F486407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 944 | 470 | 1888 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_079523|Ga0400483_079523_414_1070 |
| Length | 218 |
| Sequence | MAKIPVVRENGNTMTARGTLYTISAPSGAGKTSLVNALLKADTAIRVSVSHTTRSKRPGEQDGVNYHFVSSAQFNTFADQGDFLEHAEVFGNCYGTSRSWVEATLNEGWDVILEIDWQGADQVRQVLPDTVGIFILPPSLVALEDRLTQRGQDSAEVISKRMQAAMNEISHFPEADYLVINDDFDRALADLAAIVTAQRLTLDNQQARHREQLERLLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 214 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 221 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 222 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 223 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 224 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 228 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 337 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 340 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 341 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 342 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 381 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 382 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 383 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 384 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 385 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 386 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 387 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 388 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 389 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 390 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 391 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 392 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 393 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 394 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 395 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 396 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 397 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 398 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 399 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 400 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 401 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 402 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 403 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 404 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 405 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 406 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 407 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 408 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 409 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 410 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 411 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 412 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 413 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 414 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 415 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 416 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 417 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 418 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 419 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 420 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 421 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 422 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 423 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 424 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 425 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 426 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 427 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 428 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 429 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 430 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 431 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 432 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 433 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 434 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 435 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 436 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 437 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 438 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 439 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 440 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 441 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 442 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 443 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 444 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 445 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 446 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 447 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 448 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 449 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 450 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 451 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 452 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 453 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 454 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 455 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 456 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 457 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 458 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 459 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 460 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 461 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 462 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 463 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 464 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 465 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 466 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 467 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 468 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 469 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 470 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.94 |
| Metatranscriptomes | 0.53 |
| Isolates | 9.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.78 |
| Nodule | 2.12 |
| Rhizoplane | 5.93 |
| Rhizosphere | 72.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400483_079523 | 3300039062 | Bacteria | 1725 |
| 2 | JGI24740J21852_10001608 | 3300001979 | Bacteria | 10380 |
| 3 | JGI24739J22299_10002870 | 3300001989 | Bacteria | 6612 |
| 4 | JGI24739J22299_10002919 | 3300001989 | Bacteria | 6554 |
| 5 | JGI24739J22299_10005315 | 3300001989 | Bacteria | 4906 |
| 6 | JGI24739J22299_10036167 | 3300001989 | Bacteria | 1670 |
| 7 | JGI24737J22298_10004043 | 3300001990 | Bacteria | 5127 |
| 8 | JGI24737J22298_10009321 | 3300001990 | Bacteria | 3270 |
| 9 | JGI24735J21928_10000214 | 3300002067 | Bacteria | 20243 |
| 10 | JGI24735J21928_10000975 | 3300002067 | Bacteria | 10243 |
| 11 | JGI24738J21930_10001813 | 3300002075 | Bacteria | 5797 |
| 12 | JGI25156J39149_1000606 | 3300002705 | Bacteria | 19907 |
| 13 | JGI25156J39149_1001619 | 3300002705 | Bacteria | 9182 |
| 14 | JGI25156J39149_1001839 | 3300002705 | Bacteria | 8309 |
| 15 | JGI25165J46597_1002278 | 3300003214 | Bacteria | 6571 |
| 16 | rootH1_10082209 | 3300003316 | Bacteria | 1591 |
| 17 | rootH2_10060630 | 3300003320 | Bacteria | 1678 |
| 18 | rootH2_10060631 | 3300003320 | Bacteria | 1560 |
| 19 | rootH2_10263547 | 3300003320 | Bacteria | 2315 |
| 20 | rootL2_10044271 | 3300003322 | Bacteria | 2894 |
| 21 | rootH1_10017919 | 3300003323 | Bacteria | 23346 |
| 22 | rootH1_10017920 | 3300003323 | Bacteria | 32817 |
| 23 | rootH1_10050413 | 3300003323 | Bacteria | 1501 |
| 24 | JGI25160J50197_1000121 | 3300003354 | Bacteria | 70932 |
| 25 | Ga0055533_1000425 | 3300003756 | Bacteria | 16228 |
| 26 | Ga0055533_1002006 | 3300003756 | Bacteria | 4954 |
| 27 | Ga0055532_1000012 | 3300003758 | Bacteria | 382698 |
| 28 | Ga0055532_1002446 | 3300003758 | Bacteria | 3852 |
| 29 | Ga0055532_1010100 | 3300003758 | Bacteria | 1134 |
| 30 | Ga0055532_1012042 | 3300003758 | Bacteria | 1007 |
| 31 | Ga0055525_1008095 | 3300003759 | Bacteria | 889 |
| 32 | Ga0055527_1000011 | 3300003760 | Bacteria | 354560 |
| 33 | Ga0055527_1000565 | 3300003760 | Bacteria | 12213 |
| 34 | Ga0055527_1000584 | 3300003760 | Bacteria | 11906 |
| 35 | Ga0055535_1000009 | 3300003761 | Bacteria | 382698 |
| 36 | Ga0055535_1001392 | 3300003761 | Bacteria | 12505 |
| 37 | Ga0055535_1001425 | 3300003761 | Bacteria | 12213 |
| 38 | Ga0055542_1000015 | 3300003762 | Bacteria | 382698 |
| 39 | Ga0055542_1001317 | 3300003762 | Bacteria | 13099 |
| 40 | Ga0055542_1002323 | 3300003762 | Bacteria | 6538 |
| 41 | Ga0055529_1000011 | 3300003763 | Bacteria | 382698 |
| 42 | Ga0055529_1000988 | 3300003763 | Bacteria | 14143 |
| 43 | Ga0055529_1006134 | 3300003763 | Bacteria | 1697 |
| 44 | Ga0055528_1002055 | 3300003790 | Bacteria | 11251 |
| 45 | Ga0058692_1005361 | 3300003856 | Bacteria | 3658 |
| 46 | Ga0065165_1000236 | 3300005262 | Bacteria | 96225 |
| 47 | Ga0070658_10022962 | 3300005327 | Bacteria | 5008 |
| 48 | Ga0070658_10041263 | 3300005327 | Bacteria | 3723 |
| 49 | Ga0070658_10061710 | 3300005327 | Bacteria | 3054 |
| 50 | Ga0070658_10361142 | 3300005327 | Bacteria | 1244 |
| 51 | Ga0070658_10455233 | 3300005327 | Bacteria | 1103 |
| 52 | Ga0070676_10012165 | 3300005328 | Bacteria | 4693 |
| 53 | Ga0070676_10326612 | 3300005328 | Bacteria | 1048 |
| 54 | Ga0070690_100068578 | 3300005330 | Bacteria | 2301 |
| 55 | Ga0068869_100426182 | 3300005334 | Bacteria | 1095 |
| 56 | Ga0068868_100031957 | 3300005338 | Bacteria | 4046 |
| 57 | Ga0068868_100484039 | 3300005338 | Bacteria | 1081 |
| 58 | Ga0070660_100000412 | 3300005339 | Bacteria | 28448 |
| 59 | Ga0070660_100080628 | 3300005339 | Bacteria | 2554 |
| 60 | Ga0070660_100116852 | 3300005339 | Bacteria | 2127 |
| 61 | Ga0070689_100134547 | 3300005340 | Bacteria | 1984 |
| 62 | Ga0070687_100064444 | 3300005343 | Bacteria | 1947 |
| 63 | Ga0070661_100125396 | 3300005344 | Bacteria | 1926 |
| 64 | Ga0070661_100321864 | 3300005344 | Bacteria | 1208 |
| 65 | Ga0070668_100007642 | 3300005347 | Bacteria | 8022 |
| 66 | Ga0070668_100094310 | 3300005347 | Bacteria | 2362 |
| 67 | Ga0070669_100269299 | 3300005353 | Bacteria | 1361 |
| 68 | Ga0070675_100243763 | 3300005354 | Bacteria | 1571 |
| 69 | Ga0070671_100072441 | 3300005355 | Bacteria | 2877 |
| 70 | Ga0070674_100053234 | 3300005356 | Bacteria | 2794 |
| 71 | Ga0070674_100059614 | 3300005356 | Bacteria | 2657 |
| 72 | Ga0070674_100431592 | 3300005356 | Bacteria | 1083 |
| 73 | Ga0070688_100027794 | 3300005365 | Bacteria | 3370 |
| 74 | Ga0070659_100000014 | 3300005366 | Bacteria | 178272 |
| 75 | Ga0070659_100106972 | 3300005366 | Bacteria | 2255 |
| 76 | Ga0070659_100120912 | 3300005366 | Bacteria | 2121 |
| 77 | Ga0070667_100079091 | 3300005367 | Bacteria | 2810 |
| 78 | Ga0070667_100197501 | 3300005367 | Bacteria | 1784 |
| 79 | Ga0070714_100088008 | 3300005435 | Bacteria | 2717 |
| 80 | Ga0070701_10007392 | 3300005438 | Bacteria | 4691 |
| 81 | Ga0070711_100119291 | 3300005439 | Bacteria | 1948 |
| 82 | Ga0070705_100017262 | 3300005440 | Bacteria | 3765 |
| 83 | Ga0070700_100036533 | 3300005441 | Bacteria | 2980 |
| 84 | Ga0070663_100000465 | 3300005455 | Bacteria | 21386 |
| 85 | Ga0070663_100079605 | 3300005455 | Bacteria | 2405 |
| 86 | Ga0070663_100593271 | 3300005455 | Bacteria | 931 |
| 87 | Ga0070678_100001980 | 3300005456 | Bacteria | 11070 |
| 88 | Ga0070678_100015348 | 3300005456 | Bacteria | 4866 |
| 89 | Ga0070662_100077242 | 3300005457 | Bacteria | 2471 |
| 90 | Ga0070662_100143261 | 3300005457 | Bacteria | 1854 |
| 91 | Ga0070681_10007485 | 3300005458 | Bacteria | 10671 |
| 92 | Ga0068867_100025300 | 3300005459 | Bacteria | 4258 |
| 93 | Ga0068867_100530053 | 3300005459 | Bacteria | 1017 |
| 94 | Ga0070685_10036097 | 3300005466 | Bacteria | 2793 |
| 95 | Ga0070706_100027171 | 3300005467 | Bacteria | 5265 |
| 96 | Ga0070707_100026476 | 3300005468 | Bacteria | 5507 |
| 97 | Ga0070679_100081399 | 3300005530 | Bacteria | 3227 |
| 98 | Ga0070697_100113330 | 3300005536 | Bacteria | 2262 |
| 99 | Ga0070672_100155417 | 3300005543 | Bacteria | 1894 |
| 100 | Ga0070672_100208831 | 3300005543 | Bacteria | 1635 |
| 101 | Ga0070695_100013338 | 3300005545 | Bacteria | 4937 |
| 102 | Ga0070695_100742653 | 3300005545 | Bacteria | 782 |
| 103 | Ga0070693_100064198 | 3300005547 | Bacteria | 2142 |
| 104 | Ga0070693_100069041 | 3300005547 | Bacteria | 2076 |
| 105 | Ga0070665_100268166 | 3300005548 | Bacteria | 1709 |
| 106 | Ga0070665_100268648 | 3300005548 | Bacteria | 1707 |
| 107 | Ga0070704_100011744 | 3300005549 | Bacteria | 5383 |
| 108 | Ga0070704_100456774 | 3300005549 | Bacteria | 1101 |
| 109 | Ga0068855_100002955 | 3300005563 | Bacteria | 20773 |
| 110 | Ga0068855_100005640 | 3300005563 | Bacteria | 15276 |
| 111 | Ga0068855_101106525 | 3300005563 | Bacteria | 828 |
| 112 | Ga0070664_100711978 | 3300005564 | Bacteria | 936 |
| 113 | Ga0068857_100304738 | 3300005577 | Bacteria | 1469 |
| 114 | Ga0068854_100095793 | 3300005578 | Bacteria | 2216 |
| 115 | Ga0070702_100018299 | 3300005615 | Bacteria | 3633 |
| 116 | Ga0070702_100046763 | 3300005615 | Bacteria | 2454 |
| 117 | Ga0068852_100009260 | 3300005616 | Bacteria | 7297 |
| 118 | Ga0068852_100379939 | 3300005616 | Bacteria | 1386 |
| 119 | Ga0068866_10002174 | 3300005718 | Bacteria | 8165 |
| 120 | Ga0068866_10014626 | 3300005718 | Bacteria | 3470 |
| 121 | Ga0068861_100026271 | 3300005719 | Bacteria | 4232 |
| 122 | Ga0068861_100073082 | 3300005719 | Bacteria | 2663 |
| 123 | Ga0068870_10021019 | 3300005840 | Bacteria | 3187 |
| 124 | Ga0068863_100610084 | 3300005841 | Bacteria | 1080 |
| 125 | Ga0068858_100026437 | 3300005842 | Bacteria | 5391 |
| 126 | Ga0068860_100187922 | 3300005843 | Bacteria | 1998 |
| 127 | Ga0068862_100302256 | 3300005844 | Bacteria | 1472 |
| 128 | Ga0068862_100519859 | 3300005844 | Bacteria | 1132 |
| 129 | Ga0070716_100036920 | 3300006173 | Bacteria | 2697 |
| 130 | Ga0070712_100036562 | 3300006175 | Bacteria | 3342 |
| 131 | Ga0075369_10011755 | 3300006186 | Bacteria | 3448 |
| 132 | Ga0075366_10077882 | 3300006195 | Bacteria | 1978 |
| 133 | Ga0097621_100095777 | 3300006237 | Bacteria | 2490 |
| 134 | Ga0075370_10010707 | 3300006353 | Bacteria | 4807 |
| 135 | Ga0068871_100042754 | 3300006358 | Bacteria | 3639 |
| 136 | Ga0068871_100441887 | 3300006358 | Bacteria | 1164 |
| 137 | Ga0075433_10310937 | 3300006852 | Bacteria | 1394 |
| 138 | Ga0075434_100053749 | 3300006871 | Bacteria | 4002 |
| 139 | Ga0068865_100042183 | 3300006881 | Bacteria | 3110 |
| 140 | Ga0075435_100001710 | 3300007076 | Bacteria | 14255 |
| 141 | Ga0105251_10000128 | 3300009011 | Bacteria | 75973 |
| 142 | Ga0105251_10021378 | 3300009011 | Bacteria | 3380 |
| 143 | Ga0105251_10119617 | 3300009011 | Bacteria | 1197 |
| 144 | Ga0105240_10000748 | 3300009093 | Bacteria | 59276 |
| 145 | Ga0105240_10012809 | 3300009093 | Bacteria | 11553 |
| 146 | Ga0105240_10050146 | 3300009093 | Bacteria | 5265 |
| 147 | Ga0105240_10102224 | 3300009093 | Bacteria | 3483 |
| 148 | Ga0105240_10540973 | 3300009093 | Bacteria | 1290 |
| 149 | Ga0111539_10086516 | 3300009094 | Bacteria | 3683 |
| 150 | Ga0105245_10033012 | 3300009098 | Bacteria | 4584 |
| 151 | Ga0105245_10152455 | 3300009098 | Bacteria | 2186 |
| 152 | Ga0105247_10300188 | 3300009101 | Bacteria | 1114 |
| 153 | Ga0105243_10010284 | 3300009148 | Bacteria | 7109 |
| 154 | Ga0105241_10251910 | 3300009174 | Bacteria | 1497 |
| 155 | Ga0105242_10016251 | 3300009176 | Bacteria | 5785 |
| 156 | Ga0105242_10097070 | 3300009176 | Bacteria | 2491 |
| 157 | Ga0105248_10051332 | 3300009177 | Bacteria | 4628 |
| 158 | Ga0105248_10105353 | 3300009177 | Bacteria | 3179 |
| 159 | Ga0105248_10958322 | 3300009177 | Bacteria | 966 |
| 160 | Ga0105237_10004300 | 3300009545 | Bacteria | 16512 |
| 161 | Ga0105237_10009421 | 3300009545 | Bacteria | 10461 |
| 162 | Ga0105237_10034289 | 3300009545 | Bacteria | 5141 |
| 163 | Ga0105237_10099527 | 3300009545 | Bacteria | 2899 |
| 164 | Ga0105237_10149287 | 3300009545 | Bacteria | 2333 |
| 165 | Ga0105237_10406204 | 3300009545 | Bacteria | 1367 |
| 166 | Ga0105238_10032822 | 3300009551 | Bacteria | 5284 |
| 167 | Ga0105238_10074149 | 3300009551 | Bacteria | 3396 |
| 168 | Ga0105249_10140510 | 3300009553 | Bacteria | 2315 |
| 169 | Ga0105249_10398089 | 3300009553 | Bacteria | 1407 |
| 170 | Ga0105239_10005634 | 3300010375 | Bacteria | 14631 |
| 171 | Ga0105239_10012318 | 3300010375 | Bacteria | 9523 |
| 172 | Ga0105246_10293649 | 3300011119 | Bacteria | 1309 |
| 173 | Ga0105246_10770257 | 3300011119 | Bacteria | 851 |
| 174 | Ga0157373_10013231 | 3300013100 | Bacteria | 6058 |
| 175 | Ga0157373_10369435 | 3300013100 | Bacteria | 1025 |
| 176 | Ga0157371_10004974 | 3300013102 | Bacteria | 11416 |
| 177 | Ga0157370_10000210 | 3300013104 | Bacteria | 74229 |
| 178 | Ga0157370_10019066 | 3300013104 | Bacteria | 6895 |
| 179 | Ga0157370_10428841 | 3300013104 | Bacteria | 1216 |
| 180 | Ga0157369_10000116 | 3300013105 | Bacteria | 112213 |
| 181 | Ga0157369_10000599 | 3300013105 | Bacteria | 46911 |
| 182 | Ga0157369_10001470 | 3300013105 | Bacteria | 28877 |
| 183 | Ga0157369_10030593 | 3300013105 | Bacteria | 5936 |
| 184 | Ga0157369_10231524 | 3300013105 | Bacteria | 1932 |
| 185 | Ga0157374_10000717 | 3300013296 | Bacteria | 29010 |
| 186 | Ga0157374_10076635 | 3300013296 | Bacteria | 3162 |
| 187 | Ga0157378_10311074 | 3300013297 | Bacteria | 1528 |
| 188 | Ga0163162_10037238 | 3300013306 | Bacteria | 4853 |
| 189 | Ga0163162_10166912 | 3300013306 | Bacteria | 2325 |
| 190 | Ga0157372_10002555 | 3300013307 | Bacteria | 19729 |
| 191 | Ga0157372_10228093 | 3300013307 | Bacteria | 2159 |
| 192 | Ga0157375_10023764 | 3300013308 | Bacteria | 5663 |
| 193 | Ga0157375_10159363 | 3300013308 | Bacteria | 2398 |
| 194 | Ga0157375_10406923 | 3300013308 | Bacteria | 1527 |
| 195 | Ga0157380_10005113 | 3300014326 | Bacteria | 9168 |
| 196 | Ga0157380_10015813 | 3300014326 | Bacteria | 5551 |
| 197 | Ga0182008_10036701 | 3300014497 | Bacteria | 2452 |
| 198 | Ga0182008_10155215 | 3300014497 | Bacteria | 1149 |
| 199 | Ga0157377_10030000 | 3300014745 | Bacteria | 2942 |
| 200 | Ga0157379_10014445 | 3300014968 | Bacteria | 6930 |
| 201 | Ga0157376_10031159 | 3300014969 | Bacteria | 4267 |
| 202 | Ga0157376_10120628 | 3300014969 | Bacteria | 2323 |
| 203 | Ga0157376_10291837 | 3300014969 | Bacteria | 1540 |
| 204 | Ga0182006_1075170 | 3300015261 | Bacteria | 1244 |
| 205 | Ga0182007_10000874 | 3300015262 | Bacteria | 16687 |
| 206 | Ga0182005_1043638 | 3300015265 | Bacteria | 1219 |
| 207 | Ga0183361_10009 | 3300016635 | Bacteria | 205218 |
| 208 | Ga0163161_10053857 | 3300017792 | Bacteria | 2918 |
| 209 | Ga0163161_10125780 | 3300017792 | Bacteria | 1930 |
| 210 | Ga0197907_11106936 | 3300020069 | Bacteria | 2609 |
| 211 | Ga0206354_10063618 | 3300020081 | Bacteria | 2773 |
| 212 | Ga0206353_11985253 | 3300020082 | Bacteria | 4881 |
| 213 | Ga0224712_10000010 | 3300022467 | Bacteria | 28666 |
| 214 | Ga0209566_100797 | 3300025225 | Bacteria | 16535 |
| 215 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 216 | Ga0209674_100188 | 3300025226 | Bacteria | 67031 |
| 217 | Ga0209674_100199 | 3300025226 | Bacteria | 62593 |
| 218 | Ga0209674_101843 | 3300025226 | Bacteria | 5042 |
| 219 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 220 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 221 | Ga0209672_100083 | 3300025228 | Bacteria | 135473 |
| 222 | Ga0209672_100753 | 3300025228 | Bacteria | 15789 |
| 223 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 224 | Ga0209147_100120 | 3300025229 | Bacteria | 142306 |
| 225 | Ga0209147_100178 | 3300025229 | Bacteria | 79708 |
| 226 | Ga0209147_100365 | 3300025229 | Bacteria | 32099 |
| 227 | Ga0209563_101459 | 3300025230 | Bacteria | 6242 |
| 228 | Ga0207427_101338 | 3300025231 | Bacteria | 9160 |
| 229 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 230 | Ga0209258_100280 | 3300025242 | Bacteria | 85790 |
| 231 | Ga0209258_100292 | 3300025242 | Bacteria | 82251 |
| 232 | Ga0209646_1018733 | 3300025246 | Bacteria | 1011 |
| 233 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 234 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 235 | Ga0209148_1001699 | 3300025254 | Bacteria | 9763 |
| 236 | Ga0209759_1000251 | 3300025256 | Bacteria | 79885 |
| 237 | Ga0209759_1000261 | 3300025256 | Bacteria | 76336 |
| 238 | Ga0209759_1001264 | 3300025256 | Bacteria | 15225 |
| 239 | Ga0209759_1001797 | 3300025256 | Bacteria | 10854 |
| 240 | Ga0209759_1002082 | 3300025256 | Bacteria | 9347 |
| 241 | Ga0209233_1000093 | 3300025261 | Bacteria | 306016 |
| 242 | Ga0209565_1013667 | 3300025263 | Bacteria | 1893 |
| 243 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 244 | Ga0209455_1000203 | 3300025272 | Bacteria | 85784 |
| 245 | Ga0209455_1000683 | 3300025272 | Bacteria | 20130 |
| 246 | Ga0209673_1000070 | 3300025273 | Bacteria | 241592 |
| 247 | Ga0209564_1003673 | 3300025295 | Bacteria | 10138 |
| 248 | Ga0209564_1006486 | 3300025295 | Bacteria | 6294 |
| 249 | Ga0209256_1035276 | 3300025299 | Unclassified | 1323 |
| 250 | Ga0207426_1000183 | 3300025302 | Bacteria | 154449 |
| 251 | Ga0207426_1012231 | 3300025302 | Bacteria | 3232 |
| 252 | Ga0207697_10002969 | 3300025315 | Bacteria | 8563 |
| 253 | Ga0207713_1000135 | 3300025735 | Bacteria | 112173 |
| 254 | Ga0207713_1005578 | 3300025735 | Bacteria | 7833 |
| 255 | Ga0207682_10002543 | 3300025893 | Bacteria | 8137 |
| 256 | Ga0207642_10006148 | 3300025899 | Bacteria | 3975 |
| 257 | Ga0207642_10052696 | 3300025899 | Bacteria | 1847 |
| 258 | Ga0207688_10016415 | 3300025901 | Bacteria | 4016 |
| 259 | Ga0207647_10000466 | 3300025904 | Bacteria | 32789 |
| 260 | Ga0207647_10001635 | 3300025904 | Bacteria | 17224 |
| 261 | Ga0207647_10008680 | 3300025904 | Bacteria | 7260 |
| 262 | Ga0207647_10015811 | 3300025904 | Bacteria | 5165 |
| 263 | Ga0207647_10018503 | 3300025904 | Bacteria | 4708 |
| 264 | Ga0207645_10002306 | 3300025907 | Bacteria | 15080 |
| 265 | Ga0207643_10002326 | 3300025908 | Bacteria | 10344 |
| 266 | Ga0207705_10000292 | 3300025909 | Bacteria | 46696 |
| 267 | Ga0207705_10121329 | 3300025909 | Bacteria | 1940 |
| 268 | Ga0207705_10124406 | 3300025909 | Bacteria | 1916 |
| 269 | Ga0207705_10126338 | 3300025909 | Bacteria | 1901 |
| 270 | Ga0207684_10055702 | 3300025910 | Bacteria | 3354 |
| 271 | Ga0207707_10022182 | 3300025912 | Bacteria | 5550 |
| 272 | Ga0207695_10000955 | 3300025913 | Bacteria | 51451 |
| 273 | Ga0207695_10001386 | 3300025913 | Bacteria | 40928 |
| 274 | Ga0207695_10006007 | 3300025913 | Bacteria | 15874 |
| 275 | Ga0207695_10138385 | 3300025913 | Bacteria | 2386 |
| 276 | Ga0207671_10007494 | 3300025914 | Bacteria | 9467 |
| 277 | Ga0207671_10057403 | 3300025914 | Bacteria | 2885 |
| 278 | Ga0207671_10091830 | 3300025914 | Bacteria | 2288 |
| 279 | Ga0207693_10007239 | 3300025915 | Bacteria | 9132 |
| 280 | Ga0207663_10040384 | 3300025916 | Bacteria | 2835 |
| 281 | Ga0207662_10015167 | 3300025918 | Bacteria | 4332 |
| 282 | Ga0207657_10000018 | 3300025919 | Bacteria | 172140 |
| 283 | Ga0207657_10006875 | 3300025919 | Bacteria | 11738 |
| 284 | Ga0207657_10098014 | 3300025919 | Bacteria | 2436 |
| 285 | Ga0207649_10245890 | 3300025920 | Bacteria | 1286 |
| 286 | Ga0207652_10110583 | 3300025921 | Bacteria | 2436 |
| 287 | Ga0207646_10050124 | 3300025922 | Bacteria | 3737 |
| 288 | Ga0207681_10007701 | 3300025923 | Bacteria | 6598 |
| 289 | Ga0207694_10029357 | 3300025924 | Bacteria | 4196 |
| 290 | Ga0207659_10264478 | 3300025926 | Bacteria | 1401 |
| 291 | Ga0207687_10051376 | 3300025927 | Bacteria | 2874 |
| 292 | Ga0207687_10153268 | 3300025927 | Bacteria | 1761 |
| 293 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 294 | Ga0207690_10300985 | 3300025932 | Bacteria | 1255 |
| 295 | Ga0207706_10015483 | 3300025933 | Bacteria | 6890 |
| 296 | Ga0207706_10176497 | 3300025933 | Bacteria | 1877 |
| 297 | Ga0207686_10008764 | 3300025934 | Bacteria | 5465 |
| 298 | Ga0207686_10344416 | 3300025934 | Bacteria | 1120 |
| 299 | Ga0207669_10607717 | 3300025937 | Bacteria | 889 |
| 300 | Ga0207704_10017589 | 3300025938 | Bacteria | 3711 |
| 301 | Ga0207704_10206830 | 3300025938 | Bacteria | 1441 |
| 302 | Ga0207665_10013795 | 3300025939 | Bacteria | 5315 |
| 303 | Ga0207691_10015351 | 3300025940 | Bacteria | 7286 |
| 304 | Ga0207711_10097500 | 3300025941 | Bacteria | 2596 |
| 305 | Ga0207711_10104245 | 3300025941 | Bacteria | 2513 |
| 306 | Ga0207711_10106002 | 3300025941 | Bacteria | 2493 |
| 307 | Ga0207711_10152647 | 3300025941 | Bacteria | 2085 |
| 308 | Ga0207689_10004537 | 3300025942 | Bacteria | 12568 |
| 309 | Ga0207689_10119356 | 3300025942 | Bacteria | 2169 |
| 310 | Ga0207661_10153409 | 3300025944 | Bacteria | 1993 |
| 311 | Ga0207667_10002741 | 3300025949 | Bacteria | 21775 |
| 312 | Ga0207667_10021402 | 3300025949 | Bacteria | 7167 |
| 313 | Ga0207667_10026422 | 3300025949 | Bacteria | 6343 |
| 314 | Ga0207668_10172306 | 3300025972 | Bacteria | 1698 |
| 315 | Ga0207640_10052921 | 3300025981 | Bacteria | 2647 |
| 316 | Ga0207640_10176887 | 3300025981 | Bacteria | 1596 |
| 317 | Ga0207658_10906965 | 3300025986 | Bacteria | 802 |
| 318 | Ga0207677_10087719 | 3300026023 | Bacteria | 2253 |
| 319 | Ga0207677_10305775 | 3300026023 | Bacteria | 1315 |
| 320 | Ga0207703_10012908 | 3300026035 | Bacteria | 6512 |
| 321 | Ga0207703_10086166 | 3300026035 | Bacteria | 2630 |
| 322 | Ga0207639_10107844 | 3300026041 | Bacteria | 2263 |
| 323 | Ga0207678_10002014 | 3300026067 | Bacteria | 18462 |
| 324 | Ga0207678_10073118 | 3300026067 | Bacteria | 2938 |
| 325 | Ga0207678_10188521 | 3300026067 | Bacteria | 1762 |
| 326 | Ga0207678_10304450 | 3300026067 | Bacteria | 1370 |
| 327 | Ga0207708_10002353 | 3300026075 | Bacteria | 13889 |
| 328 | Ga0207648_10003860 | 3300026089 | Bacteria | 15650 |
| 329 | Ga0207648_10055962 | 3300026089 | Bacteria | 3443 |
| 330 | Ga0207676_10697057 | 3300026095 | Bacteria | 983 |
| 331 | Ga0207674_10490587 | 3300026116 | Bacteria | 1187 |
| 332 | Ga0207675_100010756 | 3300026118 | Bacteria | 8574 |
| 333 | Ga0207675_100128109 | 3300026118 | Bacteria | 2405 |
| 334 | Ga0207683_10003766 | 3300026121 | Bacteria | 13151 |
| 335 | Ga0207683_10004051 | 3300026121 | Bacteria | 12665 |
| 336 | Ga0207698_10006738 | 3300026142 | Bacteria | 7176 |
| 337 | Ga0207698_10280249 | 3300026142 | Bacteria | 1541 |
| 338 | Ga0207698_10412866 | 3300026142 | Bacteria | 1293 |
| 339 | Ga0209371_1000783 | 3300027312 | Bacteria | 26286 |
| 340 | Ga0209371_1001679 | 3300027312 | Bacteria | 14121 |
| 341 | Ga0209813_10045622 | 3300027866 | Bacteria | 1351 |
| 342 | Ga0207428_10064812 | 3300027907 | Bacteria | 2884 |
| 343 | Ga0268266_10051881 | 3300028379 | Bacteria | 3522 |
| 344 | Ga0268265_10290504 | 3300028380 | Bacteria | 1467 |
| 345 | Ga0268264_10163350 | 3300028381 | Bacteria | 2008 |
| 346 | Ga0265338_10005564 | 3300028800 | Bacteria | 16390 |
| 347 | Ga0268256_1000857 | 3300030500 | Bacteria | 21338 |
| 348 | Ga0268256_1005054 | 3300030500 | Bacteria | 5281 |
| 349 | Ga0265327_10003077 | 3300031251 | Bacteria | 16467 |
| 350 | Ga0307513_10287680 | 3300031456 | Bacteria | 1417 |
| 351 | Ga0307509_10000138 | 3300031507 | Bacteria | 108694 |
| 352 | Ga0307408_100000005 | 3300031548 | Bacteria | 529098 |
| 353 | Ga0307408_100001187 | 3300031548 | Bacteria | 19703 |
| 354 | Ga0307408_100002797 | 3300031548 | Bacteria | 12114 |
| 355 | Ga0316575_10001412 | 3300031665 | Bacteria | 7716 |
| 356 | Ga0316576_10016474 | 3300031727 | Bacteria | 4993 |
| 357 | Ga0316578_10025765 | 3300031728 | Bacteria | 3310 |
| 358 | Ga0307405_10012528 | 3300031731 | Bacteria | 4494 |
| 359 | Ga0307413_10137914 | 3300031824 | Unclassified | 1680 |
| 360 | Ga0307406_10000874 | 3300031901 | Bacteria | 16942 |
| 361 | Ga0307406_10503562 | 3300031901 | Bacteria | 982 |
| 362 | Ga0307412_10000016 | 3300031911 | Bacteria | 312878 |
| 363 | Ga0307412_10023901 | 3300031911 | Bacteria | 3767 |
| 364 | Ga0307409_100049740 | 3300031995 | Bacteria | 3198 |
| 365 | Ga0316583_10007937 | 3300032133 | Bacteria | 3827 |
| 366 | Ga0373952_0000039 | 3300035092 | Bacteria | 15480 |
| 367 | Ga0373945_0088000 | 3300035116 | Bacteria | 1199 |
| 368 | Ga0373961_0107347 | 3300035241 | Bacteria | 911 |
| 369 | Ga0316574_0006221 | 3300035398 | Bacteria | 6432 |
| 370 | Ga0316582_0108056 | 3300036647 | Bacteria | 1849 |
| 371 | Ga0316582_0326674 | 3300036647 | Bacteria | 1055 |
| 372 | Ga0316582_0362953 | 3300036647 | Bacteria | 997 |
| 373 | Ga0316584_0069315 | 3300036712 | Bacteria | 2644 |
| 374 | Ga0316584_0110392 | 3300036712 | Bacteria | 2058 |
| 375 | Ga0395899_0000029 | 3300037312 | Bacteria | 329371 |
| 376 | Ga0395899_0253343 | 3300037312 | Bacteria | 1207 |
| 377 | Ga0395899_0342815 | 3300037312 | Bacteria | 1001 |
| 378 | Ga0395900_0000085 | 3300037418 | Bacteria | 172265 |
| 379 | Ga0395900_0003083 | 3300037418 | Bacteria | 18108 |
| 380 | Ga0395900_0052585 | 3300037418 | Bacteria | 4192 |
| 381 | Ga0395900_0247945 | 3300037418 | Bacteria | 1783 |
| 382 | Ga0395898_0000086 | 3300037466 | Bacteria | 239895 |
| 383 | Ga0395898_0000339 | 3300037466 | Bacteria | 105864 |
| 384 | Ga0395898_0016932 | 3300037466 | Bacteria | 7441 |
| 385 | Ga0395898_0017184 | 3300037466 | Bacteria | 7389 |
| 386 | Ga0395905_0000183 | 3300037471 | Bacteria | 99662 |
| 387 | Ga0395905_0003794 | 3300037471 | Bacteria | 15978 |
| 388 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 389 | Ga0395901_0001540 | 3300038443 | Bacteria | 23894 |
| 390 | Ga0395901_0002257 | 3300038443 | Bacteria | 19672 |
| 391 | Ga0400490_24139 | 3300038726 | Bacteria | 12468 |
| 392 | Ga0400488_20240 | 3300038741 | Bacteria | 17299 |
| 393 | Ga0400488_62067 | 3300038741 | Bacteria | 2674 |
| 394 | Ga0400486_03127 | 3300038742 | Bacteria | 4714 |
| 395 | Ga0400486_32147 | 3300038742 | Bacteria | 1237 |
| 396 | Ga0400483_011190 | 3300039062 | Bacteria | 182340 |
| 397 | Ga0400483_025886 | 3300039062 | Bacteria | 13085 |
| 398 | Ga0400483_081004 | 3300039062 | Bacteria | 10239 |
| 399 | Ga0400483_143918 | 3300039062 | Bacteria | 1602 |
| 400 | Ga0400483_186862 | 3300039062 | Bacteria | 1849 |
| 401 | Ga0400483_215675 | 3300039062 | Bacteria | 181282 |
| 402 | Ga0400483_219863 | 3300039062 | Bacteria | 173210 |
| 403 | Ga0400489_43383 | 3300039093 | Bacteria | 22865 |
| 404 | Ga0400487_14538 | 3300039110 | Bacteria | 3076 |
| 405 | Ga0400487_55780 | 3300039110 | Bacteria | 12963 |
| 406 | Ga0436360_0376457 | 3300039438 | Bacteria | 815 |
| 407 | Ga0436361_0141037 | 3300039447 | Bacteria | 1867 |
| 408 | Ga0436361_0201744 | 3300039447 | Bacteria | 957 |
| 409 | Ga0436361_0371376 | 3300039447 | Bacteria | 2769 |
| 410 | Ga0439448_0000016 | 3300042005 | Bacteria | 28746 |
| 411 | Ga0450891_004960 | 3300042129 | Bacteria | 1236 |
| 412 | Ga0451577_0000659 | 3300042876 | Bacteria | 54455 |
| 413 | Ga0451577_0003395 | 3300042876 | Bacteria | 17797 |
| 414 | Ga0451577_0008544 | 3300042876 | Bacteria | 9960 |
| 415 | Ga0451577_0011087 | 3300042876 | Bacteria | 8555 |
| 416 | Ga0451577_0048059 | 3300042876 | Bacteria | 3813 |
| 417 | Ga0451577_0104462 | 3300042876 | Bacteria | 2532 |
| 418 | Ga0466977_0001336 | 3300044666 | Bacteria | 10038 |
| 419 | Ga0466965_0000556 | 3300044683 | Bacteria | 13448 |
| 420 | Ga0466966_0017520 | 3300044684 | Bacteria | 4732 |
| 421 | Ga0466966_0022290 | 3300044684 | Bacteria | 4156 |
| 422 | Ga0466966_0127607 | 3300044684 | Bacteria | 1559 |
| 423 | Ga0466961_0000233 | 3300044693 | Bacteria | 37633 |
| 424 | Ga0466961_0009166 | 3300044693 | Bacteria | 6302 |
| 425 | Ga0466961_0010118 | 3300044693 | Bacteria | 6008 |
| 426 | Ga0466961_0032088 | 3300044693 | Bacteria | 3375 |
| 427 | Ga0466961_0039674 | 3300044693 | Bacteria | 3018 |
| 428 | Ga0466961_0051708 | 3300044693 | Bacteria | 2623 |
| 429 | Ga0466961_0099510 | 3300044693 | Bacteria | 1832 |
| 430 | Ga0466963_0003833 | 3300044694 | Bacteria | 8673 |
| 431 | Ga0466963_0561167 | 3300044694 | Bacteria | 806 |
| 432 | Ga0466964_0001349 | 3300044706 | Bacteria | 8382 |
| 433 | Ga0466964_0038172 | 3300044706 | Bacteria | 1931 |
| 434 | Ga0453684_0080745 | 3300044712 | Bacteria | 4059 |
| 435 | Ga0453684_0531374 | 3300044712 | Bacteria | 1298 |
| 436 | Ga0453684_0710755 | 3300044712 | Bacteria | 1091 |
| 437 | Ga0453684_0718336 | 3300044712 | Bacteria | 1084 |
| 438 | Ga0453684_0740160 | 3300044712 | Bacteria | 1065 |
| 439 | Ga0466971_0036450 | 3300044719 | Bacteria | 2205 |
| 440 | Ga0466968_0088707 | 3300044735 | Bacteria | 1367 |
| 441 | Ga0466970_0022460 | 3300044765 | Bacteria | 3292 |
| 442 | Ga0466970_0032704 | 3300044765 | Bacteria | 2748 |
| 443 | Ga0466970_0102777 | 3300044765 | Bacteria | 1557 |
| 444 | Ga0466970_0217356 | 3300044765 | Bacteria | 1066 |
| 445 | Ga0466957_0006558 | 3300044842 | Bacteria | 6576 |
| 446 | Ga0466957_0038534 | 3300044842 | Bacteria | 2880 |
| 447 | Ga0466957_0080140 | 3300044842 | Bacteria | 2032 |
| 448 | Ga0466957_0215728 | 3300044842 | Bacteria | 1265 |
| 449 | Ga0466957_0244051 | 3300044842 | Bacteria | 1192 |
| 450 | Ga0466957_0505563 | 3300044842 | Bacteria | 838 |
| 451 | Ga0466960_0122496 | 3300044901 | Bacteria | 1363 |
| 452 | Ga0466959_0012532 | 3300045049 | Bacteria | 6129 |
| 453 | Ga0466959_0033246 | 3300045049 | Bacteria | 3815 |
| 454 | Ga0466959_0033621 | 3300045049 | Bacteria | 3792 |
| 455 | Ga0466959_0089326 | 3300045049 | Bacteria | 2214 |
| 456 | Ga0466959_0137516 | 3300045049 | Bacteria | 1728 |
| 457 | Ga0451576_0002901 | 3300045051 | Bacteria | 24469 |
| 458 | Ga0451576_0010104 | 3300045051 | Bacteria | 10868 |
| 459 | Ga0451576_0012129 | 3300045051 | Bacteria | 9719 |
| 460 | Ga0451576_0156840 | 3300045051 | Bacteria | 2375 |
| 461 | Ga0451576_0388222 | 3300045051 | Bacteria | 1463 |
| 462 | Ga0451576_0570148 | 3300045051 | Bacteria | 1189 |
| 463 | Ga0466958_0006906 | 3300045836 | Bacteria | 6208 |
| 464 | Ga0466958_0031621 | 3300045836 | Bacteria | 3146 |
| 465 | Ga0466958_0084504 | 3300045836 | Bacteria | 1957 |
| 466 | Ga0466967_0315415 | 3300045976 | Bacteria | 1507 |
| 467 | Ga0495592_0003496 | 3300046454 | Bacteria | 11275 |
| 468 | Ga0495592_0005558 | 3300046454 | Bacteria | 9323 |
| 469 | Ga0495592_0106388 | 3300046454 | Bacteria | 1991 |
| 470 | Ga0495603_0000378 | 3300046455 | Bacteria | 24228 |
| 471 | Ga0495603_0003405 | 3300046455 | Bacteria | 9472 |
| 472 | Ga0495603_0014125 | 3300046455 | Bacteria | 4831 |
| 473 | Ga0495590_0003779 | 3300046457 | Bacteria | 6164 |
| 474 | Ga0495590_0039502 | 3300046457 | Bacteria | 1646 |
| 475 | Ga0495590_0049028 | 3300046457 | Bacteria | 1473 |
| 476 | Ga0495591_005242 | 3300046458 | Bacteria | 6056 |
| 477 | Ga0495629_0000247 | 3300046459 | Bacteria | 47185 |
| 478 | Ga0495629_0000855 | 3300046459 | Bacteria | 24562 |
| 479 | Ga0495629_0001980 | 3300046459 | Bacteria | 15968 |
| 480 | Ga0495629_0006909 | 3300046459 | Bacteria | 8372 |
| 481 | Ga0495629_0069918 | 3300046459 | Bacteria | 2449 |
| 482 | Ga0495629_0205802 | 3300046459 | Bacteria | 1360 |
| 483 | Ga0495641_0020797 | 3300046461 | Bacteria | 3317 |
| 484 | Ga0495641_0029982 | 3300046461 | Bacteria | 2615 |
| 485 | Ga0495651_0054775 | 3300046462 | Bacteria | 3065 |
| 486 | Ga0495651_0174536 | 3300046462 | Bacteria | 1527 |
| 487 | Ga0495653_0001417 | 3300046463 | Bacteria | 18679 |
| 488 | Ga0495653_0024483 | 3300046463 | Bacteria | 4864 |
| 489 | Ga0495653_0046081 | 3300046463 | Bacteria | 3376 |
| 490 | Ga0495653_0061188 | 3300046463 | Bacteria | 2849 |
| 491 | Ga0495653_0164345 | 3300046463 | Bacteria | 1538 |
| 492 | Ga0495653_0219772 | 3300046463 | Bacteria | 1278 |
| 493 | Ga0495650_0000554 | 3300046471 | Bacteria | 53235 |
| 494 | Ga0495650_0020667 | 3300046471 | Bacteria | 3203 |
| 495 | Ga0495650_0057546 | 3300046471 | Bacteria | 1573 |
| 496 | Ga0495650_0199664 | 3300046471 | Bacteria | 695 |
| 497 | Ga0495580_0000063 | 3300046472 | Bacteria | 63558 |
| 498 | Ga0495580_0000113 | 3300046472 | Bacteria | 55036 |
| 499 | Ga0495580_0020233 | 3300046472 | Bacteria | 4930 |
| 500 | Ga0495580_0021318 | 3300046472 | Bacteria | 4781 |
| 501 | Ga0495580_0039104 | 3300046472 | Bacteria | 3394 |
| 502 | Ga0495580_0041613 | 3300046472 | Bacteria | 3276 |
| 503 | Ga0495580_0042249 | 3300046472 | Bacteria | 3248 |
| 504 | Ga0495582_0008677 | 3300046473 | Bacteria | 5604 |
| 505 | Ga0495582_0016493 | 3300046473 | Bacteria | 4046 |
| 506 | Ga0495582_0243951 | 3300046473 | Bacteria | 1030 |
| 507 | Ga0495605_0007856 | 3300046474 | Bacteria | 6041 |
| 508 | Ga0495605_0013827 | 3300046474 | Bacteria | 4435 |
| 509 | Ga0495605_0018837 | 3300046474 | Bacteria | 3695 |
| 510 | Ga0495605_0115150 | 3300046474 | Bacteria | 1223 |
| 511 | Ga0495662_0016072 | 3300046476 | Bacteria | 3629 |
| 512 | Ga0495662_0024545 | 3300046476 | Bacteria | 2909 |
| 513 | Ga0495664_0000674 | 3300046477 | Bacteria | 17356 |
| 514 | Ga0495664_0003151 | 3300046477 | Bacteria | 8953 |
| 515 | Ga0495664_0018340 | 3300046477 | Bacteria | 4008 |
| 516 | Ga0495584_0117964 | 3300046491 | Bacteria | 1344 |
| 517 | Ga0495584_0382534 | 3300046491 | Bacteria | 715 |
| 518 | Ga0495596_0036323 | 3300046500 | Bacteria | 1952 |
| 519 | Ga0495596_0063615 | 3300046500 | Bacteria | 1435 |
| 520 | Ga0495583_0011708 | 3300046506 | Bacteria | 5022 |
| 521 | Ga0495583_0095975 | 3300046506 | Bacteria | 1271 |
| 522 | Ga0495606_0024799 | 3300046507 | Bacteria | 4311 |
| 523 | Ga0495606_0080391 | 3300046507 | Bacteria | 2028 |
| 524 | Ga0495608_0007694 | 3300046511 | Bacteria | 7594 |
| 525 | Ga0495608_0008528 | 3300046511 | Bacteria | 7179 |
| 526 | Ga0495610_0013009 | 3300046512 | Bacteria | 4971 |
| 527 | Ga0495616_0014950 | 3300046513 | Bacteria | 4329 |
| 528 | Ga0495618_0001295 | 3300046514 | Bacteria | 16869 |
| 529 | Ga0495618_0005589 | 3300046514 | Bacteria | 7642 |
| 530 | Ga0495618_0009343 | 3300046514 | Bacteria | 5917 |
| 531 | Ga0495620_0011878 | 3300046515 | Bacteria | 4526 |
| 532 | Ga0495620_0028428 | 3300046515 | Bacteria | 2600 |
| 533 | Ga0495620_0137742 | 3300046515 | Bacteria | 955 |
| 534 | Ga0495628_0001894 | 3300046516 | Bacteria | 18978 |
| 535 | Ga0495628_0012767 | 3300046516 | Bacteria | 7071 |
| 536 | Ga0495628_0065261 | 3300046516 | Bacteria | 2848 |
| 537 | Ga0495628_0511160 | 3300046516 | Bacteria | 866 |
| 538 | Ga0495628_0534138 | 3300046516 | Bacteria | 843 |
| 539 | Ga0495630_0003458 | 3300046517 | Bacteria | 10979 |
| 540 | Ga0495630_0007833 | 3300046517 | Bacteria | 7651 |
| 541 | Ga0495630_0090148 | 3300046517 | Bacteria | 2316 |
| 542 | Ga0495630_0163411 | 3300046517 | Bacteria | 1695 |
| 543 | Ga0495631_0022240 | 3300046518 | Bacteria | 2948 |
| 544 | Ga0495648_0013411 | 3300046524 | Bacteria | 6061 |
| 545 | Ga0495648_0024471 | 3300046524 | Bacteria | 4110 |
| 546 | Ga0495648_0052889 | 3300046524 | Bacteria | 2463 |
| 547 | Ga0495666_0000403 | 3300046526 | Bacteria | 18997 |
| 548 | Ga0495666_0003242 | 3300046526 | Bacteria | 8200 |
| 549 | Ga0495666_0055220 | 3300046526 | Bacteria | 1904 |
| 550 | Ga0495642_0013499 | 3300046528 | Bacteria | 3160 |
| 551 | Ga0495642_0044604 | 3300046528 | Bacteria | 1810 |
| 552 | Ga0495642_0070508 | 3300046528 | Bacteria | 1461 |
| 553 | Ga0495652_0007309 | 3300046529 | Bacteria | 10185 |
| 554 | Ga0495652_0043381 | 3300046529 | Bacteria | 3874 |
| 555 | Ga0495652_0138515 | 3300046529 | Bacteria | 1916 |
| 556 | Ga0495652_0170372 | 3300046529 | Bacteria | 1681 |
| 557 | Ga0495665_0003969 | 3300046531 | Bacteria | 7986 |
| 558 | Ga0495665_0005705 | 3300046531 | Bacteria | 6719 |
| 559 | Ga0495665_0007407 | 3300046531 | Bacteria | 5934 |
| 560 | Ga0495665_0022055 | 3300046531 | Bacteria | 3424 |
| 561 | Ga0495665_0106361 | 3300046531 | Bacteria | 1472 |
| 562 | Ga0495640_0009949 | 3300046533 | Bacteria | 7372 |
| 563 | Ga0495640_0037063 | 3300046533 | Bacteria | 3442 |
| 564 | Ga0495640_0117734 | 3300046533 | Bacteria | 1729 |
| 565 | Ga0495586_0000326 | 3300046535 | Bacteria | 30088 |
| 566 | Ga0495586_0017850 | 3300046535 | Bacteria | 3775 |
| 567 | Ga0495586_0136458 | 3300046535 | Bacteria | 1375 |
| 568 | Ga0495587_0004548 | 3300046536 | Bacteria | 9110 |
| 569 | Ga0495587_0009815 | 3300046536 | Bacteria | 6117 |
| 570 | Ga0495597_0044547 | 3300046542 | Bacteria | 1973 |
| 571 | Ga0495645_0006404 | 3300046543 | Bacteria | 8168 |
| 572 | Ga0495645_0038683 | 3300046543 | Bacteria | 3480 |
| 573 | Ga0495645_0039215 | 3300046543 | Bacteria | 3455 |
| 574 | Ga0495645_0226666 | 3300046543 | Bacteria | 1254 |
| 575 | Ga0495622_0000039 | 3300046557 | Bacteria | 119003 |
| 576 | Ga0495622_0032081 | 3300046557 | Bacteria | 2453 |
| 577 | Ga0495656_0048527 | 3300046615 | Bacteria | 1805 |
| 578 | Ga0495634_0002076 | 3300046642 | Bacteria | 16928 |
| 579 | Ga0495634_0046651 | 3300046642 | Bacteria | 2923 |
| 580 | Ga0495611_0277672 | 3300046648 | Bacteria | 774 |
| 581 | Ga0495625_0051267 | 3300046660 | Bacteria | 2959 |
| 582 | Ga0495625_0057627 | 3300046660 | Bacteria | 2762 |
| 583 | Ga0495635_0018615 | 3300046663 | Bacteria | 4845 |
| 584 | Ga0495635_0025818 | 3300046663 | Bacteria | 4091 |
| 585 | Ga0495635_0154947 | 3300046663 | Bacteria | 1559 |
| 586 | Ga0495661_0002427 | 3300046665 | Bacteria | 14347 |
| 587 | Ga0495661_0006016 | 3300046665 | Bacteria | 8560 |
| 588 | Ga0495657_0101040 | 3300046675 | Bacteria | 1838 |
| 589 | Ga0495657_0214056 | 3300046675 | Bacteria | 1170 |
| 590 | Ga0495599_0093527 | 3300046678 | Bacteria | 1875 |
| 591 | Ga0495599_0200366 | 3300046678 | Bacteria | 1226 |
| 592 | Ga0495599_0406049 | 3300046678 | Bacteria | 811 |
| 593 | Ga0495623_0020527 | 3300046679 | Bacteria | 4269 |
| 594 | Ga0495623_0033299 | 3300046679 | Bacteria | 3306 |
| 595 | Ga0495623_0070163 | 3300046679 | Bacteria | 2183 |
| 596 | Ga0495623_0250361 | 3300046679 | Bacteria | 996 |
| 597 | Ga0495646_0000155 | 3300046680 | Bacteria | 34843 |
| 598 | Ga0495646_0024973 | 3300046680 | Bacteria | 3760 |
| 599 | Ga0495646_0242282 | 3300046680 | Bacteria | 968 |
| 600 | Ga0495669_0034092 | 3300046684 | Bacteria | 2243 |
| 601 | Ga0495669_0041682 | 3300046684 | Bacteria | 2039 |
| 602 | Ga0495613_0001408 | 3300046689 | Bacteria | 18331 |
| 603 | Ga0495613_0008462 | 3300046689 | Bacteria | 7632 |
| 604 | Ga0495613_0130069 | 3300046689 | Bacteria | 1803 |
| 605 | Ga0495624_0002650 | 3300046690 | Bacteria | 13500 |
| 606 | Ga0495624_0013056 | 3300046690 | Bacteria | 5664 |
| 607 | Ga0495624_0022460 | 3300046690 | Bacteria | 4169 |
| 608 | Ga0495624_0025596 | 3300046690 | Bacteria | 3873 |
| 609 | Ga0495670_0020644 | 3300046691 | Bacteria | 3249 |
| 610 | Ga0495670_0145878 | 3300046691 | Bacteria | 1240 |
| 611 | Ga0495671_0008251 | 3300046692 | Bacteria | 5871 |
| 612 | Ga0495671_0127628 | 3300046692 | Bacteria | 1240 |
| 613 | Ga0495671_0231999 | 3300046692 | Bacteria | 892 |
| 614 | Ga0495649_0003210 | 3300046694 | Bacteria | 11163 |
| 615 | Ga0495649_0016509 | 3300046694 | Bacteria | 4183 |
| 616 | Ga0495649_0016931 | 3300046694 | Bacteria | 4125 |
| 617 | Ga0495649_0029990 | 3300046694 | Bacteria | 3005 |
| 618 | Ga0495649_0071738 | 3300046694 | Bacteria | 1856 |
| 619 | Ga0495649_0150661 | 3300046694 | Bacteria | 1222 |
| 620 | Ga0495589_0009241 | 3300046794 | Bacteria | 5128 |
| 621 | Ga0495589_0013667 | 3300046794 | Bacteria | 4185 |
| 622 | Ga0495589_0052212 | 3300046794 | Bacteria | 2020 |
| 623 | Ga0495589_0092063 | 3300046794 | Bacteria | 1472 |
| 624 | Ga0495600_0025812 | 3300046809 | Bacteria | 3787 |
| 625 | Ga0495600_0067534 | 3300046809 | Bacteria | 2337 |
| 626 | Ga0495600_0071868 | 3300046809 | Bacteria | 2260 |
| 627 | Ga0495600_0080523 | 3300046809 | Bacteria | 2126 |
| 628 | Ga0495600_0409839 | 3300046809 | Bacteria | 842 |
| 629 | Ga0495660_0125705 | 3300046810 | Bacteria | 1292 |
| 630 | Ga0495581_0000336 | 3300047315 | Bacteria | 23362 |
| 631 | Ga0495581_0012201 | 3300047315 | Bacteria | 4975 |
| 632 | Ga0495581_0019046 | 3300047315 | Bacteria | 3984 |
| 633 | Ga0495581_0164518 | 3300047315 | Bacteria | 1297 |
| 634 | Ga0495604_0011247 | 3300047317 | Bacteria | 7105 |
| 635 | Ga0495604_0035971 | 3300047317 | Bacteria | 3906 |
| 636 | Ga0495604_0096106 | 3300047317 | Bacteria | 2187 |
| 637 | Ga0495674_0003393 | 3300047319 | Bacteria | 15471 |
| 638 | Ga0495674_0008596 | 3300047319 | Bacteria | 9720 |
| 639 | Ga0495674_0022243 | 3300047319 | Bacteria | 5847 |
| 640 | Ga0495674_0024850 | 3300047319 | Bacteria | 5499 |
| 641 | Ga0495674_0639577 | 3300047319 | Bacteria | 839 |
| 642 | Ga0495672_0041806 | 3300047320 | Bacteria | 2769 |
| 643 | Ga0495676_0017239 | 3300047321 | Bacteria | 6391 |
| 644 | Ga0495676_0032371 | 3300047321 | Bacteria | 4414 |
| 645 | Ga0495676_0074439 | 3300047321 | Bacteria | 2600 |
| 646 | Ga0495680_0009852 | 3300047322 | Bacteria | 8565 |
| 647 | Ga0495680_0084827 | 3300047322 | Bacteria | 2386 |
| 648 | Ga0495680_0182558 | 3300047322 | Bacteria | 1513 |
| 649 | Ga0495680_0396983 | 3300047322 | Bacteria | 953 |
| 650 | Ga0495680_0482883 | 3300047322 | Bacteria | 843 |
| 651 | Ga0495683_0002534 | 3300047323 | Bacteria | 10971 |
| 652 | Ga0495683_0003483 | 3300047323 | Bacteria | 9170 |
| 653 | Ga0495683_0012675 | 3300047323 | Bacteria | 4427 |
| 654 | Ga0495683_0014118 | 3300047323 | Bacteria | 4162 |
| 655 | Ga0495683_0041979 | 3300047323 | Bacteria | 2306 |
| 656 | Ga0495683_0207787 | 3300047323 | Bacteria | 879 |
| 657 | Ga0495687_000131 | 3300047443 | Bacteria | 114820 |
| 658 | Ga0495687_008005 | 3300047443 | Bacteria | 6121 |
| 659 | Ga0495687_031945 | 3300047443 | Bacteria | 2409 |
| 660 | Ga0495687_108252 | 3300047443 | Bacteria | 1027 |
| 661 | Ga0495675_0007002 | 3300047444 | Bacteria | 6935 |
| 662 | Ga0495675_0016536 | 3300047444 | Bacteria | 4667 |
| 663 | Ga0495675_0019119 | 3300047444 | Bacteria | 4352 |
| 664 | Ga0495677_0057088 | 3300047445 | Bacteria | 1443 |
| 665 | Ga0495679_000037 | 3300047446 | Bacteria | 158099 |
| 666 | Ga0495679_000454 | 3300047446 | Bacteria | 30216 |
| 667 | Ga0495679_010117 | 3300047446 | Bacteria | 3725 |
| 668 | Ga0495673_0027263 | 3300047469 | Bacteria | 2721 |
| 669 | Ga0495673_0053427 | 3300047469 | Bacteria | 1761 |
| 670 | Ga0495673_0087818 | 3300047469 | Bacteria | 1275 |
| 671 | Ga0495681_0127321 | 3300047470 | Bacteria | 1087 |
| 672 | Ga0495681_0159352 | 3300047470 | Bacteria | 941 |
| 673 | Ga0495684_0049901 | 3300047471 | Bacteria | 3197 |
| 674 | Ga0495684_0160733 | 3300047471 | Bacteria | 1675 |
| 675 | Ga0495684_0178287 | 3300047471 | Bacteria | 1576 |
| 676 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 677 | Ga0495686_0071894 | 3300047472 | Bacteria | 2128 |
| 678 | Ga0495686_0121140 | 3300047472 | Bacteria | 1559 |
| 679 | Ga0495686_0298548 | 3300047472 | Bacteria | 890 |
| 680 | Ga0495593_0008590 | 3300047673 | Bacteria | 5940 |
| 681 | Ga0495593_0013852 | 3300047673 | Bacteria | 4593 |
| 682 | Ga0495593_0014125 | 3300047673 | Bacteria | 4543 |
| 683 | Ga0495593_0060031 | 3300047673 | Bacteria | 1991 |
| 684 | Ga0495602_0002163 | 3300048088 | Bacteria | 19844 |
| 685 | Ga0495602_0043212 | 3300048088 | Bacteria | 4100 |
| 686 | Ga0495602_0049535 | 3300048088 | Bacteria | 3761 |
| 687 | Ga0495602_0088179 | 3300048088 | Bacteria | 2583 |
| 688 | Ga0495602_0377441 | 3300048088 | Bacteria | 1016 |
| 689 | Ga0495602_0394164 | 3300048088 | Bacteria | 989 |
| 690 | Ga0495602_0569586 | 3300048088 | Bacteria | 782 |
| 691 | Ga0495614_0015312 | 3300048089 | Bacteria | 3342 |
| 692 | Ga0495614_0032539 | 3300048089 | Bacteria | 2244 |
| 693 | Ga0495614_0089889 | 3300048089 | Bacteria | 1335 |
| 694 | Ga0495626_0012611 | 3300048091 | Bacteria | 4422 |
| 695 | Ga0495626_0053451 | 3300048091 | Bacteria | 1859 |
| 696 | Ga0495626_0139255 | 3300048091 | Bacteria | 1030 |
| 697 | Ga0496100_0068954 | 3300048903 | Bacteria | 2353 |
| 698 | Ga0496100_0179994 | 3300048903 | Bacteria | 1528 |
| 699 | Ga0496100_0285013 | 3300048903 | Bacteria | 1232 |
| 700 | Ga0496100_0347615 | 3300048903 | Bacteria | 1119 |
| 701 | Ga0496100_0641573 | 3300048903 | Bacteria | 826 |
| 702 | Ga0496101_0296622 | 3300048904 | Bacteria | 1265 |
| 703 | Ga0496101_0381139 | 3300048904 | Bacteria | 1109 |
| 704 | Ga0496101_0410775 | 3300048904 | Bacteria | 1067 |
| 705 | Ga0496101_0610507 | 3300048904 | Bacteria | 862 |
| 706 | Ga0496102_0028937 | 3300048905 | Bacteria | 4953 |
| 707 | Ga0496102_0030752 | 3300048905 | Bacteria | 4808 |
| 708 | Ga0496102_0038746 | 3300048905 | Bacteria | 4303 |
| 709 | Ga0496102_0085295 | 3300048905 | Bacteria | 2915 |
| 710 | Ga0496102_0149758 | 3300048905 | Bacteria | 2192 |
| 711 | Ga0496102_0579084 | 3300048905 | Bacteria | 1045 |
| 712 | Ga0496103_0001897 | 3300048906 | Bacteria | 13597 |
| 713 | Ga0496103_0140207 | 3300048906 | Bacteria | 1546 |
| 714 | Ga0496103_0151930 | 3300048906 | Bacteria | 1483 |
| 715 | Ga0496104_0064933 | 3300048907 | Bacteria | 3463 |
| 716 | Ga0496104_0081050 | 3300048907 | Bacteria | 3094 |
| 717 | Ga0496104_0109876 | 3300048907 | Bacteria | 2642 |
| 718 | Ga0496104_0313958 | 3300048907 | Bacteria | 1480 |
| 719 | Ga0496104_0467630 | 3300048907 | Bacteria | 1172 |
| 720 | Ga0496105_0150128 | 3300048908 | Bacteria | 1915 |
| 721 | Ga0496105_0217198 | 3300048908 | Bacteria | 1557 |
| 722 | Ga0496105_0332722 | 3300048908 | Bacteria | 1215 |
| 723 | Ga0496106_0000069 | 3300048909 | Bacteria | 82859 |
| 724 | Ga0496106_0040797 | 3300048909 | Bacteria | 3477 |
| 725 | Ga0496106_0067890 | 3300048909 | Bacteria | 2719 |
| 726 | Ga0496106_0197382 | 3300048909 | Bacteria | 1601 |
| 727 | Ga0496106_0280691 | 3300048909 | Bacteria | 1334 |
| 728 | Ga0496106_0304322 | 3300048909 | Bacteria | 1279 |
| 729 | Ga0496106_0446212 | 3300048909 | Bacteria | 1039 |
| 730 | Ga0496107_0257606 | 3300048910 | Bacteria | 1298 |
| 731 | Ga0496108_0100217 | 3300048911 | Bacteria | 2470 |
| 732 | Ga0496108_0111021 | 3300048911 | Bacteria | 2345 |
| 733 | Ga0496110_0030329 | 3300048913 | Bacteria | 4660 |
| 734 | Ga0496110_0120526 | 3300048913 | Bacteria | 2363 |
| 735 | Ga0496111_0139619 | 3300048914 | Bacteria | 1795 |
| 736 | Ga0496111_0250896 | 3300048914 | Bacteria | 1313 |
| 737 | Ga0496112_0010869 | 3300048915 | Bacteria | 8284 |
| 738 | Ga0496112_0061603 | 3300048915 | Bacteria | 3699 |
| 739 | Ga0496113_0029504 | 3300048916 | Bacteria | 3962 |
| 740 | Ga0496113_0343895 | 3300048916 | Bacteria | 1196 |
| 741 | Ga0496114_0069715 | 3300048917 | Bacteria | 2952 |
| 742 | Ga0496114_0195539 | 3300048917 | Bacteria | 1770 |
| 743 | Ga0496114_0220397 | 3300048917 | Bacteria | 1665 |
| 744 | Ga0496114_0266399 | 3300048917 | Bacteria | 1509 |
| 745 | Ga0496114_0267238 | 3300048917 | Bacteria | 1507 |
| 746 | Ga0496115_0156854 | 3300048918 | Bacteria | 1880 |
| 747 | Ga0496115_0227293 | 3300048918 | Bacteria | 1539 |
| 748 | Ga0496116_0002524 | 3300048919 | Bacteria | 19161 |
| 749 | Ga0496116_0017873 | 3300048919 | Bacteria | 5487 |
| 750 | Ga0496116_0161128 | 3300048919 | Bacteria | 1230 |
| 751 | Ga0496116_0194141 | 3300048919 | Bacteria | 1071 |
| 752 | Ga0496117_0012694 | 3300048920 | Bacteria | 7398 |
| 753 | Ga0496117_0014480 | 3300048920 | Bacteria | 6791 |
| 754 | Ga0496117_0014852 | 3300048920 | Bacteria | 6682 |
| 755 | Ga0496117_0018799 | 3300048920 | Bacteria | 5706 |
| 756 | Ga0496117_0026423 | 3300048920 | Bacteria | 4543 |
| 757 | Ga0496117_0215614 | 3300048920 | Bacteria | 1072 |
| 758 | Ga0496118_0003659 | 3300048921 | Bacteria | 19093 |
| 759 | Ga0496118_0005201 | 3300048921 | Bacteria | 14886 |
| 760 | Ga0496118_0005208 | 3300048921 | Bacteria | 14873 |
| 761 | Ga0496118_0005601 | 3300048921 | Bacteria | 14193 |
| 762 | Ga0496118_0006154 | 3300048921 | Bacteria | 13313 |
| 763 | Ga0496118_0010249 | 3300048921 | Bacteria | 9302 |
| 764 | Ga0496118_0039191 | 3300048921 | Bacteria | 3784 |
| 765 | Ga0496118_0063688 | 3300048921 | Bacteria | 2711 |
| 766 | Ga0496118_0106444 | 3300048921 | Bacteria | 1876 |
| 767 | Ga0496118_0120929 | 3300048921 | Bacteria | 1707 |
| 768 | Ga0496119_0074971 | 3300048922 | Bacteria | 1968 |
| 769 | Ga0496119_0092256 | 3300048922 | Bacteria | 1718 |
| 770 | Ga0496121_0000102 | 3300048924 | Bacteria | 195341 |
| 771 | Ga0496121_0000929 | 3300048924 | Bacteria | 52983 |
| 772 | Ga0496121_0014822 | 3300048924 | Bacteria | 8230 |
| 773 | Ga0496121_0015730 | 3300048924 | Bacteria | 7888 |
| 774 | Ga0496121_0242845 | 3300048924 | Bacteria | 1253 |
| 775 | Ga0496121_0281244 | 3300048924 | Bacteria | 1138 |
| 776 | Ga0496121_0333007 | 3300048924 | Bacteria | 1017 |
| 777 | Ga0496121_0379933 | 3300048924 | Bacteria | 932 |
| 778 | Ga0496122_0061614 | 3300048925 | Bacteria | 2752 |
| 779 | Ga0496122_0078029 | 3300048925 | Bacteria | 2322 |
| 780 | Ga0496122_0193064 | 3300048925 | Bacteria | 1199 |
| 781 | Ga0496122_0274088 | 3300048925 | Bacteria | 927 |
| 782 | Ga0496124_0044928 | 3300048927 | Bacteria | 3788 |
| 783 | Ga0496124_0119699 | 3300048927 | Bacteria | 2106 |
| 784 | Ga0496124_0525409 | 3300048927 | Bacteria | 787 |
| 785 | Ga0496125_0048763 | 3300048928 | Bacteria | 3527 |
| 786 | Ga0496126_0000225 | 3300048929 | Bacteria | 122842 |
| 787 | Ga0496126_0000393 | 3300048929 | Bacteria | 89680 |
| 788 | Ga0496126_0000899 | 3300048929 | Bacteria | 51751 |
| 789 | Ga0496126_0003752 | 3300048929 | Bacteria | 18891 |
| 790 | Ga0496126_0062491 | 3300048929 | Bacteria | 3341 |
| 791 | Ga0496126_0075058 | 3300048929 | Bacteria | 3002 |
| 792 | Ga0496126_0290080 | 3300048929 | Bacteria | 1353 |
| 793 | Ga0495678_037731 | 3300049459 | Bacteria | 1960 |
| 794 | Ga0495682_0011075 | 3300049460 | Bacteria | 3474 |
| 795 | Ga0501031_0363302 | 3300049568 | Bacteria | 937 |
| 796 | Ga0501033_0064301 | 3300049570 | Bacteria | 2700 |
| 797 | Ga0501036_0011585 | 3300049572 | Bacteria | 7306 |
| 798 | Ga0501036_0546403 | 3300049572 | Bacteria | 963 |
| 799 | Ga0501038_0026960 | 3300049574 | Bacteria | 5114 |
| 800 | Ga0501038_0056700 | 3300049574 | Bacteria | 3365 |
| 801 | Ga0501038_0492816 | 3300049574 | Bacteria | 938 |
| 802 | Ga0501039_0056996 | 3300049575 | Bacteria | 3027 |
| 803 | Ga0501039_0066124 | 3300049575 | Bacteria | 2806 |
| 804 | Ga0501041_0003947 | 3300049577 | Bacteria | 8557 |
| 805 | Ga0501041_0078377 | 3300049577 | Bacteria | 2033 |
| 806 | Ga0501041_0258262 | 3300049577 | Bacteria | 1095 |
| 807 | Ga0501042_0025237 | 3300049578 | Bacteria | 4174 |
| 808 | Ga0501042_0077581 | 3300049578 | Bacteria | 2379 |
| 809 | Ga0501042_0342584 | 3300049578 | Bacteria | 1081 |
| 810 | Ga0501048_0014345 | 3300049582 | Bacteria | 5868 |
| 811 | Ga0501048_0161815 | 3300049582 | Bacteria | 1584 |
| 812 | Ga0501048_0188002 | 3300049582 | Bacteria | 1464 |
| 813 | Ga0501048_0725404 | 3300049582 | Bacteria | 714 |
| 814 | Ga0501068_0105562 | 3300049584 | Bacteria | 1748 |
| 815 | Ga0501072_0011730 | 3300049588 | Bacteria | 6696 |
| 816 | Ga0501072_0060844 | 3300049588 | Bacteria | 2977 |
| 817 | Ga0501072_0091679 | 3300049588 | Bacteria | 2413 |
| 818 | Ga0501072_0633341 | 3300049588 | Bacteria | 842 |
| 819 | Ga0501073_0261300 | 3300049589 | Bacteria | 1195 |
| 820 | Ga0501075_0011761 | 3300049591 | Bacteria | 6205 |
| 821 | Ga0501075_0179966 | 3300049591 | Bacteria | 1613 |
| 822 | Ga0501076_0001607 | 3300049592 | Bacteria | 15216 |
| 823 | Ga0501076_0157723 | 3300049592 | Bacteria | 1848 |
| 824 | Ga0501209_000267 | 3300049656 | Bacteria | 6292 |
| 825 | Ga0501079_0004974 | 3300049741 | Bacteria | 9855 |
| 826 | Ga0501079_0100610 | 3300049741 | Bacteria | 2241 |
| 827 | Ga0501080_0010979 | 3300049742 | Bacteria | 8291 |
| 828 | Ga0501080_0016831 | 3300049742 | Bacteria | 6753 |
| 829 | Ga0501080_0849465 | 3300049742 | Bacteria | 798 |
| 830 | Ga0501081_0004065 | 3300049743 | Bacteria | 9371 |
| 831 | Ga0501081_0109807 | 3300049743 | Bacteria | 1957 |
| 832 | Ga0501035_0033312 | 3300049822 | Bacteria | 4686 |
| 833 | Ga0501044_0000033 | 3300049823 | Bacteria | 167177 |
| 834 | Ga0501045_0015990 | 3300049824 | Bacteria | 5323 |
| 835 | Ga0501045_0176019 | 3300049824 | Bacteria | 1594 |
| 836 | nmdc:mga03683_35003_c1 | 3300050489 | Bacteria | 2035 |
| 837 | nmdc:mga03n38_46373_c1 | 3300050490 | Bacteria | 1919 |
| 838 | nmdc:mga0qj67_328963_c1 | 3300050509 | Bacteria | 1237 |
| 839 | nmdc:mga08y16_371835_c1 | 3300050511 | Bacteria | 1466 |
| 840 | nmdc:mga0n895_133004_c1 | 3300050512 | Bacteria | 2513 |
| 841 | nmdc:mga0n895_671975_c1 | 3300050512 | Bacteria | 1033 |
| 842 | nmdc:mga0rr50_51193_c2 | 3300050513 | Bacteria | 2413 |
| 843 | Ga0500594_0014777 | 3300053118 | Bacteria | 1874 |
| 844 | Ga0500618_005339 | 3300053125 | Bacteria | 3924 |
| 845 | Ga0500637_0234382 | 3300053178 | Bacteria | 1032 |
| 846 | Ga0501084_0015793 | 3300054114 | Bacteria | 6262 |
| 847 | Ga0587088_015960 | 3300059508 | Bacteria | 1190 |
| 848 | Ga0501082_0010423 | 3300060353 | Bacteria | 8000 |
| 849 | Ga0501082_0293680 | 3300060353 | Bacteria | 1415 |
| 850 | Ga0501082_0437500 | 3300060353 | Bacteria | 1142 |
| 851 | Ga0466962_0006187 | 3300061719 | Bacteria | 5750 |
| 852 | Ga0466962_0047173 | 3300061719 | Bacteria | 2058 |
| 853 | Ga0466962_0196758 | 3300061719 | Bacteria | 984 |
| 854 | Ga0530510_0001224 | 3300061734 | Bacteria | 17146 |
| 855 | 2501081102 | 2501025502 | Bacteria | 9641094 |
| 856 | 2501408277 | 2501025504 | Bacteria | 8008976 |
| 857 | 2509130109 | 2508501125 | Bacteria | 7208311 |
| 858 | 2510251944 | 2510065045 | Bacteria | 7761063 |
| 859 | 2511085879 | 2510917013 | Bacteria | 9951648 |
| 860 | 2511096018 | 2510917014 | Bacteria | 8296963 |
| 861 | 2511103258 | 2510917015 | Bacteria | 7950052 |
| 862 | 2512345067 | 2512047030 | Bacteria | 9031815 |
| 863 | 2513554132 | 2513237082 | Bacteria | 8640282 |
| 864 | 2513561544 | 2513237083 | Bacteria | 8410967 |
| 865 | 2513962339 | 2513237151 | Bacteria | 6309801 |
| 866 | 2514053223 | 2513237166 | Bacteria | 10373764 |
| 867 | 2515685046 | 2515154122 | Bacteria | 8609520 |
| 868 | 2515691039 | 2515154123 | Bacteria | 6387382 |
| 869 | 2516020641 | 2515154189 | Bacteria | 9629850 |
| 870 | 2519458127 | 2519103095 | Bacteria | 6629912 |
| 871 | 2526212684 | 2526164512 | Bacteria | 4025691 |
| 872 | 2527077649 | 2526164713 | Bacteria | 6780608 |
| 873 | 2563059385 | 2562617112 | Bacteria | 10918404 |
| 874 | 2574431598 | 2574179768 | Bacteria | 4907129 |
| 875 | 2585294412 | 2582581311 | Bacteria | 6763856 |
| 876 | 2599739418 | 2599185239 | Bacteria | 8686614 |
| 877 | 2599742638 | 2599185240 | Bacteria | 7968121 |
| 878 | 2600204756 | 2599185355 | Bacteria | 7968906 |
| 879 | 2644028217 | 2643221603 | Bacteria | 6147767 |
| 880 | 2676741743 | 2675903129 | Bacteria | 7964495 |
| 881 | 2713479677 | 2711768613 | Bacteria | 11048459 |
| 882 | 2719641056 | 2718217991 | Bacteria | 7829542 |
| 883 | 2723878691 | 2721755763 | Bacteria | 4464185 |
| 884 | 2738819142 | 2738541296 | Bacteria | 7285013 |
| 885 | 2738830702 | 2738541298 | Bacteria | 7286732 |
| 886 | 2738872228 | 2738541306 | Bacteria | 7284992 |
| 887 | 2739189795 | 2738543002 | Bacteria | 7284546 |
| 888 | 2739218829 | 2738543008 | Bacteria | 7282815 |
| 889 | 2746088325 | 2744054900 | Bacteria | 8399525 |
| 890 | 2746096780 | 2744054901 | Bacteria | 8397047 |
| 891 | 2753567778 | 2751185846 | Bacteria | 7242164 |
| 892 | 2792838693 | 2791355137 | Bacteria | 9654227 |
| 893 | 2808972072 | 2808606384 | Bacteria | 8474373 |
| 894 | 2809007010 | 2808606390 | Bacteria | 8476311 |
| 895 | 2809014148 | 2808606391 | Bacteria | 8308166 |
| 896 | 2817260280 | 2816332253 | Bacteria | 6764532 |
| 897 | 2817277966 | 2816332256 | Bacteria | 6891714 |
| 898 | 2817451134 | 2816332286 | Bacteria | 6853759 |
| 899 | 2819621819 | 2818991450 | Bacteria | 6962147 |
| 900 | 2819632802 | 2818991452 | Bacteria | 8442785 |
| 901 | 2842324939 | 2842324504 | Bacteria | 9364110 |
| 902 | 2842349218 | 2842348783 | Bacteria | 9002918 |
| 903 | 2842461858 | 2842454564 | Bacteria | 8730687 |
| 904 | 2857361129 | 2857357740 | Bacteria | 9937880 |
| 905 | 2863421817 | 2863421361 | Bacteria | 7300805 |
| 906 | 2870072242 | 2870068957 | Bacteria | 8925310 |
| 907 | 2883096304 | 2883087390 | Bacteria | 9532701 |
| 908 | 2885277931 | 2885270888 | Bacteria | 9831543 |
| 909 | 2900637663 | 2900634093 | Bacteria | 10263517 |
| 910 | 2902686923 | 2902682994 | Bacteria | 8951596 |
| 911 | 2904487561 | 2904483920 | Bacteria | 7545285 |
| 912 | 2904565982 | 2904564687 | Bacteria | 7609577 |
| 913 | 2904573026 | 2904571731 | Bacteria | 7608790 |
| 914 | 2904618202 | 2904615490 | Bacteria | 10047340 |
| 915 | 2919528868 | 2919527303 | Bacteria | 7718827 |
| 916 | 2921646073 | 2921643360 | Bacteria | 11448031 |
| 917 | 2928111020 | 2928108538 | Bacteria | 7360024 |
| 918 | 2928137447 | 2928135762 | Bacteria | 7259641 |
| 919 | 2928159606 | 2928157003 | Bacteria | 7522202 |
| 920 | 2928164334 | 2928163908 | Bacteria | 7561269 |
| 921 | 2928173082 | 2928170801 | Bacteria | 8785406 |
| 922 | 2928505846 | 2928503688 | Bacteria | 7268108 |
| 923 | 2928538453 | 2928536128 | Bacteria | 7657547 |
| 924 | 2945937826 | 2945934425 | Bacteria | 7444609 |
| 925 | 2981994045 | 2981990288 | Bacteria | 7590678 |
| 926 | 2990705456 | 2990703756 | Bacteria | 7715990 |
| 927 | 642424477 | 641736151 | Bacteria | 7477263 |
| 928 | 642415532 | 641736154 | Bacteria | 7689995 |
| 929 | 642592435 | 642555112 | Bacteria | 8676562 |
| 930 | 642622656 | 642555113 | Bacteria | 8214658 |
| 931 | 8002394495 | 8002392321 | Bacteria | 4159911 |
| 932 | 8003957693 | 8003955200 | Bacteria | 8601927 |
| 933 | 8018848255 | 8018845410 | Bacteria | 8933938 |
| 934 | 8020809318 | 8020807995 | Bacteria | 6801506 |
| 935 | 8020939275 | 8020938398 | Bacteria | 7472757 |
| 936 | 8020947353 | 8020945358 | Bacteria | 8467355 |
| 937 | 8020954502 | 8020953355 | Bacteria | 7439080 |
| 938 | 8021122694 | 8021120328 | Bacteria | 8782274 |
| 939 | 8039099456 | 8039098773 | Bacteria | 6602928 |
| 940 | 8040170583 | 8040167225 | Bacteria | 6542727 |
| 941 | 8040175481 | 8040173305 | Bacteria | 6827067 |
| 942 | 8048749527 | 8048746797 | Bacteria | 3557226 |
| 943 | 8055267114 | 8055266321 | Bacteria | 7999742 |
| 944 | 8055301572 | 8055301274 | Bacteria | 8587385 |
| 945 | Ga0400483_079523 | |||
| 946 | JGI24740J21852_10001608 | |||
| 947 | JGI24739J22299_10002870 | |||
| 948 | JGI24739J22299_10002919 | |||
| 949 | JGI24739J22299_10005315 | |||
| 950 | JGI24739J22299_10036167 | |||
| 951 | JGI24737J22298_10004043 | |||
| 952 | JGI24737J22298_10009321 | |||
| 953 | JGI24735J21928_10000214 | |||
| 954 | JGI24735J21928_10000975 | |||
| 955 | JGI24738J21930_10001813 | |||
| 956 | JGI25156J39149_1000606 | |||
| 957 | JGI25156J39149_1001619 | |||
| 958 | JGI25156J39149_1001839 | |||
| 959 | JGI25165J46597_1002278 | |||
| 960 | rootH1_10082209 | |||
| 961 | rootH2_10060630 | |||
| 962 | rootH2_10060631 | |||
| 963 | rootH2_10263547 | |||
| 964 | rootL2_10044271 | |||
| 965 | rootH1_10017919 | |||
| 966 | rootH1_10017920 | |||
| 967 | rootH1_10050413 | |||
| 968 | JGI25160J50197_1000121 | |||
| 969 | Ga0055533_1000425 | |||
| 970 | Ga0055533_1002006 | |||
| 971 | Ga0055532_1000012 | |||
| 972 | Ga0055532_1002446 | |||
| 973 | Ga0055532_1010100 | |||
| 974 | Ga0055532_1012042 | |||
| 975 | Ga0055525_1008095 | |||
| 976 | Ga0055527_1000011 | |||
| 977 | Ga0055527_1000565 | |||
| 978 | Ga0055527_1000584 | |||
| 979 | Ga0055535_1000009 | |||
| 980 | Ga0055535_1001392 | |||
| 981 | Ga0055535_1001425 | |||
| 982 | Ga0055542_1000015 | |||
| 983 | Ga0055542_1001317 | |||
| 984 | Ga0055542_1002323 | |||
| 985 | Ga0055529_1000011 | |||
| 986 | Ga0055529_1000988 | |||
| 987 | Ga0055529_1006134 | |||
| 988 | Ga0055528_1002055 | |||
| 989 | Ga0058692_1005361 | |||
| 990 | Ga0065165_1000236 | |||
| 991 | Ga0070658_10022962 | |||
| 992 | Ga0070658_10041263 | |||
| 993 | Ga0070658_10061710 | |||
| 994 | Ga0070658_10361142 | |||
| 995 | Ga0070658_10455233 | |||
| 996 | Ga0070676_10012165 | |||
| 997 | Ga0070676_10326612 | |||
| 998 | Ga0070690_100068578 | |||
| 999 | Ga0068869_100426182 | |||
| 1000 | Ga0068868_100031957 | |||
| 1001 | Ga0068868_100484039 | |||
| 1002 | Ga0070660_100000412 | |||
| 1003 | Ga0070660_100080628 | |||
| 1004 | Ga0070660_100116852 | |||
| 1005 | Ga0070689_100134547 | |||
| 1006 | Ga0070687_100064444 | |||
| 1007 | Ga0070661_100125396 | |||
| 1008 | Ga0070661_100321864 | |||
| 1009 | Ga0070668_100007642 | |||
| 1010 | Ga0070668_100094310 | |||
| 1011 | Ga0070669_100269299 | |||
| 1012 | Ga0070675_100243763 | |||
| 1013 | Ga0070671_100072441 | |||
| 1014 | Ga0070674_100053234 | |||
| 1015 | Ga0070674_100059614 | |||
| 1016 | Ga0070674_100431592 | |||
| 1017 | Ga0070688_100027794 | |||
| 1018 | Ga0070659_100000014 | |||
| 1019 | Ga0070659_100106972 | |||
| 1020 | Ga0070659_100120912 | |||
| 1021 | Ga0070667_100079091 | |||
| 1022 | Ga0070667_100197501 | |||
| 1023 | Ga0070714_100088008 | |||
| 1024 | Ga0070701_10007392 | |||
| 1025 | Ga0070711_100119291 | |||
| 1026 | Ga0070705_100017262 | |||
| 1027 | Ga0070700_100036533 | |||
| 1028 | Ga0070663_100000465 | |||
| 1029 | Ga0070663_100079605 | |||
| 1030 | Ga0070663_100593271 | |||
| 1031 | Ga0070678_100001980 | |||
| 1032 | Ga0070678_100015348 | |||
| 1033 | Ga0070662_100077242 | |||
| 1034 | Ga0070662_100143261 | |||
| 1035 | Ga0070681_10007485 | |||
| 1036 | Ga0068867_100025300 | |||
| 1037 | Ga0068867_100530053 | |||
| 1038 | Ga0070685_10036097 | |||
| 1039 | Ga0070706_100027171 | |||
| 1040 | Ga0070707_100026476 | |||
| 1041 | Ga0070679_100081399 | |||
| 1042 | Ga0070697_100113330 | |||
| 1043 | Ga0070672_100155417 | |||
| 1044 | Ga0070672_100208831 | |||
| 1045 | Ga0070695_100013338 | |||
| 1046 | Ga0070695_100742653 | |||
| 1047 | Ga0070693_100064198 | |||
| 1048 | Ga0070693_100069041 | |||
| 1049 | Ga0070665_100268166 | |||
| 1050 | Ga0070665_100268648 | |||
| 1051 | Ga0070704_100011744 | |||
| 1052 | Ga0070704_100456774 | |||
| 1053 | Ga0068855_100002955 | |||
| 1054 | Ga0068855_100005640 | |||
| 1055 | Ga0068855_101106525 | |||
| 1056 | Ga0070664_100711978 | |||
| 1057 | Ga0068857_100304738 | |||
| 1058 | Ga0068854_100095793 | |||
| 1059 | Ga0070702_100018299 | |||
| 1060 | Ga0070702_100046763 | |||
| 1061 | Ga0068852_100009260 | |||
| 1062 | Ga0068852_100379939 | |||
| 1063 | Ga0068866_10002174 | |||
| 1064 | Ga0068866_10014626 | |||
| 1065 | Ga0068861_100026271 | |||
| 1066 | Ga0068861_100073082 | |||
| 1067 | Ga0068870_10021019 | |||
| 1068 | Ga0068863_100610084 | |||
| 1069 | Ga0068858_100026437 | |||
| 1070 | Ga0068860_100187922 | |||
| 1071 | Ga0068862_100302256 | |||
| 1072 | Ga0068862_100519859 | |||
| 1073 | Ga0070716_100036920 | |||
| 1074 | Ga0070712_100036562 | |||
| 1075 | Ga0075369_10011755 | |||
| 1076 | Ga0075366_10077882 | |||
| 1077 | Ga0097621_100095777 | |||
| 1078 | Ga0075370_10010707 | |||
| 1079 | Ga0068871_100042754 | |||
| 1080 | Ga0068871_100441887 | |||
| 1081 | Ga0075433_10310937 | |||
| 1082 | Ga0075434_100053749 | |||
| 1083 | Ga0068865_100042183 | |||
| 1084 | Ga0075435_100001710 | |||
| 1085 | Ga0105251_10000128 | |||
| 1086 | Ga0105251_10021378 | |||
| 1087 | Ga0105251_10119617 | |||
| 1088 | Ga0105240_10000748 | |||
| 1089 | Ga0105240_10012809 | |||
| 1090 | Ga0105240_10050146 | |||
| 1091 | Ga0105240_10102224 | |||
| 1092 | Ga0105240_10540973 | |||
| 1093 | Ga0111539_10086516 | |||
| 1094 | Ga0105245_10033012 | |||
| 1095 | Ga0105245_10152455 | |||
| 1096 | Ga0105247_10300188 | |||
| 1097 | Ga0105243_10010284 | |||
| 1098 | Ga0105241_10251910 | |||
| 1099 | Ga0105242_10016251 | |||
| 1100 | Ga0105242_10097070 | |||
| 1101 | Ga0105248_10051332 | |||
| 1102 | Ga0105248_10105353 | |||
| 1103 | Ga0105248_10958322 | |||
| 1104 | Ga0105237_10004300 | |||
| 1105 | Ga0105237_10009421 | |||
| 1106 | Ga0105237_10034289 | |||
| 1107 | Ga0105237_10099527 | |||
| 1108 | Ga0105237_10149287 | |||
| 1109 | Ga0105237_10406204 | |||
| 1110 | Ga0105238_10032822 | |||
| 1111 | Ga0105238_10074149 | |||
| 1112 | Ga0105249_10140510 | |||
| 1113 | Ga0105249_10398089 | |||
| 1114 | Ga0105239_10005634 | |||
| 1115 | Ga0105239_10012318 | |||
| 1116 | Ga0105246_10293649 | |||
| 1117 | Ga0105246_10770257 | |||
| 1118 | Ga0157373_10013231 | |||
| 1119 | Ga0157373_10369435 | |||
| 1120 | Ga0157371_10004974 | |||
| 1121 | Ga0157370_10000210 | |||
| 1122 | Ga0157370_10019066 | |||
| 1123 | Ga0157370_10428841 | |||
| 1124 | Ga0157369_10000116 | |||
| 1125 | Ga0157369_10000599 | |||
| 1126 | Ga0157369_10001470 | |||
| 1127 | Ga0157369_10030593 | |||
| 1128 | Ga0157369_10231524 | |||
| 1129 | Ga0157374_10000717 | |||
| 1130 | Ga0157374_10076635 | |||
| 1131 | Ga0157378_10311074 | |||
| 1132 | Ga0163162_10037238 | |||
| 1133 | Ga0163162_10166912 | |||
| 1134 | Ga0157372_10002555 | |||
| 1135 | Ga0157372_10228093 | |||
| 1136 | Ga0157375_10023764 | |||
| 1137 | Ga0157375_10159363 | |||
| 1138 | Ga0157375_10406923 | |||
| 1139 | Ga0157380_10005113 | |||
| 1140 | Ga0157380_10015813 | |||
| 1141 | Ga0182008_10036701 | |||
| 1142 | Ga0182008_10155215 | |||
| 1143 | Ga0157377_10030000 | |||
| 1144 | Ga0157379_10014445 | |||
| 1145 | Ga0157376_10031159 | |||
| 1146 | Ga0157376_10120628 | |||
| 1147 | Ga0157376_10291837 | |||
| 1148 | Ga0182006_1075170 | |||
| 1149 | Ga0182007_10000874 | |||
| 1150 | Ga0182005_1043638 | |||
| 1151 | Ga0183361_10009 | |||
| 1152 | Ga0163161_10053857 | |||
| 1153 | Ga0163161_10125780 | |||
| 1154 | Ga0197907_11106936 | |||
| 1155 | Ga0206354_10063618 | |||
| 1156 | Ga0206353_11985253 | |||
| 1157 | Ga0224712_10000010 | |||
| 1158 | Ga0209566_100797 | |||
| 1159 | Ga0209674_100013 | |||
| 1160 | Ga0209674_100188 | |||
| 1161 | Ga0209674_100199 | |||
| 1162 | Ga0209674_101843 | |||
| 1163 | Ga0209672_100010 | |||
| 1164 | Ga0209672_100051 | |||
| 1165 | Ga0209672_100083 | |||
| 1166 | Ga0209672_100753 | |||
| 1167 | Ga0209147_100006 | |||
| 1168 | Ga0209147_100120 | |||
| 1169 | Ga0209147_100178 | |||
| 1170 | Ga0209147_100365 | |||
| 1171 | Ga0209563_101459 | |||
| 1172 | Ga0207427_101338 | |||
| 1173 | Ga0209258_100010 | |||
| 1174 | Ga0209258_100280 | |||
| 1175 | Ga0209258_100292 | |||
| 1176 | Ga0209646_1018733 | |||
| 1177 | Ga0209148_1000018 | |||
| 1178 | Ga0209148_1000027 | |||
| 1179 | Ga0209148_1001699 | |||
| 1180 | Ga0209759_1000251 | |||
| 1181 | Ga0209759_1000261 | |||
| 1182 | Ga0209759_1001264 | |||
| 1183 | Ga0209759_1001797 | |||
| 1184 | Ga0209759_1002082 | |||
| 1185 | Ga0209233_1000093 | |||
| 1186 | Ga0209565_1013667 | |||
| 1187 | Ga0209455_1000015 | |||
| 1188 | Ga0209455_1000203 | |||
| 1189 | Ga0209455_1000683 | |||
| 1190 | Ga0209673_1000070 | |||
| 1191 | Ga0209564_1003673 | |||
| 1192 | Ga0209564_1006486 | |||
| 1193 | Ga0209256_1035276 | |||
| 1194 | Ga0207426_1000183 | |||
| 1195 | Ga0207426_1012231 | |||
| 1196 | Ga0207697_10002969 | |||
| 1197 | Ga0207713_1000135 | |||
| 1198 | Ga0207713_1005578 | |||
| 1199 | Ga0207682_10002543 | |||
| 1200 | Ga0207642_10006148 | |||
| 1201 | Ga0207642_10052696 | |||
| 1202 | Ga0207688_10016415 | |||
| 1203 | Ga0207647_10000466 | |||
| 1204 | Ga0207647_10001635 | |||
| 1205 | Ga0207647_10008680 | |||
| 1206 | Ga0207647_10015811 | |||
| 1207 | Ga0207647_10018503 | |||
| 1208 | Ga0207645_10002306 | |||
| 1209 | Ga0207643_10002326 | |||
| 1210 | Ga0207705_10000292 | |||
| 1211 | Ga0207705_10121329 | |||
| 1212 | Ga0207705_10124406 | |||
| 1213 | Ga0207705_10126338 | |||
| 1214 | Ga0207684_10055702 | |||
| 1215 | Ga0207707_10022182 | |||
| 1216 | Ga0207695_10000955 | |||
| 1217 | Ga0207695_10001386 | |||
| 1218 | Ga0207695_10006007 | |||
| 1219 | Ga0207695_10138385 | |||
| 1220 | Ga0207671_10007494 | |||
| 1221 | Ga0207671_10057403 | |||
| 1222 | Ga0207671_10091830 | |||
| 1223 | Ga0207693_10007239 | |||
| 1224 | Ga0207663_10040384 | |||
| 1225 | Ga0207662_10015167 | |||
| 1226 | Ga0207657_10000018 | |||
| 1227 | Ga0207657_10006875 | |||
| 1228 | Ga0207657_10098014 | |||
| 1229 | Ga0207649_10245890 | |||
| 1230 | Ga0207652_10110583 | |||
| 1231 | Ga0207646_10050124 | |||
| 1232 | Ga0207681_10007701 | |||
| 1233 | Ga0207694_10029357 | |||
| 1234 | Ga0207659_10264478 | |||
| 1235 | Ga0207687_10051376 | |||
| 1236 | Ga0207687_10153268 | |||
| 1237 | Ga0207690_10000006 | |||
| 1238 | Ga0207690_10300985 | |||
| 1239 | Ga0207706_10015483 | |||
| 1240 | Ga0207706_10176497 | |||
| 1241 | Ga0207686_10008764 | |||
| 1242 | Ga0207686_10344416 | |||
| 1243 | Ga0207669_10607717 | |||
| 1244 | Ga0207704_10017589 | |||
| 1245 | Ga0207704_10206830 | |||
| 1246 | Ga0207665_10013795 | |||
| 1247 | Ga0207691_10015351 | |||
| 1248 | Ga0207711_10097500 | |||
| 1249 | Ga0207711_10104245 | |||
| 1250 | Ga0207711_10106002 | |||
| 1251 | Ga0207711_10152647 | |||
| 1252 | Ga0207689_10004537 | |||
| 1253 | Ga0207689_10119356 | |||
| 1254 | Ga0207661_10153409 | |||
| 1255 | Ga0207667_10002741 | |||
| 1256 | Ga0207667_10021402 | |||
| 1257 | Ga0207667_10026422 | |||
| 1258 | Ga0207668_10172306 | |||
| 1259 | Ga0207640_10052921 | |||
| 1260 | Ga0207640_10176887 | |||
| 1261 | Ga0207658_10906965 | |||
| 1262 | Ga0207677_10087719 | |||
| 1263 | Ga0207677_10305775 | |||
| 1264 | Ga0207703_10012908 | |||
| 1265 | Ga0207703_10086166 | |||
| 1266 | Ga0207639_10107844 | |||
| 1267 | Ga0207678_10002014 | |||
| 1268 | Ga0207678_10073118 | |||
| 1269 | Ga0207678_10188521 | |||
| 1270 | Ga0207678_10304450 | |||
| 1271 | Ga0207708_10002353 | |||
| 1272 | Ga0207648_10003860 | |||
| 1273 | Ga0207648_10055962 | |||
| 1274 | Ga0207676_10697057 | |||
| 1275 | Ga0207674_10490587 | |||
| 1276 | Ga0207675_100010756 | |||
| 1277 | Ga0207675_100128109 | |||
| 1278 | Ga0207683_10003766 | |||
| 1279 | Ga0207683_10004051 | |||
| 1280 | Ga0207698_10006738 | |||
| 1281 | Ga0207698_10280249 | |||
| 1282 | Ga0207698_10412866 | |||
| 1283 | Ga0209371_1000783 | |||
| 1284 | Ga0209371_1001679 | |||
| 1285 | Ga0209813_10045622 | |||
| 1286 | Ga0207428_10064812 | |||
| 1287 | Ga0268266_10051881 | |||
| 1288 | Ga0268265_10290504 | |||
| 1289 | Ga0268264_10163350 | |||
| 1290 | Ga0265338_10005564 | |||
| 1291 | Ga0268256_1000857 | |||
| 1292 | Ga0268256_1005054 | |||
| 1293 | Ga0265327_10003077 | |||
| 1294 | Ga0307513_10287680 | |||
| 1295 | Ga0307509_10000138 | |||
| 1296 | Ga0307408_100000005 | |||
| 1297 | Ga0307408_100001187 | |||
| 1298 | Ga0307408_100002797 | |||
| 1299 | Ga0316575_10001412 | |||
| 1300 | Ga0316576_10016474 | |||
| 1301 | Ga0316578_10025765 | |||
| 1302 | Ga0307405_10012528 | |||
| 1303 | Ga0307413_10137914 | |||
| 1304 | Ga0307406_10000874 | |||
| 1305 | Ga0307406_10503562 | |||
| 1306 | Ga0307412_10000016 | |||
| 1307 | Ga0307412_10023901 | |||
| 1308 | Ga0307409_100049740 | |||
| 1309 | Ga0316583_10007937 | |||
| 1310 | Ga0373952_0000039 | |||
| 1311 | Ga0373945_0088000 | |||
| 1312 | Ga0373961_0107347 | |||
| 1313 | Ga0316574_0006221 | |||
| 1314 | Ga0316582_0108056 | |||
| 1315 | Ga0316582_0326674 | |||
| 1316 | Ga0316582_0362953 | |||
| 1317 | Ga0316584_0069315 | |||
| 1318 | Ga0316584_0110392 | |||
| 1319 | Ga0395899_0000029 | |||
| 1320 | Ga0395899_0253343 | |||
| 1321 | Ga0395899_0342815 | |||
| 1322 | Ga0395900_0000085 | |||
| 1323 | Ga0395900_0003083 | |||
| 1324 | Ga0395900_0052585 | |||
| 1325 | Ga0395900_0247945 | |||
| 1326 | Ga0395898_0000086 | |||
| 1327 | Ga0395898_0000339 | |||
| 1328 | Ga0395898_0016932 | |||
| 1329 | Ga0395898_0017184 | |||
| 1330 | Ga0395905_0000183 | |||
| 1331 | Ga0395905_0003794 | |||
| 1332 | Ga0395901_0000003 | |||
| 1333 | Ga0395901_0001540 | |||
| 1334 | Ga0395901_0002257 | |||
| 1335 | Ga0400490_24139 | |||
| 1336 | Ga0400488_20240 | |||
| 1337 | Ga0400488_62067 | |||
| 1338 | Ga0400486_03127 | |||
| 1339 | Ga0400486_32147 | |||
| 1340 | Ga0400483_011190 | |||
| 1341 | Ga0400483_025886 | |||
| 1342 | Ga0400483_081004 | |||
| 1343 | Ga0400483_143918 | |||
| 1344 | Ga0400483_186862 | |||
| 1345 | Ga0400483_215675 | |||
| 1346 | Ga0400483_219863 | |||
| 1347 | Ga0400489_43383 | |||
| 1348 | Ga0400487_14538 | |||
| 1349 | Ga0400487_55780 | |||
| 1350 | Ga0436360_0376457 | |||
| 1351 | Ga0436361_0141037 | |||
| 1352 | Ga0436361_0201744 | |||
| 1353 | Ga0436361_0371376 | |||
| 1354 | Ga0439448_0000016 | |||
| 1355 | Ga0450891_004960 | |||
| 1356 | Ga0451577_0000659 | |||
| 1357 | Ga0451577_0003395 | |||
| 1358 | Ga0451577_0008544 | |||
| 1359 | Ga0451577_0011087 | |||
| 1360 | Ga0451577_0048059 | |||
| 1361 | Ga0451577_0104462 | |||
| 1362 | Ga0466977_0001336 | |||
| 1363 | Ga0466965_0000556 | |||
| 1364 | Ga0466966_0017520 | |||
| 1365 | Ga0466966_0022290 | |||
| 1366 | Ga0466966_0127607 | |||
| 1367 | Ga0466961_0000233 | |||
| 1368 | Ga0466961_0009166 | |||
| 1369 | Ga0466961_0010118 | |||
| 1370 | Ga0466961_0032088 | |||
| 1371 | Ga0466961_0039674 | |||
| 1372 | Ga0466961_0051708 | |||
| 1373 | Ga0466961_0099510 | |||
| 1374 | Ga0466963_0003833 | |||
| 1375 | Ga0466963_0561167 | |||
| 1376 | Ga0466964_0001349 | |||
| 1377 | Ga0466964_0038172 | |||
| 1378 | Ga0453684_0080745 | |||
| 1379 | Ga0453684_0531374 | |||
| 1380 | Ga0453684_0710755 | |||
| 1381 | Ga0453684_0718336 | |||
| 1382 | Ga0453684_0740160 | |||
| 1383 | Ga0466971_0036450 | |||
| 1384 | Ga0466968_0088707 | |||
| 1385 | Ga0466970_0022460 | |||
| 1386 | Ga0466970_0032704 | |||
| 1387 | Ga0466970_0102777 | |||
| 1388 | Ga0466970_0217356 | |||
| 1389 | Ga0466957_0006558 | |||
| 1390 | Ga0466957_0038534 | |||
| 1391 | Ga0466957_0080140 | |||
| 1392 | Ga0466957_0215728 | |||
| 1393 | Ga0466957_0244051 | |||
| 1394 | Ga0466957_0505563 | |||
| 1395 | Ga0466960_0122496 | |||
| 1396 | Ga0466959_0012532 | |||
| 1397 | Ga0466959_0033246 | |||
| 1398 | Ga0466959_0033621 | |||
| 1399 | Ga0466959_0089326 | |||
| 1400 | Ga0466959_0137516 | |||
| 1401 | Ga0451576_0002901 | |||
| 1402 | Ga0451576_0010104 | |||
| 1403 | Ga0451576_0012129 | |||
| 1404 | Ga0451576_0156840 | |||
| 1405 | Ga0451576_0388222 | |||
| 1406 | Ga0451576_0570148 | |||
| 1407 | Ga0466958_0006906 | |||
| 1408 | Ga0466958_0031621 | |||
| 1409 | Ga0466958_0084504 | |||
| 1410 | Ga0466967_0315415 | |||
| 1411 | Ga0495592_0003496 | |||
| 1412 | Ga0495592_0005558 | |||
| 1413 | Ga0495592_0106388 | |||
| 1414 | Ga0495603_0000378 | |||
| 1415 | Ga0495603_0003405 | |||
| 1416 | Ga0495603_0014125 | |||
| 1417 | Ga0495590_0003779 | |||
| 1418 | Ga0495590_0039502 | |||
| 1419 | Ga0495590_0049028 | |||
| 1420 | Ga0495591_005242 | |||
| 1421 | Ga0495629_0000247 | |||
| 1422 | Ga0495629_0000855 | |||
| 1423 | Ga0495629_0001980 | |||
| 1424 | Ga0495629_0006909 | |||
| 1425 | Ga0495629_0069918 | |||
| 1426 | Ga0495629_0205802 | |||
| 1427 | Ga0495641_0020797 | |||
| 1428 | Ga0495641_0029982 | |||
| 1429 | Ga0495651_0054775 | |||
| 1430 | Ga0495651_0174536 | |||
| 1431 | Ga0495653_0001417 | |||
| 1432 | Ga0495653_0024483 | |||
| 1433 | Ga0495653_0046081 | |||
| 1434 | Ga0495653_0061188 | |||
| 1435 | Ga0495653_0164345 | |||
| 1436 | Ga0495653_0219772 | |||
| 1437 | Ga0495650_0000554 | |||
| 1438 | Ga0495650_0020667 | |||
| 1439 | Ga0495650_0057546 | |||
| 1440 | Ga0495650_0199664 | |||
| 1441 | Ga0495580_0000063 | |||
| 1442 | Ga0495580_0000113 | |||
| 1443 | Ga0495580_0020233 | |||
| 1444 | Ga0495580_0021318 | |||
| 1445 | Ga0495580_0039104 | |||
| 1446 | Ga0495580_0041613 | |||
| 1447 | Ga0495580_0042249 | |||
| 1448 | Ga0495582_0008677 | |||
| 1449 | Ga0495582_0016493 | |||
| 1450 | Ga0495582_0243951 | |||
| 1451 | Ga0495605_0007856 | |||
| 1452 | Ga0495605_0013827 | |||
| 1453 | Ga0495605_0018837 | |||
| 1454 | Ga0495605_0115150 | |||
| 1455 | Ga0495662_0016072 | |||
| 1456 | Ga0495662_0024545 | |||
| 1457 | Ga0495664_0000674 | |||
| 1458 | Ga0495664_0003151 | |||
| 1459 | Ga0495664_0018340 | |||
| 1460 | Ga0495584_0117964 | |||
| 1461 | Ga0495584_0382534 | |||
| 1462 | Ga0495596_0036323 | |||
| 1463 | Ga0495596_0063615 | |||
| 1464 | Ga0495583_0011708 | |||
| 1465 | Ga0495583_0095975 | |||
| 1466 | Ga0495606_0024799 | |||
| 1467 | Ga0495606_0080391 | |||
| 1468 | Ga0495608_0007694 | |||
| 1469 | Ga0495608_0008528 | |||
| 1470 | Ga0495610_0013009 | |||
| 1471 | Ga0495616_0014950 | |||
| 1472 | Ga0495618_0001295 | |||
| 1473 | Ga0495618_0005589 | |||
| 1474 | Ga0495618_0009343 | |||
| 1475 | Ga0495620_0011878 | |||
| 1476 | Ga0495620_0028428 | |||
| 1477 | Ga0495620_0137742 | |||
| 1478 | Ga0495628_0001894 | |||
| 1479 | Ga0495628_0012767 | |||
| 1480 | Ga0495628_0065261 | |||
| 1481 | Ga0495628_0511160 | |||
| 1482 | Ga0495628_0534138 | |||
| 1483 | Ga0495630_0003458 | |||
| 1484 | Ga0495630_0007833 | |||
| 1485 | Ga0495630_0090148 | |||
| 1486 | Ga0495630_0163411 | |||
| 1487 | Ga0495631_0022240 | |||
| 1488 | Ga0495648_0013411 | |||
| 1489 | Ga0495648_0024471 | |||
| 1490 | Ga0495648_0052889 | |||
| 1491 | Ga0495666_0000403 | |||
| 1492 | Ga0495666_0003242 | |||
| 1493 | Ga0495666_0055220 | |||
| 1494 | Ga0495642_0013499 | |||
| 1495 | Ga0495642_0044604 | |||
| 1496 | Ga0495642_0070508 | |||
| 1497 | Ga0495652_0007309 | |||
| 1498 | Ga0495652_0043381 | |||
| 1499 | Ga0495652_0138515 | |||
| 1500 | Ga0495652_0170372 | |||
| 1501 | Ga0495665_0003969 | |||
| 1502 | Ga0495665_0005705 | |||
| 1503 | Ga0495665_0007407 | |||
| 1504 | Ga0495665_0022055 | |||
| 1505 | Ga0495665_0106361 | |||
| 1506 | Ga0495640_0009949 | |||
| 1507 | Ga0495640_0037063 | |||
| 1508 | Ga0495640_0117734 | |||
| 1509 | Ga0495586_0000326 | |||
| 1510 | Ga0495586_0017850 | |||
| 1511 | Ga0495586_0136458 | |||
| 1512 | Ga0495587_0004548 | |||
| 1513 | Ga0495587_0009815 | |||
| 1514 | Ga0495597_0044547 | |||
| 1515 | Ga0495645_0006404 | |||
| 1516 | Ga0495645_0038683 | |||
| 1517 | Ga0495645_0039215 | |||
| 1518 | Ga0495645_0226666 | |||
| 1519 | Ga0495622_0000039 | |||
| 1520 | Ga0495622_0032081 | |||
| 1521 | Ga0495656_0048527 | |||
| 1522 | Ga0495634_0002076 | |||
| 1523 | Ga0495634_0046651 | |||
| 1524 | Ga0495611_0277672 | |||
| 1525 | Ga0495625_0051267 | |||
| 1526 | Ga0495625_0057627 | |||
| 1527 | Ga0495635_0018615 | |||
| 1528 | Ga0495635_0025818 | |||
| 1529 | Ga0495635_0154947 | |||
| 1530 | Ga0495661_0002427 | |||
| 1531 | Ga0495661_0006016 | |||
| 1532 | Ga0495657_0101040 | |||
| 1533 | Ga0495657_0214056 | |||
| 1534 | Ga0495599_0093527 | |||
| 1535 | Ga0495599_0200366 | |||
| 1536 | Ga0495599_0406049 | |||
| 1537 | Ga0495623_0020527 | |||
| 1538 | Ga0495623_0033299 | |||
| 1539 | Ga0495623_0070163 | |||
| 1540 | Ga0495623_0250361 | |||
| 1541 | Ga0495646_0000155 | |||
| 1542 | Ga0495646_0024973 | |||
| 1543 | Ga0495646_0242282 | |||
| 1544 | Ga0495669_0034092 | |||
| 1545 | Ga0495669_0041682 | |||
| 1546 | Ga0495613_0001408 | |||
| 1547 | Ga0495613_0008462 | |||
| 1548 | Ga0495613_0130069 | |||
| 1549 | Ga0495624_0002650 | |||
| 1550 | Ga0495624_0013056 | |||
| 1551 | Ga0495624_0022460 | |||
| 1552 | Ga0495624_0025596 | |||
| 1553 | Ga0495670_0020644 | |||
| 1554 | Ga0495670_0145878 | |||
| 1555 | Ga0495671_0008251 | |||
| 1556 | Ga0495671_0127628 | |||
| 1557 | Ga0495671_0231999 | |||
| 1558 | Ga0495649_0003210 | |||
| 1559 | Ga0495649_0016509 | |||
| 1560 | Ga0495649_0016931 | |||
| 1561 | Ga0495649_0029990 | |||
| 1562 | Ga0495649_0071738 | |||
| 1563 | Ga0495649_0150661 | |||
| 1564 | Ga0495589_0009241 | |||
| 1565 | Ga0495589_0013667 | |||
| 1566 | Ga0495589_0052212 | |||
| 1567 | Ga0495589_0092063 | |||
| 1568 | Ga0495600_0025812 | |||
| 1569 | Ga0495600_0067534 | |||
| 1570 | Ga0495600_0071868 | |||
| 1571 | Ga0495600_0080523 | |||
| 1572 | Ga0495600_0409839 | |||
| 1573 | Ga0495660_0125705 | |||
| 1574 | Ga0495581_0000336 | |||
| 1575 | Ga0495581_0012201 | |||
| 1576 | Ga0495581_0019046 | |||
| 1577 | Ga0495581_0164518 | |||
| 1578 | Ga0495604_0011247 | |||
| 1579 | Ga0495604_0035971 | |||
| 1580 | Ga0495604_0096106 | |||
| 1581 | Ga0495674_0003393 | |||
| 1582 | Ga0495674_0008596 | |||
| 1583 | Ga0495674_0022243 | |||
| 1584 | Ga0495674_0024850 | |||
| 1585 | Ga0495674_0639577 | |||
| 1586 | Ga0495672_0041806 | |||
| 1587 | Ga0495676_0017239 | |||
| 1588 | Ga0495676_0032371 | |||
| 1589 | Ga0495676_0074439 | |||
| 1590 | Ga0495680_0009852 | |||
| 1591 | Ga0495680_0084827 | |||
| 1592 | Ga0495680_0182558 | |||
| 1593 | Ga0495680_0396983 | |||
| 1594 | Ga0495680_0482883 | |||
| 1595 | Ga0495683_0002534 | |||
| 1596 | Ga0495683_0003483 | |||
| 1597 | Ga0495683_0012675 | |||
| 1598 | Ga0495683_0014118 | |||
| 1599 | Ga0495683_0041979 | |||
| 1600 | Ga0495683_0207787 | |||
| 1601 | Ga0495687_000131 | |||
| 1602 | Ga0495687_008005 | |||
| 1603 | Ga0495687_031945 | |||
| 1604 | Ga0495687_108252 | |||
| 1605 | Ga0495675_0007002 | |||
| 1606 | Ga0495675_0016536 | |||
| 1607 | Ga0495675_0019119 | |||
| 1608 | Ga0495677_0057088 | |||
| 1609 | Ga0495679_000037 | |||
| 1610 | Ga0495679_000454 | |||
| 1611 | Ga0495679_010117 | |||
| 1612 | Ga0495673_0027263 | |||
| 1613 | Ga0495673_0053427 | |||
| 1614 | Ga0495673_0087818 | |||
| 1615 | Ga0495681_0127321 | |||
| 1616 | Ga0495681_0159352 | |||
| 1617 | Ga0495684_0049901 | |||
| 1618 | Ga0495684_0160733 | |||
| 1619 | Ga0495684_0178287 | |||
| 1620 | Ga0495686_0000002 | |||
| 1621 | Ga0495686_0071894 | |||
| 1622 | Ga0495686_0121140 | |||
| 1623 | Ga0495686_0298548 | |||
| 1624 | Ga0495593_0008590 | |||
| 1625 | Ga0495593_0013852 | |||
| 1626 | Ga0495593_0014125 | |||
| 1627 | Ga0495593_0060031 | |||
| 1628 | Ga0495602_0002163 | |||
| 1629 | Ga0495602_0043212 | |||
| 1630 | Ga0495602_0049535 | |||
| 1631 | Ga0495602_0088179 | |||
| 1632 | Ga0495602_0377441 | |||
| 1633 | Ga0495602_0394164 | |||
| 1634 | Ga0495602_0569586 | |||
| 1635 | Ga0495614_0015312 | |||
| 1636 | Ga0495614_0032539 | |||
| 1637 | Ga0495614_0089889 | |||
| 1638 | Ga0495626_0012611 | |||
| 1639 | Ga0495626_0053451 | |||
| 1640 | Ga0495626_0139255 | |||
| 1641 | Ga0496100_0068954 | |||
| 1642 | Ga0496100_0179994 | |||
| 1643 | Ga0496100_0285013 | |||
| 1644 | Ga0496100_0347615 | |||
| 1645 | Ga0496100_0641573 | |||
| 1646 | Ga0496101_0296622 | |||
| 1647 | Ga0496101_0381139 | |||
| 1648 | Ga0496101_0410775 | |||
| 1649 | Ga0496101_0610507 | |||
| 1650 | Ga0496102_0028937 | |||
| 1651 | Ga0496102_0030752 | |||
| 1652 | Ga0496102_0038746 | |||
| 1653 | Ga0496102_0085295 | |||
| 1654 | Ga0496102_0149758 | |||
| 1655 | Ga0496102_0579084 | |||
| 1656 | Ga0496103_0001897 | |||
| 1657 | Ga0496103_0140207 | |||
| 1658 | Ga0496103_0151930 | |||
| 1659 | Ga0496104_0064933 | |||
| 1660 | Ga0496104_0081050 | |||
| 1661 | Ga0496104_0109876 | |||
| 1662 | Ga0496104_0313958 | |||
| 1663 | Ga0496104_0467630 | |||
| 1664 | Ga0496105_0150128 | |||
| 1665 | Ga0496105_0217198 | |||
| 1666 | Ga0496105_0332722 | |||
| 1667 | Ga0496106_0000069 | |||
| 1668 | Ga0496106_0040797 | |||
| 1669 | Ga0496106_0067890 | |||
| 1670 | Ga0496106_0197382 | |||
| 1671 | Ga0496106_0280691 | |||
| 1672 | Ga0496106_0304322 | |||
| 1673 | Ga0496106_0446212 | |||
| 1674 | Ga0496107_0257606 | |||
| 1675 | Ga0496108_0100217 | |||
| 1676 | Ga0496108_0111021 | |||
| 1677 | Ga0496110_0030329 | |||
| 1678 | Ga0496110_0120526 | |||
| 1679 | Ga0496111_0139619 | |||
| 1680 | Ga0496111_0250896 | |||
| 1681 | Ga0496112_0010869 | |||
| 1682 | Ga0496112_0061603 | |||
| 1683 | Ga0496113_0029504 | |||
| 1684 | Ga0496113_0343895 | |||
| 1685 | Ga0496114_0069715 | |||
| 1686 | Ga0496114_0195539 | |||
| 1687 | Ga0496114_0220397 | |||
| 1688 | Ga0496114_0266399 | |||
| 1689 | Ga0496114_0267238 | |||
| 1690 | Ga0496115_0156854 | |||
| 1691 | Ga0496115_0227293 | |||
| 1692 | Ga0496116_0002524 | |||
| 1693 | Ga0496116_0017873 | |||
| 1694 | Ga0496116_0161128 | |||
| 1695 | Ga0496116_0194141 | |||
| 1696 | Ga0496117_0012694 | |||
| 1697 | Ga0496117_0014480 | |||
| 1698 | Ga0496117_0014852 | |||
| 1699 | Ga0496117_0018799 | |||
| 1700 | Ga0496117_0026423 | |||
| 1701 | Ga0496117_0215614 | |||
| 1702 | Ga0496118_0003659 | |||
| 1703 | Ga0496118_0005201 | |||
| 1704 | Ga0496118_0005208 | |||
| 1705 | Ga0496118_0005601 | |||
| 1706 | Ga0496118_0006154 | |||
| 1707 | Ga0496118_0010249 | |||
| 1708 | Ga0496118_0039191 | |||
| 1709 | Ga0496118_0063688 | |||
| 1710 | Ga0496118_0106444 | |||
| 1711 | Ga0496118_0120929 | |||
| 1712 | Ga0496119_0074971 | |||
| 1713 | Ga0496119_0092256 | |||
| 1714 | Ga0496121_0000102 | |||
| 1715 | Ga0496121_0000929 | |||
| 1716 | Ga0496121_0014822 | |||
| 1717 | Ga0496121_0015730 | |||
| 1718 | Ga0496121_0242845 | |||
| 1719 | Ga0496121_0281244 | |||
| 1720 | Ga0496121_0333007 | |||
| 1721 | Ga0496121_0379933 | |||
| 1722 | Ga0496122_0061614 | |||
| 1723 | Ga0496122_0078029 | |||
| 1724 | Ga0496122_0193064 | |||
| 1725 | Ga0496122_0274088 | |||
| 1726 | Ga0496124_0044928 | |||
| 1727 | Ga0496124_0119699 | |||
| 1728 | Ga0496124_0525409 | |||
| 1729 | Ga0496125_0048763 | |||
| 1730 | Ga0496126_0000225 | |||
| 1731 | Ga0496126_0000393 | |||
| 1732 | Ga0496126_0000899 | |||
| 1733 | Ga0496126_0003752 | |||
| 1734 | Ga0496126_0062491 | |||
| 1735 | Ga0496126_0075058 | |||
| 1736 | Ga0496126_0290080 | |||
| 1737 | Ga0495678_037731 | |||
| 1738 | Ga0495682_0011075 | |||
| 1739 | Ga0501031_0363302 | |||
| 1740 | Ga0501033_0064301 | |||
| 1741 | Ga0501036_0011585 | |||
| 1742 | Ga0501036_0546403 | |||
| 1743 | Ga0501038_0026960 | |||
| 1744 | Ga0501038_0056700 | |||
| 1745 | Ga0501038_0492816 | |||
| 1746 | Ga0501039_0056996 | |||
| 1747 | Ga0501039_0066124 | |||
| 1748 | Ga0501041_0003947 | |||
| 1749 | Ga0501041_0078377 | |||
| 1750 | Ga0501041_0258262 | |||
| 1751 | Ga0501042_0025237 | |||
| 1752 | Ga0501042_0077581 | |||
| 1753 | Ga0501042_0342584 | |||
| 1754 | Ga0501048_0014345 | |||
| 1755 | Ga0501048_0161815 | |||
| 1756 | Ga0501048_0188002 | |||
| 1757 | Ga0501048_0725404 | |||
| 1758 | Ga0501068_0105562 | |||
| 1759 | Ga0501072_0011730 | |||
| 1760 | Ga0501072_0060844 | |||
| 1761 | Ga0501072_0091679 | |||
| 1762 | Ga0501072_0633341 | |||
| 1763 | Ga0501073_0261300 | |||
| 1764 | Ga0501075_0011761 | |||
| 1765 | Ga0501075_0179966 | |||
| 1766 | Ga0501076_0001607 | |||
| 1767 | Ga0501076_0157723 | |||
| 1768 | Ga0501209_000267 | |||
| 1769 | Ga0501079_0004974 | |||
| 1770 | Ga0501079_0100610 | |||
| 1771 | Ga0501080_0010979 | |||
| 1772 | Ga0501080_0016831 | |||
| 1773 | Ga0501080_0849465 | |||
| 1774 | Ga0501081_0004065 | |||
| 1775 | Ga0501081_0109807 | |||
| 1776 | Ga0501035_0033312 | |||
| 1777 | Ga0501044_0000033 | |||
| 1778 | Ga0501045_0015990 | |||
| 1779 | Ga0501045_0176019 | |||
| 1780 | nmdc:mga03683_35003_c1 | |||
| 1781 | nmdc:mga03n38_46373_c1 | |||
| 1782 | nmdc:mga0qj67_328963_c1 | |||
| 1783 | nmdc:mga08y16_371835_c1 | |||
| 1784 | nmdc:mga0n895_133004_c1 | |||
| 1785 | nmdc:mga0n895_671975_c1 | |||
| 1786 | nmdc:mga0rr50_51193_c2 | |||
| 1787 | Ga0500594_0014777 | |||
| 1788 | Ga0500618_005339 | |||
| 1789 | Ga0500637_0234382 | |||
| 1790 | Ga0501084_0015793 | |||
| 1791 | Ga0587088_015960 | |||
| 1792 | Ga0501082_0010423 | |||
| 1793 | Ga0501082_0293680 | |||
| 1794 | Ga0501082_0437500 | |||
| 1795 | Ga0466962_0006187 | |||
| 1796 | Ga0466962_0047173 | |||
| 1797 | Ga0466962_0196758 | |||
| 1798 | Ga0530510_0001224 | |||
| 1799 | 2501081102 | |||
| 1800 | 2501408277 | |||
| 1801 | 2509130109 | |||
| 1802 | 2510251944 | |||
| 1803 | 2511085879 | |||
| 1804 | 2511096018 | |||
| 1805 | 2511103258 | |||
| 1806 | 2512345067 | |||
| 1807 | 2513554132 | |||
| 1808 | 2513561544 | |||
| 1809 | 2513962339 | |||
| 1810 | 2514053223 | |||
| 1811 | 2515685046 | |||
| 1812 | 2515691039 | |||
| 1813 | 2516020641 | |||
| 1814 | 2519458127 | |||
| 1815 | 2526212684 | |||
| 1816 | 2527077649 | |||
| 1817 | 2563059385 | |||
| 1818 | 2574431598 | |||
| 1819 | 2585294412 | |||
| 1820 | 2599739418 | |||
| 1821 | 2599742638 | |||
| 1822 | 2600204756 | |||
| 1823 | 2644028217 | |||
| 1824 | 2676741743 | |||
| 1825 | 2713479677 | |||
| 1826 | 2719641056 | |||
| 1827 | 2723878691 | |||
| 1828 | 2738819142 | |||
| 1829 | 2738830702 | |||
| 1830 | 2738872228 | |||
| 1831 | 2739189795 | |||
| 1832 | 2739218829 | |||
| 1833 | 2746088325 | |||
| 1834 | 2746096780 | |||
| 1835 | 2753567778 | |||
| 1836 | 2792838693 | |||
| 1837 | 2808972072 | |||
| 1838 | 2809007010 | |||
| 1839 | 2809014148 | |||
| 1840 | 2817260280 | |||
| 1841 | 2817277966 | |||
| 1842 | 2817451134 | |||
| 1843 | 2819621819 | |||
| 1844 | 2819632802 | |||
| 1845 | 2842324939 | |||
| 1846 | 2842349218 | |||
| 1847 | 2842461858 | |||
| 1848 | 2857361129 | |||
| 1849 | 2863421817 | |||
| 1850 | 2870072242 | |||
| 1851 | 2883096304 | |||
| 1852 | 2885277931 | |||
| 1853 | 2900637663 | |||
| 1854 | 2902686923 | |||
| 1855 | 2904487561 | |||
| 1856 | 2904565982 | |||
| 1857 | 2904573026 | |||
| 1858 | 2904618202 | |||
| 1859 | 2919528868 | |||
| 1860 | 2921646073 | |||
| 1861 | 2928111020 | |||
| 1862 | 2928137447 | |||
| 1863 | 2928159606 | |||
| 1864 | 2928164334 | |||
| 1865 | 2928173082 | |||
| 1866 | 2928505846 | |||
| 1867 | 2928538453 | |||
| 1868 | 2945937826 | |||
| 1869 | 2981994045 | |||
| 1870 | 2990705456 | |||
| 1871 | 642424477 | |||
| 1872 | 642415532 | |||
| 1873 | 642592435 | |||
| 1874 | 642622656 | |||
| 1875 | 8002394495 | |||
| 1876 | 8003957693 | |||
| 1877 | 8018848255 | |||
| 1878 | 8020809318 | |||
| 1879 | 8020939275 | |||
| 1880 | 8020947353 | |||
| 1881 | 8020954502 | |||
| 1882 | 8021122694 | |||
| 1883 | 8039099456 | |||
| 1884 | 8040170583 | |||
| 1885 | 8040175481 | |||
| 1886 | 8048749527 | |||
| 1887 | 8055267114 | |||
| 1888 | 8055301572 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yki-assembly1.cif.gz_A | crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide | 0.9711 | 52 | 102 |
| 2f3t-assembly1.cif.gz_B | crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate | 0.91 | 21 | 223 |
| 7u5f-assembly1.cif.gz_C | crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp | 0.9085 | 22 | 220 |
| 2f3t-assembly1.cif.gz_B | crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate | 0.9015 | 21 | 223 |
| 2anc-assembly1.cif.gz_F | crystal structure of unliganded form of oligomeric e.coli guanylate kinase | 0.9012 | 22 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2QPW1_160_210_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9999 | 53 | 102 | 3.30.63.10 |
| af_Q94JM2_119_167_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9921 | 53 | 99 | 3.30.63.10 |
| af_Q5TCQ9_142_196_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9714 | 52 | 102 | 3.30.63.10 |
| 3tauB02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9699 | 53 | 112 | 3.30.63.10 |
| af_Q2QPW1_160_210_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9617 | 53 | 102 | 3.30.63.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y3GJY2-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9864 | 21 | 203 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A7W0FAL4-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9779 | 22 | 205 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A1F6PPM8-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.973 | 22 | 206 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A396MZI1-F1-model_v4 | deleted | 0.9712 | 21 | 203 |
|
| AF-A0A7Y3GJY2-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9706 | 21 | 203 |
GO:0004385
GO:0005524 GO:0005829 |