F486569

General Info

Members Datasets Scaffolds Average Seq Length
950 570 759 267

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_056431|Ga0500595_056431_102_1034
Length 310
Sequence MLSCPAKAGHRVSVAARIIARVARLHRPVELGDDVRKIKWSVPTMQDLMKGKRGLIMGIANDHSIAWGIAKALATQGAELAFSYQGEAQSKRLKPLVQPFGFDIVLPCDVEDIASVDQMFAALRERWDRLDFLVHAIGFTEKNELRGRYADTTRENFSRTMLISCFSFTEIAKRAAGMMPATGGSMITLTYGASMRAMPNYNVMGVAKAALEASVRYLAADFGPQGVRVNAISAGPVRTLAGSVIGDARAMFAFQQKHSPLGRGVTLDELGGSALYLLSDLAGGVTGEIHYVDSGYNIVLQPRPENMAPE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
22 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
23 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
24 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
25 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
26 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
32 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
33 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
34 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
35 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
36 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
37 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
38 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
39 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
40 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
41 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
42 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
43 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
44 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
45 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
46 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
47 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
48 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
49 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
50 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
51 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
52 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
53 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
54 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
55 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
56 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
57 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
58 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
59 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
64 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
65 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
71 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
72 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
73 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
74 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
75 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
76 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
77 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
78 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
79 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
80 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
81 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
82 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
83 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
84 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
85 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
86 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
87 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
88 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
89 2922368715
90 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
91 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
92 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
93 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
94 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
95 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
96 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
97 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
98 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
99 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
100 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
101 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
102 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
103 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
104 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
105 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
106 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
107 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
108 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
109 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
110 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
111 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
112 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
113 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
114 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
115 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
116 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
117 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
118 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
119 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
120 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
121 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
122 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
123 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
124 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
125 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
126 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
127 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
128 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
129 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
130 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
131 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
132 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
133 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
134 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
135 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
136 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
137 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
138 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
139 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
140 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
141 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
142 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
143 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
144 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
145 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
146 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
147 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
148 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
149 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
150 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
151 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
152 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
153 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
154 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
155 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
156 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
157 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
158 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
159 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
160 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
161 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
162 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
163 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
164 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
165 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
166 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
167 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
168 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
169 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
170 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
171 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
172 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
173 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
174 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
175 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
176 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
177 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
178 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
179 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
180 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
181 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
182 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
183 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
184 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
185 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
186 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
187 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
188 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
189 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
190 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
191 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
192 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
193 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
194 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
195 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
196 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
197 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
198 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
199 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
200 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
201 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
202 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
203 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
204 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
205 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
206 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
207 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
208 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
209 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
210 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
211 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
212 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
213 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
214 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
215 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
216 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
217 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
218 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
219 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
220 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
221 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
222 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
223 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
224 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
225 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
226 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
227 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
228 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
229 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
230 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
231 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
232 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
233 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
234 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
235 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
236 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
237 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
238 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
239 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
240 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
245 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
246 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
247 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
248 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
249 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
250 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
251 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
252 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
253 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
254 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
255 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
256 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
257 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
258 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
260 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
264 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
266 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
317 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
318 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
319 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
320 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
321 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
324 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
325 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
326 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
327 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
328 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
329 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
330 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
331 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
332 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
333 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
335 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
336 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
337 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
338 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
339 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
340 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
341 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
342 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
343 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
344 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
345 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
346 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
347 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
348 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
349 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
350 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
351 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
352 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
353 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
354 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
355 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
356 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
357 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
358 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
359 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
360 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
361 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
362 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
363 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
364 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
365 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
366 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
367 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
368 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
369 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
370 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
371 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
372 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
373 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
374 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
375 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
376 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
377 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
378 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
379 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
380 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
381 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
382 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
383 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
384 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
385 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
386 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
387 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
388 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
389 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
390 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
391 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
392 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
393 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
394 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
395 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
396 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
397 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
398 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
401 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
402 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
403 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
404 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
405 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
406 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
407 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
408 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
409 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
410 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
411 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
412 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
413 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
414 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
415 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
416 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
417 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
418 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
419 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
420 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
421 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
422 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
423 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
424 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
425 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
426 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
427 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
428 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
429 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
430 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
431 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
432 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
433 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
434 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
435 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
436 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
437 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
438 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
439 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
440 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
441 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
442 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
443 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
444 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
445 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
446 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
447 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
448 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
449 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
450 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
451 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
452 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
453 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
454 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
455 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
456 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
457 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
458 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
459 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
460 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
461 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
462 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
463 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
464 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
465 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
466 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
467 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
468 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
469 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
470 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
471 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
472 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
473 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
474 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
475 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
476 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
485 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
486 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
487 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
488 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
489 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
490 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
491 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
492 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
493 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
494 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
495 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
496 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
497 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
498 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
499 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
500 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
501 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
502 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
503 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
504 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
505 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
506 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
507 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
508 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
509 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
510 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
511 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
512 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
513 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
514 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
515 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
516 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
517 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
518 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
519 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
520 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
521 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
522 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
523 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
524 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
525 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
526 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
527 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
528 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
529 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
530 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
531 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
532 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
533 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
534 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
535 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
536 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
537 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
538 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
539 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
540 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
541 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
542 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
543 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
544 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
545 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
546 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
547 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
548 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
549 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
550 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
551 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
552 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
553 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
554 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
555 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
556 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
557 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
558 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
559 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
560 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
561 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
562 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
563 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
564 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
565 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
566 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
567 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
568 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
569 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
570 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.66
Metatranscriptomes 0.32
Isolates 20.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.32
Nodule 16.42
Rhizoplane 7.37
Rhizosphere 57.05
Stem 0
Stem Tuber 0
Unclassified 8.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10003121 3300003215 Bacteria 9344
2 JGI25153J46596_10003625 3300003215 Bacteria 8573
3 JGI25153J46596_10005115 3300003215 Bacteria 6918
4 JGI25153J46596_10010926 3300003215 Bacteria 4058
5 JGI25160J50197_1001001 3300003354 Bacteria 14647
6 JGI25160J50197_1003544 3300003354 Bacteria 6950
7 Ga0055531_10003282 3300003794 Bacteria 10366
8 Ga0055543_1003105 3300004625 Bacteria 5088
9 Ga0055543_1012639 3300004625 Bacteria 1689
10 Ga0065165_1006509 3300005262 Bacteria 6097
11 Ga0065165_1007472 3300005262 Bacteria 5358
12 Ga0065715_10303924 3300005293 Bacteria 1035
13 Ga0070658_10029625 3300005327 Bacteria 4398
14 Ga0070658_10065949 3300005327 Bacteria 2956
15 Ga0070658_10086288 3300005327 Bacteria 2582
16 Ga0070676_10283124 3300005328 Bacteria 1118
17 Ga0070683_100019421 3300005329 Bacteria 6036
18 Ga0070683_100037636 3300005329 Bacteria 4429
19 Ga0070683_100082862 3300005329 Bacteria 3004
20 Ga0070683_100201118 3300005329 Bacteria 1892
21 Ga0068869_100184781 3300005334 Bacteria 1636
22 Ga0070666_10067804 3300005335 Bacteria 2423
23 Ga0070666_10137472 3300005335 Bacteria 1701
24 Ga0070680_100005994 3300005336 Bacteria 9221
25 Ga0070680_100023189 3300005336 Bacteria 4948
26 Ga0070680_100038993 3300005336 Bacteria 3843
27 Ga0070680_100409143 3300005336 Bacteria 1157
28 Ga0070682_100099940 3300005337 Bacteria 1913
29 Ga0068868_100006519 3300005338 Bacteria 8266
30 Ga0070660_100009116 3300005339 Bacteria 6963
31 Ga0070689_100017799 3300005340 Bacteria 5224
32 Ga0070691_10119312 3300005341 Bacteria 1327
33 Ga0070661_100230067 3300005344 Bacteria 1424
34 Ga0070675_100066168 3300005354 Bacteria 2989
35 Ga0070671_100082907 3300005355 Bacteria 2682
36 Ga0070671_100438802 3300005355 Bacteria 1119
37 Ga0070673_100179111 3300005364 Bacteria 1814
38 Ga0070688_100013010 3300005365 Bacteria 4682
39 Ga0070688_100354506 3300005365 Bacteria 1075
40 Ga0070667_100184122 3300005367 Bacteria 1848
41 Ga0070709_10408689 3300005434 Bacteria 1015
42 Ga0070710_10071421 3300005437 Bacteria 2002
43 Ga0070711_100048433 3300005439 Bacteria 2906
44 Ga0070711_100048890 3300005439 Bacteria 2894
45 Ga0070711_100093270 3300005439 Bacteria 2174
46 Ga0070711_100102626 3300005439 Bacteria 2083
47 Ga0070700_100133379 3300005441 Bacteria 1679
48 Ga0070663_100117697 3300005455 Bacteria 2004
49 Ga0070678_100149557 3300005456 Bacteria 1879
50 Ga0070681_10013547 3300005458 Bacteria 8109
51 Ga0070681_10020781 3300005458 Bacteria 6576
52 Ga0070681_10155095 3300005458 Bacteria 2215
53 Ga0070685_10189807 3300005466 Bacteria 1328
54 Ga0070679_100054647 3300005530 Bacteria 3976
55 Ga0070679_100337085 3300005530 Bacteria 1456
56 Ga0070684_100012686 3300005535 Bacteria 6762
57 Ga0070684_100055646 3300005535 Bacteria 3450
58 Ga0070684_100061498 3300005535 Bacteria 3287
59 Ga0070697_100000586 3300005536 Bacteria 27495
60 Ga0068853_100007407 3300005539 Bacteria 8778
61 Ga0068853_100191638 3300005539 Bacteria 1857
62 Ga0068853_100475340 3300005539 Bacteria 1178
63 Ga0070665_100078771 3300005548 Bacteria 3302
64 Ga0070704_100124084 3300005549 Bacteria 1989
65 Ga0068855_100317504 3300005563 Bacteria 1723
66 Ga0068855_100526079 3300005563 Bacteria 1282
67 Ga0068855_100628085 3300005563 Bacteria 1156
68 Ga0068855_100722856 3300005563 Bacteria 1064
69 Ga0070664_100431590 3300005564 Bacteria 1208
70 Ga0070664_100439030 3300005564 Bacteria 1197
71 Ga0068857_100015264 3300005577 Bacteria 6704
72 Ga0068857_100106530 3300005577 Bacteria 2518
73 Ga0068854_100129752 3300005578 Bacteria 1923
74 Ga0068856_100019802 3300005614 Bacteria 6532
75 Ga0068856_100025298 3300005614 Bacteria 5786
76 Ga0068856_100064181 3300005614 Bacteria 3629
77 Ga0068852_100011334 3300005616 Bacteria 6707
78 Ga0068852_100735459 3300005616 Bacteria 998
79 Ga0068864_100024902 3300005618 Bacteria 5034
80 Ga0068864_100072754 3300005618 Bacteria 2997
81 Ga0068864_100583628 3300005618 Bacteria 1083
82 Ga0068866_10025845 3300005718 Bacteria 2766
83 Ga0068851_10192968 3300005834 Bacteria 1133
84 Ga0068863_100287447 3300005841 Bacteria 1594
85 Ga0068858_100051636 3300005842 Bacteria 3804
86 Ga0068858_100379450 3300005842 Bacteria 1356
87 Ga0068858_100544947 3300005842 Bacteria 1123
88 Ga0068860_100001623 3300005843 Bacteria 24139
89 Ga0068860_100100464 3300005843 Bacteria 2760
90 Ga0068862_100412492 3300005844 Bacteria 1266
91 Ga0068862_100640029 3300005844 Bacteria 1025
92 Ga0081455_10002724 3300005937 Bacteria 20860
93 Ga0081538_10073681 3300005981 Bacteria 1864
94 Ga0081540_1005028 3300005983 Bacteria 9926
95 Ga0081540_1097565 3300005983 Bacteria 1275
96 Ga0081540_1148590 3300005983 Bacteria 928
97 Ga0070717_10013327 3300006028 Bacteria 6296
98 Ga0075365_10087924 3300006038 Bacteria 2113
99 Ga0075365_10324439 3300006038 Bacteria 1084
100 Ga0075368_10028712 3300006042 Bacteria 2150
101 Ga0075363_100046693 3300006048 Bacteria 2299
102 Ga0075363_100058425 3300006048 Bacteria 2072
103 Ga0075364_10016682 3300006051 Bacteria 4572
104 Ga0075364_10110569 3300006051 Bacteria 1833
105 Ga0070715_10188242 3300006163 Bacteria 1040
106 Ga0070716_100113562 3300006173 Bacteria 1683
107 Ga0070712_100152731 3300006175 Bacteria 1774
108 Ga0070712_100170594 3300006175 Bacteria 1688
109 Ga0075367_10016821 3300006178 Bacteria 4000
110 Ga0075367_10018650 3300006178 Bacteria 3832
111 Ga0075367_10033232 3300006178 Bacteria 2972
112 Ga0075366_10002189 3300006195 Bacteria 9977
113 Ga0075366_10010105 3300006195 Bacteria 5291
114 Ga0097621_100156763 3300006237 Bacteria 1955
115 Ga0097621_100177899 3300006237 Bacteria 1837
116 Ga0075370_10145107 3300006353 Bacteria 1389
117 Ga0075370_10182249 3300006353 Bacteria 1236
118 Ga0075434_100334058 3300006871 Bacteria 1536
119 Ga0075436_100040321 3300006914 Bacteria 3223
120 Ga0099824_1031610 3300006942 Bacteria 1988
121 Ga0099823_1022934 3300006944 Bacteria 5747
122 Ga0105240_10002261 3300009093 Bacteria 31223
123 Ga0105240_10062622 3300009093 Bacteria 4630
124 Ga0105245_10013837 3300009098 Bacteria 7028
125 Ga0105245_10043050 3300009098 Bacteria 4028
126 Ga0105247_10054065 3300009101 Bacteria 2478
127 Ga0114129_10271364 3300009147 Bacteria 2269
128 Ga0105241_10029766 3300009174 Bacteria 4076
129 Ga0105241_10046596 3300009174 Bacteria 3293
130 Ga0105241_10560854 3300009174 Bacteria 1027
131 Ga0105242_10109173 3300009176 Bacteria 2356
132 Ga0105242_10229813 3300009176 Bacteria 1662
133 Ga0105242_10426952 3300009176 Bacteria 1243
134 Ga0105248_10041110 3300009177 Bacteria 5183
135 Ga0105248_10138209 3300009177 Bacteria 2748
136 Ga0105248_10175253 3300009177 Bacteria 2417
137 Ga0105248_10215497 3300009177 Bacteria 2163
138 Ga0105237_10003763 3300009545 Bacteria 17858
139 Ga0105237_10145812 3300009545 Bacteria 2362
140 Ga0105237_10174664 3300009545 Bacteria 2149
141 Ga0105237_10273079 3300009545 Bacteria 1693
142 Ga0105237_10579255 3300009545 Bacteria 1129
143 Ga0105237_10659413 3300009545 Bacteria 1053
144 Ga0105238_10015969 3300009551 Bacteria 7597
145 Ga0105238_10069807 3300009551 Bacteria 3514
146 Ga0105238_10193609 3300009551 Bacteria 2009
147 Ga0105238_10371555 3300009551 Bacteria 1420
148 Ga0105239_10023195 3300010375 Bacteria 6839
149 Ga0105239_10094285 3300010375 Bacteria 3306
150 Ga0105239_10216930 3300010375 Bacteria 2145
151 Ga0105246_10325764 3300011119 Bacteria 1250
152 Ga0105246_10372420 3300011119 Bacteria 1177
153 Ga0105246_10403074 3300011119 Bacteria 1136
154 Ga0157370_10035814 3300013104 Bacteria 4820
155 Ga0157370_10159270 3300013104 Bacteria 2101
156 Ga0157370_10317136 3300013104 Bacteria 1438
157 Ga0157369_10053722 3300013105 Bacteria 4352
158 Ga0157369_10106099 3300013105 Bacteria 2990
159 Ga0157374_10003265 3300013296 Bacteria 13623
160 Ga0157374_10040674 3300013296 Bacteria 4282
161 Ga0157378_10451639 3300013297 Bacteria 1276
162 Ga0163162_10081555 3300013306 Bacteria 3305
163 Ga0163162_10268331 3300013306 Bacteria 1838
164 Ga0157372_10350627 3300013307 Bacteria 1720
165 Ga0157372_10484785 3300013307 Bacteria 1441
166 Ga0157375_10144815 3300013308 Bacteria 2506
167 Ga0157375_10682301 3300013308 Bacteria 1182
168 Ga0163163_10013126 3300014325 Bacteria 7568
169 Ga0163163_10036751 3300014325 Bacteria 4759
170 Ga0163163_10193639 3300014325 Bacteria 2081
171 Ga0163163_10475585 3300014325 Bacteria 1310
172 Ga0157376_10064439 3300014969 Bacteria 3091
173 Ga0157376_10577463 3300014969 Bacteria 1116
174 Ga0182007_10047038 3300015262 Bacteria 1427
175 Ga0197907_10378139 3300020069 Bacteria 2098
176 Ga0214544_1000056 3300021320 Bacteria 132760
177 Ga0214544_1016313 3300021320 Bacteria 7228
178 Ga0214542_1000071 3300021321 Bacteria 124568
179 Ga0214542_1016361 3300021321 Bacteria 7226
180 Ga0214545_1000033 3300021324 Bacteria 124568
181 Ga0214545_1015478 3300021324 Bacteria 8323
182 Ga0214543_1000105 3300021327 Bacteria 108404
183 Ga0214543_1018322 3300021327 Bacteria 6472
184 Ga0213874_10014038 3300021377 Bacteria 2088
185 Ga0213876_10078817 3300021384 Bacteria 1741
186 Ga0213876_10107567 3300021384 Bacteria 1480
187 Ga0213871_10000532 3300021441 Bacteria 5293
188 Ga0224712_10019051 3300022467 Bacteria 2307
189 Ga0228598_1006636 3300024227 Bacteria 2390
190 Ga0207425_1027375 3300025245 Bacteria 1163
191 Ga0209148_1000308 3300025254 Bacteria 70131
192 Ga0209233_1008097 3300025261 Bacteria 3281
193 Ga0209455_1001786 3300025272 Bacteria 9080
194 Ga0209673_1023416 3300025273 Bacteria 2103
195 Ga0209564_1006612 3300025295 Bacteria 6206
196 Ga0209758_1000182 3300025297 Bacteria 140630
197 Ga0209758_1000293 3300025297 Bacteria 98643
198 Ga0209758_1000363 3300025297 Bacteria 80753
199 Ga0209758_1002068 3300025297 Bacteria 21433
200 Ga0209758_1003509 3300025297 Bacteria 14159
201 Ga0209758_1003517 3300025297 Bacteria 14133
202 Ga0209758_1005730 3300025297 Bacteria 9361
203 Ga0209758_1041376 3300025297 Bacteria 1723
204 Ga0209256_1004270 3300025299 Bacteria 9131
205 Ga0207426_1000628 3300025302 Bacteria 44820
206 Ga0207426_1000992 3300025302 Bacteria 27820
207 Ga0207426_1004958 3300025302 Bacteria 6274
208 Ga0207426_1051290 3300025302 Bacteria 1226
209 Ga0209257_1004239 3300025304 Bacteria 11331
210 Ga0207682_10039152 3300025893 Bacteria 1926
211 Ga0207692_10055491 3300025898 Bacteria 2028
212 Ga0207710_10049316 3300025900 Bacteria 1886
213 Ga0207688_10054132 3300025901 Bacteria 2251
214 Ga0207680_10483967 3300025903 Bacteria 880
215 Ga0207647_10025176 3300025904 Bacteria 3915
216 Ga0207647_10071165 3300025904 Bacteria 2098
217 Ga0207699_10006255 3300025906 Bacteria 5750
218 Ga0207699_10060143 3300025906 Bacteria 2280
219 Ga0207705_10120850 3300025909 Bacteria 1943
220 Ga0207684_10036512 3300025910 Bacteria 4170
221 Ga0207684_10710782 3300025910 Bacteria 853
222 Ga0207654_10014572 3300025911 Bacteria 4063
223 Ga0207654_10035456 3300025911 Bacteria 2780
224 Ga0207654_10065304 3300025911 Bacteria 2142
225 Ga0207707_10001497 3300025912 Bacteria 21565
226 Ga0207707_10008114 3300025912 Bacteria 9117
227 Ga0207707_10227578 3300025912 Bacteria 1623
228 Ga0207707_10242364 3300025912 Bacteria 1567
229 Ga0207695_10000107 3300025913 Bacteria 252606
230 Ga0207695_10075896 3300025913 Bacteria 3419
231 Ga0207695_10302167 3300025913 Bacteria 1491
232 Ga0207671_10004749 3300025914 Bacteria 12824
233 Ga0207671_10039127 3300025914 Bacteria 3513
234 Ga0207671_10082792 3300025914 Bacteria 2408
235 Ga0207671_10212429 3300025914 Bacteria 1514
236 Ga0207693_10009900 3300025915 Bacteria 7752
237 Ga0207693_10010117 3300025915 Bacteria 7662
238 Ga0207693_10027198 3300025915 Bacteria 4522
239 Ga0207693_10208324 3300025915 Bacteria 1537
240 Ga0207693_10297614 3300025915 Bacteria 1264
241 Ga0207663_10099417 3300025916 Bacteria 1950
242 Ga0207663_10230344 3300025916 Bacteria 1353
243 Ga0207663_10295252 3300025916 Bacteria 1209
244 Ga0207663_10406573 3300025916 Bacteria 1042
245 Ga0207660_10005316 3300025917 Bacteria 8367
246 Ga0207660_10010250 3300025917 Bacteria 6075
247 Ga0207660_10086834 3300025917 Bacteria 2310
248 Ga0207662_10025921 3300025918 Bacteria 3379
249 Ga0207657_10015131 3300025919 Bacteria 7492
250 Ga0207657_10108627 3300025919 Bacteria 2293
251 Ga0207652_10001692 3300025921 Bacteria 19294
252 Ga0207652_10010419 3300025921 Bacteria 7483
253 Ga0207652_10020006 3300025921 Bacteria 5511
254 Ga0207652_10036040 3300025921 Bacteria 4181
255 Ga0207652_10174700 3300025921 Bacteria 1929
256 Ga0207646_10193674 3300025922 Bacteria 1836
257 Ga0207694_10105768 3300025924 Bacteria 2234
258 Ga0207694_10111282 3300025924 Bacteria 2179
259 Ga0207694_10276473 3300025924 Bacteria 1378
260 Ga0207694_10290509 3300025924 Bacteria 1344
261 Ga0207659_10146537 3300025926 Bacteria 1839
262 Ga0207687_10008035 3300025927 Bacteria 6906
263 Ga0207687_10078731 3300025927 Bacteria 2374
264 Ga0207700_10069113 3300025928 Bacteria 2710
265 Ga0207644_10023803 3300025931 Bacteria 4199
266 Ga0207686_10183825 3300025934 Bacteria 1484
267 Ga0207686_10239349 3300025934 Bacteria 1320
268 Ga0207709_10023155 3300025935 Bacteria 3532
269 Ga0207709_10348394 3300025935 Bacteria 1117
270 Ga0207670_10012150 3300025936 Bacteria 5026
271 Ga0207665_10180376 3300025939 Bacteria 1529
272 Ga0207665_10206960 3300025939 Bacteria 1432
273 Ga0207691_10099020 3300025940 Bacteria 2604
274 Ga0207711_10076621 3300025941 Bacteria 2913
275 Ga0207689_10110600 3300025942 Bacteria 2258
276 Ga0207689_10114552 3300025942 Bacteria 2216
277 Ga0207661_10000579 3300025944 Bacteria 23347
278 Ga0207661_10002114 3300025944 Bacteria 13669
279 Ga0207661_10009038 3300025944 Bacteria 7139
280 Ga0207661_10193615 3300025944 Bacteria 1784
281 Ga0207667_10003118 3300025949 Bacteria 20511
282 Ga0207667_10235698 3300025949 Bacteria 1873
283 Ga0207651_10111548 3300025960 Bacteria 2054
284 Ga0207640_10134797 3300025981 Bacteria 1791
285 Ga0207640_10369666 3300025981 Bacteria 1158
286 Ga0207677_10008707 3300026023 Bacteria 5681
287 Ga0207703_10038775 3300026035 Bacteria 3805
288 Ga0207639_10009580 3300026041 Bacteria 6687
289 Ga0207639_10269549 3300026041 Bacteria 1493
290 Ga0207639_10493629 3300026041 Bacteria 1117
291 Ga0207639_10536094 3300026041 Bacteria 1073
292 Ga0207639_10852155 3300026041 Bacteria 851
293 Ga0207678_10196358 3300026067 Bacteria 1725
294 Ga0207678_10214204 3300026067 Bacteria 1648
295 Ga0207708_10047301 3300026075 Bacteria 3275
296 Ga0207702_10000350 3300026078 Bacteria 52867
297 Ga0207702_10143796 3300026078 Bacteria 2161
298 Ga0207702_10363389 3300026078 Bacteria 1388
299 Ga0207641_10122834 3300026088 Bacteria 2320
300 Ga0207648_10616534 3300026089 Bacteria 1001
301 Ga0207676_10095607 3300026095 Bacteria 2450
302 Ga0207676_10132387 3300026095 Bacteria 2122
303 Ga0207676_10541246 3300026095 Bacteria 1111
304 Ga0207674_10011007 3300026116 Bacteria 10173
305 Ga0207674_10117504 3300026116 Bacteria 2630
306 Ga0207675_100137407 3300026118 Bacteria 2320
307 Ga0207683_10019572 3300026121 Bacteria 5781
308 Ga0207683_10058673 3300026121 Bacteria 3379
309 Ga0207683_10299206 3300026121 Bacteria 1472
310 Ga0207698_10018469 3300026142 Bacteria 4752
311 Ga0207698_10318921 3300026142 Bacteria 1454
312 Ga0207698_10530778 3300026142 Bacteria 1150
313 Ga0207698_10628096 3300026142 Bacteria 1062
314 Ga0209389_1000208 3300027296 Bacteria 42287
315 Ga0209389_1000217 3300027296 Bacteria 39758
316 Ga0209589_1000032 3300027357 Bacteria 141881
317 Ga0209489_101970 3300027361 Bacteria 42287
318 Ga0209489_102214 3300027361 Bacteria 39758
319 Ga0209700_100011 3300027363 Bacteria 362159
320 Ga0209813_10010120 3300027866 Bacteria 2431
321 Ga0268266_10369146 3300028379 Bacteria 1351
322 Ga0268264_10000227 3300028381 Bacteria 109454
323 Ga0265337_1028055 3300028556 Bacteria 1693
324 Ga0265326_10016944 3300028558 Bacteria 2104
325 Ga0265319_1005200 3300028563 Bacteria 6286
326 Ga0265334_10015788 3300028573 Bacteria 3133
327 Ga0265318_10008563 3300028577 Bacteria 4544
328 Ga0265323_10001243 3300028653 Bacteria 12808
329 Ga0265322_10014422 3300028654 Bacteria 2283
330 Ga0265336_10000410 3300028666 Bacteria 26721
331 Ga0265338_10000277 3300028800 Bacteria 93095
332 Ga0265324_10005967 3300029957 Bacteria 5159
333 Ga0265760_10037980 3300031090 Bacteria 1430
334 Ga0265330_10039036 3300031235 Bacteria 2110
335 Ga0265332_10019622 3300031238 Bacteria 2984
336 Ga0265325_10000061 3300031241 Bacteria 75502
337 Ga0265325_10079574 3300031241 Bacteria 1631
338 Ga0265339_10022187 3300031249 Bacteria 3681
339 Ga0265331_10032820 3300031250 Bacteria 2570
340 Ga0265331_10071962 3300031250 Bacteria 1616
341 Ga0265331_10076691 3300031250 Bacteria 1558
342 Ga0307508_10000002 3300031616 Bacteria 407635
343 Ga0307508_10226053 3300031616 Bacteria 1471
344 Ga0265342_10022741 3300031712 Bacteria 3981
345 Ga0307516_10035775 3300031730 Bacteria 4978
346 Ga0307409_100639120 3300031995 Bacteria 1056
347 Ga0307510_10006388 3300033180 Bacteria 14055
348 Ga0307510_10145934 3300033180 Bacteria 1998
349 Ga0373930_0041962 3300034816 Bacteria 978
350 Ga0373934_0004728 3300035086 Bacteria 5034
351 Ga0373934_0069340 3300035086 Bacteria 1409
352 Ga0373923_0010717 3300035111 Bacteria 3344
353 Ga0373923_0014593 3300035111 Bacteria 2954
354 Ga0373923_0032775 3300035111 Bacteria 2100
355 Ga0373932_0020906 3300035112 Bacteria 1721
356 Ga0373936_0093673 3300035113 Bacteria 1261
357 Ga0373945_0062313 3300035116 Bacteria 1394
358 Ga0373953_0000653 3300035117 Bacteria 9634
359 Ga0373953_0075295 3300035117 Bacteria 1397
360 Ga0373954_0015067 3300035118 Bacteria 3453
361 Ga0373956_0001298 3300035119 Bacteria 10347
362 Ga0373957_0004778 3300035120 Bacteria 4150
363 Ga0373957_0050678 3300035120 Bacteria 1587
364 Ga0373960_0017880 3300035121 Bacteria 1842
365 Ga0373943_0024874 3300035170 Bacteria 2795
366 Ga0373946_0028416 3300035171 Bacteria 2218
367 Ga0373955_0000648 3300035172 Bacteria 14857
368 Ga0373955_0007599 3300035172 Bacteria 4992
369 Ga0373924_0004102 3300035410 Bacteria 5069
370 Ga0373924_0048843 3300035410 Bacteria 1749
371 Ga0373924_0099467 3300035410 Bacteria 1250
372 Ga0373931_0005720 3300035691 Bacteria 5776
373 Ga0373935_0004102 3300035692 Bacteria 8522
374 Ga0373935_0204600 3300035692 Bacteria 1365
375 Ga0373935_0335606 3300035692 Bacteria 1075
376 Ga0373927_0003439 3300035695 Bacteria 11340
377 Ga0373927_0018648 3300035695 Bacteria 4555
378 Ga0373927_0028077 3300035695 Bacteria 3672
379 Ga0373927_0078821 3300035695 Bacteria 2133
380 Ga0373927_0195756 3300035695 Bacteria 1326
381 Ga0373933_0000655 3300035724 Bacteria 21529
382 Ga0373947_0005223 3300035725 Bacteria 7588
383 Ga0373947_0016157 3300035725 Bacteria 4289
384 Ga0373947_0070390 3300035725 Bacteria 2143
385 Ga0373937_0021124 3300036401 Bacteria 5842
386 Ga0373937_0231133 3300036401 Bacteria 1742
387 Ga0373937_0680877 3300036401 Bacteria 974
388 Ga0373925_0003059 3300037068 Bacteria 13150
389 Ga0373925_0022013 3300037068 Bacteria 4645
390 Ga0373925_0168079 3300037068 Bacteria 1730
391 Ga0373925_0247068 3300037068 Bacteria 1430
392 Ga0395899_0080697 3300037312 Bacteria 2367
393 Ga0395899_0134770 3300037312 Bacteria 1761
394 Ga0395900_0001316 3300037418 Bacteria 30150
395 Ga0395900_0166608 3300037418 Bacteria 2245
396 Ga0395900_0314598 3300037418 Bacteria 1548
397 Ga0395898_0010275 3300037466 Bacteria 9797
398 Ga0395898_0261031 3300037466 Bacteria 1652
399 Ga0395905_0019550 3300037471 Bacteria 6419
400 Ga0395905_0060353 3300037471 Bacteria 3546
401 Ga0395905_0417953 3300037471 Bacteria 1237
402 Ga0395905_0539360 3300037471 Bacteria 1067
403 Ga0436364_1211788 3300037853 Bacteria 1106
404 Ga0395901_0002762 3300038443 Bacteria 17695
405 Ga0395901_0256059 3300038443 Bacteria 1823
406 Ga0395901_0516788 3300038443 Bacteria 1214
407 Ga0436365_0478600 3300039437 Bacteria 4835
408 Ga0436365_0766912 3300039437 Bacteria 1919
409 Ga0436365_1108887 3300039437 Bacteria 1837
410 Ga0436365_1246013 3300039437 Bacteria 3666
411 Ga0436365_1695882 3300039437 Bacteria 3026
412 Ga0436365_1830473 3300039437 Bacteria 2714
413 Ga0436360_0784628 3300039438 Bacteria 1889
414 Ga0436361_0734729 3300039447 Bacteria 2078
415 Ga0436363_0071431 3300039450 Bacteria 2133
416 Ga0436363_0532985 3300039450 Bacteria 7779
417 Ga0436362_0566318 3300039453 Bacteria 1572
418 Ga0439453_0006071 3300041408 Bacteria 1866
419 Ga0451793_0431397 3300041452 Bacteria 1029
420 Ga0451800_0533584 3300041459 Bacteria 1059
421 Ga0451847_0528921 3300041503 Bacteria 851
422 Ga0450923_022894 3300042125 Bacteria 1228
423 Ga0466969_0030926 3300044656 Bacteria 2726
424 Ga0466972_0000233 3300044658 Bacteria 38493
425 Ga0466965_0080097 3300044683 Bacteria 1650
426 Ga0466965_0208720 3300044683 Bacteria 1038
427 Ga0466966_0002503 3300044684 Bacteria 12045
428 Ga0466961_0003092 3300044693 Bacteria 10344
429 Ga0466963_0026147 3300044694 Bacteria 3731
430 Ga0466963_0167611 3300044694 Bacteria 1530
431 Ga0466964_0099624 3300044706 Bacteria 1279
432 Ga0466968_0003054 3300044735 Bacteria 6190
433 Ga0466970_0043302 3300044765 Bacteria 2395
434 Ga0466957_0023758 3300044842 Bacteria 3626
435 Ga0466957_0122872 3300044842 Bacteria 1656
436 Ga0466960_0141135 3300044901 Bacteria 1280
437 Ga0466959_0002845 3300045049 Bacteria 11154
438 Ga0466959_0178884 3300045049 Bacteria 1484
439 Ga0466958_0042367 3300045836 Bacteria 2741
440 Ga0466967_0073867 3300045976 Bacteria 3060
441 Ga0466967_0230673 3300045976 Bacteria 1762
442 Ga0466967_0236391 3300045976 Bacteria 1741
443 Ga0466967_0286657 3300045976 Bacteria 1581
444 Ga0495592_0000614 3300046454 Bacteria 25241
445 Ga0495592_0008192 3300046454 Bacteria 7850
446 Ga0495592_0038952 3300046454 Bacteria 3573
447 Ga0495592_0079136 3300046454 Bacteria 2379
448 Ga0495603_0000048 3300046455 Bacteria 51928
449 Ga0495629_0000849 3300046459 Bacteria 24681
450 Ga0495629_0001230 3300046459 Bacteria 20107
451 Ga0495629_0008274 3300046459 Bacteria 7648
452 Ga0495629_0061767 3300046459 Bacteria 2618
453 Ga0495638_0002713 3300046460 Bacteria 14241
454 Ga0495641_0001887 3300046461 Bacteria 17166
455 Ga0495651_0001002 3300046462 Bacteria 21924
456 Ga0495651_0030344 3300046462 Bacteria 4216
457 Ga0495651_0322730 3300046462 Bacteria 1029
458 Ga0495651_0401786 3300046462 Bacteria 894
459 Ga0495653_0015208 3300046463 Bacteria 6272
460 Ga0495653_0036319 3300046463 Bacteria 3882
461 Ga0495653_0074237 3300046463 Bacteria 2535
462 Ga0495653_0092087 3300046463 Bacteria 2214
463 Ga0495650_0058010 3300046471 Bacteria 1565
464 Ga0495580_0000084 3300046472 Bacteria 60217
465 Ga0495580_0006567 3300046472 Bacteria 9456
466 Ga0495580_0348048 3300046472 Bacteria 1004
467 Ga0495580_0368426 3300046472 Bacteria 972
468 Ga0495582_0002918 3300046473 Bacteria 9560
469 Ga0495582_0013677 3300046473 Bacteria 4467
470 Ga0495639_0000009 3300046475 Bacteria 94240
471 Ga0495639_0023943 3300046475 Bacteria 2685
472 Ga0495662_0004398 3300046476 Bacteria 7075
473 Ga0495662_0117605 3300046476 Bacteria 1304
474 Ga0495664_0010080 3300046477 Bacteria 5301
475 Ga0495664_0040457 3300046477 Bacteria 2757
476 Ga0495664_0178097 3300046477 Bacteria 1289
477 Ga0495584_0221532 3300046491 Bacteria 962
478 Ga0495594_0000603 3300046499 Bacteria 18524
479 Ga0495594_0084913 3300046499 Bacteria 1771
480 Ga0495606_0032899 3300046507 Bacteria 3585
481 Ga0495608_0001026 3300046511 Bacteria 19595
482 Ga0495620_0060542 3300046515 Bacteria 1578
483 Ga0495628_0002528 3300046516 Bacteria 16449
484 Ga0495628_0042727 3300046516 Bacteria 3614
485 Ga0495628_0044189 3300046516 Bacteria 3546
486 Ga0495628_0048772 3300046516 Bacteria 3355
487 Ga0495628_0158703 3300046516 Bacteria 1719
488 Ga0495630_0025806 3300046517 Bacteria 4346
489 Ga0495630_0033567 3300046517 Bacteria 3828
490 Ga0495643_0109135 3300046522 Bacteria 1408
491 Ga0495648_0001769 3300046524 Bacteria 20843
492 Ga0495648_0016435 3300046524 Bacteria 5337
493 Ga0495666_0036789 3300046526 Bacteria 2383
494 Ga0495666_0101122 3300046526 Bacteria 1358
495 Ga0495652_0020043 3300046529 Bacteria 5948
496 Ga0495652_0023863 3300046529 Bacteria 5418
497 Ga0495652_0129656 3300046529 Bacteria 1998
498 Ga0495652_0393116 3300046529 Bacteria 983
499 Ga0495665_0016436 3300046531 Bacteria 3987
500 Ga0495665_0039184 3300046531 Bacteria 2524
501 Ga0495640_0006145 3300046533 Bacteria 9520
502 Ga0495640_0013322 3300046533 Bacteria 6249
503 Ga0495640_0017715 3300046533 Bacteria 5300
504 Ga0495640_0043150 3300046533 Bacteria 3142
505 Ga0495640_0330461 3300046533 Bacteria 943
506 Ga0495586_0036735 3300046535 Bacteria 2630
507 Ga0495587_0005697 3300046536 Bacteria 8116
508 Ga0495587_0015864 3300046536 Bacteria 4694
509 Ga0495587_0164813 3300046536 Bacteria 1260
510 Ga0495597_0082949 3300046542 Bacteria 1369
511 Ga0495645_0016024 3300046543 Bacteria 5343
512 Ga0495645_0017296 3300046543 Bacteria 5164
513 Ga0495645_0132541 3300046543 Bacteria 1745
514 Ga0495645_0171734 3300046543 Bacteria 1492
515 Ga0495622_0000771 3300046557 Bacteria 17886
516 Ga0495667_0001358 3300046559 Bacteria 16077
517 Ga0495667_0100245 3300046559 Bacteria 1874
518 Ga0495667_0128869 3300046559 Bacteria 1632
519 Ga0495634_0001541 3300046642 Bacteria 20331
520 Ga0495634_0038726 3300046642 Bacteria 3249
521 Ga0495634_0071770 3300046642 Bacteria 2278
522 Ga0495634_0099512 3300046642 Bacteria 1880
523 Ga0495634_0103258 3300046642 Bacteria 1840
524 Ga0495634_0167516 3300046642 Bacteria 1382
525 Ga0495635_0000119 3300046663 Bacteria 47408
526 Ga0495635_0000809 3300046663 Bacteria 20486
527 Ga0495635_0220597 3300046663 Bacteria 1282
528 Ga0495657_0006732 3300046675 Bacteria 8961
529 Ga0495657_0009585 3300046675 Bacteria 7335
530 Ga0495657_0012863 3300046675 Bacteria 6200
531 Ga0495599_0000513 3300046678 Bacteria 22163
532 Ga0495599_0099618 3300046678 Bacteria 1811
533 Ga0495599_0248148 3300046678 Bacteria 1084
534 Ga0495623_0009766 3300046679 Bacteria 6224
535 Ga0495623_0011049 3300046679 Bacteria 5841
536 Ga0495623_0022025 3300046679 Bacteria 4116
537 Ga0495646_0001869 3300046680 Bacteria 12662
538 Ga0495646_0054721 3300046680 Bacteria 2399
539 Ga0495646_0056971 3300046680 Bacteria 2341
540 Ga0495646_0074070 3300046680 Bacteria 1999
541 Ga0495658_0000420 3300046683 Bacteria 23768
542 Ga0495658_0009910 3300046683 Bacteria 4753
543 Ga0495613_0001484 3300046689 Bacteria 17888
544 Ga0495613_0153011 3300046689 Bacteria 1644
545 Ga0495624_0003095 3300046690 Bacteria 12447
546 Ga0495649_0002747 3300046694 Bacteria 12249
547 Ga0495649_0115963 3300046694 Bacteria 1418
548 Ga0495600_0004615 3300046809 Bacteria 8256
549 Ga0495600_0004930 3300046809 Bacteria 8013
550 Ga0495600_0021201 3300046809 Bacteria 4160
551 Ga0495600_0104968 3300046809 Bacteria 1841
552 Ga0495581_0000103 3300047315 Bacteria 35265
553 Ga0495581_0007321 3300047315 Bacteria 6387
554 Ga0495581_0193376 3300047315 Bacteria 1190
555 Ga0495604_0010711 3300047317 Bacteria 7277
556 Ga0495604_0020575 3300047317 Bacteria 5269
557 Ga0495604_0022153 3300047317 Bacteria 5071
558 Ga0495604_0223845 3300047317 Bacteria 1294
559 Ga0495674_0000367 3300047319 Bacteria 40173
560 Ga0495674_0011448 3300047319 Bacteria 8369
561 Ga0495674_0028981 3300047319 Bacteria 5043
562 Ga0495674_0093154 3300047319 Bacteria 2571
563 Ga0495674_0098456 3300047319 Bacteria 2490
564 Ga0495674_0325532 3300047319 Bacteria 1251
565 Ga0495672_0037918 3300047320 Bacteria 2945
566 Ga0495676_0344750 3300047321 Bacteria 997
567 Ga0495676_0387975 3300047321 Bacteria 928
568 Ga0495680_0002243 3300047322 Bacteria 19932
569 Ga0495680_0012531 3300047322 Bacteria 7457
570 Ga0495687_110629 3300047443 Bacteria 1010
571 Ga0495675_0000978 3300047444 Bacteria 17349
572 Ga0495675_0014791 3300047444 Bacteria 4934
573 Ga0495677_0083420 3300047445 Bacteria 1200
574 Ga0495673_0017078 3300047469 Bacteria 3695
575 Ga0495684_0000081 3300047471 Bacteria 65985
576 Ga0495684_0021483 3300047471 Bacteria 4970
577 Ga0495684_0110828 3300047471 Bacteria 2071
578 Ga0495684_0160475 3300047471 Bacteria 1677
579 Ga0495686_0053018 3300047472 Bacteria 2542
580 Ga0495593_0000134 3300047673 Bacteria 35634
581 Ga0495593_0006901 3300047673 Bacteria 6650
582 Ga0495593_0017419 3300047673 Bacteria 4044
583 Ga0495593_0054985 3300047673 Bacteria 2097
584 Ga0495602_0002985 3300048088 Bacteria 17343
585 Ga0495602_0015795 3300048088 Bacteria 7604
586 Ga0495602_0021964 3300048088 Bacteria 6258
587 Ga0495614_0051930 3300048089 Bacteria 1757
588 Ga0495626_0064666 3300048091 Bacteria 1657
589 Ga0496100_0076046 3300048903 Bacteria 2254
590 Ga0496100_0088745 3300048903 Bacteria 2105
591 Ga0496100_0139127 3300048903 Bacteria 1718
592 Ga0496100_0284854 3300048903 Bacteria 1233
593 Ga0496101_0036649 3300048904 Bacteria 3474
594 Ga0496101_0070038 3300048904 Bacteria 2567
595 Ga0496101_0074061 3300048904 Bacteria 2503
596 Ga0496101_0107324 3300048904 Bacteria 2097
597 Ga0496101_0120096 3300048904 Bacteria 1986
598 Ga0496101_0332696 3300048904 Bacteria 1192
599 Ga0496102_0061667 3300048905 Bacteria 3432
600 Ga0496102_0172121 3300048905 Bacteria 2038
601 Ga0496102_0181350 3300048905 Bacteria 1984
602 Ga0496103_0009458 3300048906 Bacteria 5770
603 Ga0496103_0072886 3300048906 Bacteria 2151
604 Ga0496104_0020661 3300048907 Bacteria 6039
605 Ga0496104_0023555 3300048907 Bacteria 5661
606 Ga0496104_0170732 3300048907 Bacteria 2085
607 Ga0496104_0187611 3300048907 Bacteria 1978
608 Ga0496104_0191155 3300048907 Bacteria 1958
609 Ga0496104_0295438 3300048907 Bacteria 1533
610 Ga0496105_0009535 3300048908 Bacteria 7597
611 Ga0496105_0073846 3300048908 Bacteria 2817
612 Ga0496105_0248252 3300048908 Bacteria 1442
613 Ga0496106_0001576 3300048909 Bacteria 17151
614 Ga0496106_0007942 3300048909 Bacteria 7839
615 Ga0496106_0014219 3300048909 Bacteria 5878
616 Ga0496106_0108285 3300048909 Bacteria 2161
617 Ga0496107_0003437 3300048910 Bacteria 10586
618 Ga0496107_0012956 3300048910 Bacteria 5827
619 Ga0496108_0000803 3300048911 Bacteria 24388
620 Ga0496108_0035470 3300048911 Bacteria 4146
621 Ga0496108_0059942 3300048911 Bacteria 3201
622 Ga0496108_0082787 3300048911 Bacteria 2721
623 Ga0496109_0017599 3300048912 Bacteria 6268
624 Ga0496109_0035686 3300048912 Bacteria 4487
625 Ga0496109_0180998 3300048912 Bacteria 1980
626 Ga0496109_0207305 3300048912 Bacteria 1843
627 Ga0496110_0033090 3300048913 Bacteria 4470
628 Ga0496110_0035078 3300048913 Bacteria 4349
629 Ga0496111_0034758 3300048914 Bacteria 3600
630 Ga0496111_0081365 3300048914 Bacteria 2364
631 Ga0496112_0002678 3300048915 Bacteria 14403
632 Ga0496112_0031886 3300048915 Bacteria 5114
633 Ga0496112_0041336 3300048915 Bacteria 4511
634 Ga0496112_0059955 3300048915 Bacteria 3750
635 Ga0496112_0065372 3300048915 Bacteria 3589
636 Ga0496112_0084420 3300048915 Bacteria 3141
637 Ga0496112_0122679 3300048915 Bacteria 2569
638 Ga0496112_0174083 3300048915 Bacteria 2117
639 Ga0496112_0276693 3300048915 Bacteria 1626
640 Ga0496112_0403036 3300048915 Bacteria 1307
641 Ga0496113_0006745 3300048916 Bacteria 7318
642 Ga0496113_0030431 3300048916 Bacteria 3908
643 Ga0496113_0076620 3300048916 Bacteria 2555
644 Ga0496113_0333899 3300048916 Bacteria 1215
645 Ga0496113_0417594 3300048916 Bacteria 1077
646 Ga0496114_0122685 3300048917 Bacteria 2236
647 Ga0496115_0030558 3300048918 Bacteria 4238
648 Ga0496115_0034886 3300048918 Bacteria 3976
649 Ga0496115_0051161 3300048918 Bacteria 3312
650 Ga0496115_0073670 3300048918 Bacteria 2772
651 Ga0496115_0078638 3300048918 Bacteria 2683
652 Ga0496115_0087988 3300048918 Bacteria 2535
653 Ga0496115_0132941 3300048918 Bacteria 2051
654 Ga0496115_0185976 3300048918 Bacteria 1717
655 Ga0496115_0256936 3300048918 Bacteria 1437
656 Ga0496115_0376093 3300048918 Bacteria 1156
657 Ga0496116_0010704 3300048919 Bacteria 7658
658 Ga0496118_0091668 3300048921 Bacteria 2089
659 Ga0496118_0099405 3300048921 Bacteria 1972
660 Ga0496119_0008410 3300048922 Bacteria 9066
661 Ga0496121_0000786 3300048924 Bacteria 57998
662 Ga0496121_0027631 3300048924 Bacteria 5305
663 Ga0496121_0048983 3300048924 Bacteria 3588
664 Ga0496122_0024213 3300048925 Bacteria 5319
665 Ga0496122_0177556 3300048925 Bacteria 1275
666 Ga0496124_0128793 3300048927 Bacteria 2013
667 Ga0496125_0016759 3300048928 Bacteria 7025
668 Ga0496125_0120442 3300048928 Bacteria 1873
669 Ga0496126_0003797 3300048929 Bacteria 18757
670 Ga0496126_0008016 3300048929 Bacteria 11461
671 Ga0496126_0088722 3300048929 Bacteria 2723
672 Ga0496126_0130468 3300048929 Bacteria 2172
673 Ga0501032_0000011 3300049569 Bacteria 198158
674 Ga0501032_0006585 3300049569 Bacteria 8527
675 Ga0501034_0000001 3300049571 Bacteria 2184493
676 Ga0501034_0080206 3300049571 Bacteria 3267
677 Ga0501034_0284372 3300049571 Bacteria 1593
678 Ga0501039_0000243 3300049575 Bacteria 39697
679 Ga0501046_0163524 3300049580 Bacteria 1673
680 Ga0501047_0024350 3300049581 Bacteria 5811
681 Ga0501067_0021642 3300049583 Bacteria 3558
682 Ga0501069_0025177 3300049585 Bacteria 3250
683 Ga0501070_0354137 3300049586 Bacteria 1191
684 Ga0501072_0137362 3300049588 Bacteria 1949
685 Ga0501073_0320723 3300049589 Bacteria 1069
686 Ga0501074_0029125 3300049590 Bacteria 4000
687 Ga0501076_0460983 3300049592 Bacteria 1047
688 Ga0501080_0085994 3300049742 Bacteria 2921
689 Ga0501083_0187680 3300049744 Bacteria 1349
690 Ga0501083_0212691 3300049744 Bacteria 1260
691 nmdc:mga03n38_51196_c1 3300050490 Bacteria 1843
692 nmdc:mga03n38_6973_c1 3300050490 Bacteria 3969
693 nmdc:mga00v17_247168_c1 3300050491 Bacteria 1157
694 nmdc:mga0yw44_264557_c1 3300050492 Bacteria 1147
695 nmdc:mga0k408_10614_c1 3300050493 Bacteria 4987
696 nmdc:mga0k408_68103_c1 3300050493 Bacteria 2076
697 nmdc:mga06z11_161856_c1 3300050494 Bacteria 1280
698 nmdc:mga06z11_275423_c1 3300050494 Bacteria 996
699 nmdc:mga07m45_157538_c1 3300050496 Bacteria 1318
700 nmdc:mga07m45_274344_c1 3300050496 Bacteria 981
701 nmdc:mga05p37_736569_c1 3300050507 Bacteria 1089
702 nmdc:mga08y16_56695_c1 3300050511 Bacteria 4094
703 nmdc:mga08y16_891197_c1 3300050511 Bacteria 876
704 nmdc:mga0n895_37552_c1 3300050512 Bacteria 4687
705 nmdc:mga0rr50_125176_c1 3300050513 Bacteria 2051
706 nmdc:mga0sz30_20473_c1 3300050516 Bacteria 2669
707 Ga0495601_0004544 3300053077 Bacteria 8018
708 Ga0495601_0122151 3300053077 Bacteria 1692
709 Ga0495601_0244302 3300053077 Bacteria 1172
710 Ga0495612_0108920 3300053078 Bacteria 1184
711 Ga0500610_0194633 3300053079 Bacteria 982
712 Ga0495595_0000924 3300053084 Bacteria 11325
713 Ga0495595_0060631 3300053084 Bacteria 1771
714 Ga0495619_0000761 3300053085 Bacteria 21031
715 Ga0495619_0045971 3300053085 Bacteria 2869
716 Ga0495619_0058480 3300053085 Bacteria 2559
717 Ga0495619_0174706 3300053085 Bacteria 1486
718 Ga0500643_000049 3300053087 Bacteria 147107
719 Ga0500647_0011817 3300053091 Bacteria 3913
720 Ga0500583_0053404 3300053092 Bacteria 1883
721 Ga0500566_0000054 3300053094 Bacteria 54975
722 Ga0500566_0002813 3300053094 Bacteria 10360
723 Ga0500566_0204817 3300053094 Bacteria 993
724 Ga0500640_124748 3300053095 Bacteria 1025
725 Ga0500641_0023389 3300053096 Bacteria 2376
726 Ga0500556_0013425 3300053104 Bacteria 2479
727 Ga0500556_0051714 3300053104 Bacteria 1489
728 Ga0500556_0127844 3300053104 Bacteria 994
729 Ga0500557_000118 3300053105 Bacteria 22375
730 Ga0500569_103259 3300053109 Bacteria 936
731 Ga0500572_030574 3300053111 Bacteria 1498
732 Ga0500592_013606 3300053116 Bacteria 1305
733 Ga0500595_008077 3300053119 Bacteria 4318
734 Ga0500595_014837 3300053119 Bacteria 2944
735 Ga0500595_021175 3300053119 Bacteria 2325
736 Ga0500595_056431 3300053119 Bacteria 1200
737 Ga0500607_049118 3300053121 Bacteria 2252
738 Ga0500614_022081 3300053123 Bacteria 1482
739 Ga0500642_0000164 3300053130 Bacteria 27497
740 Ga0500642_0030702 3300053130 Bacteria 2238
741 Ga0500642_0093164 3300053130 Bacteria 1394
742 Ga0500559_0014505 3300053136 Bacteria 3330
743 Ga0500559_0020595 3300053136 Bacteria 2789
744 Ga0500559_0038988 3300053136 Bacteria 2065
745 Ga0500568_0014981 3300053139 Bacteria 3480
746 Ga0500616_0011794 3300053153 Bacteria 5142
747 Ga0500620_009505 3300053155 Bacteria 2513
748 Ga0500638_004886 3300053162 Bacteria 5255
749 Ga0500639_005653 3300053163 Bacteria 6412
750 Ga0500639_158143 3300053163 Bacteria 1035
751 Ga0500636_0068534 3300053177 Bacteria 2060
752 Ga0500636_0131471 3300053177 Bacteria 1393
753 Ga0500625_022233 3300053729 Bacteria 2994
754 Ga0500596_001677 3300053735 Bacteria 4480
755 Ga0500596_013825 3300053735 Bacteria 1216
756 Ga0500601_012623 3300053737 Bacteria 954
757 Ga0501084_0274526 3300054114 Bacteria 1423
758 Ga0501084_0541863 3300054114 Bacteria 983
759 Ga0500661_008628 3300055283 Bacteria 1875

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10029625 Ga0070658_100296251 236
2 3300005530 Ga0070679_100054647 Ga0070679_1000546472 236
3 3300005530 Ga0070679_100337085 Ga0070679_1003370851 236
4 3300025921 Ga0207652_10036040 Ga0207652_100360402 236
5 3300044683 Ga0466965_0080097 Ga0466965_0080097_906_1634 241
6 3300044901 Ga0466960_0141135 Ga0466960_0141135_26_754 241
7 3300053136 Ga0500559_0014505 Ga0500559_0014505_26_754 241
8 3300025919 Ga0207657_10108627 Ga0207657_101086271 247
9 iso_pu_bacteria 8019608314 8019612278 248
10 iso_pu_bacteria 8019586578 8019595511 249
11 3300046526 Ga0495666_0101122 Ga0495666_0101122_580_1344 253
12 3300037312 Ga0395899_0080697 Ga0395899_0080697_1148_1939 255
13 3300037312 Ga0395899_0134770 Ga0395899_0134770_434_1225 255
14 3300037471 Ga0395905_0539360 Ga0395905_0539360_114_905 255
15 3300006163 Ga0070715_10188242 Ga0070715_101882422 256
16 3300044684 Ga0466966_0002503 Ga0466966_0002503_11183_11953 256
17 iso_pu_bacteria 8016511872 8016518371 256
18 iso_pu_bacteria 2508501009 2508539020 257
19 iso_pu_bacteria 2513237095 2513647741 257
20 iso_pu_bacteria 2513237098 2513677545 257
21 iso_pu_bacteria 2816332527 2818237504 257
22 iso_pu_bacteria 2824600985 2824608249 257
23 iso_pu_bacteria 2824609381 2824612177 257
24 iso_pu_bacteria 2824653114 2824655566 257
25 iso_pu_bacteria 2824661429 2824668988 257
26 iso_pu_bacteria 2824696289 2824701034 257
27 iso_pu_bacteria 2824704595 2824711025 257
28 iso_pu_bacteria 2824714736 2824718274 257
29 iso_pu_bacteria 2824732956 2824736205 257
30 iso_pu_bacteria 2824746037 2824751360 257
31 iso_pu_bacteria 2824753945 2824760397 257
32 iso_pu_bacteria 2824763712 2824770847 257
33 iso_pu_bacteria 2824773399 2824775673 257
34 iso_pu_bacteria 2838122688 2838124349 257
35 iso_pu_bacteria 2841941048 2841945042 257
36 iso_pu_bacteria 2841949485 2841951828 257
37 iso_pu_bacteria 2841966195 2841973796 257
38 iso_pu_bacteria 2841974524 2841980122 257
39 iso_pu_bacteria 2841983080 2841985305 257
40 iso_pu_bacteria 2842038055 2842043655 257
41 iso_pu_bacteria 2842045827 2842052355 257
42 iso_pu_bacteria 2847939898 2847941982 257
43 iso_pu_bacteria 2857509624 2857511777 257
44 iso_pu_bacteria 2874590934 2874597084 257
45 iso_pu_bacteria 2874612657 2874616678 257
46 iso_pu_bacteria 2874620515 2874624635 257
47 iso_pu_bacteria 2874628541 2874628965 257
48 iso_pu_bacteria 2874645413 2874648068 257
49 iso_pu_bacteria 2876771140 2876777548 257
50 iso_pu_bacteria 2876818435 2876825630 257
51 iso_pu_bacteria 2879074833 2879077756 257
52 iso_pu_bacteria 2879083081 2879089816 257
53 iso_pu_bacteria 2879099564 2879108724 257
54 iso_pu_bacteria 2879127579 2879130914 257
55 iso_pu_bacteria 2879142872 2879148851 257
56 iso_pu_bacteria 2881364244 2881365827 257
57 iso_pu_bacteria 2881665667 2881665916 257
58 iso_pu_bacteria 2888388044 2888390827 257
59 iso_pu_bacteria 2888419890 2888420463 257
60 iso_pu_bacteria 2904666416 2904670410 257
61 iso_pu_bacteria 2904711408 2904715736 257
62 iso_pu_bacteria 2906643746 2906648668 257
63 iso_pu_bacteria 2908775508 2908776078 257
64 iso_pu_bacteria 2922368715 2922368778 257
65 iso_pu_bacteria 2929615660 2929618421 257
66 iso_pu_bacteria 2929624759 2929628894 257
67 iso_pu_bacteria 2932794094 2932794475 257
68 iso_pu_bacteria 2932801729 2932806756 257
69 iso_pu_bacteria 2935608549 2935615339 257
70 iso_pu_bacteria 2935675223 2935680829 257
71 iso_pu_bacteria 2935684952 2935689847 257
72 iso_pu_bacteria 2935713505 2935717367 257
73 iso_pu_bacteria 2935722832 2935723964 257
74 iso_pu_bacteria 2935732158 2935740173 257
75 iso_pu_bacteria 2935741537 2935749436 257
76 iso_pu_bacteria 2935750917 2935757201 257
77 iso_pu_bacteria 2935819856 2935825283 257
78 iso_pu_bacteria 2935847175 2935853117 257
79 iso_pu_bacteria 2940556831 2940563115 257
80 iso_pu_bacteria 3005594810 3005594866 257
81 iso_pu_bacteria 3005710791 3005710848 257
82 iso_pu_bacteria 8016530956 8016539586 257
83 iso_pu_bacteria 8016539877 8016543883 257
84 iso_pu_bacteria 8016603502 8016606728 257
85 iso_pu_bacteria 8016613128 8016618628 257
86 iso_pu_bacteria 8019538911 8019540717 257
87 iso_pu_bacteria 8019687851 8019696456 257
88 3300021384 Ga0213876_10078817 Ga0213876_100788172 258
89 iso_pu_bacteria 2906626472 2906633438 258
90 3300031995 Ga0307409_100639120 Ga0307409_1006391201 259
91 3300045976 Ga0466967_0236391 Ga0466967_0236391_699_1502 259
92 3300009177 Ga0105248_10138209 Ga0105248_101382091 260
93 3300025915 Ga0207693_10010117 Ga0207693_100101172 260
94 3300050512 nmdc:mga0n895_37552_c1 nmdc:mga0n895_37552_c1_3843_4628 260
95 3300050513 nmdc:mga0rr50_125176_c1 nmdc:mga0rr50_125176_c1_654_1439 260
96 iso_pu_bacteria 2513237104 2513719842 260
97 3300004625 Ga0055543_1012639 Ga0055543_10126391 261
98 3300005262 Ga0065165_1007472 Ga0065165_10074724 261
99 3300005329 Ga0070683_100019421 Ga0070683_1000194212 261
100 3300005336 Ga0070680_100005994 Ga0070680_1000059947 261
101 3300005339 Ga0070660_100009116 Ga0070660_1000091166 261
102 3300005344 Ga0070661_100230067 Ga0070661_1002300672 261
103 3300005354 Ga0070675_100066168 Ga0070675_1000661684 261
104 3300005466 Ga0070685_10189807 Ga0070685_101898072 261
105 3300005535 Ga0070684_100055646 Ga0070684_1000556463 261
106 3300005539 Ga0068853_100007407 Ga0068853_1000074074 261
107 3300005577 Ga0068857_100015264 Ga0068857_1000152641 261
108 3300005618 Ga0068864_100024902 Ga0068864_1000249022 261
109 3300005841 Ga0068863_100287447 Ga0068863_1002874472 261
110 3300005843 Ga0068860_100001623 Ga0068860_10000162311 261
111 3300006237 Ga0097621_100156763 Ga0097621_1001567633 261
112 3300006353 Ga0075370_10145107 Ga0075370_101451072 261
113 3300006942 Ga0099824_1031610 Ga0099824_10316102 261
114 3300021320 Ga0214544_1016313 Ga0214544_10163132 261
115 3300021321 Ga0214542_1016361 Ga0214542_10163617 261
116 3300021324 Ga0214545_1015478 Ga0214545_10154787 261
117 3300021327 Ga0214543_1018322 Ga0214543_10183226 261
118 3300025297 Ga0209758_1003509 Ga0209758_10035097 261
119 3300025302 Ga0207426_1051290 Ga0207426_10512902 261
120 3300025901 Ga0207688_10054132 Ga0207688_100541323 261
121 3300025912 Ga0207707_10001497 Ga0207707_100014979 261
122 3300025913 Ga0207695_10075896 Ga0207695_100758962 261
123 3300025917 Ga0207660_10005316 Ga0207660_100053162 261
124 3300025918 Ga0207662_10025921 Ga0207662_100259212 261
125 3300025919 Ga0207657_10015131 Ga0207657_100151317 261
126 3300025921 Ga0207652_10001692 Ga0207652_100016929 261
127 3300025924 Ga0207694_10105768 Ga0207694_101057682 261
128 3300025926 Ga0207659_10146537 Ga0207659_101465372 261
129 3300025944 Ga0207661_10009038 Ga0207661_100090387 261
130 3300025949 Ga0207667_10003118 Ga0207667_1000311810 261
131 3300025960 Ga0207651_10111548 Ga0207651_101115483 261
132 3300026041 Ga0207639_10009580 Ga0207639_100095806 261
133 3300026067 Ga0207678_10214204 Ga0207678_102142042 261
134 3300026116 Ga0207674_10011007 Ga0207674_100110076 261
135 3300026121 Ga0207683_10299206 Ga0207683_102992062 261
136 3300026142 Ga0207698_10018469 Ga0207698_100184694 261
137 3300027296 Ga0209389_1000217 Ga0209389_10002176 261
138 3300027361 Ga0209489_102214 Ga0209489_1022146 261
139 3300028381 Ga0268264_10000227 Ga0268264_1000022712 261
140 3300035170 Ga0373943_0024874 Ga0373943_0024874_792_1586 261
141 3300035695 Ga0373927_0003439 Ga0373927_0003439_8393_9187 261
142 3300039438 Ga0436360_0784628 Ga0436360_0784628_1016_1804 261
143 3300041459 Ga0451800_0533584 Ga0451800_0533584_152_940 261
144 3300046455 Ga0495603_0000048 Ga0495603_0000048_8682_9476 261
145 3300046459 Ga0495629_0001230 Ga0495629_0001230_9027_9821 261
146 3300046461 Ga0495641_0001887 Ga0495641_0001887_8590_9384 261
147 3300046462 Ga0495651_0401786 Ga0495651_0401786_10_798 261
148 3300046463 Ga0495653_0036319 Ga0495653_0036319_3071_3865 261
149 3300046472 Ga0495580_0000084 Ga0495580_0000084_26298_27092 261
150 3300046473 Ga0495582_0002918 Ga0495582_0002918_8403_9197 261
151 3300046475 Ga0495639_0000009 Ga0495639_0000009_55924_56718 261
152 3300046476 Ga0495662_0004398 Ga0495662_0004398_5498_6292 261
153 3300046499 Ga0495594_0000603 Ga0495594_0000603_8705_9499 261
154 3300046517 Ga0495630_0025806 Ga0495630_0025806_1245_2039 261
155 3300046526 Ga0495666_0036789 Ga0495666_0036789_1235_2029 261
156 3300046529 Ga0495652_0023863 Ga0495652_0023863_2864_3658 261
157 3300046531 Ga0495665_0016436 Ga0495665_0016436_3065_3859 261
158 3300046533 Ga0495640_0006145 Ga0495640_0006145_7091_7885 261
159 3300046557 Ga0495622_0000771 Ga0495622_0000771_14957_15751 261
160 3300046559 Ga0495667_0128869 Ga0495667_0128869_128_922 261
161 3300046642 Ga0495634_0001541 Ga0495634_0001541_10860_11654 261
162 3300046680 Ga0495646_0054721 Ga0495646_0054721_988_1782 261
163 3300046680 Ga0495646_0074070 Ga0495646_0074070_11_799 261
164 3300046683 Ga0495658_0000420 Ga0495658_0000420_14335_15129 261
165 3300046689 Ga0495613_0001484 Ga0495613_0001484_1509_2303 261
166 3300047315 Ga0495581_0000103 Ga0495581_0000103_34130_34924 261
167 3300047319 Ga0495674_0000367 Ga0495674_0000367_38089_38883 261
168 3300047471 Ga0495684_0021483 Ga0495684_0021483_1189_1983 261
169 3300047673 Ga0495593_0000134 Ga0495593_0000134_1134_1928 261
170 3300048089 Ga0495614_0051930 Ga0495614_0051930_853_1647 261
171 3300048903 Ga0496100_0139127 Ga0496100_0139127_895_1707 261
172 3300048907 Ga0496104_0170732 Ga0496104_0170732_33_842 261
173 3300049583 Ga0501067_0021642 Ga0501067_0021642_1893_2711 261
174 3300050511 nmdc:mga08y16_891197_c1 nmdc:mga08y16_891197_c1_16_825 261
175 3300053091 Ga0500647_0011817 Ga0500647_0011817_268_1056 261
176 3300053737 Ga0500601_012623 Ga0500601_012623_119_907 261
177 3300054114 Ga0501084_0541863 Ga0501084_0541863_47_883 261
178 iso_pu_bacteria 2507262055 2507505085 261
179 iso_pu_bacteria 2508501042 2508695337 261
180 iso_pu_bacteria 2511231028 2511394522 261
181 iso_pu_bacteria 2513237092 2513623250 261
182 iso_pu_bacteria 2513237094 2513639769 261
183 iso_pu_bacteria 2513237102 2513699303 261
184 iso_pu_bacteria 2513237139 2513873690 261
185 iso_pu_bacteria 2513237141 2513888900 261
186 iso_pu_bacteria 2513237161 2514012325 261
187 iso_pu_bacteria 2515154112 2515625647 261
188 iso_pu_bacteria 2517093001 2517102134 261
189 iso_pu_bacteria 2524023205 2524435942 261
190 iso_pu_bacteria 2524023210 2524467358 261
191 iso_pu_bacteria 2528768022 2528852496 261
192 iso_pu_bacteria 2617270735 2617350949 261
193 iso_pu_bacteria 2617270741 2617373604 261
194 iso_pu_bacteria 2744054633 2745081538 261
195 iso_pu_bacteria 2791355196 2793064941 261
196 iso_pu_bacteria 2802429603 2805915773 261
197 iso_pu_bacteria 2824617872 2824620658 261
198 iso_pu_bacteria 2824626560 2824629915 261
199 iso_pu_bacteria 2824635225 2824640571 261
200 iso_pu_bacteria 2824644064 2824647486 261
201 iso_pu_bacteria 2824671348 2824675772 261
202 iso_pu_bacteria 2824679649 2824683796 261
203 iso_pu_bacteria 2824687955 2824691894 261
204 iso_pu_bacteria 2824723954 2824728544 261
205 iso_pu_bacteria 2844315083 2844315141 261
206 iso_pu_bacteria 2849076700 2849082891 261
207 iso_pu_bacteria 2876761206 2876765595 261
208 iso_pu_bacteria 2885366525 2885371189 261
209 iso_pu_bacteria 2885383462 2885389740 261
210 iso_pu_bacteria 2885409591 2885410547 261
211 iso_pu_bacteria 2888378607 2888379740 261
212 iso_pu_bacteria 2903727486 2903732043 261
213 iso_pu_bacteria 2906602504 2906603091 261
214 iso_pu_bacteria 2922361189 2922364140 261
215 iso_pu_bacteria 2922393267 2922396285 261
216 iso_pu_bacteria 2932784394 2932786599 261
217 iso_pu_bacteria 2932809354 2932812341 261
218 iso_pu_bacteria 2932818245 2932823333 261
219 iso_pu_bacteria 2932828146 2932829827 261
220 iso_pu_bacteria 2933577622 2933580866 261
221 iso_pu_bacteria 2935616580 2935618345 261
222 iso_pu_bacteria 2935638405 2935641257 261
223 iso_pu_bacteria 2935648319 2935654838 261
224 iso_pu_bacteria 2935656913 2935663729 261
225 iso_pu_bacteria 2935665750 2935670173 261
226 iso_pu_bacteria 2935694250 2935698368 261
227 iso_pu_bacteria 2935703347 2935707510 261
228 iso_pu_bacteria 2935760218 2935763711 261
229 iso_pu_bacteria 2935769743 2935773403 261
230 iso_pu_bacteria 2935777560 2935782276 261
231 iso_pu_bacteria 2935785616 2935789229 261
232 iso_pu_bacteria 2935793552 2935797166 261
233 iso_pu_bacteria 2935801545 2935804112 261
234 iso_pu_bacteria 2935810662 2935815196 261
235 iso_pu_bacteria 2935827899 2935830988 261
236 iso_pu_bacteria 2935837841 2935841599 261
237 iso_pu_bacteria 2935855204 2935862560 261
238 iso_pu_bacteria 2935864058 2935866512 261
239 iso_pu_bacteria 2935873716 2935874819 261
240 iso_pu_bacteria 2935883170 2935888527 261
241 iso_pu_bacteria 2935908558 2935910135 261
242 iso_pu_bacteria 2935916978 2935918568 261
243 iso_pu_bacteria 2935926038 2935927954 261
244 iso_pu_bacteria 2935934488 2935936174 261
245 iso_pu_bacteria 2935942939 2935944273 261
246 iso_pu_bacteria 2935951376 2935952710 261
247 iso_pu_bacteria 2935959822 2935962489 261
248 iso_pu_bacteria 2935967501 2935969550 261
249 iso_pu_bacteria 2935975950 2935977689 261
250 iso_pu_bacteria 2935984226 2935984995 261
251 iso_pu_bacteria 2935992306 2935994325 261
252 iso_pu_bacteria 2936002035 2936004697 261
253 iso_pu_bacteria 2936011229 2936017874 261
254 iso_pu_bacteria 2936019824 2936026377 261
255 iso_pu_bacteria 2936028420 2936031575 261
256 iso_pu_bacteria 2936037263 2936043263 261
257 iso_pu_bacteria 2936046547 2936053361 261
258 iso_pu_bacteria 2936055302 2936056164 261
259 iso_pu_bacteria 2941531003 2941532538 261
260 iso_pu_bacteria 2941538514 2941543031 261
261 iso_pu_bacteria 3005483717 3005486751 261
262 iso_pu_bacteria 3005587118 3005594058 261
263 iso_pu_bacteria 3005718088 3005718144 261
264 iso_pu_bacteria 8006926726 8006929807 261
265 iso_pu_bacteria 8006964411 8006969485 261
266 iso_pu_bacteria 8006994254 8006996739 261
267 iso_pu_bacteria 8016522445 8016525983 261
268 iso_pu_bacteria 8016548790 8016549421 261
269 iso_pu_bacteria 8016557553 8016557844 261
270 iso_pu_bacteria 8016575299 8016581913 261
271 iso_pu_bacteria 8016595262 8016595863 261
272 iso_pu_bacteria 8016622563 8016623375 261
273 iso_pu_bacteria 8016630954 8016635832 261
274 iso_pu_bacteria 8017057580 8017058289 261
275 iso_pu_bacteria 8019530166 8019530867 261
276 iso_pu_bacteria 8019547302 8019550395 261
277 iso_pu_bacteria 8019576017 8019577421 261
278 iso_pu_bacteria 8019597564 8019606251 261
279 iso_pu_bacteria 8019619141 8019622803 261
280 iso_pu_bacteria 8019629233 8019630303 261
281 iso_pu_bacteria 8019638758 8019640304 261
282 iso_pu_bacteria 8019648815 8019652641 261
283 iso_pu_bacteria 8019659431 8019667132 261
284 iso_pu_bacteria 8019668869 8019676920 261
285 iso_pu_bacteria 8019678201 8019679070 261
286 iso_pu_bacteria 8055742211 8055742272 261
287 iso_pu_bacteria 8056673599 8056675586 261
288 iso_pu_bacteria 8056681323 8056687543 261
289 iso_pu_bacteria 8056967851 8056971126 261
290 3300039437 Ga0436365_1108887 Ga0436365_1108887_758_1549 262
291 3300039437 Ga0436365_1246013 Ga0436365_1246013_763_1554 262
292 3300041503 Ga0451847_0528921 Ga0451847_0528921_36_839 262
293 iso_pu_bacteria 2841957949 2841964764 262
294 3300005536 Ga0070697_100000586 Ga0070697_10000058619 263
295 3300005335 Ga0070666_10067804 Ga0070666_100678042 264
296 3300005367 Ga0070667_100184122 Ga0070667_1001841223 264
297 3300005614 Ga0068856_100019802 Ga0068856_1000198022 264
298 3300005842 Ga0068858_100544947 Ga0068858_1005449472 264
299 3300005843 Ga0068860_100100464 Ga0068860_1001004642 264
300 3300006028 Ga0070717_10013327 Ga0070717_100133275 264
301 3300006237 Ga0097621_100177899 Ga0097621_1001778991 264
302 3300006871 Ga0075434_100334058 Ga0075434_1003340581 264
303 3300006914 Ga0075436_100040321 Ga0075436_1000403211 264
304 3300009098 Ga0105245_10013837 Ga0105245_100138376 264
305 3300009176 Ga0105242_10229813 Ga0105242_102298133 264
306 3300014325 Ga0163163_10475585 Ga0163163_104755852 264
307 3300024227 Ga0228598_1006636 Ga0228598_10066362 264
308 3300025915 Ga0207693_10027198 Ga0207693_100271983 264
309 3300025924 Ga0207694_10111282 Ga0207694_101112822 264
310 3300025927 Ga0207687_10008035 Ga0207687_100080353 264
311 3300025934 Ga0207686_10183825 Ga0207686_101838252 264
312 3300025935 Ga0207709_10348394 Ga0207709_103483942 264
313 3300026078 Ga0207702_10000350 Ga0207702_1000035035 264
314 3300031090 Ga0265760_10037980 Ga0265760_100379802 264
315 3300035120 Ga0373957_0050678 Ga0373957_0050678_220_1041 264
316 3300035410 Ga0373924_0099467 Ga0373924_0099467_347_1168 264
317 3300036401 Ga0373937_0680877 Ga0373937_0680877_108_929 264
318 3300037068 Ga0373925_0168079 Ga0373925_0168079_17_871 264
319 3300039437 Ga0436365_0478600 Ga0436365_0478600_3667_4494 264
320 3300044694 Ga0466963_0167611 Ga0466963_0167611_540_1367 264
321 3300044842 Ga0466957_0122872 Ga0466957_0122872_416_1243 264
322 3300045836 Ga0466958_0042367 Ga0466958_0042367_1113_1940 264
323 3300046454 Ga0495592_0079136 Ga0495592_0079136_850_1674 264
324 3300046463 Ga0495653_0092087 Ga0495653_0092087_895_1716 264
325 3300046516 Ga0495628_0158703 Ga0495628_0158703_25_846 264
326 3300046529 Ga0495652_0393116 Ga0495652_0393116_65_889 264
327 3300046536 Ga0495587_0164813 Ga0495587_0164813_350_1171 264
328 3300046543 Ga0495645_0016024 Ga0495645_0016024_4345_5166 264
329 3300046559 Ga0495667_0100245 Ga0495667_0100245_347_1168 264
330 3300046642 Ga0495634_0103258 Ga0495634_0103258_411_1232 264
331 3300046678 Ga0495599_0099618 Ga0495599_0099618_740_1561 264
332 3300046679 Ga0495623_0022025 Ga0495623_0022025_2934_3755 264
333 3300046809 Ga0495600_0104968 Ga0495600_0104968_675_1496 264
334 3300047317 Ga0495604_0022153 Ga0495604_0022153_3511_4332 264
335 3300047319 Ga0495674_0093154 Ga0495674_0093154_885_1739 264
336 3300047321 Ga0495676_0344750 Ga0495676_0344750_159_983 264
337 3300047673 Ga0495593_0054985 Ga0495593_0054985_1011_1835 264
338 3300048088 Ga0495602_0015795 Ga0495602_0015795_3840_4661 264
339 3300048915 Ga0496112_0059955 Ga0496112_0059955_442_1287 264
340 3300048918 Ga0496115_0376093 Ga0496115_0376093_73_930 264
341 3300049569 Ga0501032_0000011 Ga0501032_0000011_194915_195736 264
342 3300049571 Ga0501034_0000001 Ga0501034_0000001_1530934_1531755 264
343 3300049575 Ga0501039_0000243 Ga0501039_0000243_36928_37749 264
344 3300053085 Ga0495619_0045971 Ga0495619_0045971_1800_2621 264
345 3300053104 Ga0500556_0051714 Ga0500556_0051714_526_1347 264
346 iso_pu_bacteria 2903768456 2903773390 264
347 3300003215 JGI25153J46596_10003121 JGI25153J46596_100031218 265
348 3300003215 JGI25153J46596_10003625 JGI25153J46596_100036258 265
349 3300003215 JGI25153J46596_10005115 JGI25153J46596_100051152 265
350 3300003215 JGI25153J46596_10010926 JGI25153J46596_100109261 265
351 3300003354 JGI25160J50197_1001001 JGI25160J50197_100100112 265
352 3300003354 JGI25160J50197_1003544 JGI25160J50197_10035447 265
353 3300003794 Ga0055531_10003282 Ga0055531_100032829 265
354 3300004625 Ga0055543_1003105 Ga0055543_10031056 265
355 3300005262 Ga0065165_1006509 Ga0065165_10065092 265
356 3300005293 Ga0065715_10303924 Ga0065715_103039241 265
357 3300005327 Ga0070658_10065949 Ga0070658_100659491 265
358 3300005327 Ga0070658_10086288 Ga0070658_100862882 265
359 3300005328 Ga0070676_10283124 Ga0070676_102831242 265
360 3300005329 Ga0070683_100037636 Ga0070683_1000376362 265
361 3300005329 Ga0070683_100082862 Ga0070683_1000828623 265
362 3300005329 Ga0070683_100201118 Ga0070683_1002011181 265
363 3300005334 Ga0068869_100184781 Ga0068869_1001847811 265
364 3300005335 Ga0070666_10137472 Ga0070666_101374722 265
365 3300005336 Ga0070680_100023189 Ga0070680_1000231892 265
366 3300005336 Ga0070680_100038993 Ga0070680_1000389931 265
367 3300005336 Ga0070680_100409143 Ga0070680_1004091432 265
368 3300005337 Ga0070682_100099940 Ga0070682_1000999402 265
369 3300005338 Ga0068868_100006519 Ga0068868_1000065196 265
370 3300005340 Ga0070689_100017799 Ga0070689_1000177995 265
371 3300005341 Ga0070691_10119312 Ga0070691_101193121 265
372 3300005355 Ga0070671_100082907 Ga0070671_1000829074 265
373 3300005355 Ga0070671_100438802 Ga0070671_1004388021 265
374 3300005364 Ga0070673_100179111 Ga0070673_1001791112 265
375 3300005365 Ga0070688_100013010 Ga0070688_1000130105 265
376 3300005365 Ga0070688_100354506 Ga0070688_1003545061 265
377 3300005434 Ga0070709_10408689 Ga0070709_104086891 265
378 3300005437 Ga0070710_10071421 Ga0070710_100714212 265
379 3300005439 Ga0070711_100048433 Ga0070711_1000484332 265
380 3300005439 Ga0070711_100048890 Ga0070711_1000488902 265
381 3300005439 Ga0070711_100093270 Ga0070711_1000932702 265
382 3300005439 Ga0070711_100102626 Ga0070711_1001026262 265
383 3300005441 Ga0070700_100133379 Ga0070700_1001333792 265
384 3300005455 Ga0070663_100117697 Ga0070663_1001176972 265
385 3300005456 Ga0070678_100149557 Ga0070678_1001495573 265
386 3300005458 Ga0070681_10013547 Ga0070681_100135475 265
387 3300005458 Ga0070681_10020781 Ga0070681_100207816 265
388 3300005458 Ga0070681_10155095 Ga0070681_101550954 265
389 3300005535 Ga0070684_100012686 Ga0070684_1000126862 265
390 3300005535 Ga0070684_100061498 Ga0070684_1000614986 265
391 3300005539 Ga0068853_100191638 Ga0068853_1001916382 265
392 3300005539 Ga0068853_100475340 Ga0068853_1004753401 265
393 3300005548 Ga0070665_100078771 Ga0070665_1000787712 265
394 3300005549 Ga0070704_100124084 Ga0070704_1001240842 265
395 3300005563 Ga0068855_100317504 Ga0068855_1003175042 265
396 3300005563 Ga0068855_100526079 Ga0068855_1005260791 265
397 3300005563 Ga0068855_100628085 Ga0068855_1006280852 265
398 3300005563 Ga0068855_100722856 Ga0068855_1007228562 265
399 3300005564 Ga0070664_100431590 Ga0070664_1004315901 265
400 3300005564 Ga0070664_100439030 Ga0070664_1004390302 265
401 3300005577 Ga0068857_100106530 Ga0068857_1001065302 265
402 3300005578 Ga0068854_100129752 Ga0068854_1001297522 265
403 3300005614 Ga0068856_100025298 Ga0068856_1000252985 265
404 3300005614 Ga0068856_100064181 Ga0068856_1000641812 265
405 3300005616 Ga0068852_100011334 Ga0068852_1000113346 265
406 3300005616 Ga0068852_100735459 Ga0068852_1007354591 265
407 3300005618 Ga0068864_100072754 Ga0068864_1000727542 265
408 3300005618 Ga0068864_100583628 Ga0068864_1005836282 265
409 3300005718 Ga0068866_10025845 Ga0068866_100258453 265
410 3300005834 Ga0068851_10192968 Ga0068851_101929681 265
411 3300005842 Ga0068858_100051636 Ga0068858_1000516364 265
412 3300005842 Ga0068858_100379450 Ga0068858_1003794502 265
413 3300005844 Ga0068862_100412492 Ga0068862_1004124922 265
414 3300005844 Ga0068862_100640029 Ga0068862_1006400291 265
415 3300005937 Ga0081455_10002724 Ga0081455_1000272417 265
416 3300005981 Ga0081538_10073681 Ga0081538_100736811 265
417 3300005983 Ga0081540_1005028 Ga0081540_10050283 265
418 3300005983 Ga0081540_1097565 Ga0081540_10975651 265
419 3300005983 Ga0081540_1148590 Ga0081540_11485901 265
420 3300006038 Ga0075365_10087924 Ga0075365_100879242 265
421 3300006038 Ga0075365_10324439 Ga0075365_103244391 265
422 3300006042 Ga0075368_10028712 Ga0075368_100287122 265
423 3300006048 Ga0075363_100046693 Ga0075363_1000466933 265
424 3300006048 Ga0075363_100058425 Ga0075363_1000584252 265
425 3300006051 Ga0075364_10016682 Ga0075364_100166822 265
426 3300006051 Ga0075364_10110569 Ga0075364_101105692 265
427 3300006173 Ga0070716_100113562 Ga0070716_1001135622 265
428 3300006175 Ga0070712_100152731 Ga0070712_1001527312 265
429 3300006175 Ga0070712_100170594 Ga0070712_1001705942 265
430 3300006178 Ga0075367_10016821 Ga0075367_100168212 265
431 3300006178 Ga0075367_10018650 Ga0075367_100186502 265
432 3300006178 Ga0075367_10033232 Ga0075367_100332322 265
433 3300006195 Ga0075366_10002189 Ga0075366_100021897 265
434 3300006195 Ga0075366_10010105 Ga0075366_100101054 265
435 3300006353 Ga0075370_10182249 Ga0075370_101822492 265
436 3300006944 Ga0099823_1022934 Ga0099823_10229346 265
437 3300009093 Ga0105240_10002261 Ga0105240_1000226121 265
438 3300009093 Ga0105240_10062622 Ga0105240_100626226 265
439 3300009098 Ga0105245_10043050 Ga0105245_100430503 265
440 3300009101 Ga0105247_10054065 Ga0105247_100540652 265
441 3300009147 Ga0114129_10271364 Ga0114129_102713642 265
442 3300009174 Ga0105241_10029766 Ga0105241_100297663 265
443 3300009174 Ga0105241_10046596 Ga0105241_100465964 265
444 3300009174 Ga0105241_10560854 Ga0105241_105608542 265
445 3300009176 Ga0105242_10109173 Ga0105242_101091732 265
446 3300009176 Ga0105242_10426952 Ga0105242_104269522 265
447 3300009177 Ga0105248_10041110 Ga0105248_100411104 265
448 3300009177 Ga0105248_10175253 Ga0105248_101752532 265
449 3300009177 Ga0105248_10215497 Ga0105248_102154972 265
450 3300009545 Ga0105237_10003763 Ga0105237_100037636 265
451 3300009545 Ga0105237_10145812 Ga0105237_101458123 265
452 3300009545 Ga0105237_10174664 Ga0105237_101746642 265
453 3300009545 Ga0105237_10273079 Ga0105237_102730792 265
454 3300009545 Ga0105237_10579255 Ga0105237_105792552 265
455 3300009545 Ga0105237_10659413 Ga0105237_106594132 265
456 3300009551 Ga0105238_10015969 Ga0105238_100159697 265
457 3300009551 Ga0105238_10069807 Ga0105238_100698072 265
458 3300009551 Ga0105238_10193609 Ga0105238_101936092 265
459 3300009551 Ga0105238_10371555 Ga0105238_103715552 265
460 3300010375 Ga0105239_10023195 Ga0105239_100231956 265
461 3300010375 Ga0105239_10094285 Ga0105239_100942854 265
462 3300010375 Ga0105239_10216930 Ga0105239_102169301 265
463 3300011119 Ga0105246_10325764 Ga0105246_103257642 265
464 3300011119 Ga0105246_10372420 Ga0105246_103724201 265
465 3300011119 Ga0105246_10403074 Ga0105246_104030742 265
466 3300013104 Ga0157370_10035814 Ga0157370_100358144 265
467 3300013104 Ga0157370_10159270 Ga0157370_101592702 265
468 3300013104 Ga0157370_10317136 Ga0157370_103171362 265
469 3300013105 Ga0157369_10053722 Ga0157369_100537222 265
470 3300013105 Ga0157369_10106099 Ga0157369_101060993 265
471 3300013296 Ga0157374_10003265 Ga0157374_100032654 265
472 3300013296 Ga0157374_10040674 Ga0157374_100406745 265
473 3300013297 Ga0157378_10451639 Ga0157378_104516392 265
474 3300013306 Ga0163162_10081555 Ga0163162_100815554 265
475 3300013306 Ga0163162_10268331 Ga0163162_102683312 265
476 3300013307 Ga0157372_10350627 Ga0157372_103506272 265
477 3300013307 Ga0157372_10484785 Ga0157372_104847852 265
478 3300013308 Ga0157375_10144815 Ga0157375_101448153 265
479 3300013308 Ga0157375_10682301 Ga0157375_106823011 265
480 3300014325 Ga0163163_10013126 Ga0163163_100131263 265
481 3300014325 Ga0163163_10036751 Ga0163163_100367516 265
482 3300014325 Ga0163163_10193639 Ga0163163_101936391 265
483 3300014969 Ga0157376_10064439 Ga0157376_100644394 265
484 3300014969 Ga0157376_10577463 Ga0157376_105774632 265
485 3300015262 Ga0182007_10047038 Ga0182007_100470382 265
486 3300020069 Ga0197907_10378139 Ga0197907_103781392 265
487 3300021320 Ga0214544_1000056 Ga0214544_100005665 265
488 3300021321 Ga0214542_1000071 Ga0214542_100007170 265
489 3300021324 Ga0214545_1000033 Ga0214545_100003352 265
490 3300021327 Ga0214543_1000105 Ga0214543_100010552 265
491 3300021377 Ga0213874_10014038 Ga0213874_100140383 265
492 3300021384 Ga0213876_10107567 Ga0213876_101075672 265
493 3300021441 Ga0213871_10000532 Ga0213871_100005325 265
494 3300022467 Ga0224712_10019051 Ga0224712_100190512 265
495 3300025245 Ga0207425_1027375 Ga0207425_10273751 265
496 3300025254 Ga0209148_1000308 Ga0209148_100030810 265
497 3300025261 Ga0209233_1008097 Ga0209233_10080973 265
498 3300025272 Ga0209455_1001786 Ga0209455_10017866 265
499 3300025273 Ga0209673_1023416 Ga0209673_10234162 265
500 3300025295 Ga0209564_1006612 Ga0209564_10066127 265
501 3300025297 Ga0209758_1000182 Ga0209758_1000182121 265
502 3300025297 Ga0209758_1000293 Ga0209758_100029352 265
503 3300025297 Ga0209758_1000363 Ga0209758_100036336 265
504 3300025297 Ga0209758_1002068 Ga0209758_100206814 265
505 3300025297 Ga0209758_1003517 Ga0209758_10035179 265
506 3300025297 Ga0209758_1005730 Ga0209758_10057307 265
507 3300025297 Ga0209758_1041376 Ga0209758_10413762 265
508 3300025299 Ga0209256_1004270 Ga0209256_10042708 265
509 3300025302 Ga0207426_1000628 Ga0207426_10006284 265
510 3300025302 Ga0207426_1000992 Ga0207426_100099218 265
511 3300025302 Ga0207426_1004958 Ga0207426_10049584 265
512 3300025304 Ga0209257_1004239 Ga0209257_10042395 265
513 3300025893 Ga0207682_10039152 Ga0207682_100391522 265
514 3300025898 Ga0207692_10055491 Ga0207692_100554912 265
515 3300025900 Ga0207710_10049316 Ga0207710_100493161 265
516 3300025903 Ga0207680_10483967 Ga0207680_104839671 265
517 3300025904 Ga0207647_10025176 Ga0207647_100251762 265
518 3300025904 Ga0207647_10071165 Ga0207647_100711652 265
519 3300025906 Ga0207699_10006255 Ga0207699_100062555 265
520 3300025906 Ga0207699_10060143 Ga0207699_100601431 265
521 3300025909 Ga0207705_10120850 Ga0207705_101208503 265
522 3300025910 Ga0207684_10036512 Ga0207684_100365124 265
523 3300025910 Ga0207684_10710782 Ga0207684_107107821 265
524 3300025911 Ga0207654_10014572 Ga0207654_100145723 265
525 3300025911 Ga0207654_10035456 Ga0207654_100354563 265
526 3300025911 Ga0207654_10065304 Ga0207654_100653042 265
527 3300025912 Ga0207707_10008114 Ga0207707_100081149 265
528 3300025912 Ga0207707_10227578 Ga0207707_102275782 265
529 3300025912 Ga0207707_10242364 Ga0207707_102423642 265
530 3300025913 Ga0207695_10000107 Ga0207695_1000010768 265
531 3300025913 Ga0207695_10302167 Ga0207695_103021672 265
532 3300025914 Ga0207671_10004749 Ga0207671_100047493 265
533 3300025914 Ga0207671_10039127 Ga0207671_100391273 265
534 3300025914 Ga0207671_10082792 Ga0207671_100827921 265
535 3300025914 Ga0207671_10212429 Ga0207671_102124292 265
536 3300025915 Ga0207693_10009900 Ga0207693_100099004 265
537 3300025915 Ga0207693_10208324 Ga0207693_102083242 265
538 3300025915 Ga0207693_10297614 Ga0207693_102976142 265
539 3300025916 Ga0207663_10099417 Ga0207663_100994173 265
540 3300025916 Ga0207663_10230344 Ga0207663_102303441 265
541 3300025916 Ga0207663_10295252 Ga0207663_102952522 265
542 3300025916 Ga0207663_10406573 Ga0207663_104065731 265
543 3300025917 Ga0207660_10010250 Ga0207660_100102503 265
544 3300025917 Ga0207660_10086834 Ga0207660_100868343 265
545 3300025921 Ga0207652_10010419 Ga0207652_100104193 265
546 3300025921 Ga0207652_10020006 Ga0207652_100200067 265
547 3300025921 Ga0207652_10174700 Ga0207652_101747002 265
548 3300025922 Ga0207646_10193674 Ga0207646_101936742 265
549 3300025924 Ga0207694_10276473 Ga0207694_102764732 265
550 3300025924 Ga0207694_10290509 Ga0207694_102905092 265
551 3300025927 Ga0207687_10078731 Ga0207687_100787312 265
552 3300025928 Ga0207700_10069113 Ga0207700_100691132 265
553 3300025931 Ga0207644_10023803 Ga0207644_100238033 265
554 3300025934 Ga0207686_10239349 Ga0207686_102393492 265
555 3300025935 Ga0207709_10023155 Ga0207709_100231552 265
556 3300025936 Ga0207670_10012150 Ga0207670_100121502 265
557 3300025939 Ga0207665_10180376 Ga0207665_101803762 265
558 3300025939 Ga0207665_10206960 Ga0207665_102069602 265
559 3300025940 Ga0207691_10099020 Ga0207691_100990202 265
560 3300025941 Ga0207711_10076621 Ga0207711_100766212 265
561 3300025942 Ga0207689_10110600 Ga0207689_101106002 265
562 3300025942 Ga0207689_10114552 Ga0207689_101145523 265
563 3300025944 Ga0207661_10000579 Ga0207661_100005797 265
564 3300025944 Ga0207661_10002114 Ga0207661_100021142 265
565 3300025944 Ga0207661_10193615 Ga0207661_101936152 265
566 3300025949 Ga0207667_10235698 Ga0207667_102356982 265
567 3300025981 Ga0207640_10134797 Ga0207640_101347971 265
568 3300025981 Ga0207640_10369666 Ga0207640_103696662 265
569 3300026023 Ga0207677_10008707 Ga0207677_100087072 265
570 3300026035 Ga0207703_10038775 Ga0207703_100387752 265
571 3300026041 Ga0207639_10269549 Ga0207639_102695492 265
572 3300026041 Ga0207639_10493629 Ga0207639_104936292 265
573 3300026041 Ga0207639_10536094 Ga0207639_105360941 265
574 3300026041 Ga0207639_10852155 Ga0207639_108521551 265
575 3300026067 Ga0207678_10196358 Ga0207678_101963582 265
576 3300026075 Ga0207708_10047301 Ga0207708_100473012 265
577 3300026078 Ga0207702_10143796 Ga0207702_101437961 265
578 3300026078 Ga0207702_10363389 Ga0207702_103633892 265
579 3300026088 Ga0207641_10122834 Ga0207641_101228343 265
580 3300026089 Ga0207648_10616534 Ga0207648_106165341 265
581 3300026095 Ga0207676_10095607 Ga0207676_100956073 265
582 3300026095 Ga0207676_10132387 Ga0207676_101323872 265
583 3300026095 Ga0207676_10541246 Ga0207676_105412462 265
584 3300026116 Ga0207674_10117504 Ga0207674_101175043 265
585 3300026118 Ga0207675_100137407 Ga0207675_1001374072 265
586 3300026121 Ga0207683_10019572 Ga0207683_100195723 265
587 3300026121 Ga0207683_10058673 Ga0207683_100586733 265
588 3300026142 Ga0207698_10318921 Ga0207698_103189212 265
589 3300026142 Ga0207698_10530778 Ga0207698_105307781 265
590 3300026142 Ga0207698_10628096 Ga0207698_106280961 265
591 3300027296 Ga0209389_1000208 Ga0209389_10002088 265
592 3300027357 Ga0209589_1000032 Ga0209589_100003268 265
593 3300027361 Ga0209489_101970 Ga0209489_1019708 265
594 3300027363 Ga0209700_100011 Ga0209700_10001152 265
595 3300027866 Ga0209813_10010120 Ga0209813_100101201 265
596 3300028379 Ga0268266_10369146 Ga0268266_103691461 265
597 3300028556 Ga0265337_1028055 Ga0265337_10280551 265
598 3300028558 Ga0265326_10016944 Ga0265326_100169442 265
599 3300028563 Ga0265319_1005200 Ga0265319_10052002 265
600 3300028573 Ga0265334_10015788 Ga0265334_100157883 265
601 3300028577 Ga0265318_10008563 Ga0265318_100085632 265
602 3300028653 Ga0265323_10001243 Ga0265323_100012435 265
603 3300028654 Ga0265322_10014422 Ga0265322_100144222 265
604 3300028666 Ga0265336_10000410 Ga0265336_100004105 265
605 3300028800 Ga0265338_10000277 Ga0265338_1000027765 265
606 3300029957 Ga0265324_10005967 Ga0265324_100059673 265
607 3300031235 Ga0265330_10039036 Ga0265330_100390363 265
608 3300031238 Ga0265332_10019622 Ga0265332_100196222 265
609 3300031241 Ga0265325_10000061 Ga0265325_1000006150 265
610 3300031241 Ga0265325_10079574 Ga0265325_100795742 265
611 3300031249 Ga0265339_10022187 Ga0265339_100221872 265
612 3300031250 Ga0265331_10032820 Ga0265331_100328203 265
613 3300031250 Ga0265331_10071962 Ga0265331_100719622 265
614 3300031250 Ga0265331_10076691 Ga0265331_100766911 265
615 3300031616 Ga0307508_10000002 Ga0307508_10000002203 265
616 3300031616 Ga0307508_10226053 Ga0307508_102260531 265
617 3300031712 Ga0265342_10022741 Ga0265342_100227413 265
618 3300031730 Ga0307516_10035775 Ga0307516_100357753 265
619 3300033180 Ga0307510_10006388 Ga0307510_1000638812 265
620 3300033180 Ga0307510_10145934 Ga0307510_101459342 265
621 3300034816 Ga0373930_0041962 Ga0373930_0041962_159_959 265
622 3300035086 Ga0373934_0004728 Ga0373934_0004728_976_1797 265
623 3300035086 Ga0373934_0069340 Ga0373934_0069340_374_1174 265
624 3300035111 Ga0373923_0010717 Ga0373923_0010717_1296_2117 265
625 3300035111 Ga0373923_0014593 Ga0373923_0014593_844_1644 265
626 3300035111 Ga0373923_0032775 Ga0373923_0032775_138_944 265
627 3300035112 Ga0373932_0020906 Ga0373932_0020906_119_943 265
628 3300035113 Ga0373936_0093673 Ga0373936_0093673_32_838 265
629 3300035116 Ga0373945_0062313 Ga0373945_0062313_326_1126 265
630 3300035117 Ga0373953_0000653 Ga0373953_0000653_4167_4988 265
631 3300035117 Ga0373953_0075295 Ga0373953_0075295_366_1166 265
632 3300035118 Ga0373954_0015067 Ga0373954_0015067_1532_2353 265
633 3300035119 Ga0373956_0001298 Ga0373956_0001298_1100_1921 265
634 3300035120 Ga0373957_0004778 Ga0373957_0004778_1535_2356 265
635 3300035121 Ga0373960_0017880 Ga0373960_0017880_119_943 265
636 3300035171 Ga0373946_0028416 Ga0373946_0028416_872_1672 265
637 3300035172 Ga0373955_0000648 Ga0373955_0000648_8816_9637 265
638 3300035172 Ga0373955_0007599 Ga0373955_0007599_2727_3533 265
639 3300035410 Ga0373924_0004102 Ga0373924_0004102_3587_4408 265
640 3300035410 Ga0373924_0048843 Ga0373924_0048843_594_1394 265
641 3300035691 Ga0373931_0005720 Ga0373931_0005720_2739_3563 265
642 3300035692 Ga0373935_0004102 Ga0373935_0004102_4791_5597 265
643 3300035692 Ga0373935_0204600 Ga0373935_0204600_19_819 265
644 3300035692 Ga0373935_0335606 Ga0373935_0335606_102_908 265
645 3300035695 Ga0373927_0018648 Ga0373927_0018648_3124_3933 265
646 3300035695 Ga0373927_0028077 Ga0373927_0028077_875_1675 265
647 3300035695 Ga0373927_0078821 Ga0373927_0078821_1039_1839 265
648 3300035695 Ga0373927_0195756 Ga0373927_0195756_340_1146 265
649 3300035724 Ga0373933_0000655 Ga0373933_0000655_18971_19792 265
650 3300035725 Ga0373947_0005223 Ga0373947_0005223_3337_4143 265
651 3300035725 Ga0373947_0016157 Ga0373947_0016157_496_1296 265
652 3300035725 Ga0373947_0070390 Ga0373947_0070390_813_1613 265
653 3300036401 Ga0373937_0021124 Ga0373937_0021124_1408_2229 265
654 3300036401 Ga0373937_0231133 Ga0373937_0231133_71_877 265
655 3300037068 Ga0373925_0003059 Ga0373925_0003059_2367_3173 265
656 3300037068 Ga0373925_0022013 Ga0373925_0022013_1322_2122 265
657 3300037068 Ga0373925_0247068 Ga0373925_0247068_440_1240 265
658 3300037418 Ga0395900_0001316 Ga0395900_0001316_28991_29788 265
659 3300037418 Ga0395900_0166608 Ga0395900_0166608_161_970 265
660 3300037418 Ga0395900_0314598 Ga0395900_0314598_641_1447 265
661 3300037466 Ga0395898_0010275 Ga0395898_0010275_22_819 265
662 3300037466 Ga0395898_0261031 Ga0395898_0261031_415_1221 265
663 3300037471 Ga0395905_0019550 Ga0395905_0019550_5555_6352 265
664 3300037471 Ga0395905_0060353 Ga0395905_0060353_2316_3113 265
665 3300037471 Ga0395905_0417953 Ga0395905_0417953_358_1182 265
666 3300037853 Ga0436364_1211788 Ga0436364_1211788_225_1031 265
667 3300038443 Ga0395901_0002762 Ga0395901_0002762_11452_12249 265
668 3300038443 Ga0395901_0256059 Ga0395901_0256059_31_840 265
669 3300038443 Ga0395901_0516788 Ga0395901_0516788_393_1190 265
670 3300039437 Ga0436365_0766912 Ga0436365_0766912_302_1102 265
671 3300039437 Ga0436365_1695882 Ga0436365_1695882_1205_2008 265
672 3300039437 Ga0436365_1830473 Ga0436365_1830473_1517_2320 265
673 3300039447 Ga0436361_0734729 Ga0436361_0734729_82_885 265
674 3300039450 Ga0436363_0071431 Ga0436363_0071431_916_1719 265
675 3300039450 Ga0436363_0532985 Ga0436363_0532985_4825_5628 265
676 3300039453 Ga0436362_0566318 Ga0436362_0566318_541_1341 265
677 3300041408 Ga0439453_0006071 Ga0439453_0006071_614_1438 265
678 3300041452 Ga0451793_0431397 Ga0451793_0431397_72_872 265
679 3300042125 Ga0450923_022894 Ga0450923_022894_255_1079 265
680 3300044656 Ga0466969_0030926 Ga0466969_0030926_52_852 265
681 3300044658 Ga0466972_0000233 Ga0466972_0000233_6667_7470 265
682 3300044683 Ga0466965_0208720 Ga0466965_0208720_152_952 265
683 3300044693 Ga0466961_0003092 Ga0466961_0003092_3151_3951 265
684 3300044694 Ga0466963_0026147 Ga0466963_0026147_424_1248 265
685 3300044706 Ga0466964_0099624 Ga0466964_0099624_424_1224 265
686 3300044735 Ga0466968_0003054 Ga0466968_0003054_662_1489 265
687 3300044765 Ga0466970_0043302 Ga0466970_0043302_1258_2058 265
688 3300044842 Ga0466957_0023758 Ga0466957_0023758_2530_3354 265
689 3300045049 Ga0466959_0002845 Ga0466959_0002845_2162_2962 265
690 3300045049 Ga0466959_0178884 Ga0466959_0178884_53_853 265
691 3300045976 Ga0466967_0073867 Ga0466967_0073867_1335_2159 265
692 3300045976 Ga0466967_0230673 Ga0466967_0230673_192_1001 265
693 3300045976 Ga0466967_0286657 Ga0466967_0286657_73_873 265
694 3300046454 Ga0495592_0000614 Ga0495592_0000614_14225_15046 265
695 3300046454 Ga0495592_0008192 Ga0495592_0008192_6110_6937 265
696 3300046454 Ga0495592_0038952 Ga0495592_0038952_1804_2604 265
697 3300046459 Ga0495629_0000849 Ga0495629_0000849_6048_6869 265
698 3300046459 Ga0495629_0008274 Ga0495629_0008274_5799_6653 265
699 3300046459 Ga0495629_0061767 Ga0495629_0061767_701_1501 265
700 3300046460 Ga0495638_0002713 Ga0495638_0002713_4088_4885 265
701 3300046462 Ga0495651_0001002 Ga0495651_0001002_3127_3948 265
702 3300046462 Ga0495651_0030344 Ga0495651_0030344_3106_3906 265
703 3300046462 Ga0495651_0322730 Ga0495651_0322730_103_927 265
704 3300046463 Ga0495653_0015208 Ga0495653_0015208_2224_3045 265
705 3300046463 Ga0495653_0074237 Ga0495653_0074237_1593_2393 265
706 3300046471 Ga0495650_0058010 Ga0495650_0058010_241_1041 265
707 3300046472 Ga0495580_0006567 Ga0495580_0006567_6549_7349 265
708 3300046472 Ga0495580_0348048 Ga0495580_0348048_61_861 265
709 3300046472 Ga0495580_0368426 Ga0495580_0368426_103_909 265
710 3300046473 Ga0495582_0013677 Ga0495582_0013677_1896_2696 265
711 3300046475 Ga0495639_0023943 Ga0495639_0023943_773_1573 265
712 3300046476 Ga0495662_0117605 Ga0495662_0117605_158_979 265
713 3300046477 Ga0495664_0010080 Ga0495664_0010080_1914_2714 265
714 3300046477 Ga0495664_0040457 Ga0495664_0040457_1935_2735 265
715 3300046477 Ga0495664_0178097 Ga0495664_0178097_116_916 265
716 3300046491 Ga0495584_0221532 Ga0495584_0221532_100_900 265
717 3300046499 Ga0495594_0084913 Ga0495594_0084913_326_1126 265
718 3300046507 Ga0495606_0032899 Ga0495606_0032899_280_1107 265
719 3300046511 Ga0495608_0001026 Ga0495608_0001026_17802_18623 265
720 3300046515 Ga0495620_0060542 Ga0495620_0060542_609_1409 265
721 3300046516 Ga0495628_0002528 Ga0495628_0002528_1451_2257 265
722 3300046516 Ga0495628_0042727 Ga0495628_0042727_194_994 265
723 3300046516 Ga0495628_0044189 Ga0495628_0044189_1787_2587 265
724 3300046516 Ga0495628_0048772 Ga0495628_0048772_1036_1857 265
725 3300046517 Ga0495630_0033567 Ga0495630_0033567_1087_1887 265
726 3300046522 Ga0495643_0109135 Ga0495643_0109135_313_1113 265
727 3300046524 Ga0495648_0001769 Ga0495648_0001769_302_1108 265
728 3300046524 Ga0495648_0016435 Ga0495648_0016435_4240_5067 265
729 3300046529 Ga0495652_0020043 Ga0495652_0020043_2167_2988 265
730 3300046529 Ga0495652_0129656 Ga0495652_0129656_773_1573 265
731 3300046531 Ga0495665_0039184 Ga0495665_0039184_587_1387 265
732 3300046533 Ga0495640_0013322 Ga0495640_0013322_403_1203 265
733 3300046533 Ga0495640_0017715 Ga0495640_0017715_2180_3001 265
734 3300046533 Ga0495640_0043150 Ga0495640_0043150_1971_2771 265
735 3300046533 Ga0495640_0330461 Ga0495640_0330461_38_838 265
736 3300046535 Ga0495586_0036735 Ga0495586_0036735_1434_2234 265
737 3300046536 Ga0495587_0005697 Ga0495587_0005697_3662_4483 265
738 3300046536 Ga0495587_0015864 Ga0495587_0015864_3591_4391 265
739 3300046542 Ga0495597_0082949 Ga0495597_0082949_214_1014 265
740 3300046543 Ga0495645_0017296 Ga0495645_0017296_909_1730 265
741 3300046543 Ga0495645_0132541 Ga0495645_0132541_543_1343 265
742 3300046543 Ga0495645_0171734 Ga0495645_0171734_354_1160 265
743 3300046559 Ga0495667_0001358 Ga0495667_0001358_973_1794 265
744 3300046642 Ga0495634_0038726 Ga0495634_0038726_299_1120 265
745 3300046642 Ga0495634_0071770 Ga0495634_0071770_703_1503 265
746 3300046642 Ga0495634_0099512 Ga0495634_0099512_357_1157 265
747 3300046642 Ga0495634_0167516 Ga0495634_0167516_109_909 265
748 3300046663 Ga0495635_0000119 Ga0495635_0000119_37936_38742 265
749 3300046663 Ga0495635_0000809 Ga0495635_0000809_16637_17458 265
750 3300046663 Ga0495635_0220597 Ga0495635_0220597_237_1037 265
751 3300046675 Ga0495657_0006732 Ga0495657_0006732_5893_6714 265
752 3300046675 Ga0495657_0009585 Ga0495657_0009585_770_1570 265
753 3300046675 Ga0495657_0012863 Ga0495657_0012863_4623_5477 265
754 3300046678 Ga0495599_0000513 Ga0495599_0000513_17853_18674 265
755 3300046678 Ga0495599_0248148 Ga0495599_0248148_121_921 265
756 3300046679 Ga0495623_0009766 Ga0495623_0009766_1709_2530 265
757 3300046679 Ga0495623_0011049 Ga0495623_0011049_1583_2383 265
758 3300046680 Ga0495646_0001869 Ga0495646_0001869_2720_3541 265
759 3300046680 Ga0495646_0056971 Ga0495646_0056971_1166_1966 265
760 3300046683 Ga0495658_0009910 Ga0495658_0009910_754_1554 265
761 3300046689 Ga0495613_0153011 Ga0495613_0153011_357_1157 265
762 3300046690 Ga0495624_0003095 Ga0495624_0003095_2132_2938 265
763 3300046694 Ga0495649_0002747 Ga0495649_0002747_3613_4440 265
764 3300046694 Ga0495649_0115963 Ga0495649_0115963_397_1197 265
765 3300046809 Ga0495600_0004615 Ga0495600_0004615_6954_7808 265
766 3300046809 Ga0495600_0004930 Ga0495600_0004930_4921_5742 265
767 3300046809 Ga0495600_0021201 Ga0495600_0021201_201_1001 265
768 3300047315 Ga0495581_0007321 Ga0495581_0007321_2870_3670 265
769 3300047315 Ga0495581_0193376 Ga0495581_0193376_310_1110 265
770 3300047317 Ga0495604_0010711 Ga0495604_0010711_807_1607 265
771 3300047317 Ga0495604_0020575 Ga0495604_0020575_3751_4551 265
772 3300047317 Ga0495604_0223845 Ga0495604_0223845_94_900 265
773 3300047319 Ga0495674_0011448 Ga0495674_0011448_2461_3261 265
774 3300047319 Ga0495674_0028981 Ga0495674_0028981_3386_4186 265
775 3300047319 Ga0495674_0098456 Ga0495674_0098456_75_896 265
776 3300047319 Ga0495674_0325532 Ga0495674_0325532_337_1137 265
777 3300047320 Ga0495672_0037918 Ga0495672_0037918_613_1464 265
778 3300047321 Ga0495676_0387975 Ga0495676_0387975_97_897 265
779 3300047322 Ga0495680_0002243 Ga0495680_0002243_1600_2421 265
780 3300047322 Ga0495680_0012531 Ga0495680_0012531_5908_6708 265
781 3300047443 Ga0495687_110629 Ga0495687_110629_185_985 265
782 3300047444 Ga0495675_0000978 Ga0495675_0000978_5043_5864 265
783 3300047444 Ga0495675_0014791 Ga0495675_0014791_393_1193 265
784 3300047445 Ga0495677_0083420 Ga0495677_0083420_246_1046 265
785 3300047469 Ga0495673_0017078 Ga0495673_0017078_2648_3454 265
786 3300047471 Ga0495684_0000081 Ga0495684_0000081_45957_46778 265
787 3300047471 Ga0495684_0110828 Ga0495684_0110828_294_1094 265
788 3300047471 Ga0495684_0160475 Ga0495684_0160475_237_1037 265
789 3300047472 Ga0495686_0053018 Ga0495686_0053018_593_1456 265
790 3300047673 Ga0495593_0006901 Ga0495593_0006901_1838_2659 265
791 3300047673 Ga0495593_0017419 Ga0495593_0017419_929_1729 265
792 3300048088 Ga0495602_0002985 Ga0495602_0002985_15422_16243 265
793 3300048088 Ga0495602_0021964 Ga0495602_0021964_4623_5423 265
794 3300048091 Ga0495626_0064666 Ga0495626_0064666_622_1422 265
795 3300048903 Ga0496100_0076046 Ga0496100_0076046_624_1451 265
796 3300048903 Ga0496100_0088745 Ga0496100_0088745_931_1731 265
797 3300048903 Ga0496100_0284854 Ga0496100_0284854_174_974 265
798 3300048904 Ga0496101_0036649 Ga0496101_0036649_2026_2850 265
799 3300048904 Ga0496101_0070038 Ga0496101_0070038_1188_1988 265
800 3300048904 Ga0496101_0074061 Ga0496101_0074061_1240_2079 265
801 3300048904 Ga0496101_0107324 Ga0496101_0107324_293_1093 265
802 3300048904 Ga0496101_0120096 Ga0496101_0120096_446_1273 265
803 3300048904 Ga0496101_0332696 Ga0496101_0332696_337_1137 265
804 3300048905 Ga0496102_0061667 Ga0496102_0061667_118_918 265
805 3300048905 Ga0496102_0172121 Ga0496102_0172121_625_1449 265
806 3300048905 Ga0496102_0181350 Ga0496102_0181350_884_1732 265
807 3300048906 Ga0496103_0009458 Ga0496103_0009458_1478_2278 265
808 3300048906 Ga0496103_0072886 Ga0496103_0072886_1204_2004 265
809 3300048907 Ga0496104_0020661 Ga0496104_0020661_1201_2040 265
810 3300048907 Ga0496104_0023555 Ga0496104_0023555_1026_1850 265
811 3300048907 Ga0496104_0187611 Ga0496104_0187611_1152_1952 265
812 3300048907 Ga0496104_0191155 Ga0496104_0191155_131_931 265
813 3300048907 Ga0496104_0295438 Ga0496104_0295438_277_1077 265
814 3300048908 Ga0496105_0009535 Ga0496105_0009535_921_1721 265
815 3300048908 Ga0496105_0073846 Ga0496105_0073846_980_1804 265
816 3300048908 Ga0496105_0248252 Ga0496105_0248252_376_1176 265
817 3300048909 Ga0496106_0001576 Ga0496106_0001576_1591_2391 265
818 3300048909 Ga0496106_0007942 Ga0496106_0007942_5732_6571 265
819 3300048909 Ga0496106_0014219 Ga0496106_0014219_3915_4739 265
820 3300048909 Ga0496106_0108285 Ga0496106_0108285_139_939 265
821 3300048910 Ga0496107_0003437 Ga0496107_0003437_4562_5362 265
822 3300048910 Ga0496107_0012956 Ga0496107_0012956_2245_3069 265
823 3300048911 Ga0496108_0000803 Ga0496108_0000803_6029_6829 265
824 3300048911 Ga0496108_0035470 Ga0496108_0035470_627_1427 265
825 3300048911 Ga0496108_0059942 Ga0496108_0059942_180_1019 265
826 3300048911 Ga0496108_0082787 Ga0496108_0082787_1629_2453 265
827 3300048912 Ga0496109_0017599 Ga0496109_0017599_779_1618 265
828 3300048912 Ga0496109_0035686 Ga0496109_0035686_3621_4421 265
829 3300048912 Ga0496109_0180998 Ga0496109_0180998_297_1121 265
830 3300048912 Ga0496109_0207305 Ga0496109_0207305_509_1309 265
831 3300048913 Ga0496110_0033090 Ga0496110_0033090_3166_4005 265
832 3300048913 Ga0496110_0035078 Ga0496110_0035078_2267_3067 265
833 3300048914 Ga0496111_0034758 Ga0496111_0034758_2149_2973 265
834 3300048914 Ga0496111_0081365 Ga0496111_0081365_1335_2135 265
835 3300048915 Ga0496112_0002678 Ga0496112_0002678_4993_5793 265
836 3300048915 Ga0496112_0031886 Ga0496112_0031886_1996_2796 265
837 3300048915 Ga0496112_0041336 Ga0496112_0041336_1415_2254 265
838 3300048915 Ga0496112_0065372 Ga0496112_0065372_470_1294 265
839 3300048915 Ga0496112_0084420 Ga0496112_0084420_2318_3124 265
840 3300048915 Ga0496112_0122679 Ga0496112_0122679_795_1601 265
841 3300048915 Ga0496112_0174083 Ga0496112_0174083_1025_1849 265
842 3300048915 Ga0496112_0276693 Ga0496112_0276693_623_1447 265
843 3300048915 Ga0496112_0403036 Ga0496112_0403036_293_1141 265
844 3300048916 Ga0496113_0006745 Ga0496113_0006745_5013_5813 265
845 3300048916 Ga0496113_0030431 Ga0496113_0030431_744_1544 265
846 3300048916 Ga0496113_0076620 Ga0496113_0076620_1154_1978 265
847 3300048916 Ga0496113_0333899 Ga0496113_0333899_361_1161 265
848 3300048916 Ga0496113_0417594 Ga0496113_0417594_83_883 265
849 3300048917 Ga0496114_0122685 Ga0496114_0122685_1128_1928 265
850 3300048918 Ga0496115_0030558 Ga0496115_0030558_2445_3269 265
851 3300048918 Ga0496115_0034886 Ga0496115_0034886_2349_3149 265
852 3300048918 Ga0496115_0051161 Ga0496115_0051161_2347_3204 265
853 3300048918 Ga0496115_0073670 Ga0496115_0073670_1706_2533 265
854 3300048918 Ga0496115_0078638 Ga0496115_0078638_499_1305 265
855 3300048918 Ga0496115_0087988 Ga0496115_0087988_331_1137 265
856 3300048918 Ga0496115_0132941 Ga0496115_0132941_451_1251 265
857 3300048918 Ga0496115_0185976 Ga0496115_0185976_519_1325 265
858 3300048918 Ga0496115_0256936 Ga0496115_0256936_491_1390 265
859 3300048919 Ga0496116_0010704 Ga0496116_0010704_2962_3762 265
860 3300048921 Ga0496118_0091668 Ga0496118_0091668_405_1205 265
861 3300048921 Ga0496118_0099405 Ga0496118_0099405_391_1191 265
862 3300048922 Ga0496119_0008410 Ga0496119_0008410_6643_7443 265
863 3300048924 Ga0496121_0000786 Ga0496121_0000786_16189_16995 265
864 3300048924 Ga0496121_0027631 Ga0496121_0027631_1537_2337 265
865 3300048924 Ga0496121_0048983 Ga0496121_0048983_1978_2778 265
866 3300048925 Ga0496122_0024213 Ga0496122_0024213_2250_3050 265
867 3300048925 Ga0496122_0177556 Ga0496122_0177556_460_1260 265
868 3300048927 Ga0496124_0128793 Ga0496124_0128793_618_1418 265
869 3300048928 Ga0496125_0016759 Ga0496125_0016759_6210_7010 265
870 3300048928 Ga0496125_0120442 Ga0496125_0120442_192_992 265
871 3300048929 Ga0496126_0003797 Ga0496126_0003797_6988_7788 265
872 3300048929 Ga0496126_0008016 Ga0496126_0008016_8975_9775 265
873 3300048929 Ga0496126_0088722 Ga0496126_0088722_290_1090 265
874 3300048929 Ga0496126_0130468 Ga0496126_0130468_869_1669 265
875 3300049569 Ga0501032_0006585 Ga0501032_0006585_5794_6717 265
876 3300049571 Ga0501034_0080206 Ga0501034_0080206_1106_1975 265
877 3300049571 Ga0501034_0284372 Ga0501034_0284372_262_1086 265
878 3300049580 Ga0501046_0163524 Ga0501046_0163524_278_1087 265
879 3300049581 Ga0501047_0024350 Ga0501047_0024350_1923_2732 265
880 3300049585 Ga0501069_0025177 Ga0501069_0025177_2330_3220 265
881 3300049586 Ga0501070_0354137 Ga0501070_0354137_244_1053 265
882 3300049588 Ga0501072_0137362 Ga0501072_0137362_231_1055 265
883 3300049589 Ga0501073_0320723 Ga0501073_0320723_150_959 265
884 3300049590 Ga0501074_0029125 Ga0501074_0029125_3163_3972 265
885 3300049592 Ga0501076_0460983 Ga0501076_0460983_54_878 265
886 3300049742 Ga0501080_0085994 Ga0501080_0085994_1887_2696 265
887 3300049744 Ga0501083_0187680 Ga0501083_0187680_247_1071 265
888 3300049744 Ga0501083_0212691 Ga0501083_0212691_127_975 265
889 3300050490 nmdc:mga03n38_51196_c1 nmdc:mga03n38_51196_c1_190_1014 265
890 3300050490 nmdc:mga03n38_6973_c1 nmdc:mga03n38_6973_c1_2851_3651 265
891 3300050491 nmdc:mga00v17_247168_c1 nmdc:mga00v17_247168_c1_113_937 265
892 3300050492 nmdc:mga0yw44_264557_c1 nmdc:mga0yw44_264557_c1_159_965 265
893 3300050493 nmdc:mga0k408_10614_c1 nmdc:mga0k408_10614_c1_261_1085 265
894 3300050493 nmdc:mga0k408_68103_c1 nmdc:mga0k408_68103_c1_1196_2020 265
895 3300050494 nmdc:mga06z11_161856_c1 nmdc:mga06z11_161856_c1_98_898 265
896 3300050494 nmdc:mga06z11_275423_c1 nmdc:mga06z11_275423_c1_62_886 265
897 3300050496 nmdc:mga07m45_157538_c1 nmdc:mga07m45_157538_c1_410_1210 265
898 3300050496 nmdc:mga07m45_274344_c1 nmdc:mga07m45_274344_c1_66_932 265
899 3300050507 nmdc:mga05p37_736569_c1 nmdc:mga05p37_736569_c1_62_886 265
900 3300050511 nmdc:mga08y16_56695_c1 nmdc:mga08y16_56695_c1_2428_3252 265
901 3300050516 nmdc:mga0sz30_20473_c1 nmdc:mga0sz30_20473_c1_1599_2399 265
902 3300053077 Ga0495601_0004544 Ga0495601_0004544_6872_7693 265
903 3300053077 Ga0495601_0122151 Ga0495601_0122151_108_908 265
904 3300053077 Ga0495601_0244302 Ga0495601_0244302_129_929 265
905 3300053078 Ga0495612_0108920 Ga0495612_0108920_118_918 265
906 3300053079 Ga0500610_0194633 Ga0500610_0194633_145_969 265
907 3300053084 Ga0495595_0000924 Ga0495595_0000924_1789_2610 265
908 3300053084 Ga0495595_0060631 Ga0495595_0060631_663_1463 265
909 3300053085 Ga0495619_0000761 Ga0495619_0000761_7059_7880 265
910 3300053085 Ga0495619_0058480 Ga0495619_0058480_184_984 265
911 3300053085 Ga0495619_0174706 Ga0495619_0174706_86_886 265
912 3300053087 Ga0500643_000049 Ga0500643_000049_104810_105610 265
913 3300053092 Ga0500583_0053404 Ga0500583_0053404_974_1774 265
914 3300053094 Ga0500566_0000054 Ga0500566_0000054_28961_29761 265
915 3300053094 Ga0500566_0002813 Ga0500566_0002813_3634_4431 265
916 3300053094 Ga0500566_0204817 Ga0500566_0204817_93_893 265
917 3300053095 Ga0500640_124748 Ga0500640_124748_12_812 265
918 3300053096 Ga0500641_0023389 Ga0500641_0023389_849_1673 265
919 3300053104 Ga0500556_0013425 Ga0500556_0013425_1492_2316 265
920 3300053104 Ga0500556_0127844 Ga0500556_0127844_37_834 265
921 3300053105 Ga0500557_000118 Ga0500557_000118_10799_11599 265
922 3300053109 Ga0500569_103259 Ga0500569_103259_66_866 265
923 3300053111 Ga0500572_030574 Ga0500572_030574_133_933 265
924 3300053116 Ga0500592_013606 Ga0500592_013606_138_938 265
925 3300053119 Ga0500595_008077 Ga0500595_008077_841_1665 265
926 3300053119 Ga0500595_014837 Ga0500595_014837_956_1783 265
927 3300053119 Ga0500595_021175 Ga0500595_021175_987_1844 265
928 3300053119 Ga0500595_056431 Ga0500595_056431_102_1034 265
929 3300053121 Ga0500607_049118 Ga0500607_049118_291_1091 265
930 3300053123 Ga0500614_022081 Ga0500614_022081_350_1150 265
931 3300053130 Ga0500642_0000164 Ga0500642_0000164_19871_20668 265
932 3300053130 Ga0500642_0030702 Ga0500642_0030702_1090_1890 265
933 3300053130 Ga0500642_0093164 Ga0500642_0093164_59_883 265
934 3300053136 Ga0500559_0020595 Ga0500559_0020595_1936_2736 265
935 3300053136 Ga0500559_0038988 Ga0500559_0038988_1078_1878 265
936 3300053139 Ga0500568_0014981 Ga0500568_0014981_1729_2580 265
937 3300053153 Ga0500616_0011794 Ga0500616_0011794_707_1504 265
938 3300053155 Ga0500620_009505 Ga0500620_009505_79_879 265
939 3300053162 Ga0500638_004886 Ga0500638_004886_3460_4260 265
940 3300053163 Ga0500639_005653 Ga0500639_005653_3696_4496 265
941 3300053163 Ga0500639_158143 Ga0500639_158143_13_813 265
942 3300053177 Ga0500636_0068534 Ga0500636_0068534_448_1248 265
943 3300053177 Ga0500636_0131471 Ga0500636_0131471_449_1249 265
944 3300053729 Ga0500625_022233 Ga0500625_022233_257_1057 265
945 3300053735 Ga0500596_001677 Ga0500596_001677_1669_2469 265
946 3300053735 Ga0500596_013825 Ga0500596_013825_210_1010 265
947 3300054114 Ga0501084_0274526 Ga0501084_0274526_298_1122 265
948 3300055283 Ga0500661_008628 Ga0500661_008628_554_1354 265
949 iso_pu_bacteria 2847930680 2847930927 265
950 iso_pu_bacteria 3005506211 3005509331 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

297

0.99

PF00106

adh_short

short chain dehydrogenase

54

249

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tf4-assembly2.cif.gz_F crystal structure of enoyl-(acyl carrier protein) reductase from bartonella henselae in complext with nad 0.9827 3 254
3grk-assembly2.cif.gz_G crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis 0.9815 3 254
4eit-assembly2.cif.gz_E-2 crystal structure of an enoyl-(acyl carrier protein) reductase from bartonella henselae 0.9815 2 254
8jfm-assembly2.cif.gz_E crystal structure of enoyl-acp reductase fabi in complex with nadh from helicobacter pylori 0.9814 3 254
2p91-assembly1.cif.gz_A crystal structure of enoyl-[acyl-carrier-protein] reductase (nadh) from aquifex aeolicus vf5 0.9793 3 254
ID Description Score Start End Superfamily
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9802 3 254 3.40.50.720
2p91A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 3 254 3.40.50.720
4cv1H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.97 5 254 3.40.50.720
2p91C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9696 5 254 3.40.50.720
3grkC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9685 3 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A431MZJ8-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.996 5 138 GO:0004318
GO:0006633
AF-A0A357X796-F1-model_v4 deleted 0.9955 1 189
AF-A0A531N3K7-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.9941 1 177 GO:0004318
GO:0006633
AF-A0A530H3P2-F1-model_v4 enoyl-[acyl-carrier-protein] reductase (NADH) (EC 1.3.1.9) 0.994 1 198 GO:0004318
GO:0006633
GO:0016746
AF-A0A356HZB3-F1-model_v4 NADH-specific enoyl-ACP reductase 0.9928 3 166 GO:0004318
GO:0006633

Feature Viewer

pLDDT pTM Quality
91.12 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map