F486407

General Info

Members Datasets Scaffolds Average Seq Length
944 470 1888 219

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_079523|Ga0400483_079523_414_1070
Length 218
Sequence MAKIPVVRENGNTMTARGTLYTISAPSGAGKTSLVNALLKADTAIRVSVSHTTRSKRPGEQDGVNYHFVSSAQFNTFADQGDFLEHAEVFGNCYGTSRSWVEATLNEGWDVILEIDWQGADQVRQVLPDTVGIFILPPSLVALEDRLTQRGQDSAEVISKRMQAAMNEISHFPEADYLVINDDFDRALADLAAIVTAQRLTLDNQQARHREQLERLLS

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
214 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
221 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
222 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
223 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
224 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
312 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
313 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
314 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
337 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
340 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
367 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
368 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
375 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
381 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
382 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
383 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
384 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
385 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
386 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
387 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
388 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
389 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
390 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
391 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
392 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
393 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
394 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
395 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
396 2519103095 Burkholderia sp. KJ006 Isolate Nodule
397 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
398 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
399 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
400 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
401 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
402 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
403 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
404 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
405 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
406 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
407 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
408 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
409 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
410 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
411 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
412 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
413 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
414 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
415 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
416 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
417 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
418 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
419 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
420 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
421 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
422 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
423 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
424 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
425 2818991450 Burkholderia sp. 604 Isolate Unclassified
426 2818991452 Burkholderia cepacia 561 Isolate Unclassified
427 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
428 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
429 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
430 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
431 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
432 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
433 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
434 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
435 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
436 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
437 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
438 2904564687 Burkholderia sp. 571 Isolate Unclassified
439 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
440 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
441 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
442 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
443 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
444 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
445 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
446 2928163908 Burkholderia sp. 567 Isolate Unclassified
447 2928170801 Burkholderia sp. 572 Isolate Unclassified
448 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
449 2928536128 Burkholderia sola 565 Isolate Unclassified
450 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
451 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
452 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
453 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
454 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
455 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
456 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
457 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
458 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
459 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
460 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
461 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
462 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
463 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
464 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
465 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
466 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
467 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
468 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
469 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
470 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.94
Metatranscriptomes 0.53
Isolates 9.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.78
Nodule 2.12
Rhizoplane 5.93
Rhizosphere 72.46
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_079523 3300039062 Bacteria 1725
2 JGI24740J21852_10001608 3300001979 Bacteria 10380
3 JGI24739J22299_10002870 3300001989 Bacteria 6612
4 JGI24739J22299_10002919 3300001989 Bacteria 6554
5 JGI24739J22299_10005315 3300001989 Bacteria 4906
6 JGI24739J22299_10036167 3300001989 Bacteria 1670
7 JGI24737J22298_10004043 3300001990 Bacteria 5127
8 JGI24737J22298_10009321 3300001990 Bacteria 3270
9 JGI24735J21928_10000214 3300002067 Bacteria 20243
10 JGI24735J21928_10000975 3300002067 Bacteria 10243
11 JGI24738J21930_10001813 3300002075 Bacteria 5797
12 JGI25156J39149_1000606 3300002705 Bacteria 19907
13 JGI25156J39149_1001619 3300002705 Bacteria 9182
14 JGI25156J39149_1001839 3300002705 Bacteria 8309
15 JGI25165J46597_1002278 3300003214 Bacteria 6571
16 rootH1_10082209 3300003316 Bacteria 1591
17 rootH2_10060630 3300003320 Bacteria 1678
18 rootH2_10060631 3300003320 Bacteria 1560
19 rootH2_10263547 3300003320 Bacteria 2315
20 rootL2_10044271 3300003322 Bacteria 2894
21 rootH1_10017919 3300003323 Bacteria 23346
22 rootH1_10017920 3300003323 Bacteria 32817
23 rootH1_10050413 3300003323 Bacteria 1501
24 JGI25160J50197_1000121 3300003354 Bacteria 70932
25 Ga0055533_1000425 3300003756 Bacteria 16228
26 Ga0055533_1002006 3300003756 Bacteria 4954
27 Ga0055532_1000012 3300003758 Bacteria 382698
28 Ga0055532_1002446 3300003758 Bacteria 3852
29 Ga0055532_1010100 3300003758 Bacteria 1134
30 Ga0055532_1012042 3300003758 Bacteria 1007
31 Ga0055525_1008095 3300003759 Bacteria 889
32 Ga0055527_1000011 3300003760 Bacteria 354560
33 Ga0055527_1000565 3300003760 Bacteria 12213
34 Ga0055527_1000584 3300003760 Bacteria 11906
35 Ga0055535_1000009 3300003761 Bacteria 382698
36 Ga0055535_1001392 3300003761 Bacteria 12505
37 Ga0055535_1001425 3300003761 Bacteria 12213
38 Ga0055542_1000015 3300003762 Bacteria 382698
39 Ga0055542_1001317 3300003762 Bacteria 13099
40 Ga0055542_1002323 3300003762 Bacteria 6538
41 Ga0055529_1000011 3300003763 Bacteria 382698
42 Ga0055529_1000988 3300003763 Bacteria 14143
43 Ga0055529_1006134 3300003763 Bacteria 1697
44 Ga0055528_1002055 3300003790 Bacteria 11251
45 Ga0058692_1005361 3300003856 Bacteria 3658
46 Ga0065165_1000236 3300005262 Bacteria 96225
47 Ga0070658_10022962 3300005327 Bacteria 5008
48 Ga0070658_10041263 3300005327 Bacteria 3723
49 Ga0070658_10061710 3300005327 Bacteria 3054
50 Ga0070658_10361142 3300005327 Bacteria 1244
51 Ga0070658_10455233 3300005327 Bacteria 1103
52 Ga0070676_10012165 3300005328 Bacteria 4693
53 Ga0070676_10326612 3300005328 Bacteria 1048
54 Ga0070690_100068578 3300005330 Bacteria 2301
55 Ga0068869_100426182 3300005334 Bacteria 1095
56 Ga0068868_100031957 3300005338 Bacteria 4046
57 Ga0068868_100484039 3300005338 Bacteria 1081
58 Ga0070660_100000412 3300005339 Bacteria 28448
59 Ga0070660_100080628 3300005339 Bacteria 2554
60 Ga0070660_100116852 3300005339 Bacteria 2127
61 Ga0070689_100134547 3300005340 Bacteria 1984
62 Ga0070687_100064444 3300005343 Bacteria 1947
63 Ga0070661_100125396 3300005344 Bacteria 1926
64 Ga0070661_100321864 3300005344 Bacteria 1208
65 Ga0070668_100007642 3300005347 Bacteria 8022
66 Ga0070668_100094310 3300005347 Bacteria 2362
67 Ga0070669_100269299 3300005353 Bacteria 1361
68 Ga0070675_100243763 3300005354 Bacteria 1571
69 Ga0070671_100072441 3300005355 Bacteria 2877
70 Ga0070674_100053234 3300005356 Bacteria 2794
71 Ga0070674_100059614 3300005356 Bacteria 2657
72 Ga0070674_100431592 3300005356 Bacteria 1083
73 Ga0070688_100027794 3300005365 Bacteria 3370
74 Ga0070659_100000014 3300005366 Bacteria 178272
75 Ga0070659_100106972 3300005366 Bacteria 2255
76 Ga0070659_100120912 3300005366 Bacteria 2121
77 Ga0070667_100079091 3300005367 Bacteria 2810
78 Ga0070667_100197501 3300005367 Bacteria 1784
79 Ga0070714_100088008 3300005435 Bacteria 2717
80 Ga0070701_10007392 3300005438 Bacteria 4691
81 Ga0070711_100119291 3300005439 Bacteria 1948
82 Ga0070705_100017262 3300005440 Bacteria 3765
83 Ga0070700_100036533 3300005441 Bacteria 2980
84 Ga0070663_100000465 3300005455 Bacteria 21386
85 Ga0070663_100079605 3300005455 Bacteria 2405
86 Ga0070663_100593271 3300005455 Bacteria 931
87 Ga0070678_100001980 3300005456 Bacteria 11070
88 Ga0070678_100015348 3300005456 Bacteria 4866
89 Ga0070662_100077242 3300005457 Bacteria 2471
90 Ga0070662_100143261 3300005457 Bacteria 1854
91 Ga0070681_10007485 3300005458 Bacteria 10671
92 Ga0068867_100025300 3300005459 Bacteria 4258
93 Ga0068867_100530053 3300005459 Bacteria 1017
94 Ga0070685_10036097 3300005466 Bacteria 2793
95 Ga0070706_100027171 3300005467 Bacteria 5265
96 Ga0070707_100026476 3300005468 Bacteria 5507
97 Ga0070679_100081399 3300005530 Bacteria 3227
98 Ga0070697_100113330 3300005536 Bacteria 2262
99 Ga0070672_100155417 3300005543 Bacteria 1894
100 Ga0070672_100208831 3300005543 Bacteria 1635
101 Ga0070695_100013338 3300005545 Bacteria 4937
102 Ga0070695_100742653 3300005545 Bacteria 782
103 Ga0070693_100064198 3300005547 Bacteria 2142
104 Ga0070693_100069041 3300005547 Bacteria 2076
105 Ga0070665_100268166 3300005548 Bacteria 1709
106 Ga0070665_100268648 3300005548 Bacteria 1707
107 Ga0070704_100011744 3300005549 Bacteria 5383
108 Ga0070704_100456774 3300005549 Bacteria 1101
109 Ga0068855_100002955 3300005563 Bacteria 20773
110 Ga0068855_100005640 3300005563 Bacteria 15276
111 Ga0068855_101106525 3300005563 Bacteria 828
112 Ga0070664_100711978 3300005564 Bacteria 936
113 Ga0068857_100304738 3300005577 Bacteria 1469
114 Ga0068854_100095793 3300005578 Bacteria 2216
115 Ga0070702_100018299 3300005615 Bacteria 3633
116 Ga0070702_100046763 3300005615 Bacteria 2454
117 Ga0068852_100009260 3300005616 Bacteria 7297
118 Ga0068852_100379939 3300005616 Bacteria 1386
119 Ga0068866_10002174 3300005718 Bacteria 8165
120 Ga0068866_10014626 3300005718 Bacteria 3470
121 Ga0068861_100026271 3300005719 Bacteria 4232
122 Ga0068861_100073082 3300005719 Bacteria 2663
123 Ga0068870_10021019 3300005840 Bacteria 3187
124 Ga0068863_100610084 3300005841 Bacteria 1080
125 Ga0068858_100026437 3300005842 Bacteria 5391
126 Ga0068860_100187922 3300005843 Bacteria 1998
127 Ga0068862_100302256 3300005844 Bacteria 1472
128 Ga0068862_100519859 3300005844 Bacteria 1132
129 Ga0070716_100036920 3300006173 Bacteria 2697
130 Ga0070712_100036562 3300006175 Bacteria 3342
131 Ga0075369_10011755 3300006186 Bacteria 3448
132 Ga0075366_10077882 3300006195 Bacteria 1978
133 Ga0097621_100095777 3300006237 Bacteria 2490
134 Ga0075370_10010707 3300006353 Bacteria 4807
135 Ga0068871_100042754 3300006358 Bacteria 3639
136 Ga0068871_100441887 3300006358 Bacteria 1164
137 Ga0075433_10310937 3300006852 Bacteria 1394
138 Ga0075434_100053749 3300006871 Bacteria 4002
139 Ga0068865_100042183 3300006881 Bacteria 3110
140 Ga0075435_100001710 3300007076 Bacteria 14255
141 Ga0105251_10000128 3300009011 Bacteria 75973
142 Ga0105251_10021378 3300009011 Bacteria 3380
143 Ga0105251_10119617 3300009011 Bacteria 1197
144 Ga0105240_10000748 3300009093 Bacteria 59276
145 Ga0105240_10012809 3300009093 Bacteria 11553
146 Ga0105240_10050146 3300009093 Bacteria 5265
147 Ga0105240_10102224 3300009093 Bacteria 3483
148 Ga0105240_10540973 3300009093 Bacteria 1290
149 Ga0111539_10086516 3300009094 Bacteria 3683
150 Ga0105245_10033012 3300009098 Bacteria 4584
151 Ga0105245_10152455 3300009098 Bacteria 2186
152 Ga0105247_10300188 3300009101 Bacteria 1114
153 Ga0105243_10010284 3300009148 Bacteria 7109
154 Ga0105241_10251910 3300009174 Bacteria 1497
155 Ga0105242_10016251 3300009176 Bacteria 5785
156 Ga0105242_10097070 3300009176 Bacteria 2491
157 Ga0105248_10051332 3300009177 Bacteria 4628
158 Ga0105248_10105353 3300009177 Bacteria 3179
159 Ga0105248_10958322 3300009177 Bacteria 966
160 Ga0105237_10004300 3300009545 Bacteria 16512
161 Ga0105237_10009421 3300009545 Bacteria 10461
162 Ga0105237_10034289 3300009545 Bacteria 5141
163 Ga0105237_10099527 3300009545 Bacteria 2899
164 Ga0105237_10149287 3300009545 Bacteria 2333
165 Ga0105237_10406204 3300009545 Bacteria 1367
166 Ga0105238_10032822 3300009551 Bacteria 5284
167 Ga0105238_10074149 3300009551 Bacteria 3396
168 Ga0105249_10140510 3300009553 Bacteria 2315
169 Ga0105249_10398089 3300009553 Bacteria 1407
170 Ga0105239_10005634 3300010375 Bacteria 14631
171 Ga0105239_10012318 3300010375 Bacteria 9523
172 Ga0105246_10293649 3300011119 Bacteria 1309
173 Ga0105246_10770257 3300011119 Bacteria 851
174 Ga0157373_10013231 3300013100 Bacteria 6058
175 Ga0157373_10369435 3300013100 Bacteria 1025
176 Ga0157371_10004974 3300013102 Bacteria 11416
177 Ga0157370_10000210 3300013104 Bacteria 74229
178 Ga0157370_10019066 3300013104 Bacteria 6895
179 Ga0157370_10428841 3300013104 Bacteria 1216
180 Ga0157369_10000116 3300013105 Bacteria 112213
181 Ga0157369_10000599 3300013105 Bacteria 46911
182 Ga0157369_10001470 3300013105 Bacteria 28877
183 Ga0157369_10030593 3300013105 Bacteria 5936
184 Ga0157369_10231524 3300013105 Bacteria 1932
185 Ga0157374_10000717 3300013296 Bacteria 29010
186 Ga0157374_10076635 3300013296 Bacteria 3162
187 Ga0157378_10311074 3300013297 Bacteria 1528
188 Ga0163162_10037238 3300013306 Bacteria 4853
189 Ga0163162_10166912 3300013306 Bacteria 2325
190 Ga0157372_10002555 3300013307 Bacteria 19729
191 Ga0157372_10228093 3300013307 Bacteria 2159
192 Ga0157375_10023764 3300013308 Bacteria 5663
193 Ga0157375_10159363 3300013308 Bacteria 2398
194 Ga0157375_10406923 3300013308 Bacteria 1527
195 Ga0157380_10005113 3300014326 Bacteria 9168
196 Ga0157380_10015813 3300014326 Bacteria 5551
197 Ga0182008_10036701 3300014497 Bacteria 2452
198 Ga0182008_10155215 3300014497 Bacteria 1149
199 Ga0157377_10030000 3300014745 Bacteria 2942
200 Ga0157379_10014445 3300014968 Bacteria 6930
201 Ga0157376_10031159 3300014969 Bacteria 4267
202 Ga0157376_10120628 3300014969 Bacteria 2323
203 Ga0157376_10291837 3300014969 Bacteria 1540
204 Ga0182006_1075170 3300015261 Bacteria 1244
205 Ga0182007_10000874 3300015262 Bacteria 16687
206 Ga0182005_1043638 3300015265 Bacteria 1219
207 Ga0183361_10009 3300016635 Bacteria 205218
208 Ga0163161_10053857 3300017792 Bacteria 2918
209 Ga0163161_10125780 3300017792 Bacteria 1930
210 Ga0197907_11106936 3300020069 Bacteria 2609
211 Ga0206354_10063618 3300020081 Bacteria 2773
212 Ga0206353_11985253 3300020082 Bacteria 4881
213 Ga0224712_10000010 3300022467 Bacteria 28666
214 Ga0209566_100797 3300025225 Bacteria 16535
215 Ga0209674_100013 3300025226 Bacteria 813140
216 Ga0209674_100188 3300025226 Bacteria 67031
217 Ga0209674_100199 3300025226 Bacteria 62593
218 Ga0209674_101843 3300025226 Bacteria 5042
219 Ga0209672_100010 3300025228 Bacteria 873151
220 Ga0209672_100051 3300025228 Bacteria 234414
221 Ga0209672_100083 3300025228 Bacteria 135473
222 Ga0209672_100753 3300025228 Bacteria 15789
223 Ga0209147_100006 3300025229 Bacteria 873276
224 Ga0209147_100120 3300025229 Bacteria 142306
225 Ga0209147_100178 3300025229 Bacteria 79708
226 Ga0209147_100365 3300025229 Bacteria 32099
227 Ga0209563_101459 3300025230 Bacteria 6242
228 Ga0207427_101338 3300025231 Bacteria 9160
229 Ga0209258_100010 3300025242 Bacteria 873276
230 Ga0209258_100280 3300025242 Bacteria 85790
231 Ga0209258_100292 3300025242 Bacteria 82251
232 Ga0209646_1018733 3300025246 Bacteria 1011
233 Ga0209148_1000018 3300025254 Bacteria 756247
234 Ga0209148_1000027 3300025254 Bacteria 616374
235 Ga0209148_1001699 3300025254 Bacteria 9763
236 Ga0209759_1000251 3300025256 Bacteria 79885
237 Ga0209759_1000261 3300025256 Bacteria 76336
238 Ga0209759_1001264 3300025256 Bacteria 15225
239 Ga0209759_1001797 3300025256 Bacteria 10854
240 Ga0209759_1002082 3300025256 Bacteria 9347
241 Ga0209233_1000093 3300025261 Bacteria 306016
242 Ga0209565_1013667 3300025263 Bacteria 1893
243 Ga0209455_1000015 3300025272 Bacteria 756128
244 Ga0209455_1000203 3300025272 Bacteria 85784
245 Ga0209455_1000683 3300025272 Bacteria 20130
246 Ga0209673_1000070 3300025273 Bacteria 241592
247 Ga0209564_1003673 3300025295 Bacteria 10138
248 Ga0209564_1006486 3300025295 Bacteria 6294
249 Ga0209256_1035276 3300025299 Unclassified 1323
250 Ga0207426_1000183 3300025302 Bacteria 154449
251 Ga0207426_1012231 3300025302 Bacteria 3232
252 Ga0207697_10002969 3300025315 Bacteria 8563
253 Ga0207713_1000135 3300025735 Bacteria 112173
254 Ga0207713_1005578 3300025735 Bacteria 7833
255 Ga0207682_10002543 3300025893 Bacteria 8137
256 Ga0207642_10006148 3300025899 Bacteria 3975
257 Ga0207642_10052696 3300025899 Bacteria 1847
258 Ga0207688_10016415 3300025901 Bacteria 4016
259 Ga0207647_10000466 3300025904 Bacteria 32789
260 Ga0207647_10001635 3300025904 Bacteria 17224
261 Ga0207647_10008680 3300025904 Bacteria 7260
262 Ga0207647_10015811 3300025904 Bacteria 5165
263 Ga0207647_10018503 3300025904 Bacteria 4708
264 Ga0207645_10002306 3300025907 Bacteria 15080
265 Ga0207643_10002326 3300025908 Bacteria 10344
266 Ga0207705_10000292 3300025909 Bacteria 46696
267 Ga0207705_10121329 3300025909 Bacteria 1940
268 Ga0207705_10124406 3300025909 Bacteria 1916
269 Ga0207705_10126338 3300025909 Bacteria 1901
270 Ga0207684_10055702 3300025910 Bacteria 3354
271 Ga0207707_10022182 3300025912 Bacteria 5550
272 Ga0207695_10000955 3300025913 Bacteria 51451
273 Ga0207695_10001386 3300025913 Bacteria 40928
274 Ga0207695_10006007 3300025913 Bacteria 15874
275 Ga0207695_10138385 3300025913 Bacteria 2386
276 Ga0207671_10007494 3300025914 Bacteria 9467
277 Ga0207671_10057403 3300025914 Bacteria 2885
278 Ga0207671_10091830 3300025914 Bacteria 2288
279 Ga0207693_10007239 3300025915 Bacteria 9132
280 Ga0207663_10040384 3300025916 Bacteria 2835
281 Ga0207662_10015167 3300025918 Bacteria 4332
282 Ga0207657_10000018 3300025919 Bacteria 172140
283 Ga0207657_10006875 3300025919 Bacteria 11738
284 Ga0207657_10098014 3300025919 Bacteria 2436
285 Ga0207649_10245890 3300025920 Bacteria 1286
286 Ga0207652_10110583 3300025921 Bacteria 2436
287 Ga0207646_10050124 3300025922 Bacteria 3737
288 Ga0207681_10007701 3300025923 Bacteria 6598
289 Ga0207694_10029357 3300025924 Bacteria 4196
290 Ga0207659_10264478 3300025926 Bacteria 1401
291 Ga0207687_10051376 3300025927 Bacteria 2874
292 Ga0207687_10153268 3300025927 Bacteria 1761
293 Ga0207690_10000006 3300025932 Bacteria 433880
294 Ga0207690_10300985 3300025932 Bacteria 1255
295 Ga0207706_10015483 3300025933 Bacteria 6890
296 Ga0207706_10176497 3300025933 Bacteria 1877
297 Ga0207686_10008764 3300025934 Bacteria 5465
298 Ga0207686_10344416 3300025934 Bacteria 1120
299 Ga0207669_10607717 3300025937 Bacteria 889
300 Ga0207704_10017589 3300025938 Bacteria 3711
301 Ga0207704_10206830 3300025938 Bacteria 1441
302 Ga0207665_10013795 3300025939 Bacteria 5315
303 Ga0207691_10015351 3300025940 Bacteria 7286
304 Ga0207711_10097500 3300025941 Bacteria 2596
305 Ga0207711_10104245 3300025941 Bacteria 2513
306 Ga0207711_10106002 3300025941 Bacteria 2493
307 Ga0207711_10152647 3300025941 Bacteria 2085
308 Ga0207689_10004537 3300025942 Bacteria 12568
309 Ga0207689_10119356 3300025942 Bacteria 2169
310 Ga0207661_10153409 3300025944 Bacteria 1993
311 Ga0207667_10002741 3300025949 Bacteria 21775
312 Ga0207667_10021402 3300025949 Bacteria 7167
313 Ga0207667_10026422 3300025949 Bacteria 6343
314 Ga0207668_10172306 3300025972 Bacteria 1698
315 Ga0207640_10052921 3300025981 Bacteria 2647
316 Ga0207640_10176887 3300025981 Bacteria 1596
317 Ga0207658_10906965 3300025986 Bacteria 802
318 Ga0207677_10087719 3300026023 Bacteria 2253
319 Ga0207677_10305775 3300026023 Bacteria 1315
320 Ga0207703_10012908 3300026035 Bacteria 6512
321 Ga0207703_10086166 3300026035 Bacteria 2630
322 Ga0207639_10107844 3300026041 Bacteria 2263
323 Ga0207678_10002014 3300026067 Bacteria 18462
324 Ga0207678_10073118 3300026067 Bacteria 2938
325 Ga0207678_10188521 3300026067 Bacteria 1762
326 Ga0207678_10304450 3300026067 Bacteria 1370
327 Ga0207708_10002353 3300026075 Bacteria 13889
328 Ga0207648_10003860 3300026089 Bacteria 15650
329 Ga0207648_10055962 3300026089 Bacteria 3443
330 Ga0207676_10697057 3300026095 Bacteria 983
331 Ga0207674_10490587 3300026116 Bacteria 1187
332 Ga0207675_100010756 3300026118 Bacteria 8574
333 Ga0207675_100128109 3300026118 Bacteria 2405
334 Ga0207683_10003766 3300026121 Bacteria 13151
335 Ga0207683_10004051 3300026121 Bacteria 12665
336 Ga0207698_10006738 3300026142 Bacteria 7176
337 Ga0207698_10280249 3300026142 Bacteria 1541
338 Ga0207698_10412866 3300026142 Bacteria 1293
339 Ga0209371_1000783 3300027312 Bacteria 26286
340 Ga0209371_1001679 3300027312 Bacteria 14121
341 Ga0209813_10045622 3300027866 Bacteria 1351
342 Ga0207428_10064812 3300027907 Bacteria 2884
343 Ga0268266_10051881 3300028379 Bacteria 3522
344 Ga0268265_10290504 3300028380 Bacteria 1467
345 Ga0268264_10163350 3300028381 Bacteria 2008
346 Ga0265338_10005564 3300028800 Bacteria 16390
347 Ga0268256_1000857 3300030500 Bacteria 21338
348 Ga0268256_1005054 3300030500 Bacteria 5281
349 Ga0265327_10003077 3300031251 Bacteria 16467
350 Ga0307513_10287680 3300031456 Bacteria 1417
351 Ga0307509_10000138 3300031507 Bacteria 108694
352 Ga0307408_100000005 3300031548 Bacteria 529098
353 Ga0307408_100001187 3300031548 Bacteria 19703
354 Ga0307408_100002797 3300031548 Bacteria 12114
355 Ga0316575_10001412 3300031665 Bacteria 7716
356 Ga0316576_10016474 3300031727 Bacteria 4993
357 Ga0316578_10025765 3300031728 Bacteria 3310
358 Ga0307405_10012528 3300031731 Bacteria 4494
359 Ga0307413_10137914 3300031824 Unclassified 1680
360 Ga0307406_10000874 3300031901 Bacteria 16942
361 Ga0307406_10503562 3300031901 Bacteria 982
362 Ga0307412_10000016 3300031911 Bacteria 312878
363 Ga0307412_10023901 3300031911 Bacteria 3767
364 Ga0307409_100049740 3300031995 Bacteria 3198
365 Ga0316583_10007937 3300032133 Bacteria 3827
366 Ga0373952_0000039 3300035092 Bacteria 15480
367 Ga0373945_0088000 3300035116 Bacteria 1199
368 Ga0373961_0107347 3300035241 Bacteria 911
369 Ga0316574_0006221 3300035398 Bacteria 6432
370 Ga0316582_0108056 3300036647 Bacteria 1849
371 Ga0316582_0326674 3300036647 Bacteria 1055
372 Ga0316582_0362953 3300036647 Bacteria 997
373 Ga0316584_0069315 3300036712 Bacteria 2644
374 Ga0316584_0110392 3300036712 Bacteria 2058
375 Ga0395899_0000029 3300037312 Bacteria 329371
376 Ga0395899_0253343 3300037312 Bacteria 1207
377 Ga0395899_0342815 3300037312 Bacteria 1001
378 Ga0395900_0000085 3300037418 Bacteria 172265
379 Ga0395900_0003083 3300037418 Bacteria 18108
380 Ga0395900_0052585 3300037418 Bacteria 4192
381 Ga0395900_0247945 3300037418 Bacteria 1783
382 Ga0395898_0000086 3300037466 Bacteria 239895
383 Ga0395898_0000339 3300037466 Bacteria 105864
384 Ga0395898_0016932 3300037466 Bacteria 7441
385 Ga0395898_0017184 3300037466 Bacteria 7389
386 Ga0395905_0000183 3300037471 Bacteria 99662
387 Ga0395905_0003794 3300037471 Bacteria 15978
388 Ga0395901_0000003 3300038443 Bacteria 701538
389 Ga0395901_0001540 3300038443 Bacteria 23894
390 Ga0395901_0002257 3300038443 Bacteria 19672
391 Ga0400490_24139 3300038726 Bacteria 12468
392 Ga0400488_20240 3300038741 Bacteria 17299
393 Ga0400488_62067 3300038741 Bacteria 2674
394 Ga0400486_03127 3300038742 Bacteria 4714
395 Ga0400486_32147 3300038742 Bacteria 1237
396 Ga0400483_011190 3300039062 Bacteria 182340
397 Ga0400483_025886 3300039062 Bacteria 13085
398 Ga0400483_081004 3300039062 Bacteria 10239
399 Ga0400483_143918 3300039062 Bacteria 1602
400 Ga0400483_186862 3300039062 Bacteria 1849
401 Ga0400483_215675 3300039062 Bacteria 181282
402 Ga0400483_219863 3300039062 Bacteria 173210
403 Ga0400489_43383 3300039093 Bacteria 22865
404 Ga0400487_14538 3300039110 Bacteria 3076
405 Ga0400487_55780 3300039110 Bacteria 12963
406 Ga0436360_0376457 3300039438 Bacteria 815
407 Ga0436361_0141037 3300039447 Bacteria 1867
408 Ga0436361_0201744 3300039447 Bacteria 957
409 Ga0436361_0371376 3300039447 Bacteria 2769
410 Ga0439448_0000016 3300042005 Bacteria 28746
411 Ga0450891_004960 3300042129 Bacteria 1236
412 Ga0451577_0000659 3300042876 Bacteria 54455
413 Ga0451577_0003395 3300042876 Bacteria 17797
414 Ga0451577_0008544 3300042876 Bacteria 9960
415 Ga0451577_0011087 3300042876 Bacteria 8555
416 Ga0451577_0048059 3300042876 Bacteria 3813
417 Ga0451577_0104462 3300042876 Bacteria 2532
418 Ga0466977_0001336 3300044666 Bacteria 10038
419 Ga0466965_0000556 3300044683 Bacteria 13448
420 Ga0466966_0017520 3300044684 Bacteria 4732
421 Ga0466966_0022290 3300044684 Bacteria 4156
422 Ga0466966_0127607 3300044684 Bacteria 1559
423 Ga0466961_0000233 3300044693 Bacteria 37633
424 Ga0466961_0009166 3300044693 Bacteria 6302
425 Ga0466961_0010118 3300044693 Bacteria 6008
426 Ga0466961_0032088 3300044693 Bacteria 3375
427 Ga0466961_0039674 3300044693 Bacteria 3018
428 Ga0466961_0051708 3300044693 Bacteria 2623
429 Ga0466961_0099510 3300044693 Bacteria 1832
430 Ga0466963_0003833 3300044694 Bacteria 8673
431 Ga0466963_0561167 3300044694 Bacteria 806
432 Ga0466964_0001349 3300044706 Bacteria 8382
433 Ga0466964_0038172 3300044706 Bacteria 1931
434 Ga0453684_0080745 3300044712 Bacteria 4059
435 Ga0453684_0531374 3300044712 Bacteria 1298
436 Ga0453684_0710755 3300044712 Bacteria 1091
437 Ga0453684_0718336 3300044712 Bacteria 1084
438 Ga0453684_0740160 3300044712 Bacteria 1065
439 Ga0466971_0036450 3300044719 Bacteria 2205
440 Ga0466968_0088707 3300044735 Bacteria 1367
441 Ga0466970_0022460 3300044765 Bacteria 3292
442 Ga0466970_0032704 3300044765 Bacteria 2748
443 Ga0466970_0102777 3300044765 Bacteria 1557
444 Ga0466970_0217356 3300044765 Bacteria 1066
445 Ga0466957_0006558 3300044842 Bacteria 6576
446 Ga0466957_0038534 3300044842 Bacteria 2880
447 Ga0466957_0080140 3300044842 Bacteria 2032
448 Ga0466957_0215728 3300044842 Bacteria 1265
449 Ga0466957_0244051 3300044842 Bacteria 1192
450 Ga0466957_0505563 3300044842 Bacteria 838
451 Ga0466960_0122496 3300044901 Bacteria 1363
452 Ga0466959_0012532 3300045049 Bacteria 6129
453 Ga0466959_0033246 3300045049 Bacteria 3815
454 Ga0466959_0033621 3300045049 Bacteria 3792
455 Ga0466959_0089326 3300045049 Bacteria 2214
456 Ga0466959_0137516 3300045049 Bacteria 1728
457 Ga0451576_0002901 3300045051 Bacteria 24469
458 Ga0451576_0010104 3300045051 Bacteria 10868
459 Ga0451576_0012129 3300045051 Bacteria 9719
460 Ga0451576_0156840 3300045051 Bacteria 2375
461 Ga0451576_0388222 3300045051 Bacteria 1463
462 Ga0451576_0570148 3300045051 Bacteria 1189
463 Ga0466958_0006906 3300045836 Bacteria 6208
464 Ga0466958_0031621 3300045836 Bacteria 3146
465 Ga0466958_0084504 3300045836 Bacteria 1957
466 Ga0466967_0315415 3300045976 Bacteria 1507
467 Ga0495592_0003496 3300046454 Bacteria 11275
468 Ga0495592_0005558 3300046454 Bacteria 9323
469 Ga0495592_0106388 3300046454 Bacteria 1991
470 Ga0495603_0000378 3300046455 Bacteria 24228
471 Ga0495603_0003405 3300046455 Bacteria 9472
472 Ga0495603_0014125 3300046455 Bacteria 4831
473 Ga0495590_0003779 3300046457 Bacteria 6164
474 Ga0495590_0039502 3300046457 Bacteria 1646
475 Ga0495590_0049028 3300046457 Bacteria 1473
476 Ga0495591_005242 3300046458 Bacteria 6056
477 Ga0495629_0000247 3300046459 Bacteria 47185
478 Ga0495629_0000855 3300046459 Bacteria 24562
479 Ga0495629_0001980 3300046459 Bacteria 15968
480 Ga0495629_0006909 3300046459 Bacteria 8372
481 Ga0495629_0069918 3300046459 Bacteria 2449
482 Ga0495629_0205802 3300046459 Bacteria 1360
483 Ga0495641_0020797 3300046461 Bacteria 3317
484 Ga0495641_0029982 3300046461 Bacteria 2615
485 Ga0495651_0054775 3300046462 Bacteria 3065
486 Ga0495651_0174536 3300046462 Bacteria 1527
487 Ga0495653_0001417 3300046463 Bacteria 18679
488 Ga0495653_0024483 3300046463 Bacteria 4864
489 Ga0495653_0046081 3300046463 Bacteria 3376
490 Ga0495653_0061188 3300046463 Bacteria 2849
491 Ga0495653_0164345 3300046463 Bacteria 1538
492 Ga0495653_0219772 3300046463 Bacteria 1278
493 Ga0495650_0000554 3300046471 Bacteria 53235
494 Ga0495650_0020667 3300046471 Bacteria 3203
495 Ga0495650_0057546 3300046471 Bacteria 1573
496 Ga0495650_0199664 3300046471 Bacteria 695
497 Ga0495580_0000063 3300046472 Bacteria 63558
498 Ga0495580_0000113 3300046472 Bacteria 55036
499 Ga0495580_0020233 3300046472 Bacteria 4930
500 Ga0495580_0021318 3300046472 Bacteria 4781
501 Ga0495580_0039104 3300046472 Bacteria 3394
502 Ga0495580_0041613 3300046472 Bacteria 3276
503 Ga0495580_0042249 3300046472 Bacteria 3248
504 Ga0495582_0008677 3300046473 Bacteria 5604
505 Ga0495582_0016493 3300046473 Bacteria 4046
506 Ga0495582_0243951 3300046473 Bacteria 1030
507 Ga0495605_0007856 3300046474 Bacteria 6041
508 Ga0495605_0013827 3300046474 Bacteria 4435
509 Ga0495605_0018837 3300046474 Bacteria 3695
510 Ga0495605_0115150 3300046474 Bacteria 1223
511 Ga0495662_0016072 3300046476 Bacteria 3629
512 Ga0495662_0024545 3300046476 Bacteria 2909
513 Ga0495664_0000674 3300046477 Bacteria 17356
514 Ga0495664_0003151 3300046477 Bacteria 8953
515 Ga0495664_0018340 3300046477 Bacteria 4008
516 Ga0495584_0117964 3300046491 Bacteria 1344
517 Ga0495584_0382534 3300046491 Bacteria 715
518 Ga0495596_0036323 3300046500 Bacteria 1952
519 Ga0495596_0063615 3300046500 Bacteria 1435
520 Ga0495583_0011708 3300046506 Bacteria 5022
521 Ga0495583_0095975 3300046506 Bacteria 1271
522 Ga0495606_0024799 3300046507 Bacteria 4311
523 Ga0495606_0080391 3300046507 Bacteria 2028
524 Ga0495608_0007694 3300046511 Bacteria 7594
525 Ga0495608_0008528 3300046511 Bacteria 7179
526 Ga0495610_0013009 3300046512 Bacteria 4971
527 Ga0495616_0014950 3300046513 Bacteria 4329
528 Ga0495618_0001295 3300046514 Bacteria 16869
529 Ga0495618_0005589 3300046514 Bacteria 7642
530 Ga0495618_0009343 3300046514 Bacteria 5917
531 Ga0495620_0011878 3300046515 Bacteria 4526
532 Ga0495620_0028428 3300046515 Bacteria 2600
533 Ga0495620_0137742 3300046515 Bacteria 955
534 Ga0495628_0001894 3300046516 Bacteria 18978
535 Ga0495628_0012767 3300046516 Bacteria 7071
536 Ga0495628_0065261 3300046516 Bacteria 2848
537 Ga0495628_0511160 3300046516 Bacteria 866
538 Ga0495628_0534138 3300046516 Bacteria 843
539 Ga0495630_0003458 3300046517 Bacteria 10979
540 Ga0495630_0007833 3300046517 Bacteria 7651
541 Ga0495630_0090148 3300046517 Bacteria 2316
542 Ga0495630_0163411 3300046517 Bacteria 1695
543 Ga0495631_0022240 3300046518 Bacteria 2948
544 Ga0495648_0013411 3300046524 Bacteria 6061
545 Ga0495648_0024471 3300046524 Bacteria 4110
546 Ga0495648_0052889 3300046524 Bacteria 2463
547 Ga0495666_0000403 3300046526 Bacteria 18997
548 Ga0495666_0003242 3300046526 Bacteria 8200
549 Ga0495666_0055220 3300046526 Bacteria 1904
550 Ga0495642_0013499 3300046528 Bacteria 3160
551 Ga0495642_0044604 3300046528 Bacteria 1810
552 Ga0495642_0070508 3300046528 Bacteria 1461
553 Ga0495652_0007309 3300046529 Bacteria 10185
554 Ga0495652_0043381 3300046529 Bacteria 3874
555 Ga0495652_0138515 3300046529 Bacteria 1916
556 Ga0495652_0170372 3300046529 Bacteria 1681
557 Ga0495665_0003969 3300046531 Bacteria 7986
558 Ga0495665_0005705 3300046531 Bacteria 6719
559 Ga0495665_0007407 3300046531 Bacteria 5934
560 Ga0495665_0022055 3300046531 Bacteria 3424
561 Ga0495665_0106361 3300046531 Bacteria 1472
562 Ga0495640_0009949 3300046533 Bacteria 7372
563 Ga0495640_0037063 3300046533 Bacteria 3442
564 Ga0495640_0117734 3300046533 Bacteria 1729
565 Ga0495586_0000326 3300046535 Bacteria 30088
566 Ga0495586_0017850 3300046535 Bacteria 3775
567 Ga0495586_0136458 3300046535 Bacteria 1375
568 Ga0495587_0004548 3300046536 Bacteria 9110
569 Ga0495587_0009815 3300046536 Bacteria 6117
570 Ga0495597_0044547 3300046542 Bacteria 1973
571 Ga0495645_0006404 3300046543 Bacteria 8168
572 Ga0495645_0038683 3300046543 Bacteria 3480
573 Ga0495645_0039215 3300046543 Bacteria 3455
574 Ga0495645_0226666 3300046543 Bacteria 1254
575 Ga0495622_0000039 3300046557 Bacteria 119003
576 Ga0495622_0032081 3300046557 Bacteria 2453
577 Ga0495656_0048527 3300046615 Bacteria 1805
578 Ga0495634_0002076 3300046642 Bacteria 16928
579 Ga0495634_0046651 3300046642 Bacteria 2923
580 Ga0495611_0277672 3300046648 Bacteria 774
581 Ga0495625_0051267 3300046660 Bacteria 2959
582 Ga0495625_0057627 3300046660 Bacteria 2762
583 Ga0495635_0018615 3300046663 Bacteria 4845
584 Ga0495635_0025818 3300046663 Bacteria 4091
585 Ga0495635_0154947 3300046663 Bacteria 1559
586 Ga0495661_0002427 3300046665 Bacteria 14347
587 Ga0495661_0006016 3300046665 Bacteria 8560
588 Ga0495657_0101040 3300046675 Bacteria 1838
589 Ga0495657_0214056 3300046675 Bacteria 1170
590 Ga0495599_0093527 3300046678 Bacteria 1875
591 Ga0495599_0200366 3300046678 Bacteria 1226
592 Ga0495599_0406049 3300046678 Bacteria 811
593 Ga0495623_0020527 3300046679 Bacteria 4269
594 Ga0495623_0033299 3300046679 Bacteria 3306
595 Ga0495623_0070163 3300046679 Bacteria 2183
596 Ga0495623_0250361 3300046679 Bacteria 996
597 Ga0495646_0000155 3300046680 Bacteria 34843
598 Ga0495646_0024973 3300046680 Bacteria 3760
599 Ga0495646_0242282 3300046680 Bacteria 968
600 Ga0495669_0034092 3300046684 Bacteria 2243
601 Ga0495669_0041682 3300046684 Bacteria 2039
602 Ga0495613_0001408 3300046689 Bacteria 18331
603 Ga0495613_0008462 3300046689 Bacteria 7632
604 Ga0495613_0130069 3300046689 Bacteria 1803
605 Ga0495624_0002650 3300046690 Bacteria 13500
606 Ga0495624_0013056 3300046690 Bacteria 5664
607 Ga0495624_0022460 3300046690 Bacteria 4169
608 Ga0495624_0025596 3300046690 Bacteria 3873
609 Ga0495670_0020644 3300046691 Bacteria 3249
610 Ga0495670_0145878 3300046691 Bacteria 1240
611 Ga0495671_0008251 3300046692 Bacteria 5871
612 Ga0495671_0127628 3300046692 Bacteria 1240
613 Ga0495671_0231999 3300046692 Bacteria 892
614 Ga0495649_0003210 3300046694 Bacteria 11163
615 Ga0495649_0016509 3300046694 Bacteria 4183
616 Ga0495649_0016931 3300046694 Bacteria 4125
617 Ga0495649_0029990 3300046694 Bacteria 3005
618 Ga0495649_0071738 3300046694 Bacteria 1856
619 Ga0495649_0150661 3300046694 Bacteria 1222
620 Ga0495589_0009241 3300046794 Bacteria 5128
621 Ga0495589_0013667 3300046794 Bacteria 4185
622 Ga0495589_0052212 3300046794 Bacteria 2020
623 Ga0495589_0092063 3300046794 Bacteria 1472
624 Ga0495600_0025812 3300046809 Bacteria 3787
625 Ga0495600_0067534 3300046809 Bacteria 2337
626 Ga0495600_0071868 3300046809 Bacteria 2260
627 Ga0495600_0080523 3300046809 Bacteria 2126
628 Ga0495600_0409839 3300046809 Bacteria 842
629 Ga0495660_0125705 3300046810 Bacteria 1292
630 Ga0495581_0000336 3300047315 Bacteria 23362
631 Ga0495581_0012201 3300047315 Bacteria 4975
632 Ga0495581_0019046 3300047315 Bacteria 3984
633 Ga0495581_0164518 3300047315 Bacteria 1297
634 Ga0495604_0011247 3300047317 Bacteria 7105
635 Ga0495604_0035971 3300047317 Bacteria 3906
636 Ga0495604_0096106 3300047317 Bacteria 2187
637 Ga0495674_0003393 3300047319 Bacteria 15471
638 Ga0495674_0008596 3300047319 Bacteria 9720
639 Ga0495674_0022243 3300047319 Bacteria 5847
640 Ga0495674_0024850 3300047319 Bacteria 5499
641 Ga0495674_0639577 3300047319 Bacteria 839
642 Ga0495672_0041806 3300047320 Bacteria 2769
643 Ga0495676_0017239 3300047321 Bacteria 6391
644 Ga0495676_0032371 3300047321 Bacteria 4414
645 Ga0495676_0074439 3300047321 Bacteria 2600
646 Ga0495680_0009852 3300047322 Bacteria 8565
647 Ga0495680_0084827 3300047322 Bacteria 2386
648 Ga0495680_0182558 3300047322 Bacteria 1513
649 Ga0495680_0396983 3300047322 Bacteria 953
650 Ga0495680_0482883 3300047322 Bacteria 843
651 Ga0495683_0002534 3300047323 Bacteria 10971
652 Ga0495683_0003483 3300047323 Bacteria 9170
653 Ga0495683_0012675 3300047323 Bacteria 4427
654 Ga0495683_0014118 3300047323 Bacteria 4162
655 Ga0495683_0041979 3300047323 Bacteria 2306
656 Ga0495683_0207787 3300047323 Bacteria 879
657 Ga0495687_000131 3300047443 Bacteria 114820
658 Ga0495687_008005 3300047443 Bacteria 6121
659 Ga0495687_031945 3300047443 Bacteria 2409
660 Ga0495687_108252 3300047443 Bacteria 1027
661 Ga0495675_0007002 3300047444 Bacteria 6935
662 Ga0495675_0016536 3300047444 Bacteria 4667
663 Ga0495675_0019119 3300047444 Bacteria 4352
664 Ga0495677_0057088 3300047445 Bacteria 1443
665 Ga0495679_000037 3300047446 Bacteria 158099
666 Ga0495679_000454 3300047446 Bacteria 30216
667 Ga0495679_010117 3300047446 Bacteria 3725
668 Ga0495673_0027263 3300047469 Bacteria 2721
669 Ga0495673_0053427 3300047469 Bacteria 1761
670 Ga0495673_0087818 3300047469 Bacteria 1275
671 Ga0495681_0127321 3300047470 Bacteria 1087
672 Ga0495681_0159352 3300047470 Bacteria 941
673 Ga0495684_0049901 3300047471 Bacteria 3197
674 Ga0495684_0160733 3300047471 Bacteria 1675
675 Ga0495684_0178287 3300047471 Bacteria 1576
676 Ga0495686_0000002 3300047472 Bacteria 1050777
677 Ga0495686_0071894 3300047472 Bacteria 2128
678 Ga0495686_0121140 3300047472 Bacteria 1559
679 Ga0495686_0298548 3300047472 Bacteria 890
680 Ga0495593_0008590 3300047673 Bacteria 5940
681 Ga0495593_0013852 3300047673 Bacteria 4593
682 Ga0495593_0014125 3300047673 Bacteria 4543
683 Ga0495593_0060031 3300047673 Bacteria 1991
684 Ga0495602_0002163 3300048088 Bacteria 19844
685 Ga0495602_0043212 3300048088 Bacteria 4100
686 Ga0495602_0049535 3300048088 Bacteria 3761
687 Ga0495602_0088179 3300048088 Bacteria 2583
688 Ga0495602_0377441 3300048088 Bacteria 1016
689 Ga0495602_0394164 3300048088 Bacteria 989
690 Ga0495602_0569586 3300048088 Bacteria 782
691 Ga0495614_0015312 3300048089 Bacteria 3342
692 Ga0495614_0032539 3300048089 Bacteria 2244
693 Ga0495614_0089889 3300048089 Bacteria 1335
694 Ga0495626_0012611 3300048091 Bacteria 4422
695 Ga0495626_0053451 3300048091 Bacteria 1859
696 Ga0495626_0139255 3300048091 Bacteria 1030
697 Ga0496100_0068954 3300048903 Bacteria 2353
698 Ga0496100_0179994 3300048903 Bacteria 1528
699 Ga0496100_0285013 3300048903 Bacteria 1232
700 Ga0496100_0347615 3300048903 Bacteria 1119
701 Ga0496100_0641573 3300048903 Bacteria 826
702 Ga0496101_0296622 3300048904 Bacteria 1265
703 Ga0496101_0381139 3300048904 Bacteria 1109
704 Ga0496101_0410775 3300048904 Bacteria 1067
705 Ga0496101_0610507 3300048904 Bacteria 862
706 Ga0496102_0028937 3300048905 Bacteria 4953
707 Ga0496102_0030752 3300048905 Bacteria 4808
708 Ga0496102_0038746 3300048905 Bacteria 4303
709 Ga0496102_0085295 3300048905 Bacteria 2915
710 Ga0496102_0149758 3300048905 Bacteria 2192
711 Ga0496102_0579084 3300048905 Bacteria 1045
712 Ga0496103_0001897 3300048906 Bacteria 13597
713 Ga0496103_0140207 3300048906 Bacteria 1546
714 Ga0496103_0151930 3300048906 Bacteria 1483
715 Ga0496104_0064933 3300048907 Bacteria 3463
716 Ga0496104_0081050 3300048907 Bacteria 3094
717 Ga0496104_0109876 3300048907 Bacteria 2642
718 Ga0496104_0313958 3300048907 Bacteria 1480
719 Ga0496104_0467630 3300048907 Bacteria 1172
720 Ga0496105_0150128 3300048908 Bacteria 1915
721 Ga0496105_0217198 3300048908 Bacteria 1557
722 Ga0496105_0332722 3300048908 Bacteria 1215
723 Ga0496106_0000069 3300048909 Bacteria 82859
724 Ga0496106_0040797 3300048909 Bacteria 3477
725 Ga0496106_0067890 3300048909 Bacteria 2719
726 Ga0496106_0197382 3300048909 Bacteria 1601
727 Ga0496106_0280691 3300048909 Bacteria 1334
728 Ga0496106_0304322 3300048909 Bacteria 1279
729 Ga0496106_0446212 3300048909 Bacteria 1039
730 Ga0496107_0257606 3300048910 Bacteria 1298
731 Ga0496108_0100217 3300048911 Bacteria 2470
732 Ga0496108_0111021 3300048911 Bacteria 2345
733 Ga0496110_0030329 3300048913 Bacteria 4660
734 Ga0496110_0120526 3300048913 Bacteria 2363
735 Ga0496111_0139619 3300048914 Bacteria 1795
736 Ga0496111_0250896 3300048914 Bacteria 1313
737 Ga0496112_0010869 3300048915 Bacteria 8284
738 Ga0496112_0061603 3300048915 Bacteria 3699
739 Ga0496113_0029504 3300048916 Bacteria 3962
740 Ga0496113_0343895 3300048916 Bacteria 1196
741 Ga0496114_0069715 3300048917 Bacteria 2952
742 Ga0496114_0195539 3300048917 Bacteria 1770
743 Ga0496114_0220397 3300048917 Bacteria 1665
744 Ga0496114_0266399 3300048917 Bacteria 1509
745 Ga0496114_0267238 3300048917 Bacteria 1507
746 Ga0496115_0156854 3300048918 Bacteria 1880
747 Ga0496115_0227293 3300048918 Bacteria 1539
748 Ga0496116_0002524 3300048919 Bacteria 19161
749 Ga0496116_0017873 3300048919 Bacteria 5487
750 Ga0496116_0161128 3300048919 Bacteria 1230
751 Ga0496116_0194141 3300048919 Bacteria 1071
752 Ga0496117_0012694 3300048920 Bacteria 7398
753 Ga0496117_0014480 3300048920 Bacteria 6791
754 Ga0496117_0014852 3300048920 Bacteria 6682
755 Ga0496117_0018799 3300048920 Bacteria 5706
756 Ga0496117_0026423 3300048920 Bacteria 4543
757 Ga0496117_0215614 3300048920 Bacteria 1072
758 Ga0496118_0003659 3300048921 Bacteria 19093
759 Ga0496118_0005201 3300048921 Bacteria 14886
760 Ga0496118_0005208 3300048921 Bacteria 14873
761 Ga0496118_0005601 3300048921 Bacteria 14193
762 Ga0496118_0006154 3300048921 Bacteria 13313
763 Ga0496118_0010249 3300048921 Bacteria 9302
764 Ga0496118_0039191 3300048921 Bacteria 3784
765 Ga0496118_0063688 3300048921 Bacteria 2711
766 Ga0496118_0106444 3300048921 Bacteria 1876
767 Ga0496118_0120929 3300048921 Bacteria 1707
768 Ga0496119_0074971 3300048922 Bacteria 1968
769 Ga0496119_0092256 3300048922 Bacteria 1718
770 Ga0496121_0000102 3300048924 Bacteria 195341
771 Ga0496121_0000929 3300048924 Bacteria 52983
772 Ga0496121_0014822 3300048924 Bacteria 8230
773 Ga0496121_0015730 3300048924 Bacteria 7888
774 Ga0496121_0242845 3300048924 Bacteria 1253
775 Ga0496121_0281244 3300048924 Bacteria 1138
776 Ga0496121_0333007 3300048924 Bacteria 1017
777 Ga0496121_0379933 3300048924 Bacteria 932
778 Ga0496122_0061614 3300048925 Bacteria 2752
779 Ga0496122_0078029 3300048925 Bacteria 2322
780 Ga0496122_0193064 3300048925 Bacteria 1199
781 Ga0496122_0274088 3300048925 Bacteria 927
782 Ga0496124_0044928 3300048927 Bacteria 3788
783 Ga0496124_0119699 3300048927 Bacteria 2106
784 Ga0496124_0525409 3300048927 Bacteria 787
785 Ga0496125_0048763 3300048928 Bacteria 3527
786 Ga0496126_0000225 3300048929 Bacteria 122842
787 Ga0496126_0000393 3300048929 Bacteria 89680
788 Ga0496126_0000899 3300048929 Bacteria 51751
789 Ga0496126_0003752 3300048929 Bacteria 18891
790 Ga0496126_0062491 3300048929 Bacteria 3341
791 Ga0496126_0075058 3300048929 Bacteria 3002
792 Ga0496126_0290080 3300048929 Bacteria 1353
793 Ga0495678_037731 3300049459 Bacteria 1960
794 Ga0495682_0011075 3300049460 Bacteria 3474
795 Ga0501031_0363302 3300049568 Bacteria 937
796 Ga0501033_0064301 3300049570 Bacteria 2700
797 Ga0501036_0011585 3300049572 Bacteria 7306
798 Ga0501036_0546403 3300049572 Bacteria 963
799 Ga0501038_0026960 3300049574 Bacteria 5114
800 Ga0501038_0056700 3300049574 Bacteria 3365
801 Ga0501038_0492816 3300049574 Bacteria 938
802 Ga0501039_0056996 3300049575 Bacteria 3027
803 Ga0501039_0066124 3300049575 Bacteria 2806
804 Ga0501041_0003947 3300049577 Bacteria 8557
805 Ga0501041_0078377 3300049577 Bacteria 2033
806 Ga0501041_0258262 3300049577 Bacteria 1095
807 Ga0501042_0025237 3300049578 Bacteria 4174
808 Ga0501042_0077581 3300049578 Bacteria 2379
809 Ga0501042_0342584 3300049578 Bacteria 1081
810 Ga0501048_0014345 3300049582 Bacteria 5868
811 Ga0501048_0161815 3300049582 Bacteria 1584
812 Ga0501048_0188002 3300049582 Bacteria 1464
813 Ga0501048_0725404 3300049582 Bacteria 714
814 Ga0501068_0105562 3300049584 Bacteria 1748
815 Ga0501072_0011730 3300049588 Bacteria 6696
816 Ga0501072_0060844 3300049588 Bacteria 2977
817 Ga0501072_0091679 3300049588 Bacteria 2413
818 Ga0501072_0633341 3300049588 Bacteria 842
819 Ga0501073_0261300 3300049589 Bacteria 1195
820 Ga0501075_0011761 3300049591 Bacteria 6205
821 Ga0501075_0179966 3300049591 Bacteria 1613
822 Ga0501076_0001607 3300049592 Bacteria 15216
823 Ga0501076_0157723 3300049592 Bacteria 1848
824 Ga0501209_000267 3300049656 Bacteria 6292
825 Ga0501079_0004974 3300049741 Bacteria 9855
826 Ga0501079_0100610 3300049741 Bacteria 2241
827 Ga0501080_0010979 3300049742 Bacteria 8291
828 Ga0501080_0016831 3300049742 Bacteria 6753
829 Ga0501080_0849465 3300049742 Bacteria 798
830 Ga0501081_0004065 3300049743 Bacteria 9371
831 Ga0501081_0109807 3300049743 Bacteria 1957
832 Ga0501035_0033312 3300049822 Bacteria 4686
833 Ga0501044_0000033 3300049823 Bacteria 167177
834 Ga0501045_0015990 3300049824 Bacteria 5323
835 Ga0501045_0176019 3300049824 Bacteria 1594
836 nmdc:mga03683_35003_c1 3300050489 Bacteria 2035
837 nmdc:mga03n38_46373_c1 3300050490 Bacteria 1919
838 nmdc:mga0qj67_328963_c1 3300050509 Bacteria 1237
839 nmdc:mga08y16_371835_c1 3300050511 Bacteria 1466
840 nmdc:mga0n895_133004_c1 3300050512 Bacteria 2513
841 nmdc:mga0n895_671975_c1 3300050512 Bacteria 1033
842 nmdc:mga0rr50_51193_c2 3300050513 Bacteria 2413
843 Ga0500594_0014777 3300053118 Bacteria 1874
844 Ga0500618_005339 3300053125 Bacteria 3924
845 Ga0500637_0234382 3300053178 Bacteria 1032
846 Ga0501084_0015793 3300054114 Bacteria 6262
847 Ga0587088_015960 3300059508 Bacteria 1190
848 Ga0501082_0010423 3300060353 Bacteria 8000
849 Ga0501082_0293680 3300060353 Bacteria 1415
850 Ga0501082_0437500 3300060353 Bacteria 1142
851 Ga0466962_0006187 3300061719 Bacteria 5750
852 Ga0466962_0047173 3300061719 Bacteria 2058
853 Ga0466962_0196758 3300061719 Bacteria 984
854 Ga0530510_0001224 3300061734 Bacteria 17146
855 2501081102 2501025502 Bacteria 9641094
856 2501408277 2501025504 Bacteria 8008976
857 2509130109 2508501125 Bacteria 7208311
858 2510251944 2510065045 Bacteria 7761063
859 2511085879 2510917013 Bacteria 9951648
860 2511096018 2510917014 Bacteria 8296963
861 2511103258 2510917015 Bacteria 7950052
862 2512345067 2512047030 Bacteria 9031815
863 2513554132 2513237082 Bacteria 8640282
864 2513561544 2513237083 Bacteria 8410967
865 2513962339 2513237151 Bacteria 6309801
866 2514053223 2513237166 Bacteria 10373764
867 2515685046 2515154122 Bacteria 8609520
868 2515691039 2515154123 Bacteria 6387382
869 2516020641 2515154189 Bacteria 9629850
870 2519458127 2519103095 Bacteria 6629912
871 2526212684 2526164512 Bacteria 4025691
872 2527077649 2526164713 Bacteria 6780608
873 2563059385 2562617112 Bacteria 10918404
874 2574431598 2574179768 Bacteria 4907129
875 2585294412 2582581311 Bacteria 6763856
876 2599739418 2599185239 Bacteria 8686614
877 2599742638 2599185240 Bacteria 7968121
878 2600204756 2599185355 Bacteria 7968906
879 2644028217 2643221603 Bacteria 6147767
880 2676741743 2675903129 Bacteria 7964495
881 2713479677 2711768613 Bacteria 11048459
882 2719641056 2718217991 Bacteria 7829542
883 2723878691 2721755763 Bacteria 4464185
884 2738819142 2738541296 Bacteria 7285013
885 2738830702 2738541298 Bacteria 7286732
886 2738872228 2738541306 Bacteria 7284992
887 2739189795 2738543002 Bacteria 7284546
888 2739218829 2738543008 Bacteria 7282815
889 2746088325 2744054900 Bacteria 8399525
890 2746096780 2744054901 Bacteria 8397047
891 2753567778 2751185846 Bacteria 7242164
892 2792838693 2791355137 Bacteria 9654227
893 2808972072 2808606384 Bacteria 8474373
894 2809007010 2808606390 Bacteria 8476311
895 2809014148 2808606391 Bacteria 8308166
896 2817260280 2816332253 Bacteria 6764532
897 2817277966 2816332256 Bacteria 6891714
898 2817451134 2816332286 Bacteria 6853759
899 2819621819 2818991450 Bacteria 6962147
900 2819632802 2818991452 Bacteria 8442785
901 2842324939 2842324504 Bacteria 9364110
902 2842349218 2842348783 Bacteria 9002918
903 2842461858 2842454564 Bacteria 8730687
904 2857361129 2857357740 Bacteria 9937880
905 2863421817 2863421361 Bacteria 7300805
906 2870072242 2870068957 Bacteria 8925310
907 2883096304 2883087390 Bacteria 9532701
908 2885277931 2885270888 Bacteria 9831543
909 2900637663 2900634093 Bacteria 10263517
910 2902686923 2902682994 Bacteria 8951596
911 2904487561 2904483920 Bacteria 7545285
912 2904565982 2904564687 Bacteria 7609577
913 2904573026 2904571731 Bacteria 7608790
914 2904618202 2904615490 Bacteria 10047340
915 2919528868 2919527303 Bacteria 7718827
916 2921646073 2921643360 Bacteria 11448031
917 2928111020 2928108538 Bacteria 7360024
918 2928137447 2928135762 Bacteria 7259641
919 2928159606 2928157003 Bacteria 7522202
920 2928164334 2928163908 Bacteria 7561269
921 2928173082 2928170801 Bacteria 8785406
922 2928505846 2928503688 Bacteria 7268108
923 2928538453 2928536128 Bacteria 7657547
924 2945937826 2945934425 Bacteria 7444609
925 2981994045 2981990288 Bacteria 7590678
926 2990705456 2990703756 Bacteria 7715990
927 642424477 641736151 Bacteria 7477263
928 642415532 641736154 Bacteria 7689995
929 642592435 642555112 Bacteria 8676562
930 642622656 642555113 Bacteria 8214658
931 8002394495 8002392321 Bacteria 4159911
932 8003957693 8003955200 Bacteria 8601927
933 8018848255 8018845410 Bacteria 8933938
934 8020809318 8020807995 Bacteria 6801506
935 8020939275 8020938398 Bacteria 7472757
936 8020947353 8020945358 Bacteria 8467355
937 8020954502 8020953355 Bacteria 7439080
938 8021122694 8021120328 Bacteria 8782274
939 8039099456 8039098773 Bacteria 6602928
940 8040170583 8040167225 Bacteria 6542727
941 8040175481 8040173305 Bacteria 6827067
942 8048749527 8048746797 Bacteria 3557226
943 8055267114 8055266321 Bacteria 7999742
944 8055301572 8055301274 Bacteria 8587385
945 Ga0400483_079523
946 JGI24740J21852_10001608
947 JGI24739J22299_10002870
948 JGI24739J22299_10002919
949 JGI24739J22299_10005315
950 JGI24739J22299_10036167
951 JGI24737J22298_10004043
952 JGI24737J22298_10009321
953 JGI24735J21928_10000214
954 JGI24735J21928_10000975
955 JGI24738J21930_10001813
956 JGI25156J39149_1000606
957 JGI25156J39149_1001619
958 JGI25156J39149_1001839
959 JGI25165J46597_1002278
960 rootH1_10082209
961 rootH2_10060630
962 rootH2_10060631
963 rootH2_10263547
964 rootL2_10044271
965 rootH1_10017919
966 rootH1_10017920
967 rootH1_10050413
968 JGI25160J50197_1000121
969 Ga0055533_1000425
970 Ga0055533_1002006
971 Ga0055532_1000012
972 Ga0055532_1002446
973 Ga0055532_1010100
974 Ga0055532_1012042
975 Ga0055525_1008095
976 Ga0055527_1000011
977 Ga0055527_1000565
978 Ga0055527_1000584
979 Ga0055535_1000009
980 Ga0055535_1001392
981 Ga0055535_1001425
982 Ga0055542_1000015
983 Ga0055542_1001317
984 Ga0055542_1002323
985 Ga0055529_1000011
986 Ga0055529_1000988
987 Ga0055529_1006134
988 Ga0055528_1002055
989 Ga0058692_1005361
990 Ga0065165_1000236
991 Ga0070658_10022962
992 Ga0070658_10041263
993 Ga0070658_10061710
994 Ga0070658_10361142
995 Ga0070658_10455233
996 Ga0070676_10012165
997 Ga0070676_10326612
998 Ga0070690_100068578
999 Ga0068869_100426182
1000 Ga0068868_100031957
1001 Ga0068868_100484039
1002 Ga0070660_100000412
1003 Ga0070660_100080628
1004 Ga0070660_100116852
1005 Ga0070689_100134547
1006 Ga0070687_100064444
1007 Ga0070661_100125396
1008 Ga0070661_100321864
1009 Ga0070668_100007642
1010 Ga0070668_100094310
1011 Ga0070669_100269299
1012 Ga0070675_100243763
1013 Ga0070671_100072441
1014 Ga0070674_100053234
1015 Ga0070674_100059614
1016 Ga0070674_100431592
1017 Ga0070688_100027794
1018 Ga0070659_100000014
1019 Ga0070659_100106972
1020 Ga0070659_100120912
1021 Ga0070667_100079091
1022 Ga0070667_100197501
1023 Ga0070714_100088008
1024 Ga0070701_10007392
1025 Ga0070711_100119291
1026 Ga0070705_100017262
1027 Ga0070700_100036533
1028 Ga0070663_100000465
1029 Ga0070663_100079605
1030 Ga0070663_100593271
1031 Ga0070678_100001980
1032 Ga0070678_100015348
1033 Ga0070662_100077242
1034 Ga0070662_100143261
1035 Ga0070681_10007485
1036 Ga0068867_100025300
1037 Ga0068867_100530053
1038 Ga0070685_10036097
1039 Ga0070706_100027171
1040 Ga0070707_100026476
1041 Ga0070679_100081399
1042 Ga0070697_100113330
1043 Ga0070672_100155417
1044 Ga0070672_100208831
1045 Ga0070695_100013338
1046 Ga0070695_100742653
1047 Ga0070693_100064198
1048 Ga0070693_100069041
1049 Ga0070665_100268166
1050 Ga0070665_100268648
1051 Ga0070704_100011744
1052 Ga0070704_100456774
1053 Ga0068855_100002955
1054 Ga0068855_100005640
1055 Ga0068855_101106525
1056 Ga0070664_100711978
1057 Ga0068857_100304738
1058 Ga0068854_100095793
1059 Ga0070702_100018299
1060 Ga0070702_100046763
1061 Ga0068852_100009260
1062 Ga0068852_100379939
1063 Ga0068866_10002174
1064 Ga0068866_10014626
1065 Ga0068861_100026271
1066 Ga0068861_100073082
1067 Ga0068870_10021019
1068 Ga0068863_100610084
1069 Ga0068858_100026437
1070 Ga0068860_100187922
1071 Ga0068862_100302256
1072 Ga0068862_100519859
1073 Ga0070716_100036920
1074 Ga0070712_100036562
1075 Ga0075369_10011755
1076 Ga0075366_10077882
1077 Ga0097621_100095777
1078 Ga0075370_10010707
1079 Ga0068871_100042754
1080 Ga0068871_100441887
1081 Ga0075433_10310937
1082 Ga0075434_100053749
1083 Ga0068865_100042183
1084 Ga0075435_100001710
1085 Ga0105251_10000128
1086 Ga0105251_10021378
1087 Ga0105251_10119617
1088 Ga0105240_10000748
1089 Ga0105240_10012809
1090 Ga0105240_10050146
1091 Ga0105240_10102224
1092 Ga0105240_10540973
1093 Ga0111539_10086516
1094 Ga0105245_10033012
1095 Ga0105245_10152455
1096 Ga0105247_10300188
1097 Ga0105243_10010284
1098 Ga0105241_10251910
1099 Ga0105242_10016251
1100 Ga0105242_10097070
1101 Ga0105248_10051332
1102 Ga0105248_10105353
1103 Ga0105248_10958322
1104 Ga0105237_10004300
1105 Ga0105237_10009421
1106 Ga0105237_10034289
1107 Ga0105237_10099527
1108 Ga0105237_10149287
1109 Ga0105237_10406204
1110 Ga0105238_10032822
1111 Ga0105238_10074149
1112 Ga0105249_10140510
1113 Ga0105249_10398089
1114 Ga0105239_10005634
1115 Ga0105239_10012318
1116 Ga0105246_10293649
1117 Ga0105246_10770257
1118 Ga0157373_10013231
1119 Ga0157373_10369435
1120 Ga0157371_10004974
1121 Ga0157370_10000210
1122 Ga0157370_10019066
1123 Ga0157370_10428841
1124 Ga0157369_10000116
1125 Ga0157369_10000599
1126 Ga0157369_10001470
1127 Ga0157369_10030593
1128 Ga0157369_10231524
1129 Ga0157374_10000717
1130 Ga0157374_10076635
1131 Ga0157378_10311074
1132 Ga0163162_10037238
1133 Ga0163162_10166912
1134 Ga0157372_10002555
1135 Ga0157372_10228093
1136 Ga0157375_10023764
1137 Ga0157375_10159363
1138 Ga0157375_10406923
1139 Ga0157380_10005113
1140 Ga0157380_10015813
1141 Ga0182008_10036701
1142 Ga0182008_10155215
1143 Ga0157377_10030000
1144 Ga0157379_10014445
1145 Ga0157376_10031159
1146 Ga0157376_10120628
1147 Ga0157376_10291837
1148 Ga0182006_1075170
1149 Ga0182007_10000874
1150 Ga0182005_1043638
1151 Ga0183361_10009
1152 Ga0163161_10053857
1153 Ga0163161_10125780
1154 Ga0197907_11106936
1155 Ga0206354_10063618
1156 Ga0206353_11985253
1157 Ga0224712_10000010
1158 Ga0209566_100797
1159 Ga0209674_100013
1160 Ga0209674_100188
1161 Ga0209674_100199
1162 Ga0209674_101843
1163 Ga0209672_100010
1164 Ga0209672_100051
1165 Ga0209672_100083
1166 Ga0209672_100753
1167 Ga0209147_100006
1168 Ga0209147_100120
1169 Ga0209147_100178
1170 Ga0209147_100365
1171 Ga0209563_101459
1172 Ga0207427_101338
1173 Ga0209258_100010
1174 Ga0209258_100280
1175 Ga0209258_100292
1176 Ga0209646_1018733
1177 Ga0209148_1000018
1178 Ga0209148_1000027
1179 Ga0209148_1001699
1180 Ga0209759_1000251
1181 Ga0209759_1000261
1182 Ga0209759_1001264
1183 Ga0209759_1001797
1184 Ga0209759_1002082
1185 Ga0209233_1000093
1186 Ga0209565_1013667
1187 Ga0209455_1000015
1188 Ga0209455_1000203
1189 Ga0209455_1000683
1190 Ga0209673_1000070
1191 Ga0209564_1003673
1192 Ga0209564_1006486
1193 Ga0209256_1035276
1194 Ga0207426_1000183
1195 Ga0207426_1012231
1196 Ga0207697_10002969
1197 Ga0207713_1000135
1198 Ga0207713_1005578
1199 Ga0207682_10002543
1200 Ga0207642_10006148
1201 Ga0207642_10052696
1202 Ga0207688_10016415
1203 Ga0207647_10000466
1204 Ga0207647_10001635
1205 Ga0207647_10008680
1206 Ga0207647_10015811
1207 Ga0207647_10018503
1208 Ga0207645_10002306
1209 Ga0207643_10002326
1210 Ga0207705_10000292
1211 Ga0207705_10121329
1212 Ga0207705_10124406
1213 Ga0207705_10126338
1214 Ga0207684_10055702
1215 Ga0207707_10022182
1216 Ga0207695_10000955
1217 Ga0207695_10001386
1218 Ga0207695_10006007
1219 Ga0207695_10138385
1220 Ga0207671_10007494
1221 Ga0207671_10057403
1222 Ga0207671_10091830
1223 Ga0207693_10007239
1224 Ga0207663_10040384
1225 Ga0207662_10015167
1226 Ga0207657_10000018
1227 Ga0207657_10006875
1228 Ga0207657_10098014
1229 Ga0207649_10245890
1230 Ga0207652_10110583
1231 Ga0207646_10050124
1232 Ga0207681_10007701
1233 Ga0207694_10029357
1234 Ga0207659_10264478
1235 Ga0207687_10051376
1236 Ga0207687_10153268
1237 Ga0207690_10000006
1238 Ga0207690_10300985
1239 Ga0207706_10015483
1240 Ga0207706_10176497
1241 Ga0207686_10008764
1242 Ga0207686_10344416
1243 Ga0207669_10607717
1244 Ga0207704_10017589
1245 Ga0207704_10206830
1246 Ga0207665_10013795
1247 Ga0207691_10015351
1248 Ga0207711_10097500
1249 Ga0207711_10104245
1250 Ga0207711_10106002
1251 Ga0207711_10152647
1252 Ga0207689_10004537
1253 Ga0207689_10119356
1254 Ga0207661_10153409
1255 Ga0207667_10002741
1256 Ga0207667_10021402
1257 Ga0207667_10026422
1258 Ga0207668_10172306
1259 Ga0207640_10052921
1260 Ga0207640_10176887
1261 Ga0207658_10906965
1262 Ga0207677_10087719
1263 Ga0207677_10305775
1264 Ga0207703_10012908
1265 Ga0207703_10086166
1266 Ga0207639_10107844
1267 Ga0207678_10002014
1268 Ga0207678_10073118
1269 Ga0207678_10188521
1270 Ga0207678_10304450
1271 Ga0207708_10002353
1272 Ga0207648_10003860
1273 Ga0207648_10055962
1274 Ga0207676_10697057
1275 Ga0207674_10490587
1276 Ga0207675_100010756
1277 Ga0207675_100128109
1278 Ga0207683_10003766
1279 Ga0207683_10004051
1280 Ga0207698_10006738
1281 Ga0207698_10280249
1282 Ga0207698_10412866
1283 Ga0209371_1000783
1284 Ga0209371_1001679
1285 Ga0209813_10045622
1286 Ga0207428_10064812
1287 Ga0268266_10051881
1288 Ga0268265_10290504
1289 Ga0268264_10163350
1290 Ga0265338_10005564
1291 Ga0268256_1000857
1292 Ga0268256_1005054
1293 Ga0265327_10003077
1294 Ga0307513_10287680
1295 Ga0307509_10000138
1296 Ga0307408_100000005
1297 Ga0307408_100001187
1298 Ga0307408_100002797
1299 Ga0316575_10001412
1300 Ga0316576_10016474
1301 Ga0316578_10025765
1302 Ga0307405_10012528
1303 Ga0307413_10137914
1304 Ga0307406_10000874
1305 Ga0307406_10503562
1306 Ga0307412_10000016
1307 Ga0307412_10023901
1308 Ga0307409_100049740
1309 Ga0316583_10007937
1310 Ga0373952_0000039
1311 Ga0373945_0088000
1312 Ga0373961_0107347
1313 Ga0316574_0006221
1314 Ga0316582_0108056
1315 Ga0316582_0326674
1316 Ga0316582_0362953
1317 Ga0316584_0069315
1318 Ga0316584_0110392
1319 Ga0395899_0000029
1320 Ga0395899_0253343
1321 Ga0395899_0342815
1322 Ga0395900_0000085
1323 Ga0395900_0003083
1324 Ga0395900_0052585
1325 Ga0395900_0247945
1326 Ga0395898_0000086
1327 Ga0395898_0000339
1328 Ga0395898_0016932
1329 Ga0395898_0017184
1330 Ga0395905_0000183
1331 Ga0395905_0003794
1332 Ga0395901_0000003
1333 Ga0395901_0001540
1334 Ga0395901_0002257
1335 Ga0400490_24139
1336 Ga0400488_20240
1337 Ga0400488_62067
1338 Ga0400486_03127
1339 Ga0400486_32147
1340 Ga0400483_011190
1341 Ga0400483_025886
1342 Ga0400483_081004
1343 Ga0400483_143918
1344 Ga0400483_186862
1345 Ga0400483_215675
1346 Ga0400483_219863
1347 Ga0400489_43383
1348 Ga0400487_14538
1349 Ga0400487_55780
1350 Ga0436360_0376457
1351 Ga0436361_0141037
1352 Ga0436361_0201744
1353 Ga0436361_0371376
1354 Ga0439448_0000016
1355 Ga0450891_004960
1356 Ga0451577_0000659
1357 Ga0451577_0003395
1358 Ga0451577_0008544
1359 Ga0451577_0011087
1360 Ga0451577_0048059
1361 Ga0451577_0104462
1362 Ga0466977_0001336
1363 Ga0466965_0000556
1364 Ga0466966_0017520
1365 Ga0466966_0022290
1366 Ga0466966_0127607
1367 Ga0466961_0000233
1368 Ga0466961_0009166
1369 Ga0466961_0010118
1370 Ga0466961_0032088
1371 Ga0466961_0039674
1372 Ga0466961_0051708
1373 Ga0466961_0099510
1374 Ga0466963_0003833
1375 Ga0466963_0561167
1376 Ga0466964_0001349
1377 Ga0466964_0038172
1378 Ga0453684_0080745
1379 Ga0453684_0531374
1380 Ga0453684_0710755
1381 Ga0453684_0718336
1382 Ga0453684_0740160
1383 Ga0466971_0036450
1384 Ga0466968_0088707
1385 Ga0466970_0022460
1386 Ga0466970_0032704
1387 Ga0466970_0102777
1388 Ga0466970_0217356
1389 Ga0466957_0006558
1390 Ga0466957_0038534
1391 Ga0466957_0080140
1392 Ga0466957_0215728
1393 Ga0466957_0244051
1394 Ga0466957_0505563
1395 Ga0466960_0122496
1396 Ga0466959_0012532
1397 Ga0466959_0033246
1398 Ga0466959_0033621
1399 Ga0466959_0089326
1400 Ga0466959_0137516
1401 Ga0451576_0002901
1402 Ga0451576_0010104
1403 Ga0451576_0012129
1404 Ga0451576_0156840
1405 Ga0451576_0388222
1406 Ga0451576_0570148
1407 Ga0466958_0006906
1408 Ga0466958_0031621
1409 Ga0466958_0084504
1410 Ga0466967_0315415
1411 Ga0495592_0003496
1412 Ga0495592_0005558
1413 Ga0495592_0106388
1414 Ga0495603_0000378
1415 Ga0495603_0003405
1416 Ga0495603_0014125
1417 Ga0495590_0003779
1418 Ga0495590_0039502
1419 Ga0495590_0049028
1420 Ga0495591_005242
1421 Ga0495629_0000247
1422 Ga0495629_0000855
1423 Ga0495629_0001980
1424 Ga0495629_0006909
1425 Ga0495629_0069918
1426 Ga0495629_0205802
1427 Ga0495641_0020797
1428 Ga0495641_0029982
1429 Ga0495651_0054775
1430 Ga0495651_0174536
1431 Ga0495653_0001417
1432 Ga0495653_0024483
1433 Ga0495653_0046081
1434 Ga0495653_0061188
1435 Ga0495653_0164345
1436 Ga0495653_0219772
1437 Ga0495650_0000554
1438 Ga0495650_0020667
1439 Ga0495650_0057546
1440 Ga0495650_0199664
1441 Ga0495580_0000063
1442 Ga0495580_0000113
1443 Ga0495580_0020233
1444 Ga0495580_0021318
1445 Ga0495580_0039104
1446 Ga0495580_0041613
1447 Ga0495580_0042249
1448 Ga0495582_0008677
1449 Ga0495582_0016493
1450 Ga0495582_0243951
1451 Ga0495605_0007856
1452 Ga0495605_0013827
1453 Ga0495605_0018837
1454 Ga0495605_0115150
1455 Ga0495662_0016072
1456 Ga0495662_0024545
1457 Ga0495664_0000674
1458 Ga0495664_0003151
1459 Ga0495664_0018340
1460 Ga0495584_0117964
1461 Ga0495584_0382534
1462 Ga0495596_0036323
1463 Ga0495596_0063615
1464 Ga0495583_0011708
1465 Ga0495583_0095975
1466 Ga0495606_0024799
1467 Ga0495606_0080391
1468 Ga0495608_0007694
1469 Ga0495608_0008528
1470 Ga0495610_0013009
1471 Ga0495616_0014950
1472 Ga0495618_0001295
1473 Ga0495618_0005589
1474 Ga0495618_0009343
1475 Ga0495620_0011878
1476 Ga0495620_0028428
1477 Ga0495620_0137742
1478 Ga0495628_0001894
1479 Ga0495628_0012767
1480 Ga0495628_0065261
1481 Ga0495628_0511160
1482 Ga0495628_0534138
1483 Ga0495630_0003458
1484 Ga0495630_0007833
1485 Ga0495630_0090148
1486 Ga0495630_0163411
1487 Ga0495631_0022240
1488 Ga0495648_0013411
1489 Ga0495648_0024471
1490 Ga0495648_0052889
1491 Ga0495666_0000403
1492 Ga0495666_0003242
1493 Ga0495666_0055220
1494 Ga0495642_0013499
1495 Ga0495642_0044604
1496 Ga0495642_0070508
1497 Ga0495652_0007309
1498 Ga0495652_0043381
1499 Ga0495652_0138515
1500 Ga0495652_0170372
1501 Ga0495665_0003969
1502 Ga0495665_0005705
1503 Ga0495665_0007407
1504 Ga0495665_0022055
1505 Ga0495665_0106361
1506 Ga0495640_0009949
1507 Ga0495640_0037063
1508 Ga0495640_0117734
1509 Ga0495586_0000326
1510 Ga0495586_0017850
1511 Ga0495586_0136458
1512 Ga0495587_0004548
1513 Ga0495587_0009815
1514 Ga0495597_0044547
1515 Ga0495645_0006404
1516 Ga0495645_0038683
1517 Ga0495645_0039215
1518 Ga0495645_0226666
1519 Ga0495622_0000039
1520 Ga0495622_0032081
1521 Ga0495656_0048527
1522 Ga0495634_0002076
1523 Ga0495634_0046651
1524 Ga0495611_0277672
1525 Ga0495625_0051267
1526 Ga0495625_0057627
1527 Ga0495635_0018615
1528 Ga0495635_0025818
1529 Ga0495635_0154947
1530 Ga0495661_0002427
1531 Ga0495661_0006016
1532 Ga0495657_0101040
1533 Ga0495657_0214056
1534 Ga0495599_0093527
1535 Ga0495599_0200366
1536 Ga0495599_0406049
1537 Ga0495623_0020527
1538 Ga0495623_0033299
1539 Ga0495623_0070163
1540 Ga0495623_0250361
1541 Ga0495646_0000155
1542 Ga0495646_0024973
1543 Ga0495646_0242282
1544 Ga0495669_0034092
1545 Ga0495669_0041682
1546 Ga0495613_0001408
1547 Ga0495613_0008462
1548 Ga0495613_0130069
1549 Ga0495624_0002650
1550 Ga0495624_0013056
1551 Ga0495624_0022460
1552 Ga0495624_0025596
1553 Ga0495670_0020644
1554 Ga0495670_0145878
1555 Ga0495671_0008251
1556 Ga0495671_0127628
1557 Ga0495671_0231999
1558 Ga0495649_0003210
1559 Ga0495649_0016509
1560 Ga0495649_0016931
1561 Ga0495649_0029990
1562 Ga0495649_0071738
1563 Ga0495649_0150661
1564 Ga0495589_0009241
1565 Ga0495589_0013667
1566 Ga0495589_0052212
1567 Ga0495589_0092063
1568 Ga0495600_0025812
1569 Ga0495600_0067534
1570 Ga0495600_0071868
1571 Ga0495600_0080523
1572 Ga0495600_0409839
1573 Ga0495660_0125705
1574 Ga0495581_0000336
1575 Ga0495581_0012201
1576 Ga0495581_0019046
1577 Ga0495581_0164518
1578 Ga0495604_0011247
1579 Ga0495604_0035971
1580 Ga0495604_0096106
1581 Ga0495674_0003393
1582 Ga0495674_0008596
1583 Ga0495674_0022243
1584 Ga0495674_0024850
1585 Ga0495674_0639577
1586 Ga0495672_0041806
1587 Ga0495676_0017239
1588 Ga0495676_0032371
1589 Ga0495676_0074439
1590 Ga0495680_0009852
1591 Ga0495680_0084827
1592 Ga0495680_0182558
1593 Ga0495680_0396983
1594 Ga0495680_0482883
1595 Ga0495683_0002534
1596 Ga0495683_0003483
1597 Ga0495683_0012675
1598 Ga0495683_0014118
1599 Ga0495683_0041979
1600 Ga0495683_0207787
1601 Ga0495687_000131
1602 Ga0495687_008005
1603 Ga0495687_031945
1604 Ga0495687_108252
1605 Ga0495675_0007002
1606 Ga0495675_0016536
1607 Ga0495675_0019119
1608 Ga0495677_0057088
1609 Ga0495679_000037
1610 Ga0495679_000454
1611 Ga0495679_010117
1612 Ga0495673_0027263
1613 Ga0495673_0053427
1614 Ga0495673_0087818
1615 Ga0495681_0127321
1616 Ga0495681_0159352
1617 Ga0495684_0049901
1618 Ga0495684_0160733
1619 Ga0495684_0178287
1620 Ga0495686_0000002
1621 Ga0495686_0071894
1622 Ga0495686_0121140
1623 Ga0495686_0298548
1624 Ga0495593_0008590
1625 Ga0495593_0013852
1626 Ga0495593_0014125
1627 Ga0495593_0060031
1628 Ga0495602_0002163
1629 Ga0495602_0043212
1630 Ga0495602_0049535
1631 Ga0495602_0088179
1632 Ga0495602_0377441
1633 Ga0495602_0394164
1634 Ga0495602_0569586
1635 Ga0495614_0015312
1636 Ga0495614_0032539
1637 Ga0495614_0089889
1638 Ga0495626_0012611
1639 Ga0495626_0053451
1640 Ga0495626_0139255
1641 Ga0496100_0068954
1642 Ga0496100_0179994
1643 Ga0496100_0285013
1644 Ga0496100_0347615
1645 Ga0496100_0641573
1646 Ga0496101_0296622
1647 Ga0496101_0381139
1648 Ga0496101_0410775
1649 Ga0496101_0610507
1650 Ga0496102_0028937
1651 Ga0496102_0030752
1652 Ga0496102_0038746
1653 Ga0496102_0085295
1654 Ga0496102_0149758
1655 Ga0496102_0579084
1656 Ga0496103_0001897
1657 Ga0496103_0140207
1658 Ga0496103_0151930
1659 Ga0496104_0064933
1660 Ga0496104_0081050
1661 Ga0496104_0109876
1662 Ga0496104_0313958
1663 Ga0496104_0467630
1664 Ga0496105_0150128
1665 Ga0496105_0217198
1666 Ga0496105_0332722
1667 Ga0496106_0000069
1668 Ga0496106_0040797
1669 Ga0496106_0067890
1670 Ga0496106_0197382
1671 Ga0496106_0280691
1672 Ga0496106_0304322
1673 Ga0496106_0446212
1674 Ga0496107_0257606
1675 Ga0496108_0100217
1676 Ga0496108_0111021
1677 Ga0496110_0030329
1678 Ga0496110_0120526
1679 Ga0496111_0139619
1680 Ga0496111_0250896
1681 Ga0496112_0010869
1682 Ga0496112_0061603
1683 Ga0496113_0029504
1684 Ga0496113_0343895
1685 Ga0496114_0069715
1686 Ga0496114_0195539
1687 Ga0496114_0220397
1688 Ga0496114_0266399
1689 Ga0496114_0267238
1690 Ga0496115_0156854
1691 Ga0496115_0227293
1692 Ga0496116_0002524
1693 Ga0496116_0017873
1694 Ga0496116_0161128
1695 Ga0496116_0194141
1696 Ga0496117_0012694
1697 Ga0496117_0014480
1698 Ga0496117_0014852
1699 Ga0496117_0018799
1700 Ga0496117_0026423
1701 Ga0496117_0215614
1702 Ga0496118_0003659
1703 Ga0496118_0005201
1704 Ga0496118_0005208
1705 Ga0496118_0005601
1706 Ga0496118_0006154
1707 Ga0496118_0010249
1708 Ga0496118_0039191
1709 Ga0496118_0063688
1710 Ga0496118_0106444
1711 Ga0496118_0120929
1712 Ga0496119_0074971
1713 Ga0496119_0092256
1714 Ga0496121_0000102
1715 Ga0496121_0000929
1716 Ga0496121_0014822
1717 Ga0496121_0015730
1718 Ga0496121_0242845
1719 Ga0496121_0281244
1720 Ga0496121_0333007
1721 Ga0496121_0379933
1722 Ga0496122_0061614
1723 Ga0496122_0078029
1724 Ga0496122_0193064
1725 Ga0496122_0274088
1726 Ga0496124_0044928
1727 Ga0496124_0119699
1728 Ga0496124_0525409
1729 Ga0496125_0048763
1730 Ga0496126_0000225
1731 Ga0496126_0000393
1732 Ga0496126_0000899
1733 Ga0496126_0003752
1734 Ga0496126_0062491
1735 Ga0496126_0075058
1736 Ga0496126_0290080
1737 Ga0495678_037731
1738 Ga0495682_0011075
1739 Ga0501031_0363302
1740 Ga0501033_0064301
1741 Ga0501036_0011585
1742 Ga0501036_0546403
1743 Ga0501038_0026960
1744 Ga0501038_0056700
1745 Ga0501038_0492816
1746 Ga0501039_0056996
1747 Ga0501039_0066124
1748 Ga0501041_0003947
1749 Ga0501041_0078377
1750 Ga0501041_0258262
1751 Ga0501042_0025237
1752 Ga0501042_0077581
1753 Ga0501042_0342584
1754 Ga0501048_0014345
1755 Ga0501048_0161815
1756 Ga0501048_0188002
1757 Ga0501048_0725404
1758 Ga0501068_0105562
1759 Ga0501072_0011730
1760 Ga0501072_0060844
1761 Ga0501072_0091679
1762 Ga0501072_0633341
1763 Ga0501073_0261300
1764 Ga0501075_0011761
1765 Ga0501075_0179966
1766 Ga0501076_0001607
1767 Ga0501076_0157723
1768 Ga0501209_000267
1769 Ga0501079_0004974
1770 Ga0501079_0100610
1771 Ga0501080_0010979
1772 Ga0501080_0016831
1773 Ga0501080_0849465
1774 Ga0501081_0004065
1775 Ga0501081_0109807
1776 Ga0501035_0033312
1777 Ga0501044_0000033
1778 Ga0501045_0015990
1779 Ga0501045_0176019
1780 nmdc:mga03683_35003_c1
1781 nmdc:mga03n38_46373_c1
1782 nmdc:mga0qj67_328963_c1
1783 nmdc:mga08y16_371835_c1
1784 nmdc:mga0n895_133004_c1
1785 nmdc:mga0n895_671975_c1
1786 nmdc:mga0rr50_51193_c2
1787 Ga0500594_0014777
1788 Ga0500618_005339
1789 Ga0500637_0234382
1790 Ga0501084_0015793
1791 Ga0587088_015960
1792 Ga0501082_0010423
1793 Ga0501082_0293680
1794 Ga0501082_0437500
1795 Ga0466962_0006187
1796 Ga0466962_0047173
1797 Ga0466962_0196758
1798 Ga0530510_0001224
1799 2501081102
1800 2501408277
1801 2509130109
1802 2510251944
1803 2511085879
1804 2511096018
1805 2511103258
1806 2512345067
1807 2513554132
1808 2513561544
1809 2513962339
1810 2514053223
1811 2515685046
1812 2515691039
1813 2516020641
1814 2519458127
1815 2526212684
1816 2527077649
1817 2563059385
1818 2574431598
1819 2585294412
1820 2599739418
1821 2599742638
1822 2600204756
1823 2644028217
1824 2676741743
1825 2713479677
1826 2719641056
1827 2723878691
1828 2738819142
1829 2738830702
1830 2738872228
1831 2739189795
1832 2739218829
1833 2746088325
1834 2746096780
1835 2753567778
1836 2792838693
1837 2808972072
1838 2809007010
1839 2809014148
1840 2817260280
1841 2817277966
1842 2817451134
1843 2819621819
1844 2819632802
1845 2842324939
1846 2842349218
1847 2842461858
1848 2857361129
1849 2863421817
1850 2870072242
1851 2883096304
1852 2885277931
1853 2900637663
1854 2902686923
1855 2904487561
1856 2904565982
1857 2904573026
1858 2904618202
1859 2919528868
1860 2921646073
1861 2928111020
1862 2928137447
1863 2928159606
1864 2928164334
1865 2928173082
1866 2928505846
1867 2928538453
1868 2945937826
1869 2981994045
1870 2990705456
1871 642424477
1872 642415532
1873 642592435
1874 642622656
1875 8002394495
1876 8003957693
1877 8018848255
1878 8020809318
1879 8020939275
1880 8020947353
1881 8020954502
1882 8021122694
1883 8039099456
1884 8040170583
1885 8040175481
1886 8048749527
1887 8055267114
1888 8055301572

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

17

198

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9711 52 102
2f3t-assembly1.cif.gz_B crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.91 21 223
7u5f-assembly1.cif.gz_C crystal structure of guanylate kinase from pseudomonas aeruginosa pao1 in complex with gmp 0.9085 22 220
2f3t-assembly1.cif.gz_B crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.9015 21 223
2anc-assembly1.cif.gz_F crystal structure of unliganded form of oligomeric e.coli guanylate kinase 0.9012 22 220
ID Description Score Start End Superfamily
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9999 53 102 3.30.63.10
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9921 53 99 3.30.63.10
af_Q5TCQ9_142_196_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9714 52 102 3.30.63.10
3tauB02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9699 53 112 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9617 53 102 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A7Y3GJY2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9864 21 203 GO:0004385
GO:0005524
GO:0005829
AF-A0A7W0FAL4-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9779 22 205 GO:0004385
GO:0005524
GO:0005829
AF-A0A1F6PPM8-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.973 22 206 GO:0004385
GO:0005524
GO:0005829
AF-A0A396MZI1-F1-model_v4 deleted 0.9712 21 203
AF-A0A7Y3GJY2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9706 21 203 GO:0004385
GO:0005524
GO:0005829

Map