264 |
| 335 | 3300047319 | Ga0495674_0093154 | Ga0495674_0093154_885_1739 | 264 |
| 336 | 3300047321 | Ga0495676_0344750 | Ga0495676_0344750_159_983 | 264 |
| 337 | 3300047673 | Ga0495593_0054985 | Ga0495593_0054985_1011_1835 | 264 |
| 338 | 3300048088 | Ga0495602_0015795 | Ga0495602_0015795_3840_4661 | 264 |
| 339 | 3300048915 | Ga0496112_0059955 | Ga0496112_0059955_442_1287 | 264 |
| 340 | 3300048918 | Ga0496115_0376093 | Ga0496115_0376093_73_930 | 264 |
| 341 | 3300049569 | Ga0501032_0000011 | Ga0501032_0000011_194915_195736 | 264 |
| 342 | 3300049571 | Ga0501034_0000001 | Ga0501034_0000001_1530934_1531755 | 264 |
| 343 | 3300049575 | Ga0501039_0000243 | Ga0501039_0000243_36928_37749 | 264 |
| 344 | 3300053085 | Ga0495619_0045971 | Ga0495619_0045971_1800_2621 | 264 |
| 345 | 3300053104 | Ga0500556_0051714 | Ga0500556_0051714_526_1347 | 264 |
| 346 | iso_pu_bacteria | 2903768456 | 2903773390 | 264 |
| 347 | 3300003215 | JGI25153J46596_10003121 | JGI25153J46596_100031218 | 265 |
| 348 | 3300003215 | JGI25153J46596_10003625 | JGI25153J46596_100036258 | 265 |
| 349 | 3300003215 | JGI25153J46596_10005115 | JGI25153J46596_100051152 | 265 |
| 350 | 3300003215 | JGI25153J46596_10010926 | JGI25153J46596_100109261 | 265 |
| 351 | 3300003354 | JGI25160J50197_1001001 | JGI25160J50197_100100112 | 265 |
| 352 | 3300003354 | JGI25160J50197_1003544 | JGI25160J50197_10035447 | 265 |
| 353 | 3300003794 | Ga0055531_10003282 | Ga0055531_100032829 | 265 |
| 354 | 3300004625 | Ga0055543_1003105 | Ga0055543_10031056 | 265 |
| 355 | 3300005262 | Ga0065165_1006509 | Ga0065165_10065092 | 265 |
| 356 | 3300005293 | Ga0065715_10303924 | Ga0065715_103039241 | 265 |
| 357 | 3300005327 | Ga0070658_10065949 | Ga0070658_100659491 | 265 |
| 358 | 3300005327 | Ga0070658_10086288 | Ga0070658_100862882 | 265 |
| 359 | 3300005328 | Ga0070676_10283124 | Ga0070676_102831242 | 265 |
| 360 | 3300005329 | Ga0070683_100037636 | Ga0070683_1000376362 | 265 |
| 361 | 3300005329 | Ga0070683_100082862 | Ga0070683_1000828623 | 265 |
| 362 | 3300005329 | Ga0070683_100201118 | Ga0070683_1002011181 | 265 |
| 363 | 3300005334 | Ga0068869_100184781 | Ga0068869_1001847811 | 265 |
| 364 | 3300005335 | Ga0070666_10137472 | Ga0070666_101374722 | 265 |
| 365 | 3300005336 | Ga0070680_100023189 | Ga0070680_1000231892 | 265 |
| 366 | 3300005336 | Ga0070680_100038993 | Ga0070680_1000389931 | 265 |
| 367 | 3300005336 | Ga0070680_100409143 | Ga0070680_1004091432 | 265 |
| 368 | 3300005337 | Ga0070682_100099940 | Ga0070682_1000999402 | 265 |
| 369 | 3300005338 | Ga0068868_100006519 | Ga0068868_1000065196 | 265 |
| 370 | 3300005340 | Ga0070689_100017799 | Ga0070689_1000177995 | 265 |
| 371 | 3300005341 | Ga0070691_10119312 | Ga0070691_101193121 | 265 |
| 372 | 3300005355 | Ga0070671_100082907 | Ga0070671_1000829074 | 265 |
| 373 | 3300005355 | Ga0070671_100438802 | Ga0070671_1004388021 | 265 |
| 374 | 3300005364 | Ga0070673_100179111 | Ga0070673_1001791112 | 265 |
| 375 | 3300005365 | Ga0070688_100013010 | Ga0070688_1000130105 | 265 |
| 376 | 3300005365 | Ga0070688_100354506 | Ga0070688_1003545061 | 265 |
| 377 | 3300005434 | Ga0070709_10408689 | Ga0070709_104086891 | 265 |
| 378 | 3300005437 | Ga0070710_10071421 | Ga0070710_100714212 | 265 |
| 379 | 3300005439 | Ga0070711_100048433 | Ga0070711_1000484332 | 265 |
| 380 | 3300005439 | Ga0070711_100048890 | Ga0070711_1000488902 | 265 |
| 381 | 3300005439 | Ga0070711_100093270 | Ga0070711_1000932702 | 265 |
| 382 | 3300005439 | Ga0070711_100102626 | Ga0070711_1001026262 | 265 |
| 383 | 3300005441 | Ga0070700_100133379 | Ga0070700_1001333792 | 265 |
| 384 | 3300005455 | Ga0070663_100117697 | Ga0070663_1001176972 | 265 |
| 385 | 3300005456 | Ga0070678_100149557 | Ga0070678_1001495573 | 265 |
| 386 | 3300005458 | Ga0070681_10013547 | Ga0070681_100135475 | 265 |
| 387 | 3300005458 | Ga0070681_10020781 | Ga0070681_100207816 | 265 |
| 388 | 3300005458 | Ga0070681_10155095 | Ga0070681_101550954 | 265 |
| 389 | 3300005535 | Ga0070684_100012686 | Ga0070684_1000126862 | 265 |
| 390 | 3300005535 | Ga0070684_100061498 | Ga0070684_1000614986 | 265 |
| 391 | 3300005539 | Ga0068853_100191638 | Ga0068853_1001916382 | 265 |
| 392 | 3300005539 | Ga0068853_100475340 | Ga0068853_1004753401 | 265 |
| 393 | 3300005548 | Ga0070665_100078771 | Ga0070665_1000787712 | 265 |
| 394 | 3300005549 | Ga0070704_100124084 | Ga0070704_1001240842 | 265 |
| 395 | 3300005563 | Ga0068855_100317504 | Ga0068855_1003175042 | 265 |
| 396 | 3300005563 | Ga0068855_100526079 | Ga0068855_1005260791 | 265 |
| 397 | 3300005563 | Ga0068855_100628085 | Ga0068855_1006280852 | 265 |
| 398 | 3300005563 | Ga0068855_100722856 | Ga0068855_1007228562 | 265 |
| 399 | 3300005564 | Ga0070664_100431590 | Ga0070664_1004315901 | 265 |
| 400 | 3300005564 | Ga0070664_100439030 | Ga0070664_1004390302 | 265 |
| 401 | 3300005577 | Ga0068857_100106530 | Ga0068857_1001065302 | 265 |
| 402 | 3300005578 | Ga0068854_100129752 | Ga0068854_1001297522 | 265 |
| 403 | 3300005614 | Ga0068856_100025298 | Ga0068856_1000252985 | 265 |
| 404 | 3300005614 | Ga0068856_100064181 | Ga0068856_1000641812 | 265 |
| 405 | 3300005616 | Ga0068852_100011334 | Ga0068852_1000113346 | 265 |
| 406 | 3300005616 | Ga0068852_100735459 | Ga0068852_1007354591 | 265 |
| 407 | 3300005618 | Ga0068864_100072754 | Ga0068864_1000727542 | 265 |
| 408 | 3300005618 | Ga0068864_100583628 | Ga0068864_1005836282 | 265 |
| 409 | 3300005718 | Ga0068866_10025845 | Ga0068866_100258453 | 265 |
| 410 | 3300005834 | Ga0068851_10192968 | Ga0068851_101929681 | 265 |
| 411 | 3300005842 | Ga0068858_100051636 | Ga0068858_1000516364 | 265 |
| 412 | 3300005842 | Ga0068858_100379450 | Ga0068858_1003794502 | 265 |
| 413 | 3300005844 | Ga0068862_100412492 | Ga0068862_1004124922 | 265 |
| 414 | 3300005844 | Ga0068862_100640029 | Ga0068862_1006400291 | 265 |
| 415 | 3300005937 | Ga0081455_10002724 | Ga0081455_1000272417 | 265 |
| 416 | 3300005981 | Ga0081538_10073681 | Ga0081538_100736811 | 265 |
| 417 | 3300005983 | Ga0081540_1005028 | Ga0081540_10050283 | 265 |
| 418 | 3300005983 | Ga0081540_1097565 | Ga0081540_10975651 | 265 |
| 419 | 3300005983 | Ga0081540_1148590 | Ga0081540_11485901 | 265 |
| 420 | 3300006038 | Ga0075365_10087924 | Ga0075365_100879242 | 265 |
| 421 | 3300006038 | Ga0075365_10324439 | Ga0075365_103244391 | 265 |
| 422 | 3300006042 | Ga0075368_10028712 | Ga0075368_100287122 | 265 |
| 423 | 3300006048 | Ga0075363_100046693 | Ga0075363_1000466933 | 265 |
| 424 | 3300006048 | Ga0075363_100058425 | Ga0075363_1000584252 | 265 |
| 425 | 3300006051 | Ga0075364_10016682 | Ga0075364_100166822 | 265 |
| 426 | 3300006051 | Ga0075364_10110569 | Ga0075364_101105692 | 265 |
| 427 | 3300006173 | Ga0070716_100113562 | Ga0070716_1001135622 | 265 |
| 428 | 3300006175 | Ga0070712_100152731 | Ga0070712_1001527312 | 265 |
| 429 | 3300006175 | Ga0070712_100170594 | Ga0070712_1001705942 | 265 |
| 430 | 3300006178 | Ga0075367_10016821 | Ga0075367_100168212 | 265 |
| 431 | 3300006178 | Ga0075367_10018650 | Ga0075367_100186502 | 265 |
| 432 | 3300006178 | Ga0075367_10033232 | Ga0075367_100332322 | 265 |
| 433 | 3300006195 | Ga0075366_10002189 | Ga0075366_100021897 | 265 |
| 434 | 3300006195 | Ga0075366_10010105 | Ga0075366_100101054 | 265 |
| 435 | 3300006353 | Ga0075370_10182249 | Ga0075370_101822492 | 265 |
| 436 | 3300006944 | Ga0099823_1022934 | Ga0099823_10229346 | 265 |
| 437 | 3300009093 | Ga0105240_10002261 | Ga0105240_1000226121 | 265 |
| 438 | 3300009093 | Ga0105240_10062622 | Ga0105240_100626226 | 265 |
| 439 | 3300009098 | Ga0105245_10043050 | Ga0105245_100430503 | 265 |
| 440 | 3300009101 | Ga0105247_10054065 | Ga0105247_100540652 | 265 |
| 441 | 3300009147 | Ga0114129_10271364 | Ga0114129_102713642 | 265 |
| 442 | 3300009174 | Ga0105241_10029766 | Ga0105241_100297663 | 265 |
| 443 | 3300009174 | Ga0105241_10046596 | Ga0105241_100465964 | 265 |
| 444 | 3300009174 | Ga0105241_10560854 | Ga0105241_105608542 | 265 |
| 445 | 3300009176 | Ga0105242_10109173 | Ga0105242_101091732 | 265 |
| 446 | 3300009176 | Ga0105242_10426952 | Ga0105242_104269522 | 265 |
| 447 | 3300009177 | Ga0105248_10041110 | Ga0105248_100411104 | 265 |
| 448 | 3300009177 | Ga0105248_10175253 | Ga0105248_101752532 | 265 |
| 449 | 3300009177 | Ga0105248_10215497 | Ga0105248_102154972 | 265 |
| 450 | 3300009545 | Ga0105237_10003763 | Ga0105237_100037636 | 265 |
| 451 | 3300009545 | Ga0105237_10145812 | Ga0105237_101458123 | 265 |
| 452 | 3300009545 | Ga0105237_10174664 | Ga0105237_101746642 | 265 |
| 453 | 3300009545 | Ga0105237_10273079 | Ga0105237_102730792 | 265 |
| 454 | 3300009545 | Ga0105237_10579255 | Ga0105237_105792552 | 265 |
| 455 | 3300009545 | Ga0105237_10659413 | Ga0105237_106594132 | 265 |
| 456 | 3300009551 | Ga0105238_10015969 | Ga0105238_100159697 | 265 |
| 457 | 3300009551 | Ga0105238_10069807 | Ga0105238_100698072 | 265 |
| 458 | 3300009551 | Ga0105238_10193609 | Ga0105238_101936092 | 265 |
| 459 | 3300009551 | Ga0105238_10371555 | Ga0105238_103715552 | 265 |
| 460 | 3300010375 | Ga0105239_10023195 | Ga0105239_100231956 | 265 |
| 461 | 3300010375 | Ga0105239_10094285 | Ga0105239_100942854 | 265 |
| 462 | 3300010375 | Ga0105239_10216930 | Ga0105239_102169301 | 265 |
| 463 | 3300011119 | Ga0105246_10325764 | Ga0105246_103257642 | 265 |
| 464 | 3300011119 | Ga0105246_10372420 | Ga0105246_103724201 | 265 |
| 465 | 3300011119 | Ga0105246_10403074 | Ga0105246_104030742 | 265 |
| 466 | 3300013104 | Ga0157370_10035814 | Ga0157370_100358144 | 265 |
| 467 | 3300013104 | Ga0157370_10159270 | Ga0157370_101592702 | 265 |
| 468 | 3300013104 | Ga0157370_10317136 | Ga0157370_103171362 | 265 |
| 469 | 3300013105 | Ga0157369_10053722 | Ga0157369_100537222 | 265 |
| 470 | 3300013105 | Ga0157369_10106099 | Ga0157369_101060993 | 265 |
| 471 | 3300013296 | Ga0157374_10003265 | Ga0157374_100032654 | 265 |
| 472 | 3300013296 | Ga0157374_10040674 | Ga0157374_100406745 | 265 |
| 473 | 3300013297 | Ga0157378_10451639 | Ga0157378_104516392 | 265 |
| 474 | 3300013306 | Ga0163162_10081555 | Ga0163162_100815554 | 265 |
| 475 | 3300013306 | Ga0163162_10268331 | Ga0163162_102683312 | 265 |
| 476 | 3300013307 | Ga0157372_10350627 | Ga0157372_103506272 | 265 |
| 477 | 3300013307 | Ga0157372_10484785 | Ga0157372_104847852 | 265 |
| 478 | 3300013308 | Ga0157375_10144815 | Ga0157375_101448153 | 265 |
| 479 | 3300013308 | Ga0157375_10682301 | Ga0157375_106823011 | 265 |
| 480 | 3300014325 | Ga0163163_10013126 | Ga0163163_100131263 | 265 |
| 481 | 3300014325 | Ga0163163_10036751 | Ga0163163_100367516 | 265 |
| 482 | 3300014325 | Ga0163163_10193639 | Ga0163163_101936391 | 265 |
| 483 | 3300014969 | Ga0157376_10064439 | Ga0157376_100644394 | 265 |
| 484 | 3300014969 | Ga0157376_10577463 | Ga0157376_105774632 | 265 |
| 485 | 3300015262 | Ga0182007_10047038 | Ga0182007_100470382 | 265 |
| 486 | 3300020069 | Ga0197907_10378139 | Ga0197907_103781392 | 265 |
| 487 | 3300021320 | Ga0214544_1000056 | Ga0214544_100005665 | 265 |
| 488 | 3300021321 | Ga0214542_1000071 | Ga0214542_100007170 | 265 |
| 489 | 3300021324 | Ga0214545_1000033 | Ga0214545_100003352 | 265 |
| 490 | 3300021327 | Ga0214543_1000105 | Ga0214543_100010552 | 265 |
| 491 | 3300021377 | Ga0213874_10014038 | Ga0213874_100140383 | 265 |
| 492 | 3300021384 | Ga0213876_10107567 | Ga0213876_101075672 | 265 |
| 493 | 3300021441 | Ga0213871_10000532 | Ga0213871_100005325 | 265 |
| 494 | 3300022467 | Ga0224712_10019051 | Ga0224712_100190512 | 265 |
| 495 | 3300025245 | Ga0207425_1027375 | Ga0207425_10273751 | 265 |
| 496 | 3300025254 | Ga0209148_1000308 | Ga0209148_100030810 | 265 |
| 497 | 3300025261 | Ga0209233_1008097 | Ga0209233_10080973 | 265 |
| 498 | 3300025272 | Ga0209455_1001786 | Ga0209455_10017866 | 265 |
| 499 | 3300025273 | Ga0209673_1023416 | Ga0209673_10234162 | 265 |
| 500 | 3300025295 | Ga0209564_1006612 | Ga0209564_10066127 | 265 |
| 501 | 3300025297 | Ga0209758_1000182 | Ga0209758_1000182121 | 265 |
| 502 | 3300025297 | Ga0209758_1000293 | Ga0209758_100029352 | 265 |
| 503 | 3300025297 | Ga0209758_1000363 | Ga0209758_100036336 | 265 |
| 504 | 3300025297 | Ga0209758_1002068 | Ga0209758_100206814 | 265 |
| 505 | 3300025297 | Ga0209758_1003517 | Ga0209758_10035179 | 265 |
| 506 | 3300025297 | Ga0209758_1005730 | Ga0209758_10057307 | 265 |
| 507 | 3300025297 | Ga0209758_1041376 | Ga0209758_10413762 | 265 |
| 508 | 3300025299 | Ga0209256_1004270 | Ga0209256_10042708 | 265 |
| 509 | 3300025302 | Ga0207426_1000628 | Ga0207426_10006284 | 265 |
| 510 | 3300025302 | Ga0207426_1000992 | Ga0207426_100099218 | 265 |
| 511 | 3300025302 | Ga0207426_1004958 | Ga0207426_10049584 | 265 |
| 512 | 3300025304 | Ga0209257_1004239 | Ga0209257_10042395 | 265 |
| 513 | 3300025893 | Ga0207682_10039152 | Ga0207682_100391522 | 265 |
| 514 | 3300025898 | Ga0207692_10055491 | Ga0207692_100554912 | 265 |
| 515 | 3300025900 | Ga0207710_10049316 | Ga0207710_100493161 | 265 |
| 516 | 3300025903 | Ga0207680_10483967 | Ga0207680_104839671 | 265 |
| 517 | 3300025904 | Ga0207647_10025176 | Ga0207647_100251762 | 265 |
| 518 | 3300025904 | Ga0207647_10071165 | Ga0207647_100711652 | 265 |
| 519 | 3300025906 | Ga0207699_10006255 | Ga0207699_100062555 | 265 |
| 520 | 3300025906 | Ga0207699_10060143 | Ga0207699_100601431 | 265 |
| 521 | 3300025909 | Ga0207705_10120850 | Ga0207705_101208503 | 265 |
| 522 | 3300025910 | Ga0207684_10036512 | Ga0207684_100365124 | 265 |
| 523 | 3300025910 | Ga0207684_10710782 | Ga0207684_107107821 | 265 |
| 524 | 3300025911 | Ga0207654_10014572 | Ga0207654_100145723 | 265 |
| 525 | 3300025911 | Ga0207654_10035456 | Ga0207654_100354563 | 265 |
| 526 | 3300025911 | Ga0207654_10065304 | Ga0207654_100653042 | 265 |
| 527 | 3300025912 | Ga0207707_10008114 | Ga0207707_100081149 | 265 |
| 528 | 3300025912 | Ga0207707_10227578 | Ga0207707_102275782 | 265 |
| 529 | 3300025912 | Ga0207707_10242364 | Ga0207707_102423642 | 265 |
| 530 | 3300025913 | Ga0207695_10000107 | Ga0207695_1000010768 | 265 |
| 531 | 3300025913 | Ga0207695_10302167 | Ga0207695_103021672 | 265 |
| 532 | 3300025914 | Ga0207671_10004749 | Ga0207671_100047493 | 265 |
| 533 | 3300025914 | Ga0207671_10039127 | Ga0207671_100391273 | 265 |
| 534 | 3300025914 | Ga0207671_10082792 | Ga0207671_100827921 | 265 |
| 535 | 3300025914 | Ga0207671_10212429 | Ga0207671_102124292 | 265 |
| 536 | 3300025915 | Ga0207693_10009900 | Ga0207693_100099004 | 265 |
| 537 | 3300025915 | Ga0207693_10208324 | Ga0207693_102083242 | 265 |
| 538 | 3300025915 | Ga0207693_10297614 | Ga0207693_102976142 | 265 |
| 539 | 3300025916 | Ga0207663_10099417 | Ga0207663_100994173 | 265 |
| 540 | 3300025916 | Ga0207663_10230344 | Ga0207663_102303441 | 265 |
| 541 | 3300025916 | Ga0207663_10295252 | Ga0207663_102952522 | 265 |
| 542 | 3300025916 | Ga0207663_10406573 | Ga0207663_104065731 | 265 |
| 543 | 3300025917 | Ga0207660_10010250 | Ga0207660_100102503 | 265 |
| 544 | 3300025917 | Ga0207660_10086834 | Ga0207660_100868343 | 265 |
| 545 | 3300025921 | Ga0207652_10010419 | Ga0207652_100104193 | 265 |
| 546 | 3300025921 | Ga0207652_10020006 | Ga0207652_100200067 | 265 |
| 547 | 3300025921 | Ga0207652_10174700 | Ga0207652_101747002 | 265 |
| 548 | 3300025922 | Ga0207646_10193674 | Ga0207646_101936742 | 265 |
| 549 | 3300025924 | Ga0207694_10276473 | Ga0207694_102764732 | 265 |
| 550 | 3300025924 | Ga0207694_10290509 | Ga0207694_102905092 | 265 |
| 551 | 3300025927 | Ga0207687_10078731 | Ga0207687_100787312 | 265 |
| 552 | 3300025928 | Ga0207700_10069113 | Ga0207700_100691132 | 265 |
| 553 | 3300025931 | Ga0207644_10023803 | Ga0207644_100238033 | 265 |
| 554 | 3300025934 | Ga0207686_10239349 | Ga0207686_102393492 | 265 |
| 555 | 3300025935 | Ga0207709_10023155 | Ga0207709_100231552 | 265 |
| 556 | 3300025936 | Ga0207670_10012150 | Ga0207670_100121502 | 265 |
| 557 | 3300025939 | Ga0207665_10180376 | Ga0207665_101803762 | 265 |
| 558 | 3300025939 | Ga0207665_10206960 | Ga0207665_102069602 | 265 |
| 559 | 3300025940 | Ga0207691_10099020 | Ga0207691_100990202 | 265 |
| 560 | 3300025941 | Ga0207711_10076621 | Ga0207711_100766212 | 265 |
| 561 | 3300025942 | Ga0207689_10110600 | Ga0207689_101106002 | 265 |
| 562 | 3300025942 | Ga0207689_10114552 | Ga0207689_101145523 | 265 |
| 563 | 3300025944 | Ga0207661_10000579 | Ga0207661_100005797 | 265 |
| 564 | 3300025944 | Ga0207661_10002114 | Ga0207661_100021142 | 265 |
| 565 | 3300025944 | Ga0207661_10193615 | Ga0207661_101936152 | 265 |
| 566 | 3300025949 | Ga0207667_10235698 | Ga0207667_102356982 | 265 |
| 567 | 3300025981 | Ga0207640_10134797 | Ga0207640_101347971 | 265 |
| 568 | 3300025981 | Ga0207640_10369666 | Ga0207640_103696662 | 265 |
| 569 | 3300026023 | Ga0207677_10008707 | Ga0207677_100087072 | 265 |
| 570 | 3300026035 | Ga0207703_10038775 | Ga0207703_100387752 | 265 |
| 571 | 3300026041 | Ga0207639_10269549 | Ga0207639_102695492 | 265 |
| 572 | 3300026041 | Ga0207639_10493629 | Ga0207639_104936292 | 265 |
| 573 | 3300026041 | Ga0207639_10536094 | Ga0207639_105360941 | 265 |
| 574 | 3300026041 | Ga0207639_10852155 | Ga0207639_108521551 | 265 |
| 575 | 3300026067 | Ga0207678_10196358 | Ga0207678_101963582 | 265 |
| 576 | 3300026075 | Ga0207708_10047301 | Ga0207708_100473012 | 265 |
| 577 | 3300026078 | Ga0207702_10143796 | Ga0207702_101437961 | 265 |
| 578 | 3300026078 | Ga0207702_10363389 | Ga0207702_103633892 | 265 |
| 579 | 3300026088 | Ga0207641_10122834 | Ga0207641_101228343 | 265 |
| 580 | 3300026089 | Ga0207648_10616534 | Ga0207648_106165341 | 265 |
| 581 | 3300026095 | Ga0207676_10095607 | Ga0207676_100956073 | 265 |
| 582 | 3300026095 | Ga0207676_10132387 | Ga0207676_101323872 | 265 |
| 583 | 3300026095 | Ga0207676_10541246 | Ga0207676_105412462 | 265 |
| 584 | 3300026116 | Ga0207674_10117504 | Ga0207674_101175043 | 265 |
| 585 | 3300026118 | Ga0207675_100137407 | Ga0207675_1001374072 | 265 |
| 586 | 3300026121 | Ga0207683_10019572 | Ga0207683_100195723 | 265 |
| 587 | 3300026121 | Ga0207683_10058673 | Ga0207683_100586733 | 265 |
| 588 | 3300026142 | Ga0207698_10318921 | Ga0207698_103189212 | 265 |
| 589 | 3300026142 | Ga0207698_10530778 | Ga0207698_105307781 | 265 |
| 590 | 3300026142 | Ga0207698_10628096 | Ga0207698_106280961 | 265 |
| 591 | 3300027296 | Ga0209389_1000208 | Ga0209389_10002088 | 265 |
| 592 | 3300027357 | Ga0209589_1000032 | Ga0209589_100003268 | 265 |
| 593 | 3300027361 | Ga0209489_101970 | Ga0209489_1019708 | 265 |
| 594 | 3300027363 | Ga0209700_100011 | Ga0209700_10001152 | 265 |
| 595 | 3300027866 | Ga0209813_10010120 | Ga0209813_100101201 | 265 |
| 596 | 3300028379 | Ga0268266_10369146 | Ga0268266_103691461 | 265 |
| 597 | 3300028556 | Ga0265337_1028055 | Ga0265337_10280551 | 265 |
| 598 | 3300028558 | Ga0265326_10016944 | Ga0265326_100169442 | 265 |
| 599 | 3300028563 | Ga0265319_1005200 | Ga0265319_10052002 | 265 |
| 600 | 3300028573 | Ga0265334_10015788 | Ga0265334_100157883 | 265 |
| 601 | 3300028577 | Ga0265318_10008563 | Ga0265318_100085632 | 265 |
| 602 | 3300028653 | Ga0265323_10001243 | Ga0265323_100012435 | 265 |
| 603 | 3300028654 | Ga0265322_10014422 | Ga0265322_100144222 | 265 |
| 604 | 3300028666 | Ga0265336_10000410 | Ga0265336_100004105 | 265 |
| 605 | 3300028800 | Ga0265338_10000277 | Ga0265338_1000027765 | 265 |
| 606 | 3300029957 | Ga0265324_10005967 | Ga0265324_100059673 | 265 |
| 607 | 3300031235 | Ga0265330_10039036 | Ga0265330_100390363 | 265 |
| 608 | 3300031238 | Ga0265332_10019622 | Ga0265332_100196222 | 265 |
| 609 | 3300031241 | Ga0265325_10000061 | Ga0265325_1000006150 | 265 |
| 610 | 3300031241 | Ga0265325_10079574 | Ga0265325_100795742 | 265 |
| 611 | 3300031249 | Ga0265339_10022187 | Ga0265339_100221872 | 265 |
| 612 | 3300031250 | Ga0265331_10032820 | Ga0265331_100328203 | 265 |
| 613 | 3300031250 | Ga0265331_10071962 | Ga0265331_100719622 | 265 |
| 614 | 3300031250 | Ga0265331_10076691 | Ga0265331_100766911 | 265 |
| 615 | 3300031616 | Ga0307508_10000002 | Ga0307508_10000002203 | 265 |
| 616 | 3300031616 | Ga0307508_10226053 | Ga0307508_102260531 | 265 |
| 617 | 3300031712 | Ga0265342_10022741 | Ga0265342_100227413 | 265 |
| 618 | 3300031730 | Ga0307516_10035775 | Ga0307516_100357753 | 265 |
| 619 | 3300033180 | Ga0307510_10006388 | Ga0307510_1000638812 | 265 |
| 620 | 3300033180 | Ga0307510_10145934 | Ga0307510_101459342 | 265 |
| 621 | 3300034816 | Ga0373930_0041962 | Ga0373930_0041962_159_959 | 265 |
| 622 | 3300035086 | Ga0373934_0004728 | Ga0373934_0004728_976_1797 | 265 |
| 623 | 3300035086 | Ga0373934_0069340 | Ga0373934_0069340_374_1174 | 265 |
| 624 | 3300035111 | Ga0373923_0010717 | Ga0373923_0010717_1296_2117 | 265 |
| 625 | 3300035111 | Ga0373923_0014593 | Ga0373923_0014593_844_1644 | 265 |
| 626 | 3300035111 | Ga0373923_0032775 | Ga0373923_0032775_138_944 | 265 |
| 627 | 3300035112 | Ga0373932_0020906 | Ga0373932_0020906_119_943 | 265 |
| 628 | 3300035113 | Ga0373936_0093673 | Ga0373936_0093673_32_838 | 265 |
| 629 | 3300035116 | Ga0373945_0062313 | Ga0373945_0062313_326_1126 | 265 |
| 630 | 3300035117 | Ga0373953_0000653 | Ga0373953_0000653_4167_4988 | 265 |
| 631 | 3300035117 | Ga0373953_0075295 | Ga0373953_0075295_366_1166 | 265 |
| 632 | 3300035118 | Ga0373954_0015067 | Ga0373954_0015067_1532_2353 | 265 |
| 633 | 3300035119 | Ga0373956_0001298 | Ga0373956_0001298_1100_1921 | 265 |
| 634 | 3300035120 | Ga0373957_0004778 | Ga0373957_0004778_1535_2356 | 265 |
| 635 | 3300035121 | Ga0373960_0017880 | Ga0373960_0017880_119_943 | 265 |
| 636 | 3300035171 | Ga0373946_0028416 | Ga0373946_0028416_872_1672 | 265 |
| 637 | 3300035172 | Ga0373955_0000648 | Ga0373955_0000648_8816_9637 | 265 |
| 638 | 3300035172 | Ga0373955_0007599 | Ga0373955_0007599_2727_3533 | 265 |
| 639 | 3300035410 | Ga0373924_0004102 | Ga0373924_0004102_3587_4408 | 265 |
| 640 | 3300035410 | Ga0373924_0048843 | Ga0373924_0048843_594_1394 | 265 |
| 641 | 3300035691 | Ga0373931_0005720 | Ga0373931_0005720_2739_3563 | 265 |
| 642 | 3300035692 | Ga0373935_0004102 | Ga0373935_0004102_4791_5597 | 265 |
| 643 | 3300035692 | Ga0373935_0204600 | Ga0373935_0204600_19_819 | 265 |
| 644 | 3300035692 | Ga0373935_0335606 | Ga0373935_0335606_102_908 | 265 |
| 645 | 3300035695 | Ga0373927_0018648 | Ga0373927_0018648_3124_3933 | 265 |
| 646 | 3300035695 | Ga0373927_0028077 | Ga0373927_0028077_875_1675 | 265 |
| 647 | 3300035695 | Ga0373927_0078821 | Ga0373927_0078821_1039_1839 | 265 |
| 648 | 3300035695 | Ga0373927_0195756 | Ga0373927_0195756_340_1146 | 265 |
| 649 | 3300035724 | Ga0373933_0000655 | Ga0373933_0000655_18971_19792 | 265 |
| 650 | 3300035725 | Ga0373947_0005223 | Ga0373947_0005223_3337_4143 | 265 |
| 651 | 3300035725 | Ga0373947_0016157 | Ga0373947_0016157_496_1296 | 265 |
| 652 | 3300035725 | Ga0373947_0070390 | Ga0373947_0070390_813_1613 | 265 |
| 653 | 3300036401 | Ga0373937_0021124 | Ga0373937_0021124_1408_2229 | 265 |
| 654 | 3300036401 | Ga0373937_0231133 | Ga0373937_0231133_71_877 | 265 |
| 655 | 3300037068 | Ga0373925_0003059 | Ga0373925_0003059_2367_3173 | 265 |
| 656 | 3300037068 | Ga0373925_0022013 | Ga0373925_0022013_1322_2122 | 265 |
| 657 | 3300037068 | Ga0373925_0247068 | Ga0373925_0247068_440_1240 | 265 |
| 658 | 3300037418 | Ga0395900_0001316 | Ga0395900_0001316_28991_29788 | 265 |
| 659 | 3300037418 | Ga0395900_0166608 | Ga0395900_0166608_161_970 | 265 |
| 660 | 3300037418 | Ga0395900_0314598 | Ga0395900_0314598_641_1447 | 265 |
| 661 | 3300037466 | Ga0395898_0010275 | Ga0395898_0010275_22_819 | 265 |
| 662 | 3300037466 | Ga0395898_0261031 | Ga0395898_0261031_415_1221 | 265 |
| 663 | 3300037471 | Ga0395905_0019550 | Ga0395905_0019550_5555_6352 | 265 |
| 664 | 3300037471 | Ga0395905_0060353 | Ga0395905_0060353_2316_3113 | 265 |
| 665 | 3300037471 | Ga0395905_0417953 | Ga0395905_0417953_358_1182 | 265 |
| 666 | 3300037853 | Ga0436364_1211788 | Ga0436364_1211788_225_1031 | 265 |
| 667 | 3300038443 | Ga0395901_0002762 | Ga0395901_0002762_11452_12249 | 265 |
| 668 | 3300038443 | Ga0395901_0256059 | Ga0395901_0256059_31_840 | 265 |
| 669 | 3300038443 | Ga0395901_0516788 | Ga0395901_0516788_393_1190 | 265 |
| 670 | 3300039437 | Ga0436365_0766912 | Ga0436365_0766912_302_1102 | 265 |
| 671 | 3300039437 | Ga0436365_1695882 | Ga0436365_1695882_1205_2008 | 265 |
| 672 | 3300039437 | Ga0436365_1830473 | Ga0436365_1830473_1517_2320 | 265 |
| 673 | 3300039447 | Ga0436361_0734729 | Ga0436361_0734729_82_885 | 265 |
| 674 | 3300039450 | Ga0436363_0071431 | Ga0436363_0071431_916_1719 | 265 |
| 675 | 3300039450 | Ga0436363_0532985 | Ga0436363_0532985_4825_5628 | 265 |
| 676 | 3300039453 | Ga0436362_0566318 | Ga0436362_0566318_541_1341 | 265 |
| 677 | 3300041408 | Ga0439453_0006071 | Ga0439453_0006071_614_1438 | 265 |
| 678 | 3300041452 | Ga0451793_0431397 | Ga0451793_0431397_72_872 | 265 |
| 679 | 3300042125 | Ga0450923_022894 | Ga0450923_022894_255_1079 | 265 |
| 680 | 3300044656 | Ga0466969_0030926 | Ga0466969_0030926_52_852 | 265 |
| 681 | 3300044658 | Ga0466972_0000233 | Ga0466972_0000233_6667_7470 | 265 |
| 682 | 3300044683 | Ga0466965_0208720 | Ga0466965_0208720_152_952 | 265 |
| 683 | 3300044693 | Ga0466961_0003092 | Ga0466961_0003092_3151_3951 | 265 |
| 684 | 3300044694 | Ga0466963_0026147 | Ga0466963_0026147_424_1248 | 265 |
| 685 | 3300044706 | Ga0466964_0099624 | Ga0466964_0099624_424_1224 | 265 |
| 686 | 3300044735 | Ga0466968_0003054 | Ga0466968_0003054_662_1489 | 265 |
| 687 | 3300044765 | Ga0466970_0043302 | Ga0466970_0043302_1258_2058 | 265 |
| 688 | 3300044842 | Ga0466957_0023758 | Ga0466957_0023758_2530_3354 | 265 |
| 689 | 3300045049 | Ga0466959_0002845 | Ga0466959_0002845_2162_2962 | 265 |
| 690 | 3300045049 | Ga0466959_0178884 | Ga0466959_0178884_53_853 | 265 |
| 691 | 3300045976 | Ga0466967_0073867 | Ga0466967_0073867_1335_2159 | 265 |
| 692 | 3300045976 | Ga0466967_0230673 | Ga0466967_0230673_192_1001 | 265 |
| 693 | 3300045976 | Ga0466967_0286657 | Ga0466967_0286657_73_873 | 265 |
| 694 | 3300046454 | Ga0495592_0000614 | Ga0495592_0000614_14225_15046 | 265 |
| 695 | 3300046454 | Ga0495592_0008192 | Ga0495592_0008192_6110_6937 | 265 |
| 696 | 3300046454 | Ga0495592_0038952 | Ga0495592_0038952_1804_2604 | 265 |
| 697 | 3300046459 | Ga0495629_0000849 | Ga0495629_0000849_6048_6869 | 265 |
| 698 | 3300046459 | Ga0495629_0008274 | Ga0495629_0008274_5799_6653 | 265 |
| 699 | 3300046459 | Ga0495629_0061767 | Ga0495629_0061767_701_1501 | 265 |
| 700 | 3300046460 | Ga0495638_0002713 | Ga0495638_0002713_4088_4885 | 265 |
| 701 | 3300046462 | Ga0495651_0001002 | Ga0495651_0001002_3127_3948 | 265 |
| 702 | 3300046462 | Ga0495651_0030344 | Ga0495651_0030344_3106_3906 | 265 |
| 703 | 3300046462 | Ga0495651_0322730 | Ga0495651_0322730_103_927 | 265 |
| 704 | 3300046463 | Ga0495653_0015208 | Ga0495653_0015208_2224_3045 | 265 |
| 705 | 3300046463 | Ga0495653_0074237 | Ga0495653_0074237_1593_2393 | 265 |
| 706 | 3300046471 | Ga0495650_0058010 | Ga0495650_0058010_241_1041 | 265 |
| 707 | 3300046472 | Ga0495580_0006567 | Ga0495580_0006567_6549_7349 | 265 |
| 708 | 3300046472 | Ga0495580_0348048 | Ga0495580_0348048_61_861 | 265 |
| 709 | 3300046472 | Ga0495580_0368426 | Ga0495580_0368426_103_909 | 265 |
| 710 | 3300046473 | Ga0495582_0013677 | Ga0495582_0013677_1896_2696 | 265 |
| 711 | 3300046475 | Ga0495639_0023943 | Ga0495639_0023943_773_1573 | 265 |
| 712 | 3300046476 | Ga0495662_0117605 | Ga0495662_0117605_158_979 | 265 |
| 713 | 3300046477 | Ga0495664_0010080 | Ga0495664_0010080_1914_2714 | 265 |
| 714 | 3300046477 | Ga0495664_0040457 | Ga0495664_0040457_1935_2735 | 265 |
| 715 | 3300046477 | Ga0495664_0178097 | Ga0495664_0178097_116_916 | 265 |
| 716 | 3300046491 | Ga0495584_0221532 | Ga0495584_0221532_100_900 | 265 |
| 717 | 3300046499 | Ga0495594_0084913 | Ga0495594_0084913_326_1126 | 265 |
| 718 | 3300046507 | Ga0495606_0032899 | Ga0495606_0032899_280_1107 | 265 |
| 719 | 3300046511 | Ga0495608_0001026 | Ga0495608_0001026_17802_18623 | 265 |
| 720 | 3300046515 | Ga0495620_0060542 | Ga0495620_0060542_609_1409 | 265 |
| 721 | 3300046516 | Ga0495628_0002528 | Ga0495628_0002528_1451_2257 | 265 |
| 722 | 3300046516 | Ga0495628_0042727 | Ga0495628_0042727_194_994 | 265 |
| 723 | 3300046516 | Ga0495628_0044189 | Ga0495628_0044189_1787_2587 | 265 |
| 724 | 3300046516 | Ga0495628_0048772 | Ga0495628_0048772_1036_1857 | 265 |
| 725 | 3300046517 | Ga0495630_0033567 | Ga0495630_0033567_1087_1887 | 265 |
| 726 | 3300046522 | Ga0495643_0109135 | Ga0495643_0109135_313_1113 | 265 |
| 727 | 3300046524 | Ga0495648_0001769 | Ga0495648_0001769_302_1108 | 265 |
| 728 | 3300046524 | Ga0495648_0016435 | Ga0495648_0016435_4240_5067 | 265 |
| 729 | 3300046529 | Ga0495652_0020043 | Ga0495652_0020043_2167_2988 | 265 |
| 730 | 3300046529 | Ga0495652_0129656 | Ga0495652_0129656_773_1573 | 265 |
| 731 | 3300046531 | Ga0495665_0039184 | Ga0495665_0039184_587_1387 | 265 |
| 732 | 3300046533 | Ga0495640_0013322 | Ga0495640_0013322_403_1203 | 265 |
| 733 | 3300046533 | Ga0495640_0017715 | Ga0495640_0017715_2180_3001 | 265 |
| 734 | 3300046533 | Ga0495640_0043150 | Ga0495640_0043150_1971_2771 | 265 |
| 735 | 3300046533 | Ga0495640_0330461 | Ga0495640_0330461_38_838 | 265 |
| 736 | 3300046535 | Ga0495586_0036735 | Ga0495586_0036735_1434_2234 | 265 |
| 737 | 3300046536 | Ga0495587_0005697 | Ga0495587_0005697_3662_4483 | 265 |
| 738 | 3300046536 | Ga0495587_0015864 | Ga0495587_0015864_3591_4391 | 265 |
| 739 | 3300046542 | Ga0495597_0082949 | Ga0495597_0082949_214_1014 | 265 |
| 740 | 3300046543 | Ga0495645_0017296 | Ga0495645_0017296_909_1730 | 265 |
| 741 | 3300046543 | Ga0495645_0132541 | Ga0495645_0132541_543_1343 | 265 |
| 742 | 3300046543 | Ga0495645_0171734 | Ga0495645_0171734_354_1160 | 265 |
| 743 | 3300046559 | Ga0495667_0001358 | Ga0495667_0001358_973_1794 | 265 |
| 744 | 3300046642 | Ga0495634_0038726 | Ga0495634_0038726_299_1120 | 265 |
| 745 | 3300046642 | Ga0495634_0071770 | Ga0495634_0071770_703_1503 | 265 |
| 746 | 3300046642 | Ga0495634_0099512 | Ga0495634_0099512_357_1157 | 265 |
| 747 | 3300046642 | Ga0495634_0167516 | Ga0495634_0167516_109_909 | 265 |
| 748 | 3300046663 | Ga0495635_0000119 | Ga0495635_0000119_37936_38742 | 265 |
| 749 | 3300046663 | Ga0495635_0000809 | Ga0495635_0000809_16637_17458 | 265 |
| 750 | 3300046663 | Ga0495635_0220597 | Ga0495635_0220597_237_1037 | 265 |
| 751 | 3300046675 | Ga0495657_0006732 | Ga0495657_0006732_5893_6714 | 265 |
| 752 | 3300046675 | Ga0495657_0009585 | Ga0495657_0009585_770_1570 | 265 |
| 753 | 3300046675 | Ga0495657_0012863 | Ga0495657_0012863_4623_5477 | 265 |
| 754 | 3300046678 | Ga0495599_0000513 | Ga0495599_0000513_17853_18674 | 265 |
| 755 | 3300046678 | Ga0495599_0248148 | Ga0495599_0248148_121_921 | 265 |
| 756 | 3300046679 | Ga0495623_0009766 | Ga0495623_0009766_1709_2530 | 265 |
| 757 | 3300046679 | Ga0495623_0011049 | Ga0495623_0011049_1583_2383 | 265 |
| 758 | 3300046680 | Ga0495646_0001869 | Ga0495646_0001869_2720_3541 | 265 |
| 759 | 3300046680 | Ga0495646_0056971 | Ga0495646_0056971_1166_1966 | 265 |
| 760 | 3300046683 | Ga0495658_0009910 | Ga0495658_0009910_754_1554 | 265 |
| 761 | 3300046689 | Ga0495613_0153011 | Ga0495613_0153011_357_1157 | 265 |
| 762 | 3300046690 | Ga0495624_0003095 | Ga0495624_0003095_2132_2938 | 265 |
| 763 | 3300046694 | Ga0495649_0002747 | Ga0495649_0002747_3613_4440 | 265 |
| 764 | 3300046694 | Ga0495649_0115963 | Ga0495649_0115963_397_1197 | 265 |
| 765 | 3300046809 | Ga0495600_0004615 | Ga0495600_0004615_6954_7808 | 265 |
| 766 | 3300046809 | Ga0495600_0004930 | Ga0495600_0004930_4921_5742 | 265 |
| 767 | 3300046809 | Ga0495600_0021201 | Ga0495600_0021201_201_1001 | 265 |
| 768 | 3300047315 | Ga0495581_0007321 | Ga0495581_0007321_2870_3670 | 265 |
| 769 | 3300047315 | Ga0495581_0193376 | Ga0495581_0193376_310_1110 | 265 |
| 770 | 3300047317 | Ga0495604_0010711 | Ga0495604_0010711_807_1607 | 265 |
| 771 | 3300047317 | Ga0495604_0020575 | Ga0495604_0020575_3751_4551 | 265 |
| 772 | 3300047317 | Ga0495604_0223845 | Ga0495604_0223845_94_900 | 265 |
| 773 | 3300047319 | Ga0495674_0011448 | Ga0495674_0011448_2461_3261 | 265 |
| 774 | 3300047319 | Ga0495674_0028981 | Ga0495674_0028981_3386_4186 | 265 |
| 775 | 3300047319 | Ga0495674_0098456 | Ga0495674_0098456_75_896 | 265 |
| 776 | 3300047319 | Ga0495674_0325532 | Ga0495674_0325532_337_1137 | 265 |
| 777 | 3300047320 | Ga0495672_0037918 | Ga0495672_0037918_613_1464 | 265 |
| 778 | 3300047321 | Ga0495676_0387975 | Ga0495676_0387975_97_897 | 265 |
| 779 | 3300047322 | Ga0495680_0002243 | Ga0495680_0002243_1600_2421 | 265 |
| 780 | 3300047322 | Ga0495680_0012531 | Ga0495680_0012531_5908_6708 | 265 |
| 781 | 3300047443 | Ga0495687_110629 | Ga0495687_110629_185_985 | 265 |
| 782 | 3300047444 | Ga0495675_0000978 | Ga0495675_0000978_5043_5864 | 265 |
| 783 | 3300047444 | Ga0495675_0014791 | Ga0495675_0014791_393_1193 | 265 |
| 784 | 3300047445 | Ga0495677_0083420 | Ga0495677_0083420_246_1046 | 265 |
| 785 | 3300047469 | Ga0495673_0017078 | Ga0495673_0017078_2648_3454 | 265 |
| 786 | 3300047471 | Ga0495684_0000081 | Ga0495684_0000081_45957_46778 | 265 |
| 787 | 3300047471 | Ga0495684_0110828 | Ga0495684_0110828_294_1094 | 265 |
| 788 | 3300047471 | Ga0495684_0160475 | Ga0495684_0160475_237_1037 | 265 |
| 789 | 3300047472 | Ga0495686_0053018 | Ga0495686_0053018_593_1456 | 265 |
| 790 | 3300047673 | Ga0495593_0006901 | Ga0495593_0006901_1838_2659 | 265 |
| 791 | 3300047673 | Ga0495593_0017419 | Ga0495593_0017419_929_1729 | 265 |
| 792 | 3300048088 | Ga0495602_0002985 | Ga0495602_0002985_15422_16243 | 265 |
| 793 | 3300048088 | Ga0495602_0021964 | Ga0495602_0021964_4623_5423 | 265 |
| 794 | 3300048091 | Ga0495626_0064666 | Ga0495626_0064666_622_1422 | 265 |
| 795 | 3300048903 | Ga0496100_0076046 | Ga0496100_0076046_624_1451 | 265 |
| 796 | 3300048903 | Ga0496100_0088745 | Ga0496100_0088745_931_1731 | 265 |
| 797 | 3300048903 | Ga0496100_0284854 | Ga0496100_0284854_174_974 | 265 |
| 798 | 3300048904 | Ga0496101_0036649 | Ga0496101_0036649_2026_2850 | 265 |
| 799 | 3300048904 | Ga0496101_0070038 | Ga0496101_0070038_1188_1988 | 265 |
| 800 | 3300048904 | Ga0496101_0074061 | Ga0496101_0074061_1240_2079 | 265 |
| 801 | 3300048904 | Ga0496101_0107324 | Ga0496101_0107324_293_1093 | 265 |
| 802 | 3300048904 | Ga0496101_0120096 | Ga0496101_0120096_446_1273 | 265 |
| 803 | 3300048904 | Ga0496101_0332696 | Ga0496101_0332696_337_1137 | 265 |
| 804 | 3300048905 | Ga0496102_0061667 | Ga0496102_0061667_118_918 | 265 |
| 805 | 3300048905 | Ga0496102_0172121 | Ga0496102_0172121_625_1449 | 265 |
| 806 | 3300048905 | Ga0496102_0181350 | Ga0496102_0181350_884_1732 | 265 |
| 807 | 3300048906 | Ga0496103_0009458 | Ga0496103_0009458_1478_2278 | 265 |
| 808 | 3300048906 | Ga0496103_0072886 | Ga0496103_0072886_1204_2004 | 265 |
| 809 | 3300048907 | Ga0496104_0020661 | Ga0496104_0020661_1201_2040 | 265 |
| 810 | 3300048907 | Ga0496104_0023555 | Ga0496104_0023555_1026_1850 | 265 |
| 811 | 3300048907 | Ga0496104_0187611 | Ga0496104_0187611_1152_1952 | 265 |
| 812 | 3300048907 | Ga0496104_0191155 | Ga0496104_0191155_131_931 | 265 |
| 813 | 3300048907 | Ga0496104_0295438 | Ga0496104_0295438_277_1077 | 265 |
| 814 | 3300048908 | Ga0496105_0009535 | Ga0496105_0009535_921_1721 | 265 |
| 815 | 3300048908 | Ga0496105_0073846 | Ga0496105_0073846_980_1804 | 265 |
| 816 | 3300048908 | Ga0496105_0248252 | Ga0496105_0248252_376_1176 | 265 |
| 817 | 3300048909 | Ga0496106_0001576 | Ga0496106_0001576_1591_2391 | 265 |
| 818 | 3300048909 | Ga0496106_0007942 | Ga0496106_0007942_5732_6571 | 265 |
| 819 | 3300048909 | Ga0496106_0014219 | Ga0496106_0014219_3915_4739 | 265 |
| 820 | 3300048909 | Ga0496106_0108285 | Ga0496106_0108285_139_939 | 265 |
| 821 | 3300048910 | Ga0496107_0003437 | Ga0496107_0003437_4562_5362 | 265 |
| 822 | 3300048910 | Ga0496107_0012956 | Ga0496107_0012956_2245_3069 | 265 |
| 823 | 3300048911 | Ga0496108_0000803 | Ga0496108_0000803_6029_6829 | 265 |
| 824 | 3300048911 | Ga0496108_0035470 | Ga0496108_0035470_627_1427 | 265 |
| 825 | 3300048911 | Ga0496108_0059942 | Ga0496108_0059942_180_1019 | 265 |
| 826 | 3300048911 | Ga0496108_0082787 | Ga0496108_0082787_1629_2453 | 265 |
| 827 | 3300048912 | Ga0496109_0017599 | Ga0496109_0017599_779_1618 | 265 |
| 828 | 3300048912 | Ga0496109_0035686 | Ga0496109_0035686_3621_4421 | 265 |
| 829 | 3300048912 | Ga0496109_0180998 | Ga0496109_0180998_297_1121 | 265 |
| 830 | 3300048912 | Ga0496109_0207305 | Ga0496109_0207305_509_1309 | 265 |
| 831 | 3300048913 | Ga0496110_0033090 | Ga0496110_0033090_3166_4005 | 265 |
| 832 | 3300048913 | Ga0496110_0035078 | Ga0496110_0035078_2267_3067 | 265 |
| 833 | 3300048914 | Ga0496111_0034758 | Ga0496111_0034758_2149_2973 | 265 |
| 834 | 3300048914 | Ga0496111_0081365 | Ga0496111_0081365_1335_2135 | 265 |
| 835 | 3300048915 | Ga0496112_0002678 | Ga0496112_0002678_4993_5793 | 265 |
| 836 | 3300048915 | Ga0496112_0031886 | Ga0496112_0031886_1996_2796 | 265 |
| 837 | 3300048915 | Ga0496112_0041336 | Ga0496112_0041336_1415_2254 | 265 |
| 838 | 3300048915 | Ga0496112_0065372 | Ga0496112_0065372_470_1294 | 265 |
| 839 | 3300048915 | Ga0496112_0084420 | Ga0496112_0084420_2318_3124 | 265 |
| 840 | 3300048915 | Ga0496112_0122679 | Ga0496112_0122679_795_1601 | 265 |
| 841 | 3300048915 | Ga0496112_0174083 | Ga0496112_0174083_1025_1849 | 265 |
| 842 | 3300048915 | Ga0496112_0276693 | Ga0496112_0276693_623_1447 | 265 |
| 843 | 3300048915 | Ga0496112_0403036 | Ga0496112_0403036_293_1141 | 265 |
| 844 | 3300048916 | Ga0496113_0006745 | Ga0496113_0006745_5013_5813 | 265 |
| 845 | 3300048916 | Ga0496113_0030431 | Ga0496113_0030431_744_1544 | 265 |
| 846 | 3300048916 | Ga0496113_0076620 | Ga0496113_0076620_1154_1978 | 265 |
| 847 | 3300048916 | Ga0496113_0333899 | Ga0496113_0333899_361_1161 | 265 |
| 848 | 3300048916 | Ga0496113_0417594 | Ga0496113_0417594_83_883 | 265 |
| 849 | 3300048917 | Ga0496114_0122685 | Ga0496114_0122685_1128_1928 | 265 |
| 850 | 3300048918 | Ga0496115_0030558 | Ga0496115_0030558_2445_3269 | 265 |
| 851 | 3300048918 | Ga0496115_0034886 | Ga0496115_0034886_2349_3149 | 265 |
| 852 | 3300048918 | Ga0496115_0051161 | Ga0496115_0051161_2347_3204 | 265 |
| 853 | 3300048918 | Ga0496115_0073670 | Ga0496115_0073670_1706_2533 | 265 |
| 854 | 3300048918 | Ga0496115_0078638 | Ga0496115_0078638_499_1305 | 265 |
| 855 | 3300048918 | Ga0496115_0087988 | Ga0496115_0087988_331_1137 | 265 |
| 856 | 3300048918 | Ga0496115_0132941 | Ga0496115_0132941_451_1251 | 265 |
| 857 | 3300048918 | Ga0496115_0185976 | Ga0496115_0185976_519_1325 | 265 |
| 858 | 3300048918 | Ga0496115_0256936 | Ga0496115_0256936_491_1390 | 265 |
| 859 | 3300048919 | Ga0496116_0010704 | Ga0496116_0010704_2962_3762 | 265 |
| 860 | 3300048921 | Ga0496118_0091668 | Ga0496118_0091668_405_1205 | 265 |
| 861 | 3300048921 | Ga0496118_0099405 | Ga0496118_0099405_391_1191 | 265 |
| 862 | 3300048922 | Ga0496119_0008410 | Ga0496119_0008410_6643_7443 | 265 |
| 863 | 3300048924 | Ga0496121_0000786 | Ga0496121_0000786_16189_16995 | 265 |
| 864 | 3300048924 | Ga0496121_0027631 | Ga0496121_0027631_1537_2337 | 265 |
| 865 | 3300048924 | Ga0496121_0048983 | Ga0496121_0048983_1978_2778 | 265 |
| 866 | 3300048925 | Ga0496122_0024213 | Ga0496122_0024213_2250_3050 | 265 |
| 867 | 3300048925 | Ga0496122_0177556 | Ga0496122_0177556_460_1260 | 265 |
| 868 | 3300048927 | Ga0496124_0128793 | Ga0496124_0128793_618_1418 | 265 |
| 869 | 3300048928 | Ga0496125_0016759 | Ga0496125_0016759_6210_7010 | 265 |
| 870 | 3300048928 | Ga0496125_0120442 | Ga0496125_0120442_192_992 | 265 |
| 871 | 3300048929 | Ga0496126_0003797 | Ga0496126_0003797_6988_7788 | 265 |
| 872 | 3300048929 | Ga0496126_0008016 | Ga0496126_0008016_8975_9775 | 265 |
| 873 | 3300048929 | Ga0496126_0088722 | Ga0496126_0088722_290_1090 | 265 |
| 874 | 3300048929 | Ga0496126_0130468 | Ga0496126_0130468_869_1669 | 265 |
| 875 | 3300049569 | Ga0501032_0006585 | Ga0501032_0006585_5794_6717 | 265 |
| 876 | 3300049571 | Ga0501034_0080206 | Ga0501034_0080206_1106_1975 | 265 |
| 877 | 3300049571 | Ga0501034_0284372 | Ga0501034_0284372_262_1086 | 265 |
| 878 | 3300049580 | Ga0501046_0163524 | Ga0501046_0163524_278_1087 | 265 |
| 879 | 3300049581 | Ga0501047_0024350 | Ga0501047_0024350_1923_2732 | 265 |
| 880 | 3300049585 | Ga0501069_0025177 | Ga0501069_0025177_2330_3220 | 265 |
| 881 | 3300049586 | Ga0501070_0354137 | Ga0501070_0354137_244_1053 | 265 |
| 882 | 3300049588 | Ga0501072_0137362 | Ga0501072_0137362_231_1055 | 265 |
| 883 | 3300049589 | Ga0501073_0320723 | Ga0501073_0320723_150_959 | 265 |
| 884 | 3300049590 | Ga0501074_0029125 | Ga0501074_0029125_3163_3972 | 265 |
| 885 | 3300049592 | Ga0501076_0460983 | Ga0501076_0460983_54_878 | 265 |
| 886 | 3300049742 | Ga0501080_0085994 | Ga0501080_0085994_1887_2696 | 265 |
| 887 | 3300049744 | Ga0501083_0187680 | Ga0501083_0187680_247_1071 | 265 |
| 888 | 3300049744 | Ga0501083_0212691 | Ga0501083_0212691_127_975 | 265 |
| 889 | 3300050490 | nmdc:mga03n38_51196_c1 | nmdc:mga03n38_51196_c1_190_1014 | 265 |
| 890 | 3300050490 | nmdc:mga03n38_6973_c1 | nmdc:mga03n38_6973_c1_2851_3651 | 265 |
| 891 | 3300050491 | nmdc:mga00v17_247168_c1 | nmdc:mga00v17_247168_c1_113_937 | 265 |
| 892 | 3300050492 | nmdc:mga0yw44_264557_c1 | nmdc:mga0yw44_264557_c1_159_965 | 265 |
| 893 | 3300050493 | nmdc:mga0k408_10614_c1 | nmdc:mga0k408_10614_c1_261_1085 | 265 |
| 894 | 3300050493 | nmdc:mga0k408_68103_c1 | nmdc:mga0k408_68103_c1_1196_2020 | 265 |
| 895 | 3300050494 | nmdc:mga06z11_161856_c1 | nmdc:mga06z11_161856_c1_98_898 | 265 |
| 896 | 3300050494 | nmdc:mga06z11_275423_c1 | nmdc:mga06z11_275423_c1_62_886 | 265 |
| 897 | 3300050496 | nmdc:mga07m45_157538_c1 | nmdc:mga07m45_157538_c1_410_1210 | 265 |
| 898 | 3300050496 | nmdc:mga07m45_274344_c1 | nmdc:mga07m45_274344_c1_66_932 | 265 |
| 899 | 3300050507 | nmdc:mga05p37_736569_c1 | nmdc:mga05p37_736569_c1_62_886 | 265 |
| 900 | 3300050511 | nmdc:mga08y16_56695_c1 | nmdc:mga08y16_56695_c1_2428_3252 | 265 |
| 901 | 3300050516 | nmdc:mga0sz30_20473_c1 | nmdc:mga0sz30_20473_c1_1599_2399 | 265 |
| 902 | 3300053077 | Ga0495601_0004544 | Ga0495601_0004544_6872_7693 | 265 |
| 903 | 3300053077 | Ga0495601_0122151 | Ga0495601_0122151_108_908 | 265 |
| 904 | 3300053077 | Ga0495601_0244302 | Ga0495601_0244302_129_929 | 265 |
| 905 | 3300053078 | Ga0495612_0108920 | Ga0495612_0108920_118_918 | 265 |
| 906 | 3300053079 | Ga0500610_0194633 | Ga0500610_0194633_145_969 | 265 |
| 907 | 3300053084 | Ga0495595_0000924 | Ga0495595_0000924_1789_2610 | 265 |
| 908 | 3300053084 | Ga0495595_0060631 | Ga0495595_0060631_663_1463 | 265 |
| 909 | 3300053085 | Ga0495619_0000761 | Ga0495619_0000761_7059_7880 | 265 |
| 910 | 3300053085 | Ga0495619_0058480 | Ga0495619_0058480_184_984 | 265 |
| 911 | 3300053085 | Ga0495619_0174706 | Ga0495619_0174706_86_886 | 265 |
| 912 | 3300053087 | Ga0500643_000049 | Ga0500643_000049_104810_105610 | 265 |
| 913 | 3300053092 | Ga0500583_0053404 | Ga0500583_0053404_974_1774 | 265 |
| 914 | 3300053094 | Ga0500566_0000054 | Ga0500566_0000054_28961_29761 | 265 |
| 915 | 3300053094 | Ga0500566_0002813 | Ga0500566_0002813_3634_4431 | 265 |
| 916 | 3300053094 | Ga0500566_0204817 | Ga0500566_0204817_93_893 | 265 |
| 917 | 3300053095 | Ga0500640_124748 | Ga0500640_124748_12_812 | 265 |
| 918 | 3300053096 | Ga0500641_0023389 | Ga0500641_0023389_849_1673 | 265 |
| 919 | 3300053104 | Ga0500556_0013425 | Ga0500556_0013425_1492_2316 | 265 |
| 920 | 3300053104 | Ga0500556_0127844 | Ga0500556_0127844_37_834 | 265 |
| 921 | 3300053105 | Ga0500557_000118 | Ga0500557_000118_10799_11599 | 265 |
| 922 | 3300053109 | Ga0500569_103259 | Ga0500569_103259_66_866 | 265 |
| 923 | 3300053111 | Ga0500572_030574 | Ga0500572_030574_133_933 | 265 |
| 924 | 3300053116 | Ga0500592_013606 | Ga0500592_013606_138_938 | 265 |
| 925 | 3300053119 | Ga0500595_008077 | Ga0500595_008077_841_1665 | 265 |
| 926 | 3300053119 | Ga0500595_014837 | Ga0500595_014837_956_1783 | 265 |
| 927 | 3300053119 | Ga0500595_021175 | Ga0500595_021175_987_1844 | 265 |
| 928 | 3300053119 | Ga0500595_056431 | Ga0500595_056431_102_1034 | 265 |
| 929 | 3300053121 | Ga0500607_049118 | Ga0500607_049118_291_1091 | 265 |
| 930 | 3300053123 | Ga0500614_022081 | Ga0500614_022081_350_1150 | 265 |
| 931 | 3300053130 | Ga0500642_0000164 | Ga0500642_0000164_19871_20668 | 265 |
| 932 | 3300053130 | Ga0500642_0030702 | Ga0500642_0030702_1090_1890 | 265 |
| 933 | 3300053130 | Ga0500642_0093164 | Ga0500642_0093164_59_883 | 265 |
| 934 | 3300053136 | Ga0500559_0020595 | Ga0500559_0020595_1936_2736 | 265 |
| 935 | 3300053136 | Ga0500559_0038988 | Ga0500559_0038988_1078_1878 | 265 |
| 936 | 3300053139 | Ga0500568_0014981 | Ga0500568_0014981_1729_2580 | 265 |
| 937 | 3300053153 | Ga0500616_0011794 | Ga0500616_0011794_707_1504 | 265 |
| 938 | 3300053155 | Ga0500620_009505 | Ga0500620_009505_79_879 | 265 |
| 939 | 3300053162 | Ga0500638_004886 | Ga0500638_004886_3460_4260 | 265 |
| 940 | 3300053163 | Ga0500639_005653 | Ga0500639_005653_3696_4496 | 265 |
| 941 | 3300053163 | Ga0500639_158143 | Ga0500639_158143_13_813 | 265 |
| 942 | 3300053177 | Ga0500636_0068534 | Ga0500636_0068534_448_1248 | 265 |
| 943 | 3300053177 | Ga0500636_0131471 | Ga0500636_0131471_449_1249 | 265 |
| 944 | 3300053729 | Ga0500625_022233 | Ga0500625_022233_257_1057 | 265 |
| 945 | 3300053735 | Ga0500596_001677 | Ga0500596_001677_1669_2469 | 265 |
| 946 | 3300053735 | Ga0500596_013825 | Ga0500596_013825_210_1010 | 265 |
| 947 | 3300054114 | Ga0501084_0274526 | Ga0501084_0274526_298_1122 | 265 |
| 948 | 3300055283 | Ga0500661_008628 | Ga0500661_008628_554_1354 | 265 |
| 949 | iso_pu_bacteria | 2847930680 | 2847930927 | 265 |
| 950 | iso_pu_bacteria | 3005506211 | 3005509331 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tf4-assembly2.cif.gz_F | crystal structure of enoyl-(acyl carrier protein) reductase from bartonella henselae in complext with nad | 0.9827 | 3 | 254 |
| 3grk-assembly2.cif.gz_G | crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis | 0.9815 | 3 | 254 |
| 4eit-assembly2.cif.gz_E-2 | crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae | 0.9815 | 2 | 254 |
| 8jfm-assembly2.cif.gz_E | crystal structure of enoyl-acp reductase fabi in complex with nadh from helicobacter pylori | 0.9814 | 3 | 254 |
| 2p91-assembly1.cif.gz_A | crystal structure of enoyl-[acyl-carrier-protein] reductase (nadh) from aquifex aeolicus vf5 | 0.9793 | 3 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9802 | 3 | 254 | 3.40.50.720 |
| 2p91A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9793 | 3 | 254 | 3.40.50.720 |
| 4cv1H00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.97 | 5 | 254 | 3.40.50.720 |
| 2p91C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9696 | 5 | 254 | 3.40.50.720 |
| 3grkC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9685 | 3 | 254 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431MZJ8-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.996 | 5 | 138 |
GO:0004318
GO:0006633 |
| AF-A0A357X796-F1-model_v4 | deleted | 0.9955 | 1 | 189 |
|
| AF-A0A531N3K7-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.9941 | 1 | 177 |
GO:0004318
GO:0006633 |
| AF-A0A530H3P2-F1-model_v4 | enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) | 0.994 | 1 | 198 |
GO:0004318
GO:0006633 GO:0016746 |
| AF-A0A356HZB3-F1-model_v4 | NADH-specific enoyl-ACP reductase | 0.9928 | 3 | 166 |
GO:0004318
GO:0006633 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar