F486406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 944 | 385 | 1888 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0094170|Ga0395901_0094170_2166_3029 |
| Length | 287 |
| Sequence | VGGRDVIAGRRXXXPGVVVDDAMTPAAEAGQGGAPSLQVSDLAFSYPDGHRALDGVDLEIGRGERVALLGPNGAGKTTLVLHLNGILQPERGSVTVAGLAVDKPSLREIRRRVGIVFQDPDDQLFMPTVRDDVAFGPANLGLRGRELDARVDHALTLVGMQAYAERPPNHLSYGQRRRVAVATVLAMEPEVLVLDEPSSNLDPASRRELAEILDGLDVTLLMVTHDLPYALELCPRSLVMGEGRIVADGPTADVLGDEDLMRANRLELPFGFDPRWAVRHAGGGAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 10 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 25 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 29 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 30 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 34 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 60 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 78 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 79 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 80 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 81 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 82 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 83 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 84 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 85 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 86 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 87 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 88 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 89 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 90 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 91 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 92 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 95 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 96 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 97 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 98 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 104 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 105 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 106 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 107 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 108 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 113 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 114 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 122 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 123 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 124 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 125 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 126 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 127 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 128 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 129 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 130 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 131 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 132 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 133 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 134 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 135 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 136 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 137 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 138 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 141 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 142 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 143 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 144 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 149 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 150 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 151 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 152 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 256 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 266 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 268 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 269 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 270 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 272 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 273 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 274 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 279 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 280 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 281 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 282 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 283 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 284 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 285 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 286 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 287 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 288 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 289 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 290 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 291 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 292 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 293 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 294 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 295 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 296 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 297 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 298 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 299 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 300 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 301 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 302 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 303 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 304 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 305 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 306 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 307 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 308 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 309 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 310 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 311 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 312 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 313 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 314 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 315 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 316 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 317 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 318 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 319 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 320 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 321 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 322 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 323 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 324 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 325 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 326 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 327 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 328 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 329 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 330 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 331 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 332 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 333 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 334 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 335 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 336 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 337 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 338 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 339 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 340 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 341 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 342 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 343 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 344 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 345 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 346 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 347 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 348 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 349 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 350 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 351 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 352 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 353 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 354 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 355 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 356 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 357 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 358 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 359 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 360 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 361 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 362 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 363 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 364 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 365 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 366 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 367 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 368 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 369 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 370 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 371 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 372 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 373 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 374 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 375 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 376 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 377 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 378 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 379 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 380 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 381 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 382 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 383 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 384 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 385 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.92 |
| Metatranscriptomes | 0.85 |
| Isolates | 11.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.08 |
| Nodule | 1.06 |
| Rhizoplane | 1.38 |
| Rhizosphere | 82.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395901_0094170 | 3300038443 | Bacteria | 3137 |
| 2 | JGI24739J22299_10036082 | 3300001989 | Bacteria | 1672 |
| 3 | JGI24737J22298_10006965 | 3300001990 | Bacteria | 3833 |
| 4 | rootH1_10007500 | 3300003316 | Bacteria | 12200 |
| 5 | rootH2_10041617 | 3300003320 | Bacteria | 2667 |
| 6 | rootH1_10005128 | 3300003323 | Bacteria | 8259 |
| 7 | JGI25160J50197_1022820 | 3300003354 | Bacteria | 1825 |
| 8 | JGI25160J50197_1023936 | 3300003354 | Bacteria | 1745 |
| 9 | JGI25407J50210_10000257 | 3300003373 | Bacteria | 9414 |
| 10 | Ga0006562J51391_1072226 | 3300003578 | Bacteria | 10520 |
| 11 | Ga0006562J51391_1072228 | 3300003578 | Bacteria | 6280 |
| 12 | Ga0006562J51391_1195513 | 3300003578 | Bacteria | 3200 |
| 13 | Ga0006562J51391_1195514 | 3300003578 | Bacteria | 3070 |
| 14 | Ga0006562J51391_1218549 | 3300003578 | Bacteria | 3726 |
| 15 | Ga0006562J51391_1218550 | 3300003578 | Bacteria | 3580 |
| 16 | Ga0058692_1034166 | 3300003856 | Bacteria | 936 |
| 17 | Ga0070683_100321129 | 3300005329 | Bacteria | 1474 |
| 18 | Ga0070683_100502289 | 3300005329 | Bacteria | 1158 |
| 19 | Ga0070660_100166225 | 3300005339 | Bacteria | 1780 |
| 20 | Ga0070668_100793471 | 3300005347 | Bacteria | 841 |
| 21 | Ga0070674_100073896 | 3300005356 | Bacteria | 2418 |
| 22 | Ga0070667_100150841 | 3300005367 | Bacteria | 2042 |
| 23 | Ga0070714_100034488 | 3300005435 | Bacteria | 4238 |
| 24 | Ga0070700_100136807 | 3300005441 | Bacteria | 1660 |
| 25 | Ga0070678_100628848 | 3300005456 | Bacteria | 961 |
| 26 | Ga0070697_100403731 | 3300005536 | Bacteria | 1186 |
| 27 | Ga0070665_100459744 | 3300005548 | Bacteria | 1283 |
| 28 | Ga0070704_100395310 | 3300005549 | Bacteria | 1178 |
| 29 | Ga0070664_100122756 | 3300005564 | Bacteria | 2275 |
| 30 | Ga0068852_100956368 | 3300005616 | Bacteria | 875 |
| 31 | Ga0068866_10250742 | 3300005718 | Bacteria | 1083 |
| 32 | Ga0068870_10050081 | 3300005840 | Bacteria | 2206 |
| 33 | Ga0081455_10021892 | 3300005937 | Bacteria | 5987 |
| 34 | Ga0081455_10041551 | 3300005937 | Bacteria | 4042 |
| 35 | Ga0081455_10082549 | 3300005937 | Bacteria | 2629 |
| 36 | Ga0081455_10082877 | 3300005937 | Bacteria | 2622 |
| 37 | Ga0081455_10127014 | 3300005937 | Bacteria | 1999 |
| 38 | Ga0081455_10198944 | 3300005937 | Bacteria | 1502 |
| 39 | Ga0081538_10000071 | 3300005981 | Bacteria | 96238 |
| 40 | Ga0081538_10000636 | 3300005981 | Bacteria | 38924 |
| 41 | Ga0081538_10000708 | 3300005981 | Bacteria | 36607 |
| 42 | Ga0081538_10000786 | 3300005981 | Bacteria | 34645 |
| 43 | Ga0081538_10000848 | 3300005981 | Bacteria | 33003 |
| 44 | Ga0081538_10005143 | 3300005981 | Bacteria | 11857 |
| 45 | Ga0081538_10015429 | 3300005981 | Bacteria | 5912 |
| 46 | Ga0081538_10035476 | 3300005981 | Bacteria | 3276 |
| 47 | Ga0081538_10044130 | 3300005981 | Bacteria | 2785 |
| 48 | Ga0081538_10050185 | 3300005981 | Bacteria | 2522 |
| 49 | Ga0081538_10057632 | 3300005981 | Bacteria | 2261 |
| 50 | Ga0081538_10093866 | 3300005981 | Bacteria | 1539 |
| 51 | Ga0075365_10001046 | 3300006038 | Bacteria | 11936 |
| 52 | Ga0075365_10014479 | 3300006038 | Bacteria | 4747 |
| 53 | Ga0075368_10004437 | 3300006042 | Bacteria | 4759 |
| 54 | Ga0075368_10005106 | 3300006042 | Bacteria | 4496 |
| 55 | Ga0075363_100048713 | 3300006048 | Bacteria | 2254 |
| 56 | Ga0075363_100087411 | 3300006048 | Bacteria | 1712 |
| 57 | Ga0075363_100340078 | 3300006048 | Bacteria | 875 |
| 58 | Ga0075363_100401392 | 3300006048 | Bacteria | 806 |
| 59 | Ga0075364_10001308 | 3300006051 | Bacteria | 13398 |
| 60 | Ga0075364_10017255 | 3300006051 | Bacteria | 4506 |
| 61 | Ga0075362_10034851 | 3300006177 | Bacteria | 2196 |
| 62 | Ga0075367_10066726 | 3300006178 | Bacteria | 2156 |
| 63 | Ga0075367_10211740 | 3300006178 | Bacteria | 1212 |
| 64 | Ga0075369_10041418 | 3300006186 | Bacteria | 1972 |
| 65 | Ga0075369_10051545 | 3300006186 | Bacteria | 1782 |
| 66 | Ga0075370_10036461 | 3300006353 | Bacteria | 2762 |
| 67 | Ga0075370_10038499 | 3300006353 | Bacteria | 2691 |
| 68 | Ga0075370_10114138 | 3300006353 | Bacteria | 1570 |
| 69 | Ga0075428_100005158 | 3300006844 | Bacteria | 14522 |
| 70 | Ga0075428_100008238 | 3300006844 | Bacteria | 11557 |
| 71 | Ga0075428_100030080 | 3300006844 | Bacteria | 6007 |
| 72 | Ga0075428_100031174 | 3300006844 | Bacteria | 5896 |
| 73 | Ga0075428_100275996 | 3300006844 | Bacteria | 1809 |
| 74 | Ga0075430_100005719 | 3300006846 | Bacteria | 10488 |
| 75 | Ga0075430_100033857 | 3300006846 | Bacteria | 4335 |
| 76 | Ga0075430_100053015 | 3300006846 | Bacteria | 3415 |
| 77 | Ga0075430_100068066 | 3300006846 | Bacteria | 2988 |
| 78 | Ga0075430_100128622 | 3300006846 | Bacteria | 2111 |
| 79 | Ga0075431_100004645 | 3300006847 | Bacteria | 13486 |
| 80 | Ga0075431_100006078 | 3300006847 | Bacteria | 11967 |
| 81 | Ga0075431_100026331 | 3300006847 | Bacteria | 5966 |
| 82 | Ga0075431_100032094 | 3300006847 | Bacteria | 5412 |
| 83 | Ga0075431_100060234 | 3300006847 | Bacteria | 3917 |
| 84 | Ga0075431_100065749 | 3300006847 | Bacteria | 3744 |
| 85 | Ga0075431_100336844 | 3300006847 | Bacteria | 1519 |
| 86 | Ga0075431_100482424 | 3300006847 | Bacteria | 1232 |
| 87 | Ga0075433_10141954 | 3300006852 | Bacteria | 2134 |
| 88 | Ga0075433_10438702 | 3300006852 | Bacteria | 1151 |
| 89 | Ga0075434_100046669 | 3300006871 | Bacteria | 4298 |
| 90 | Ga0075429_100003826 | 3300006880 | Bacteria | 12851 |
| 91 | Ga0075429_100015277 | 3300006880 | Bacteria | 6653 |
| 92 | Ga0075429_100017988 | 3300006880 | Bacteria | 6112 |
| 93 | Ga0075429_100063077 | 3300006880 | Bacteria | 3229 |
| 94 | Ga0075429_100191001 | 3300006880 | Bacteria | 1794 |
| 95 | Ga0068865_100174213 | 3300006881 | Bacteria | 1652 |
| 96 | Ga0068865_100468966 | 3300006881 | Bacteria | 1044 |
| 97 | Ga0099826_10097682 | 3300006948 | Bacteria | 1779 |
| 98 | Ga0105240_10524579 | 3300009093 | Bacteria | 1314 |
| 99 | Ga0111539_10028862 | 3300009094 | Bacteria | 6766 |
| 100 | Ga0111539_10040555 | 3300009094 | Bacteria | 5603 |
| 101 | Ga0111539_10105080 | 3300009094 | Bacteria | 3313 |
| 102 | Ga0111539_10508740 | 3300009094 | Bacteria | 1403 |
| 103 | Ga0114129_10005316 | 3300009147 | Bacteria | 18171 |
| 104 | Ga0114129_10014842 | 3300009147 | Bacteria | 11101 |
| 105 | Ga0114129_10030852 | 3300009147 | Bacteria | 7581 |
| 106 | Ga0114129_10034885 | 3300009147 | Bacteria | 7106 |
| 107 | Ga0114129_10159229 | 3300009147 | Bacteria | 3086 |
| 108 | Ga0114129_10161999 | 3300009147 | Bacteria | 3055 |
| 109 | Ga0114129_10260197 | 3300009147 | Bacteria | 2326 |
| 110 | Ga0114129_10330218 | 3300009147 | Bacteria | 2025 |
| 111 | Ga0114129_10893678 | 3300009147 | Bacteria | 1126 |
| 112 | Ga0114129_11064087 | 3300009147 | Bacteria | 1015 |
| 113 | Ga0105241_10409082 | 3300009174 | Bacteria | 1192 |
| 114 | Ga0105242_10135188 | 3300009176 | Bacteria | 2133 |
| 115 | Ga0105238_10000079 | 3300009551 | Bacteria | 109619 |
| 116 | Ga0105028_103073 | 3300009993 | Bacteria | 1750 |
| 117 | Ga0105239_10511048 | 3300010375 | Bacteria | 1366 |
| 118 | Ga0105246_10136470 | 3300011119 | Bacteria | 1839 |
| 119 | Ga0157370_10209938 | 3300013104 | Bacteria | 1805 |
| 120 | Ga0157369_10036068 | 3300013105 | Bacteria | 5421 |
| 121 | Ga0157372_10035360 | 3300013307 | Bacteria | 5499 |
| 122 | Ga0157375_10022168 | 3300013308 | Bacteria | 5843 |
| 123 | Ga0157380_10057803 | 3300014326 | Bacteria | 3090 |
| 124 | Ga0157376_10172948 | 3300014969 | Bacteria | 1968 |
| 125 | Ga0183367_1005 | 3300015688 | Bacteria | 652063 |
| 126 | Ga0209758_1044091 | 3300025297 | Bacteria | 1635 |
| 127 | Ga0207426_1001348 | 3300025302 | Bacteria | 20858 |
| 128 | Ga0207426_1002109 | 3300025302 | Bacteria | 13660 |
| 129 | Ga0207426_1007095 | 3300025302 | Bacteria | 4738 |
| 130 | Ga0207426_1069139 | 3300025302 | Bacteria | 990 |
| 131 | Ga0207647_10005257 | 3300025904 | Bacteria | 9528 |
| 132 | Ga0207643_10111108 | 3300025908 | Bacteria | 1615 |
| 133 | Ga0207694_10086266 | 3300025924 | Bacteria | 2472 |
| 134 | Ga0207687_10100756 | 3300025927 | Bacteria | 2125 |
| 135 | Ga0207664_10088587 | 3300025929 | Bacteria | 2533 |
| 136 | Ga0207690_10074444 | 3300025932 | Bacteria | 2352 |
| 137 | Ga0207706_10125184 | 3300025933 | Bacteria | 2260 |
| 138 | Ga0207706_10419900 | 3300025933 | Bacteria | 1159 |
| 139 | Ga0207669_10140596 | 3300025937 | Bacteria | 1675 |
| 140 | Ga0207704_10155784 | 3300025938 | Bacteria | 1619 |
| 141 | Ga0207661_10131294 | 3300025944 | Bacteria | 2146 |
| 142 | Ga0207679_10209761 | 3300025945 | Bacteria | 1633 |
| 143 | Ga0207658_10553241 | 3300025986 | Bacteria | 1030 |
| 144 | Ga0207676_10519117 | 3300026095 | Bacteria | 1134 |
| 145 | Ga0207674_10129666 | 3300026116 | Bacteria | 2486 |
| 146 | Ga0209813_10000932 | 3300027866 | Bacteria | 6562 |
| 147 | Ga0207428_10000623 | 3300027907 | Bacteria | 41755 |
| 148 | Ga0207428_10071628 | 3300027907 | Bacteria | 2722 |
| 149 | Ga0207428_10094843 | 3300027907 | Bacteria | 2312 |
| 150 | Ga0207428_10168704 | 3300027907 | Bacteria | 1658 |
| 151 | Ga0207428_10195863 | 3300027907 | Bacteria | 1522 |
| 152 | Ga0307517_10004807 | 3300028786 | Bacteria | 20607 |
| 153 | Ga0307515_10000054 | 3300028794 | Bacteria | 265489 |
| 154 | Ga0307515_10211056 | 3300028794 | Bacteria | 1786 |
| 155 | Ga0307511_10000467 | 3300030521 | Bacteria | 43772 |
| 156 | Ga0307511_10016574 | 3300030521 | Bacteria | 7097 |
| 157 | Ga0307512_10005063 | 3300030522 | Bacteria | 14015 |
| 158 | Ga0307512_10171288 | 3300030522 | Bacteria | 1244 |
| 159 | Ga0265327_10031703 | 3300031251 | Bacteria | 2966 |
| 160 | Ga0307513_10053178 | 3300031456 | Bacteria | 4355 |
| 161 | Ga0307509_10008190 | 3300031507 | Bacteria | 13384 |
| 162 | Ga0307509_10016949 | 3300031507 | Bacteria | 8402 |
| 163 | Ga0307408_100032153 | 3300031548 | Bacteria | 3658 |
| 164 | Ga0307408_100385172 | 3300031548 | Bacteria | 1200 |
| 165 | Ga0307508_10001920 | 3300031616 | Bacteria | 22822 |
| 166 | Ga0307508_10239000 | 3300031616 | Bacteria | 1414 |
| 167 | Ga0307514_10014887 | 3300031649 | Bacteria | 6424 |
| 168 | Ga0307514_10074955 | 3300031649 | Bacteria | 2524 |
| 169 | Ga0307514_10103233 | 3300031649 | Bacteria | 2041 |
| 170 | Ga0307514_10257249 | 3300031649 | Bacteria | 1026 |
| 171 | Ga0316575_10014010 | 3300031665 | Bacteria | 3004 |
| 172 | Ga0316575_10069087 | 3300031665 | Bacteria | 1418 |
| 173 | Ga0316579_10006654 | 3300031691 | Bacteria | 4726 |
| 174 | Ga0316579_10077118 | 3300031691 | Bacteria | 1584 |
| 175 | Ga0316576_10031701 | 3300031727 | Bacteria | 3752 |
| 176 | Ga0316576_10040183 | 3300031727 | Bacteria | 3361 |
| 177 | Ga0316576_10093974 | 3300031727 | Bacteria | 2235 |
| 178 | Ga0316576_10153188 | 3300031727 | Bacteria | 1737 |
| 179 | Ga0316576_10245064 | 3300031727 | Bacteria | 1346 |
| 180 | Ga0316576_10332658 | 3300031727 | Bacteria | 1132 |
| 181 | Ga0316576_10365452 | 3300031727 | Bacteria | 1072 |
| 182 | Ga0316578_10087806 | 3300031728 | Bacteria | 1855 |
| 183 | Ga0316578_10120993 | 3300031728 | Bacteria | 1574 |
| 184 | Ga0307516_10001443 | 3300031730 | Bacteria | 32830 |
| 185 | Ga0307516_10058416 | 3300031730 | Bacteria | 3755 |
| 186 | Ga0307405_10226917 | 3300031731 | Bacteria | 1374 |
| 187 | Ga0307405_10340311 | 3300031731 | Bacteria | 1153 |
| 188 | Ga0316577_10039761 | 3300031733 | Bacteria | 2630 |
| 189 | Ga0316577_10127655 | 3300031733 | Bacteria | 1430 |
| 190 | Ga0316577_10277945 | 3300031733 | Bacteria | 948 |
| 191 | Ga0307413_10032135 | 3300031824 | Bacteria | 2971 |
| 192 | Ga0307413_10059286 | 3300031824 | Bacteria | 2351 |
| 193 | Ga0307413_10070917 | 3300031824 | Bacteria | 2193 |
| 194 | Ga0307413_10214426 | 3300031824 | Bacteria | 1401 |
| 195 | Ga0307518_10040266 | 3300031838 | Bacteria | 3399 |
| 196 | Ga0307518_10264678 | 3300031838 | Bacteria | 1079 |
| 197 | Ga0307410_10062248 | 3300031852 | Bacteria | 2556 |
| 198 | Ga0307410_10075295 | 3300031852 | Bacteria | 2353 |
| 199 | Ga0307410_10101674 | 3300031852 | Bacteria | 2061 |
| 200 | Ga0307410_10250866 | 3300031852 | Bacteria | 1376 |
| 201 | Ga0307410_10475793 | 3300031852 | Bacteria | 1024 |
| 202 | Ga0307406_10186254 | 3300031901 | Bacteria | 1516 |
| 203 | Ga0307407_10016157 | 3300031903 | Bacteria | 3709 |
| 204 | Ga0307407_10160409 | 3300031903 | Bacteria | 1471 |
| 205 | Ga0307407_10222811 | 3300031903 | Bacteria | 1276 |
| 206 | Ga0307412_10097967 | 3300031911 | Bacteria | 2067 |
| 207 | Ga0307412_10291415 | 3300031911 | Bacteria | 1286 |
| 208 | Ga0307409_100001075 | 3300031995 | Bacteria | 12880 |
| 209 | Ga0307409_100025790 | 3300031995 | Bacteria | 4131 |
| 210 | Ga0307409_100116265 | 3300031995 | Bacteria | 2254 |
| 211 | Ga0307409_100131453 | 3300031995 | Bacteria | 2140 |
| 212 | Ga0307409_100137726 | 3300031995 | Bacteria | 2098 |
| 213 | Ga0307409_100996104 | 3300031995 | Bacteria | 856 |
| 214 | Ga0307416_100012615 | 3300032002 | Bacteria | 5704 |
| 215 | Ga0307416_100015839 | 3300032002 | Bacteria | 5221 |
| 216 | Ga0307416_100262747 | 3300032002 | Bacteria | 1688 |
| 217 | Ga0307416_100356040 | 3300032002 | Bacteria | 1483 |
| 218 | Ga0307411_10012666 | 3300032005 | Bacteria | 4615 |
| 219 | Ga0307411_10032985 | 3300032005 | Bacteria | 3207 |
| 220 | Ga0307411_10112733 | 3300032005 | Bacteria | 1950 |
| 221 | Ga0307415_100072733 | 3300032126 | Bacteria | 2422 |
| 222 | Ga0316583_10003502 | 3300032133 | Bacteria | 5528 |
| 223 | Ga0316583_10039865 | 3300032133 | Bacteria | 1663 |
| 224 | Ga0316585_10001345 | 3300032137 | Bacteria | 6451 |
| 225 | Ga0316585_10005153 | 3300032137 | Bacteria | 3678 |
| 226 | Ga0316580_10000262 | 3300032139 | Bacteria | 11229 |
| 227 | Ga0316580_10005722 | 3300032139 | Bacteria | 3646 |
| 228 | Ga0316593_10009722 | 3300032168 | Bacteria | 2729 |
| 229 | Ga0307507_10059352 | 3300033179 | Bacteria | 3582 |
| 230 | Ga0307507_10063764 | 3300033179 | Bacteria | 3407 |
| 231 | Ga0307507_10091993 | 3300033179 | Bacteria | 2592 |
| 232 | Ga0307510_10021100 | 3300033180 | Bacteria | 7598 |
| 233 | Ga0307510_10053296 | 3300033180 | Bacteria | 4254 |
| 234 | Ga0316596_1020430 | 3300033541 | Bacteria | 1683 |
| 235 | Ga0316574_0017698 | 3300035398 | Bacteria | 4176 |
| 236 | Ga0316574_0093448 | 3300035398 | Bacteria | 1920 |
| 237 | Ga0316574_0124021 | 3300035398 | Bacteria | 1660 |
| 238 | Ga0316582_0001333 | 3300036647 | Bacteria | 10712 |
| 239 | Ga0316582_0002112 | 3300036647 | Bacteria | 9181 |
| 240 | Ga0316582_0051859 | 3300036647 | Bacteria | 2605 |
| 241 | Ga0316582_0137932 | 3300036647 | Bacteria | 1643 |
| 242 | Ga0316584_0000134 | 3300036712 | Bacteria | 32879 |
| 243 | Ga0316584_0018979 | 3300036712 | Bacteria | 4968 |
| 244 | Ga0316584_0026219 | 3300036712 | Bacteria | 4282 |
| 245 | Ga0316584_0056682 | 3300036712 | Bacteria | 2933 |
| 246 | Ga0316584_0168202 | 3300036712 | Bacteria | 1627 |
| 247 | Ga0316584_0169357 | 3300036712 | Bacteria | 1621 |
| 248 | Ga0395899_0043233 | 3300037312 | Bacteria | 3361 |
| 249 | Ga0395900_0013600 | 3300037418 | Bacteria | 8312 |
| 250 | Ga0395900_0696649 | 3300037418 | Bacteria | 950 |
| 251 | Ga0395898_0002257 | 3300037466 | Bacteria | 23382 |
| 252 | Ga0395898_0013578 | 3300037466 | Bacteria | 8382 |
| 253 | Ga0395898_0127490 | 3300037466 | Bacteria | 2438 |
| 254 | Ga0395905_0062160 | 3300037471 | Bacteria | 3493 |
| 255 | Ga0395905_0084695 | 3300037471 | Bacteria | 2970 |
| 256 | Ga0395901_0014461 | 3300038443 | Bacteria | 8028 |
| 257 | Ga0395901_0114894 | 3300038443 | Bacteria | 2827 |
| 258 | Ga0395901_0286597 | 3300038443 | Bacteria | 1710 |
| 259 | Ga0400489_04604 | 3300039093 | Bacteria | 1136 |
| 260 | Ga0400489_40306 | 3300039093 | Bacteria | 3218 |
| 261 | Ga0400489_76681 | 3300039093 | Bacteria | 86059 |
| 262 | Ga0436365_1051447 | 3300039437 | Bacteria | 9593 |
| 263 | Ga0439436_0003819 | 3300041404 | Bacteria | 4608 |
| 264 | Ga0439436_0003918 | 3300041404 | Bacteria | 4563 |
| 265 | Ga0439436_0054527 | 3300041404 | Bacteria | 1124 |
| 266 | Ga0439439_0002034 | 3300041406 | Bacteria | 4213 |
| 267 | Ga0439465_0001411 | 3300041413 | Bacteria | 7769 |
| 268 | Ga0451853_0486773 | 3300041512 | Bacteria | 3022 |
| 269 | Ga0439433_0001200 | 3300041999 | Bacteria | 5332 |
| 270 | Ga0439433_0031891 | 3300041999 | Bacteria | 1207 |
| 271 | Ga0439442_013864 | 3300042002 | Bacteria | 1656 |
| 272 | Ga0439443_011224 | 3300042003 | Bacteria | 1310 |
| 273 | Ga0439448_0002553 | 3300042005 | Bacteria | 4960 |
| 274 | Ga0439449_0007359 | 3300042007 | Bacteria | 4182 |
| 275 | Ga0439455_0000958 | 3300042012 | Bacteria | 4501 |
| 276 | Ga0439455_0040248 | 3300042012 | Bacteria | 1194 |
| 277 | Ga0439457_001962 | 3300042014 | Bacteria | 6052 |
| 278 | Ga0439457_012728 | 3300042014 | Bacteria | 1894 |
| 279 | Ga0439462_0025982 | 3300042015 | Bacteria | 1542 |
| 280 | Ga0450894_000304 | 3300042131 | Bacteria | 8801 |
| 281 | Ga0450899_003582 | 3300042135 | Bacteria | 1668 |
| 282 | Ga0450903_000066 | 3300042138 | Bacteria | 21042 |
| 283 | Ga0450906_000460 | 3300042145 | Bacteria | 8514 |
| 284 | Ga0439458_0003962 | 3300042157 | Bacteria | 3420 |
| 285 | Ga0439460_0008826 | 3300042461 | Bacteria | 2549 |
| 286 | Ga0439460_0125784 | 3300042461 | Bacteria | 842 |
| 287 | Ga0451577_0003848 | 3300042876 | Bacteria | 16302 |
| 288 | Ga0451577_0049114 | 3300042876 | Bacteria | 3768 |
| 289 | Ga0439440_0029370 | 3300042993 | Bacteria | 1289 |
| 290 | Ga0466969_0038112 | 3300044656 | Bacteria | 2420 |
| 291 | Ga0466972_0002289 | 3300044658 | Bacteria | 9410 |
| 292 | Ga0466972_0017323 | 3300044658 | Bacteria | 3606 |
| 293 | Ga0466972_0017353 | 3300044658 | Bacteria | 3604 |
| 294 | Ga0453683_0000038 | 3300044673 | Bacteria | 229847 |
| 295 | Ga0453683_0007664 | 3300044673 | Bacteria | 7310 |
| 296 | Ga0453683_0060447 | 3300044673 | Bacteria | 2369 |
| 297 | Ga0453683_0063844 | 3300044673 | Bacteria | 2302 |
| 298 | Ga0453683_0177183 | 3300044673 | Bacteria | 1351 |
| 299 | Ga0453683_0270866 | 3300044673 | Unclassified | 1084 |
| 300 | Ga0466965_0013841 | 3300044683 | Bacteria | 3811 |
| 301 | Ga0466965_0014062 | 3300044683 | Bacteria | 3785 |
| 302 | Ga0466965_0015058 | 3300044683 | Bacteria | 3670 |
| 303 | Ga0466965_0015153 | 3300044683 | Bacteria | 3660 |
| 304 | Ga0466965_0078483 | 3300044683 | Bacteria | 1668 |
| 305 | Ga0466965_0090365 | 3300044683 | Bacteria | 1557 |
| 306 | Ga0466966_0004695 | 3300044684 | Bacteria | 8988 |
| 307 | Ga0466966_0014018 | 3300044684 | Bacteria | 5306 |
| 308 | Ga0466961_0000718 | 3300044693 | Bacteria | 20868 |
| 309 | Ga0466963_0005753 | 3300044694 | Bacteria | 7289 |
| 310 | Ga0466963_0034858 | 3300044694 | Bacteria | 3276 |
| 311 | Ga0466963_0142504 | 3300044694 | Bacteria | 1661 |
| 312 | Ga0466964_0020724 | 3300044706 | Bacteria | 2534 |
| 313 | Ga0453684_0000062 | 3300044712 | Bacteria | 487590 |
| 314 | Ga0453684_0000071 | 3300044712 | Bacteria | 448904 |
| 315 | Ga0453684_0008600 | 3300044712 | Bacteria | 18209 |
| 316 | Ga0453684_0020669 | 3300044712 | Bacteria | 9906 |
| 317 | Ga0453684_0022219 | 3300044712 | Bacteria | 9427 |
| 318 | Ga0453684_0030643 | 3300044712 | Bacteria | 7591 |
| 319 | Ga0453684_0095521 | 3300044712 | Bacteria | 3653 |
| 320 | Ga0466971_0016404 | 3300044719 | Bacteria | 3268 |
| 321 | Ga0466971_0021500 | 3300044719 | Bacteria | 2871 |
| 322 | Ga0466968_0007041 | 3300044735 | Bacteria | 4263 |
| 323 | Ga0466968_0027605 | 3300044735 | Bacteria | 2337 |
| 324 | Ga0466970_0002176 | 3300044765 | Bacteria | 9466 |
| 325 | Ga0466970_0002883 | 3300044765 | Bacteria | 8325 |
| 326 | Ga0466957_0000779 | 3300044842 | Bacteria | 16304 |
| 327 | Ga0466960_0001348 | 3300044901 | Bacteria | 8933 |
| 328 | Ga0466960_0167602 | 3300044901 | Bacteria | 1183 |
| 329 | Ga0466959_0004797 | 3300045049 | Bacteria | 9125 |
| 330 | Ga0451576_0004322 | 3300045051 | Bacteria | 18559 |
| 331 | Ga0451576_0037942 | 3300045051 | Bacteria | 5101 |
| 332 | Ga0451576_0054268 | 3300045051 | Bacteria | 4197 |
| 333 | Ga0451576_0069603 | 3300045051 | Bacteria | 3662 |
| 334 | Ga0451576_0172253 | 3300045051 | Bacteria | 2259 |
| 335 | Ga0451576_0329163 | 3300045051 | Bacteria | 1599 |
| 336 | Ga0466958_0003100 | 3300045836 | Bacteria | 8534 |
| 337 | Ga0466967_0003170 | 3300045976 | Bacteria | 10607 |
| 338 | Ga0466967_0010111 | 3300045976 | Bacteria | 7053 |
| 339 | Ga0466967_0052226 | 3300045976 | Bacteria | 3587 |
| 340 | Ga0466967_0092975 | 3300045976 | Bacteria | 2743 |
| 341 | Ga0466967_0339608 | 3300045976 | Bacteria | 1452 |
| 342 | Ga0466967_0569609 | 3300045976 | Bacteria | 1116 |
| 343 | Ga0495592_0004815 | 3300046454 | Bacteria | 9924 |
| 344 | Ga0495592_0024165 | 3300046454 | Bacteria | 4619 |
| 345 | Ga0495603_0001370 | 3300046455 | Bacteria | 14157 |
| 346 | Ga0495603_0002153 | 3300046455 | Bacteria | 11585 |
| 347 | Ga0495603_0016300 | 3300046455 | Bacteria | 4496 |
| 348 | Ga0495603_0153248 | 3300046455 | Bacteria | 1338 |
| 349 | Ga0495629_0003785 | 3300046459 | Bacteria | 11394 |
| 350 | Ga0495629_0007890 | 3300046459 | Bacteria | 7831 |
| 351 | Ga0495629_0019177 | 3300046459 | Bacteria | 4889 |
| 352 | Ga0495629_0408298 | 3300046459 | Bacteria | 923 |
| 353 | Ga0495638_0003378 | 3300046460 | Bacteria | 12584 |
| 354 | Ga0495638_0008595 | 3300046460 | Bacteria | 7228 |
| 355 | Ga0495653_0260464 | 3300046463 | Bacteria | 1147 |
| 356 | Ga0495580_0151521 | 3300046472 | Bacteria | 1606 |
| 357 | Ga0495605_0121331 | 3300046474 | Bacteria | 1184 |
| 358 | Ga0495662_0003541 | 3300046476 | Bacteria | 7890 |
| 359 | Ga0495662_0005344 | 3300046476 | Bacteria | 6433 |
| 360 | Ga0495662_0009252 | 3300046476 | Bacteria | 4832 |
| 361 | Ga0495662_0042315 | 3300046476 | Bacteria | 2198 |
| 362 | Ga0495662_0043378 | 3300046476 | Bacteria | 2171 |
| 363 | Ga0495664_0233213 | 3300046477 | Bacteria | 1113 |
| 364 | Ga0495664_0303656 | 3300046477 | Bacteria | 963 |
| 365 | Ga0495585_0014221 | 3300046492 | Bacteria | 4641 |
| 366 | Ga0495594_0000491 | 3300046499 | Bacteria | 20171 |
| 367 | Ga0495608_0034251 | 3300046511 | Bacteria | 3429 |
| 368 | Ga0495620_0003260 | 3300046515 | Bacteria | 9304 |
| 369 | Ga0495628_0451536 | 3300046516 | Bacteria | 933 |
| 370 | Ga0495643_0003358 | 3300046522 | Bacteria | 11793 |
| 371 | Ga0495652_0199080 | 3300046529 | Bacteria | 1521 |
| 372 | Ga0495665_0013220 | 3300046531 | Bacteria | 4466 |
| 373 | Ga0495640_0116564 | 3300046533 | Bacteria | 1739 |
| 374 | Ga0495587_0181447 | 3300046536 | Bacteria | 1193 |
| 375 | Ga0495597_0020606 | 3300046542 | Bacteria | 3069 |
| 376 | Ga0495645_0028776 | 3300046543 | Bacteria | 4038 |
| 377 | Ga0495622_0009074 | 3300046557 | Bacteria | 4605 |
| 378 | Ga0495667_0084597 | 3300046559 | Bacteria | 2059 |
| 379 | Ga0495634_0004159 | 3300046642 | Bacteria | 11433 |
| 380 | Ga0495625_0004168 | 3300046660 | Bacteria | 13777 |
| 381 | Ga0495625_0007968 | 3300046660 | Bacteria | 9103 |
| 382 | Ga0495625_0057483 | 3300046660 | Bacteria | 2766 |
| 383 | Ga0495635_0014699 | 3300046663 | Bacteria | 5475 |
| 384 | Ga0495635_0061618 | 3300046663 | Bacteria | 2576 |
| 385 | Ga0495588_0018527 | 3300046674 | Bacteria | 3396 |
| 386 | Ga0495588_0080453 | 3300046674 | Bacteria | 1700 |
| 387 | Ga0495588_0102379 | 3300046674 | Bacteria | 1505 |
| 388 | Ga0495657_0016882 | 3300046675 | Bacteria | 5307 |
| 389 | Ga0495657_0061601 | 3300046675 | Bacteria | 2481 |
| 390 | Ga0495657_0338236 | 3300046675 | Bacteria | 892 |
| 391 | Ga0495599_0230706 | 3300046678 | Bacteria | 1130 |
| 392 | Ga0495623_0044298 | 3300046679 | Bacteria | 2828 |
| 393 | Ga0495646_0075671 | 3300046680 | Bacteria | 1973 |
| 394 | Ga0495658_0086210 | 3300046683 | Bacteria | 1852 |
| 395 | Ga0495613_0000624 | 3300046689 | Bacteria | 28151 |
| 396 | Ga0495613_0001608 | 3300046689 | Bacteria | 17165 |
| 397 | Ga0495613_0002838 | 3300046689 | Bacteria | 12995 |
| 398 | Ga0495613_0028098 | 3300046689 | Bacteria | 4185 |
| 399 | Ga0495613_0078163 | 3300046689 | Bacteria | 2407 |
| 400 | Ga0495613_0336524 | 3300046689 | Bacteria | 1039 |
| 401 | Ga0495613_0365862 | 3300046689 | Bacteria | 988 |
| 402 | Ga0495613_0539796 | 3300046689 | Bacteria | 781 |
| 403 | Ga0495624_0076715 | 3300046690 | Bacteria | 2073 |
| 404 | Ga0495671_0009078 | 3300046692 | Bacteria | 5573 |
| 405 | Ga0495649_0024122 | 3300046694 | Bacteria | 3395 |
| 406 | Ga0495589_0019195 | 3300046794 | Bacteria | 3507 |
| 407 | Ga0495589_0019573 | 3300046794 | Bacteria | 3467 |
| 408 | Ga0495589_0085636 | 3300046794 | Bacteria | 1531 |
| 409 | Ga0495600_0048123 | 3300046809 | Bacteria | 2781 |
| 410 | Ga0495600_0078277 | 3300046809 | Bacteria | 2159 |
| 411 | Ga0495581_0056126 | 3300047315 | Bacteria | 2273 |
| 412 | Ga0495581_0196954 | 3300047315 | Bacteria | 1178 |
| 413 | Ga0495604_0005238 | 3300047317 | Bacteria | 10271 |
| 414 | Ga0495604_0138755 | 3300047317 | Bacteria | 1739 |
| 415 | Ga0495636_0029027 | 3300047318 | Bacteria | 2257 |
| 416 | Ga0495636_0127017 | 3300047318 | Bacteria | 1132 |
| 417 | Ga0495674_0104228 | 3300047319 | Bacteria | 2411 |
| 418 | Ga0495674_0296054 | 3300047319 | Bacteria | 1322 |
| 419 | Ga0495672_0109170 | 3300047320 | Bacteria | 1487 |
| 420 | Ga0495672_0270826 | 3300047320 | Bacteria | 815 |
| 421 | Ga0495676_0031051 | 3300047321 | Bacteria | 4524 |
| 422 | Ga0495676_0038155 | 3300047321 | Bacteria | 3992 |
| 423 | Ga0495676_0055204 | 3300047321 | Bacteria | 3151 |
| 424 | Ga0495680_0031502 | 3300047322 | Bacteria | 4315 |
| 425 | Ga0495687_016422 | 3300047443 | Bacteria | 3722 |
| 426 | Ga0495675_0002845 | 3300047444 | Bacteria | 10375 |
| 427 | Ga0495685_002845 | 3300047447 | Bacteria | 5462 |
| 428 | Ga0495685_003637 | 3300047447 | Bacteria | 4929 |
| 429 | Ga0495681_0000474 | 3300047470 | Bacteria | 30767 |
| 430 | Ga0495681_0011681 | 3300047470 | Bacteria | 5211 |
| 431 | Ga0495684_0060253 | 3300047471 | Bacteria | 2890 |
| 432 | Ga0495593_0002842 | 3300047673 | Bacteria | 10430 |
| 433 | Ga0495593_0052582 | 3300047673 | Bacteria | 2152 |
| 434 | Ga0495602_0050641 | 3300048088 | Bacteria | 3709 |
| 435 | Ga0495614_0000061 | 3300048089 | Bacteria | 34474 |
| 436 | Ga0495614_0001224 | 3300048089 | Bacteria | 11044 |
| 437 | Ga0495614_0017495 | 3300048089 | Bacteria | 3114 |
| 438 | Ga0495614_0037703 | 3300048089 | Bacteria | 2074 |
| 439 | Ga0495614_0131834 | 3300048089 | Bacteria | 1106 |
| 440 | Ga0495614_0157986 | 3300048089 | Bacteria | 1013 |
| 441 | Ga0496102_0105804 | 3300048905 | Bacteria | 2618 |
| 442 | Ga0496104_0110872 | 3300048907 | Bacteria | 2631 |
| 443 | Ga0496108_0007785 | 3300048911 | Bacteria | 8679 |
| 444 | Ga0496108_0728248 | 3300048911 | Bacteria | 859 |
| 445 | Ga0496109_0199730 | 3300048912 | Bacteria | 1880 |
| 446 | Ga0496109_0809019 | 3300048912 | Bacteria | 875 |
| 447 | Ga0496111_0291700 | 3300048914 | Bacteria | 1210 |
| 448 | Ga0496114_0006498 | 3300048917 | Bacteria | 9210 |
| 449 | Ga0496114_0008701 | 3300048917 | Bacteria | 8042 |
| 450 | Ga0496114_0038056 | 3300048917 | Bacteria | 3980 |
| 451 | Ga0496114_0070666 | 3300048917 | Bacteria | 2933 |
| 452 | Ga0496114_0208102 | 3300048917 | Bacteria | 1715 |
| 453 | Ga0496114_0284293 | 3300048917 | Bacteria | 1459 |
| 454 | Ga0496126_0034787 | 3300048929 | Bacteria | 4727 |
| 455 | Ga0496126_0144897 | 3300048929 | Bacteria | 2041 |
| 456 | Ga0501031_0000810 | 3300049568 | Bacteria | 18799 |
| 457 | Ga0501031_0003034 | 3300049568 | Bacteria | 10734 |
| 458 | Ga0501031_0004140 | 3300049568 | Bacteria | 9368 |
| 459 | Ga0501031_0013096 | 3300049568 | Bacteria | 5410 |
| 460 | Ga0501031_0050009 | 3300049568 | Bacteria | 2724 |
| 461 | Ga0501031_0077545 | 3300049568 | Bacteria | 2164 |
| 462 | Ga0501031_0189096 | 3300049568 | Bacteria | 1345 |
| 463 | Ga0501031_0196599 | 3300049568 | Bacteria | 1316 |
| 464 | Ga0501031_0281926 | 3300049568 | Bacteria | 1078 |
| 465 | Ga0501032_0017051 | 3300049569 | Bacteria | 5102 |
| 466 | Ga0501032_0028932 | 3300049569 | Bacteria | 3805 |
| 467 | Ga0501032_0090990 | 3300049569 | Bacteria | 2025 |
| 468 | Ga0501032_0291172 | 3300049569 | Bacteria | 1056 |
| 469 | Ga0501033_0001666 | 3300049570 | Bacteria | 19436 |
| 470 | Ga0501033_0006703 | 3300049570 | Bacteria | 8996 |
| 471 | Ga0501033_0007876 | 3300049570 | Bacteria | 8255 |
| 472 | Ga0501033_0010528 | 3300049570 | Bacteria | 7092 |
| 473 | Ga0501033_0020298 | 3300049570 | Bacteria | 5019 |
| 474 | Ga0501033_0023202 | 3300049570 | Bacteria | 4680 |
| 475 | Ga0501033_0116797 | 3300049570 | Bacteria | 1938 |
| 476 | Ga0501033_0277232 | 3300049570 | Bacteria | 1184 |
| 477 | Ga0501034_0000800 | 3300049571 | Bacteria | 46777 |
| 478 | Ga0501034_0005910 | 3300049571 | Bacteria | 13280 |
| 479 | Ga0501034_0011945 | 3300049571 | Bacteria | 8975 |
| 480 | Ga0501034_0012696 | 3300049571 | Bacteria | 8692 |
| 481 | Ga0501034_0027215 | 3300049571 | Bacteria | 5816 |
| 482 | Ga0501034_0178790 | 3300049571 | Bacteria | 2087 |
| 483 | Ga0501034_0639155 | 3300049571 | Bacteria | 967 |
| 484 | Ga0501036_0000066 | 3300049572 | Bacteria | 67540 |
| 485 | Ga0501036_0000874 | 3300049572 | Bacteria | 22446 |
| 486 | Ga0501036_0001818 | 3300049572 | Bacteria | 16540 |
| 487 | Ga0501036_0007768 | 3300049572 | Bacteria | 8768 |
| 488 | Ga0501036_0015788 | 3300049572 | Bacteria | 6309 |
| 489 | Ga0501036_0020590 | 3300049572 | Bacteria | 5540 |
| 490 | Ga0501036_0056964 | 3300049572 | Bacteria | 3311 |
| 491 | Ga0501036_0143715 | 3300049572 | Bacteria | 2012 |
| 492 | Ga0501036_0146055 | 3300049572 | Bacteria | 1995 |
| 493 | Ga0501036_0253943 | 3300049572 | Bacteria | 1473 |
| 494 | Ga0501037_0007621 | 3300049573 | Bacteria | 7926 |
| 495 | Ga0501037_0019818 | 3300049573 | Bacteria | 4963 |
| 496 | Ga0501037_0043769 | 3300049573 | Bacteria | 3290 |
| 497 | Ga0501037_0053537 | 3300049573 | Bacteria | 2952 |
| 498 | Ga0501037_0203646 | 3300049573 | Bacteria | 1398 |
| 499 | Ga0501037_0264510 | 3300049573 | Bacteria | 1201 |
| 500 | Ga0501038_0000941 | 3300049574 | Bacteria | 25968 |
| 501 | Ga0501038_0003246 | 3300049574 | Bacteria | 15159 |
| 502 | Ga0501038_0013338 | 3300049574 | Bacteria | 7495 |
| 503 | Ga0501038_0031253 | 3300049574 | Bacteria | 4706 |
| 504 | Ga0501038_0090415 | 3300049574 | Bacteria | 2566 |
| 505 | Ga0501038_0121279 | 3300049574 | Bacteria | 2155 |
| 506 | Ga0501038_0127565 | 3300049574 | Bacteria | 2092 |
| 507 | Ga0501038_0148433 | 3300049574 | Bacteria | 1913 |
| 508 | Ga0501038_0269059 | 3300049574 | Bacteria | 1344 |
| 509 | Ga0501038_0381105 | 3300049574 | Bacteria | 1094 |
| 510 | Ga0501039_0000380 | 3300049575 | Bacteria | 31802 |
| 511 | Ga0501039_0000868 | 3300049575 | Bacteria | 21888 |
| 512 | Ga0501039_0015156 | 3300049575 | Bacteria | 5898 |
| 513 | Ga0501039_0020742 | 3300049575 | Bacteria | 5036 |
| 514 | Ga0501039_0046324 | 3300049575 | Bacteria | 3359 |
| 515 | Ga0501039_0067465 | 3300049575 | Bacteria | 2778 |
| 516 | Ga0501039_0069077 | 3300049575 | Bacteria | 2743 |
| 517 | Ga0501039_0098207 | 3300049575 | Bacteria | 2284 |
| 518 | Ga0501039_0107178 | 3300049575 | Bacteria | 2183 |
| 519 | Ga0501039_0207081 | 3300049575 | Bacteria | 1542 |
| 520 | Ga0501040_0000744 | 3300049576 | Bacteria | 20205 |
| 521 | Ga0501040_0001405 | 3300049576 | Bacteria | 15219 |
| 522 | Ga0501040_0004430 | 3300049576 | Bacteria | 9120 |
| 523 | Ga0501040_0009363 | 3300049576 | Bacteria | 6382 |
| 524 | Ga0501040_0012135 | 3300049576 | Bacteria | 5642 |
| 525 | Ga0501040_0051837 | 3300049576 | Bacteria | 2807 |
| 526 | Ga0501040_0058659 | 3300049576 | Bacteria | 2643 |
| 527 | Ga0501040_0065753 | 3300049576 | Bacteria | 2498 |
| 528 | Ga0501040_0075017 | 3300049576 | Bacteria | 2337 |
| 529 | Ga0501040_0107243 | 3300049576 | Bacteria | 1952 |
| 530 | Ga0501040_0113953 | 3300049576 | Bacteria | 1892 |
| 531 | Ga0501040_0240540 | 3300049576 | Bacteria | 1290 |
| 532 | Ga0501040_0244571 | 3300049576 | Bacteria | 1279 |
| 533 | Ga0501040_0494106 | 3300049576 | Bacteria | 882 |
| 534 | Ga0501041_0000702 | 3300049577 | Bacteria | 17800 |
| 535 | Ga0501041_0003349 | 3300049577 | Bacteria | 9224 |
| 536 | Ga0501041_0004869 | 3300049577 | Bacteria | 7800 |
| 537 | Ga0501041_0017958 | 3300049577 | Bacteria | 4211 |
| 538 | Ga0501041_0031434 | 3300049577 | Bacteria | 3207 |
| 539 | Ga0501041_0052301 | 3300049577 | Bacteria | 2490 |
| 540 | Ga0501041_0080194 | 3300049577 | Bacteria | 2010 |
| 541 | Ga0501041_0108654 | 3300049577 | Bacteria | 1720 |
| 542 | Ga0501041_0127204 | 3300049577 | Bacteria | 1586 |
| 543 | Ga0501041_0213240 | 3300049577 | Bacteria | 1211 |
| 544 | Ga0501041_0240645 | 3300049577 | Bacteria | 1137 |
| 545 | Ga0501042_0001054 | 3300049578 | Bacteria | 15751 |
| 546 | Ga0501042_0006923 | 3300049578 | Bacteria | 7400 |
| 547 | Ga0501042_0018759 | 3300049578 | Bacteria | 4794 |
| 548 | Ga0501042_0023219 | 3300049578 | Bacteria | 4338 |
| 549 | Ga0501042_0039259 | 3300049578 | Bacteria | 3363 |
| 550 | Ga0501042_0043676 | 3300049578 | Bacteria | 3192 |
| 551 | Ga0501042_0048387 | 3300049578 | Bacteria | 3031 |
| 552 | Ga0501042_0061312 | 3300049578 | Bacteria | 2687 |
| 553 | Ga0501042_0076672 | 3300049578 | Bacteria | 2393 |
| 554 | Ga0501042_0111666 | 3300049578 | Bacteria | 1968 |
| 555 | Ga0501042_0114896 | 3300049578 | Bacteria | 1938 |
| 556 | Ga0501042_0118268 | 3300049578 | Bacteria | 1908 |
| 557 | Ga0501042_0153477 | 3300049578 | Bacteria | 1660 |
| 558 | Ga0501042_0262412 | 3300049578 | Bacteria | 1247 |
| 559 | Ga0501042_0314275 | 3300049578 | Bacteria | 1132 |
| 560 | Ga0501043_0004985 | 3300049579 | Bacteria | 10741 |
| 561 | Ga0501043_0020784 | 3300049579 | Bacteria | 5148 |
| 562 | Ga0501043_0029861 | 3300049579 | Bacteria | 4283 |
| 563 | Ga0501043_0040430 | 3300049579 | Bacteria | 3665 |
| 564 | Ga0501043_0063211 | 3300049579 | Bacteria | 2906 |
| 565 | Ga0501043_0085250 | 3300049579 | Bacteria | 2482 |
| 566 | Ga0501043_0164967 | 3300049579 | Bacteria | 1730 |
| 567 | Ga0501046_0000595 | 3300049580 | Bacteria | 35470 |
| 568 | Ga0501046_0008429 | 3300049580 | Bacteria | 8991 |
| 569 | Ga0501046_0033574 | 3300049580 | Bacteria | 4144 |
| 570 | Ga0501046_0036536 | 3300049580 | Bacteria | 3953 |
| 571 | Ga0501046_0100312 | 3300049580 | Bacteria | 2222 |
| 572 | Ga0501046_0101645 | 3300049580 | Bacteria | 2205 |
| 573 | Ga0501046_0109738 | 3300049580 | Bacteria | 2109 |
| 574 | Ga0501046_0113400 | 3300049580 | Bacteria | 2069 |
| 575 | Ga0501046_0211990 | 3300049580 | Bacteria | 1437 |
| 576 | Ga0501046_0402752 | 3300049580 | Bacteria | 988 |
| 577 | Ga0501047_0034845 | 3300049581 | Bacteria | 4860 |
| 578 | Ga0501047_0055618 | 3300049581 | Bacteria | 3826 |
| 579 | Ga0501047_0119235 | 3300049581 | Bacteria | 2520 |
| 580 | Ga0501047_0175533 | 3300049581 | Bacteria | 2010 |
| 581 | Ga0501047_0236142 | 3300049581 | Bacteria | 1680 |
| 582 | Ga0501048_0000213 | 3300049582 | Bacteria | 37962 |
| 583 | Ga0501048_0009825 | 3300049582 | Bacteria | 7173 |
| 584 | Ga0501048_0019029 | 3300049582 | Bacteria | 5046 |
| 585 | Ga0501048_0020402 | 3300049582 | Bacteria | 4856 |
| 586 | Ga0501048_0028452 | 3300049582 | Bacteria | 4056 |
| 587 | Ga0501048_0038044 | 3300049582 | Bacteria | 3454 |
| 588 | Ga0501048_0056872 | 3300049582 | Bacteria | 2775 |
| 589 | Ga0501048_0240401 | 3300049582 | Bacteria | 1285 |
| 590 | Ga0501048_0337926 | 3300049582 | Bacteria | 1073 |
| 591 | Ga0501067_0065969 | 3300049583 | Bacteria | 2004 |
| 592 | Ga0501068_0006733 | 3300049584 | Bacteria | 6349 |
| 593 | Ga0501068_0017727 | 3300049584 | Bacteria | 4120 |
| 594 | Ga0501068_0032041 | 3300049584 | Bacteria | 3124 |
| 595 | Ga0501068_0394620 | 3300049584 | Bacteria | 892 |
| 596 | Ga0501069_0004037 | 3300049585 | Bacteria | 7576 |
| 597 | Ga0501069_0098947 | 3300049585 | Bacteria | 1655 |
| 598 | Ga0501070_0007592 | 3300049586 | Bacteria | 9211 |
| 599 | Ga0501070_0077349 | 3300049586 | Bacteria | 2754 |
| 600 | Ga0501070_0117090 | 3300049586 | Bacteria | 2201 |
| 601 | Ga0501070_0208163 | 3300049586 | Bacteria | 1606 |
| 602 | Ga0501070_0239371 | 3300049586 | Bacteria | 1486 |
| 603 | Ga0501070_0547393 | 3300049586 | Bacteria | 927 |
| 604 | Ga0501070_0568300 | 3300049586 | Bacteria | 906 |
| 605 | Ga0501071_0000625 | 3300049587 | Bacteria | 18359 |
| 606 | Ga0501071_0001040 | 3300049587 | Bacteria | 15362 |
| 607 | Ga0501071_0003533 | 3300049587 | Bacteria | 9779 |
| 608 | Ga0501071_0018103 | 3300049587 | Bacteria | 4872 |
| 609 | Ga0501071_0018692 | 3300049587 | Bacteria | 4804 |
| 610 | Ga0501071_0019426 | 3300049587 | Bacteria | 4715 |
| 611 | Ga0501071_0084960 | 3300049587 | Archaea | 2320 |
| 612 | Ga0501071_0151140 | 3300049587 | Bacteria | 1732 |
| 613 | Ga0501071_0218460 | 3300049587 | Bacteria | 1434 |
| 614 | Ga0501071_0241295 | 3300049587 | Bacteria | 1363 |
| 615 | Ga0501072_0000303 | 3300049588 | Bacteria | 34901 |
| 616 | Ga0501072_0002169 | 3300049588 | Bacteria | 14653 |
| 617 | Ga0501072_0002715 | 3300049588 | Bacteria | 13289 |
| 618 | Ga0501072_0013828 | 3300049588 | Bacteria | 6182 |
| 619 | Ga0501072_0021954 | 3300049588 | Bacteria | 4952 |
| 620 | Ga0501072_0054867 | 3300049588 | Bacteria | 3141 |
| 621 | Ga0501072_0061960 | 3300049588 | Bacteria | 2950 |
| 622 | Ga0501072_0104209 | 3300049588 | Bacteria | 2255 |
| 623 | Ga0501072_0112972 | 3300049588 | Bacteria | 2162 |
| 624 | Ga0501072_0149025 | 3300049588 | Bacteria | 1865 |
| 625 | Ga0501072_0150470 | 3300049588 | Bacteria | 1855 |
| 626 | Ga0501072_0204857 | 3300049588 | Bacteria | 1573 |
| 627 | Ga0501072_0251259 | 3300049588 | Archaea | 1408 |
| 628 | Ga0501072_0507575 | 3300049588 | Bacteria | 954 |
| 629 | Ga0501072_0572855 | 3300049588 | Bacteria | 891 |
| 630 | Ga0501072_0594781 | 3300049588 | Bacteria | 872 |
| 631 | Ga0501073_0013367 | 3300049589 | Bacteria | 5975 |
| 632 | Ga0501073_0142662 | 3300049589 | Bacteria | 1660 |
| 633 | Ga0501074_0001971 | 3300049590 | Bacteria | 14111 |
| 634 | Ga0501074_0008601 | 3300049590 | Bacteria | 7393 |
| 635 | Ga0501074_0025663 | 3300049590 | Bacteria | 4277 |
| 636 | Ga0501074_0047691 | 3300049590 | Bacteria | 3096 |
| 637 | Ga0501074_0052872 | 3300049590 | Bacteria | 2931 |
| 638 | Ga0501074_0198079 | 3300049590 | Bacteria | 1432 |
| 639 | Ga0501074_0207345 | 3300049590 | Bacteria | 1397 |
| 640 | Ga0501074_0233758 | 3300049590 | Bacteria | 1308 |
| 641 | Ga0501074_0325858 | 3300049590 | Bacteria | 1091 |
| 642 | Ga0501075_0001225 | 3300049591 | Bacteria | 16620 |
| 643 | Ga0501075_0002238 | 3300049591 | Bacteria | 12815 |
| 644 | Ga0501075_0006482 | 3300049591 | Bacteria | 8056 |
| 645 | Ga0501075_0006573 | 3300049591 | Bacteria | 8008 |
| 646 | Ga0501075_0030493 | 3300049591 | Bacteria | 3995 |
| 647 | Ga0501075_0032162 | 3300049591 | Bacteria | 3896 |
| 648 | Ga0501075_0035321 | 3300049591 | Bacteria | 3727 |
| 649 | Ga0501075_0062825 | 3300049591 | Bacteria | 2799 |
| 650 | Ga0501075_0081114 | 3300049591 | Bacteria | 2456 |
| 651 | Ga0501075_0082016 | 3300049591 | Bacteria | 2442 |
| 652 | Ga0501075_0096133 | 3300049591 | Bacteria | 2248 |
| 653 | Ga0501075_0137162 | 3300049591 | Bacteria | 1864 |
| 654 | Ga0501075_0185591 | 3300049591 | Bacteria | 1586 |
| 655 | Ga0501075_0191052 | 3300049591 | Bacteria | 1562 |
| 656 | Ga0501075_0225546 | 3300049591 | Archaea | 1429 |
| 657 | Ga0501076_0000264 | 3300049592 | Bacteria | 32410 |
| 658 | Ga0501076_0001986 | 3300049592 | Bacteria | 13978 |
| 659 | Ga0501076_0004481 | 3300049592 | Bacteria | 9946 |
| 660 | Ga0501076_0016346 | 3300049592 | Bacteria | 5627 |
| 661 | Ga0501076_0037295 | 3300049592 | Bacteria | 3811 |
| 662 | Ga0501076_0061513 | 3300049592 | Bacteria | 2988 |
| 663 | Ga0501076_0067643 | 3300049592 | Bacteria | 2853 |
| 664 | Ga0501076_0079834 | 3300049592 | Bacteria | 2625 |
| 665 | Ga0501076_0095804 | 3300049592 | Archaea | 2390 |
| 666 | Ga0501076_0096144 | 3300049592 | Bacteria | 2385 |
| 667 | Ga0501076_0150358 | 3300049592 | Bacteria | 1894 |
| 668 | Ga0501076_0333143 | 3300049592 | Bacteria | 1245 |
| 669 | Ga0501076_0443600 | 3300049592 | Bacteria | 1068 |
| 670 | Ga0501076_0470174 | 3300049592 | Bacteria | 1036 |
| 671 | Ga0501077_0000998 | 3300049593 | Bacteria | 17063 |
| 672 | Ga0501077_0005528 | 3300049593 | Bacteria | 7693 |
| 673 | Ga0501077_0006282 | 3300049593 | Bacteria | 7268 |
| 674 | Ga0501077_0014750 | 3300049593 | Bacteria | 4910 |
| 675 | Ga0501077_0025059 | 3300049593 | Bacteria | 3789 |
| 676 | Ga0501077_0127820 | 3300049593 | Bacteria | 1611 |
| 677 | Ga0501077_0140237 | 3300049593 | Bacteria | 1533 |
| 678 | Ga0501079_0000118 | 3300049741 | Bacteria | 41398 |
| 679 | Ga0501079_0006591 | 3300049741 | Bacteria | 8735 |
| 680 | Ga0501079_0008786 | 3300049741 | Bacteria | 7656 |
| 681 | Ga0501079_0029642 | 3300049741 | Bacteria | 4202 |
| 682 | Ga0501079_0036180 | 3300049741 | Bacteria | 3803 |
| 683 | Ga0501079_0038811 | 3300049741 | Bacteria | 3672 |
| 684 | Ga0501079_0041665 | 3300049741 | Archaea | 3546 |
| 685 | Ga0501079_0057150 | 3300049741 | Bacteria | 3011 |
| 686 | Ga0501079_0060717 | 3300049741 | Bacteria | 2916 |
| 687 | Ga0501079_0106247 | 3300049741 | Bacteria | 2178 |
| 688 | Ga0501079_0137967 | 3300049741 | Bacteria | 1899 |
| 689 | Ga0501079_0185655 | 3300049741 | Bacteria | 1623 |
| 690 | Ga0501079_0256685 | 3300049741 | Bacteria | 1366 |
| 691 | Ga0501079_0300690 | 3300049741 | Bacteria | 1255 |
| 692 | Ga0501079_0650688 | 3300049741 | Bacteria | 830 |
| 693 | Ga0501080_0009462 | 3300049742 | Bacteria | 8888 |
| 694 | Ga0501080_0016427 | 3300049742 | Bacteria | 6835 |
| 695 | Ga0501080_0028679 | 3300049742 | Bacteria | 5181 |
| 696 | Ga0501080_0050439 | 3300049742 | Bacteria | 3873 |
| 697 | Ga0501080_0064991 | 3300049742 | Bacteria | 3394 |
| 698 | Ga0501080_0092189 | 3300049742 | Bacteria | 2814 |
| 699 | Ga0501080_0208077 | 3300049742 | Bacteria | 1794 |
| 700 | Ga0501080_0257750 | 3300049742 | Bacteria | 1589 |
| 701 | Ga0501080_0412888 | 3300049742 | Bacteria | 1213 |
| 702 | Ga0501080_0486463 | 3300049742 | Bacteria | 1104 |
| 703 | Ga0501081_0002839 | 3300049743 | Bacteria | 10999 |
| 704 | Ga0501081_0034004 | 3300049743 | Bacteria | 3466 |
| 705 | Ga0501081_0058151 | 3300049743 | Bacteria | 2675 |
| 706 | Ga0501081_0070489 | 3300049743 | Bacteria | 2436 |
| 707 | Ga0501081_0086298 | 3300049743 | Bacteria | 2203 |
| 708 | Ga0501081_0143619 | 3300049743 | Bacteria | 1711 |
| 709 | Ga0501081_0178824 | 3300049743 | Bacteria | 1534 |
| 710 | Ga0501081_0254420 | 3300049743 | Bacteria | 1282 |
| 711 | Ga0501081_0574221 | 3300049743 | Bacteria | 843 |
| 712 | Ga0501083_0006538 | 3300049744 | Bacteria | 8268 |
| 713 | Ga0501083_0009109 | 3300049744 | Bacteria | 7011 |
| 714 | Ga0501083_0023559 | 3300049744 | Bacteria | 4268 |
| 715 | Ga0501083_0115166 | 3300049744 | Bacteria | 1765 |
| 716 | Ga0501035_0012203 | 3300049822 | Bacteria | 7944 |
| 717 | Ga0501035_0017304 | 3300049822 | Bacteria | 6646 |
| 718 | Ga0501035_0018600 | 3300049822 | Bacteria | 6399 |
| 719 | Ga0501035_0023182 | 3300049822 | Bacteria | 5694 |
| 720 | Ga0501035_0083843 | 3300049822 | Bacteria | 2812 |
| 721 | Ga0501035_0151924 | 3300049822 | Bacteria | 2009 |
| 722 | Ga0501035_0157153 | 3300049822 | Bacteria | 1970 |
| 723 | Ga0501035_0333488 | 3300049822 | Bacteria | 1272 |
| 724 | Ga0501044_0000401 | 3300049823 | Bacteria | 53413 |
| 725 | Ga0501044_0001707 | 3300049823 | Bacteria | 25760 |
| 726 | Ga0501044_0050448 | 3300049823 | Bacteria | 4293 |
| 727 | Ga0501044_0089660 | 3300049823 | Bacteria | 3104 |
| 728 | Ga0501044_0094159 | 3300049823 | Bacteria | 3020 |
| 729 | Ga0501044_0396371 | 3300049823 | Bacteria | 1293 |
| 730 | Ga0501044_0466886 | 3300049823 | Bacteria | 1167 |
| 731 | Ga0501045_0000152 | 3300049824 | Bacteria | 37014 |
| 732 | Ga0501045_0004273 | 3300049824 | Bacteria | 9849 |
| 733 | Ga0501045_0010090 | 3300049824 | Bacteria | 6607 |
| 734 | Ga0501045_0019749 | 3300049824 | Bacteria | 4808 |
| 735 | Ga0501045_0020927 | 3300049824 | Bacteria | 4676 |
| 736 | Ga0501045_0022986 | 3300049824 | Bacteria | 4467 |
| 737 | Ga0501045_0037119 | 3300049824 | Bacteria | 3541 |
| 738 | Ga0501045_0074808 | 3300049824 | Bacteria | 2494 |
| 739 | Ga0501045_0081751 | 3300049824 | Bacteria | 2382 |
| 740 | Ga0501045_0109448 | 3300049824 | Bacteria | 2048 |
| 741 | Ga0501045_0121744 | 3300049824 | Bacteria | 1937 |
| 742 | Ga0501045_0125369 | 3300049824 | Bacteria | 1908 |
| 743 | Ga0501045_0147206 | 3300049824 | Bacteria | 1752 |
| 744 | Ga0501045_0156527 | 3300049824 | Bacteria | 1695 |
| 745 | Ga0501045_0259832 | 3300049824 | Bacteria | 1292 |
| 746 | nmdc:mga00v17_2504_c1 | 3300050491 | Bacteria | 9400 |
| 747 | nmdc:mga00v17_35056_c1 | 3300050491 | Bacteria | 2984 |
| 748 | nmdc:mga0yw44_13970_c1 | 3300050492 | Bacteria | 4247 |
| 749 | nmdc:mga0yw44_5760_c1 | 3300050492 | Bacteria | 5904 |
| 750 | nmdc:mga06z11_4138_c1 | 3300050494 | Bacteria | 5673 |
| 751 | nmdc:mga04h51_633_c1 | 3300050495 | Bacteria | 8256 |
| 752 | nmdc:mga07m45_156921_c1 | 3300050496 | Bacteria | 1320 |
| 753 | nmdc:mga07m45_23930_c1 | 3300050496 | Bacteria | 3341 |
| 754 | nmdc:mga07m45_62252_c1 | 3300050496 | Bacteria | 2114 |
| 755 | nmdc:mga05p37_132535_c1 | 3300050507 | Bacteria | 3057 |
| 756 | nmdc:mga05p37_15942_c1 | 3300050507 | Bacteria | 9039 |
| 757 | nmdc:mga05p37_2907_c1 | 3300050507 | Bacteria | 19878 |
| 758 | nmdc:mga05p37_38627_c1 | 3300050507 | Bacteria | 5856 |
| 759 | nmdc:mga05p37_497252_c1 | 3300050507 | Bacteria | 1401 |
| 760 | nmdc:mga05p37_62893_c1 | 3300050507 | Bacteria | 4568 |
| 761 | nmdc:mga05p37_881488_c1 | 3300050507 | Bacteria | 968 |
| 762 | nmdc:mga09592_167807_c1 | 3300050508 | Bacteria | 1898 |
| 763 | nmdc:mga09592_205623_c1 | 3300050508 | Bacteria | 1705 |
| 764 | nmdc:mga09592_249_c1 | 3300050508 | Bacteria | 39234 |
| 765 | nmdc:mga09592_29730_c1 | 3300050508 | Bacteria | 4544 |
| 766 | nmdc:mga09592_318408_c1 | 3300050508 | Bacteria | 1348 |
| 767 | nmdc:mga0qj67_25818_c1 | 3300050509 | Bacteria | 4544 |
| 768 | nmdc:mga0qj67_423243_c1 | 3300050509 | Bacteria | 1074 |
| 769 | nmdc:mga0qj67_534872_c1 | 3300050509 | Bacteria | 941 |
| 770 | nmdc:mga0qj67_54379_c1 | 3300050509 | Bacteria | 3170 |
| 771 | nmdc:mga06r32_12415_c1 | 3300050510 | Bacteria | 7687 |
| 772 | nmdc:mga06r32_225_c4 | 3300050510 | Bacteria | 5549 |
| 773 | nmdc:mga06r32_24715_c1 | 3300050510 | Bacteria | 5581 |
| 774 | nmdc:mga06r32_256153_c1 | 3300050510 | Bacteria | 1738 |
| 775 | nmdc:mga06r32_266_c1 | 3300050510 | Bacteria | 43245 |
| 776 | nmdc:mga06r32_281000_c1 | 3300050510 | Bacteria | 1652 |
| 777 | nmdc:mga06r32_85436_c1 | 3300050510 | Bacteria | 3077 |
| 778 | nmdc:mga08y16_11013_c1 | 3300050511 | Bacteria | 9495 |
| 779 | nmdc:mga08y16_231631_c1 | 3300050511 | Bacteria | 1911 |
| 780 | nmdc:mga08y16_47858_c1 | 3300050511 | Bacteria | 4476 |
| 781 | nmdc:mga08y16_57380_c1 | 3300050511 | Bacteria | 4069 |
| 782 | nmdc:mga08y16_79044_c1 | 3300050511 | Bacteria | 3428 |
| 783 | nmdc:mga0n895_25480_c1 | 3300050512 | Bacteria | 5588 |
| 784 | nmdc:mga0a205_16948_c1 | 3300050515 | Bacteria | 6820 |
| 785 | nmdc:mga0a205_201453_c1 | 3300050515 | Bacteria | 1881 |
| 786 | nmdc:mga0sz30_21950_c1 | 3300050516 | Bacteria | 2588 |
| 787 | nmdc:mga0sz30_92882_c1 | 3300050516 | Bacteria | 1314 |
| 788 | Ga0500643_006718 | 3300053087 | Bacteria | 4756 |
| 789 | Ga0500644_0003457 | 3300053088 | Bacteria | 3909 |
| 790 | Ga0500560_017676 | 3300053107 | Bacteria | 1973 |
| 791 | Ga0500608_139889 | 3300053122 | Bacteria | 1075 |
| 792 | Ga0500652_008752 | 3300053131 | Bacteria | 3389 |
| 793 | Ga0500658_0146002 | 3300053134 | Bacteria | 1064 |
| 794 | Ga0500559_0158724 | 3300053136 | Bacteria | 1062 |
| 795 | Ga0500568_0010217 | 3300053139 | Bacteria | 4408 |
| 796 | Ga0500616_0003919 | 3300053153 | Bacteria | 10934 |
| 797 | Ga0500616_0073033 | 3300053153 | Bacteria | 1743 |
| 798 | Ga0500627_0017663 | 3300053158 | Bacteria | 2807 |
| 799 | Ga0501084_0000607 | 3300054114 | Bacteria | 27348 |
| 800 | Ga0501084_0008161 | 3300054114 | Bacteria | 8633 |
| 801 | Ga0501084_0012072 | 3300054114 | Bacteria | 7155 |
| 802 | Ga0501084_0014901 | 3300054114 | Bacteria | 6447 |
| 803 | Ga0501084_0021076 | 3300054114 | Bacteria | 5436 |
| 804 | Ga0501084_0021133 | 3300054114 | Bacteria | 5428 |
| 805 | Ga0501084_0027041 | 3300054114 | Bacteria | 4793 |
| 806 | Ga0501084_0081507 | 3300054114 | Bacteria | 2714 |
| 807 | Ga0501084_0143679 | 3300054114 | Bacteria | 2010 |
| 808 | Ga0501084_0649217 | 3300054114 | Bacteria | 891 |
| 809 | Ga0590077_002424 | 3300059426 | Bacteria | 4000 |
| 810 | Ga0501082_0000935 | 3300060353 | Bacteria | 25818 |
| 811 | Ga0501082_0029743 | 3300060353 | Bacteria | 4706 |
| 812 | Ga0501082_0034289 | 3300060353 | Bacteria | 4377 |
| 813 | Ga0501082_0036856 | 3300060353 | Bacteria | 4213 |
| 814 | Ga0501082_0039403 | 3300060353 | Bacteria | 4076 |
| 815 | Ga0501082_0068014 | 3300060353 | Bacteria | 3067 |
| 816 | Ga0501082_0079864 | 3300060353 | Bacteria | 2822 |
| 817 | Ga0501082_0138348 | 3300060353 | Bacteria | 2113 |
| 818 | Ga0501082_0158837 | 3300060353 | Bacteria | 1964 |
| 819 | Ga0501082_0176406 | 3300060353 | Bacteria | 1858 |
| 820 | Ga0501082_0177831 | 3300060353 | Bacteria | 1850 |
| 821 | Ga0501082_0232975 | 3300060353 | Bacteria | 1603 |
| 822 | Ga0501082_0391372 | 3300060353 | Bacteria | 1213 |
| 823 | Ga0501082_0430902 | 3300060353 | Bacteria | 1152 |
| 824 | Ga0466962_0029358 | 3300061719 | Bacteria | 2632 |
| 825 | Ga0466962_0086277 | 3300061719 | Bacteria | 1503 |
| 826 | Ga0530510_0000194 | 3300061734 | Bacteria | 37649 |
| 827 | Ga0530510_0000238 | 3300061734 | Bacteria | 34506 |
| 828 | Ga0530510_0005897 | 3300061734 | Bacteria | 8492 |
| 829 | Ga0530510_0007361 | 3300061734 | Bacteria | 7663 |
| 830 | Ga0530510_0012689 | 3300061734 | Bacteria | 5925 |
| 831 | Ga0530510_0014615 | 3300061734 | Bacteria | 5541 |
| 832 | Ga0530510_0025304 | 3300061734 | Bacteria | 4243 |
| 833 | Ga0530510_0037808 | 3300061734 | Bacteria | 3482 |
| 834 | Ga0530510_0046990 | 3300061734 | Bacteria | 3118 |
| 835 | Ga0530510_0062928 | 3300061734 | Bacteria | 2686 |
| 836 | Ga0530510_0115421 | 3300061734 | Bacteria | 1968 |
| 837 | Ga0530510_0134115 | 3300061734 | Bacteria | 1822 |
| 838 | Ga0530510_0199402 | 3300061734 | Bacteria | 1486 |
| 839 | 2515852908 | 2515154155 | Bacteria | 7985436 |
| 840 | 2547407995 | 2547132111 | Bacteria | 8013147 |
| 841 | 2552109224 | 2551306166 | Bacteria | 9731570 |
| 842 | 2585300126 | 2582581312 | Bacteria | 7308206 |
| 843 | 2585308654 | 2582581313 | Bacteria | 10042643 |
| 844 | 2616695301 | 2616644814 | Bacteria | 11555299 |
| 845 | 2623502007 | 2622736605 | Bacteria | 4992138 |
| 846 | 2643765688 | 2643221548 | Bacteria | 8053412 |
| 847 | 2643888294 | 2643221575 | Bacteria | 4022601 |
| 848 | 2643898519 | 2643221578 | Bacteria | 9213798 |
| 849 | 2643948258 | 2643221587 | Bacteria | 7586415 |
| 850 | 2644264094 | 2643221647 | Bacteria | 10741251 |
| 851 | 2644388780 | 2643221670 | Bacteria | 6497041 |
| 852 | 2644406435 | 2643221673 | Bacteria | 9196637 |
| 853 | 2644429731 | 2643221677 | Bacteria | 7584031 |
| 854 | 2644436981 | 2643221678 | Bacteria | 9540101 |
| 855 | 2644459800 | 2643221682 | Bacteria | 6743283 |
| 856 | 2671834166 | 2671180195 | Bacteria | 9757215 |
| 857 | 2676473210 | 2675903058 | Bacteria | 6822861 |
| 858 | 2676489927 | 2675903060 | Bacteria | 10051191 |
| 859 | 2686538362 | 2684623035 | Bacteria | 8032739 |
| 860 | 2689990065 | 2687453743 | Bacteria | 8361025 |
| 861 | 2723642281 | 2721755702 | Bacteria | 4373124 |
| 862 | 2744954526 | 2744054611 | Bacteria | 5611514 |
| 863 | 2774852322 | 2773857922 | Bacteria | 9757215 |
| 864 | 2776376671 | 2775506925 | Bacteria | 7237746 |
| 865 | 2784588448 | 2784132148 | Bacteria | 8627943 |
| 866 | 2785343522 | 2784746763 | Bacteria | 9783172 |
| 867 | 2785369277 | 2784746768 | Bacteria | 10036182 |
| 868 | 2786670415 | 2786546132 | Bacteria | 10419719 |
| 869 | 2791913641 | 2791354901 | Bacteria | 8322202 |
| 870 | 2795796103 | 2795385472 | Bacteria | 6627535 |
| 871 | 2808841879 | 2808606359 | Bacteria | 9866990 |
| 872 | 2808920414 | 2808606375 | Bacteria | 9466072 |
| 873 | 2809232044 | 2808606448 | Bacteria | 8656184 |
| 874 | 2812358378 | 2811994879 | Bacteria | 9313447 |
| 875 | 2812480729 | 2811994917 | Bacteria | 7761064 |
| 876 | 2816426012 | 2816332119 | Bacteria | 8120218 |
| 877 | 2819697932 | 2818991463 | Bacteria | 7948711 |
| 878 | 2827631808 | 2827628540 | Bacteria | 6858585 |
| 879 | 2836165142 | 2836160341 | Unclassified | 5867367 |
| 880 | 2837272279 | 2837268691 | Bacteria | 7850704 |
| 881 | 2842138372 | 2842134933 | Bacteria | 5847019 |
| 882 | 2852636875 | 2852635781 | Bacteria | 8251373 |
| 883 | 2855671264 | 2855670206 | Bacteria | 7120389 |
| 884 | 2855682530 | 2855676851 | Bacteria | 7063653 |
| 885 | 2857291959 | 2857288857 | Bacteria | 7189066 |
| 886 | 2858850747 | 2858848962 | Bacteria | 6963058 |
| 887 | 2858871998 | 2858868258 | Bacteria | 7683772 |
| 888 | 2858883879 | 2858882152 | Bacteria | 7230291 |
| 889 | 2858889967 | 2858888857 | Bacteria | 7060307 |
| 890 | 2858900819 | 2858895516 | Bacteria | 7378898 |
| 891 | 2862285479 | 2862281513 | Bacteria | 9621493 |
| 892 | 2862386354 | 2862382967 | Bacteria | 10317375 |
| 893 | 2863073499 | 2863067949 | Bacteria | 8541735 |
| 894 | 2866556311 | 2866552031 | Bacteria | 5824618 |
| 895 | 2867371719 | 2867369537 | Bacteria | 6501581 |
| 896 | 2867430402 | 2867428634 | Bacteria | 9590268 |
| 897 | 2867478221 | 2867475112 | Bacteria | 6909112 |
| 898 | 2869054566 | 2869048445 | Bacteria | 6875584 |
| 899 | 2869063731 | 2869061728 | Bacteria | 7112407 |
| 900 | 2869070953 | 2869068681 | Bacteria | 7205615 |
| 901 | 2873314402 | 2873314349 | Bacteria | 8512634 |
| 902 | 2875394400 | 2875391855 | Bacteria | 7600475 |
| 903 | 2877681274 | 2877676314 | Bacteria | 9512378 |
| 904 | 2880499049 | 2880495981 | Bacteria | 7340502 |
| 905 | 2884694757 | 2884693830 | Bacteria | 11273186 |
| 906 | 2891331771 | 2891326441 | Bacteria | 6439512 |
| 907 | 2895436382 | 2895427314 | Bacteria | 13147766 |
| 908 | 2895447189 | 2895442618 | Bacteria | 11027144 |
| 909 | 2895890329 | 2895880812 | Bacteria | 11255272 |
| 910 | 2902587213 | 2902582711 | Bacteria | 6187705 |
| 911 | 2912720263 | 2912715099 | Bacteria | 9460473 |
| 912 | 2919469677 | 2919468124 | Bacteria | 9133025 |
| 913 | 2928143596 | 2928142448 | Bacteria | 5288925 |
| 914 | 2929215005 | 2929212328 | Bacteria | 7708288 |
| 915 | 2929227635 | 2929226422 | Bacteria | 7248583 |
| 916 | 2946050209 | 2946045630 | Bacteria | 8527308 |
| 917 | 2946067500 | 2946064051 | Bacteria | 8957905 |
| 918 | 2954007678 | 2954002825 | Bacteria | 9173742 |
| 919 | 2954386417 | 2954380949 | Bacteria | 10050426 |
| 920 | 2954676761 | 2954673503 | Bacteria | 9685905 |
| 921 | 2954687405 | 2954682443 | Bacteria | 9862841 |
| 922 | 2954697094 | 2954691527 | Bacteria | 10720516 |
| 923 | 2954705042 | 2954701450 | Bacteria | 10834262 |
| 924 | 2954716400 | 2954711539 | Bacteria | 10867210 |
| 925 | 2954726344 | 2954721474 | Bacteria | 10456478 |
| 926 | 2954735466 | 2954731030 | Bacteria | 10243860 |
| 927 | 2954745267 | 2954740390 | Bacteria | 10229294 |
| 928 | 2954754321 | 2954749733 | Bacteria | 10366972 |
| 929 | 2954764243 | 2954759201 | Bacteria | 9358192 |
| 930 | 2966602717 | 2966598605 | Bacteria | 7676064 |
| 931 | 2997600978 | 2997600082 | Bacteria | 9896405 |
| 932 | 3006496231 | 3006493962 | Bacteria | 8825450 |
| 933 | 8001783635 | 8001781756 | Bacteria | 9586736 |
| 934 | 8023628863 | 8023623736 | Bacteria | 8593882 |
| 935 | 8025536583 | 8025530807 | Bacteria | 8495698 |
| 936 | 8033691251 | 8033684223 | Bacteria | 6906479 |
| 937 | 8048134632 | 8048127548 | Bacteria | 11053136 |
| 938 | 8048410221 | 8048406513 | Bacteria | 8936924 |
| 939 | 8054164095 | 8054160619 | Bacteria | 7783213 |
| 940 | 8054705053 | 8054704163 | Bacteria | 7247792 |
| 941 | 8054735962 | 8054734606 | Bacteria | 6947278 |
| 942 | 8055071169 | 8055066027 | Bacteria | 9479577 |
| 943 | 8055175970 | 8055172936 | Bacteria | 9305943 |
| 944 | 8056671919 | 8056667051 | Bacteria | 6953971 |
| 945 | Ga0395901_0094170 | |||
| 946 | JGI24739J22299_10036082 | |||
| 947 | JGI24737J22298_10006965 | |||
| 948 | rootH1_10007500 | |||
| 949 | rootH2_10041617 | |||
| 950 | rootH1_10005128 | |||
| 951 | JGI25160J50197_1022820 | |||
| 952 | JGI25160J50197_1023936 | |||
| 953 | JGI25407J50210_10000257 | |||
| 954 | Ga0006562J51391_1072226 | |||
| 955 | Ga0006562J51391_1072228 | |||
| 956 | Ga0006562J51391_1195513 | |||
| 957 | Ga0006562J51391_1195514 | |||
| 958 | Ga0006562J51391_1218549 | |||
| 959 | Ga0006562J51391_1218550 | |||
| 960 | Ga0058692_1034166 | |||
| 961 | Ga0070683_100321129 | |||
| 962 | Ga0070683_100502289 | |||
| 963 | Ga0070660_100166225 | |||
| 964 | Ga0070668_100793471 | |||
| 965 | Ga0070674_100073896 | |||
| 966 | Ga0070667_100150841 | |||
| 967 | Ga0070714_100034488 | |||
| 968 | Ga0070700_100136807 | |||
| 969 | Ga0070678_100628848 | |||
| 970 | Ga0070697_100403731 | |||
| 971 | Ga0070665_100459744 | |||
| 972 | Ga0070704_100395310 | |||
| 973 | Ga0070664_100122756 | |||
| 974 | Ga0068852_100956368 | |||
| 975 | Ga0068866_10250742 | |||
| 976 | Ga0068870_10050081 | |||
| 977 | Ga0081455_10021892 | |||
| 978 | Ga0081455_10041551 | |||
| 979 | Ga0081455_10082549 | |||
| 980 | Ga0081455_10082877 | |||
| 981 | Ga0081455_10127014 | |||
| 982 | Ga0081455_10198944 | |||
| 983 | Ga0081538_10000071 | |||
| 984 | Ga0081538_10000636 | |||
| 985 | Ga0081538_10000708 | |||
| 986 | Ga0081538_10000786 | |||
| 987 | Ga0081538_10000848 | |||
| 988 | Ga0081538_10005143 | |||
| 989 | Ga0081538_10015429 | |||
| 990 | Ga0081538_10035476 | |||
| 991 | Ga0081538_10044130 | |||
| 992 | Ga0081538_10050185 | |||
| 993 | Ga0081538_10057632 | |||
| 994 | Ga0081538_10093866 | |||
| 995 | Ga0075365_10001046 | |||
| 996 | Ga0075365_10014479 | |||
| 997 | Ga0075368_10004437 | |||
| 998 | Ga0075368_10005106 | |||
| 999 | Ga0075363_100048713 | |||
| 1000 | Ga0075363_100087411 | |||
| 1001 | Ga0075363_100340078 | |||
| 1002 | Ga0075363_100401392 | |||
| 1003 | Ga0075364_10001308 | |||
| 1004 | Ga0075364_10017255 | |||
| 1005 | Ga0075362_10034851 | |||
| 1006 | Ga0075367_10066726 | |||
| 1007 | Ga0075367_10211740 | |||
| 1008 | Ga0075369_10041418 | |||
| 1009 | Ga0075369_10051545 | |||
| 1010 | Ga0075370_10036461 | |||
| 1011 | Ga0075370_10038499 | |||
| 1012 | Ga0075370_10114138 | |||
| 1013 | Ga0075428_100005158 | |||
| 1014 | Ga0075428_100008238 | |||
| 1015 | Ga0075428_100030080 | |||
| 1016 | Ga0075428_100031174 | |||
| 1017 | Ga0075428_100275996 | |||
| 1018 | Ga0075430_100005719 | |||
| 1019 | Ga0075430_100033857 | |||
| 1020 | Ga0075430_100053015 | |||
| 1021 | Ga0075430_100068066 | |||
| 1022 | Ga0075430_100128622 | |||
| 1023 | Ga0075431_100004645 | |||
| 1024 | Ga0075431_100006078 | |||
| 1025 | Ga0075431_100026331 | |||
| 1026 | Ga0075431_100032094 | |||
| 1027 | Ga0075431_100060234 | |||
| 1028 | Ga0075431_100065749 | |||
| 1029 | Ga0075431_100336844 | |||
| 1030 | Ga0075431_100482424 | |||
| 1031 | Ga0075433_10141954 | |||
| 1032 | Ga0075433_10438702 | |||
| 1033 | Ga0075434_100046669 | |||
| 1034 | Ga0075429_100003826 | |||
| 1035 | Ga0075429_100015277 | |||
| 1036 | Ga0075429_100017988 | |||
| 1037 | Ga0075429_100063077 | |||
| 1038 | Ga0075429_100191001 | |||
| 1039 | Ga0068865_100174213 | |||
| 1040 | Ga0068865_100468966 | |||
| 1041 | Ga0099826_10097682 | |||
| 1042 | Ga0105240_10524579 | |||
| 1043 | Ga0111539_10028862 | |||
| 1044 | Ga0111539_10040555 | |||
| 1045 | Ga0111539_10105080 | |||
| 1046 | Ga0111539_10508740 | |||
| 1047 | Ga0114129_10005316 | |||
| 1048 | Ga0114129_10014842 | |||
| 1049 | Ga0114129_10030852 | |||
| 1050 | Ga0114129_10034885 | |||
| 1051 | Ga0114129_10159229 | |||
| 1052 | Ga0114129_10161999 | |||
| 1053 | Ga0114129_10260197 | |||
| 1054 | Ga0114129_10330218 | |||
| 1055 | Ga0114129_10893678 | |||
| 1056 | Ga0114129_11064087 | |||
| 1057 | Ga0105241_10409082 | |||
| 1058 | Ga0105242_10135188 | |||
| 1059 | Ga0105238_10000079 | |||
| 1060 | Ga0105028_103073 | |||
| 1061 | Ga0105239_10511048 | |||
| 1062 | Ga0105246_10136470 | |||
| 1063 | Ga0157370_10209938 | |||
| 1064 | Ga0157369_10036068 | |||
| 1065 | Ga0157372_10035360 | |||
| 1066 | Ga0157375_10022168 | |||
| 1067 | Ga0157380_10057803 | |||
| 1068 | Ga0157376_10172948 | |||
| 1069 | Ga0183367_1005 | |||
| 1070 | Ga0209758_1044091 | |||
| 1071 | Ga0207426_1001348 | |||
| 1072 | Ga0207426_1002109 | |||
| 1073 | Ga0207426_1007095 | |||
| 1074 | Ga0207426_1069139 | |||
| 1075 | Ga0207647_10005257 | |||
| 1076 | Ga0207643_10111108 | |||
| 1077 | Ga0207694_10086266 | |||
| 1078 | Ga0207687_10100756 | |||
| 1079 | Ga0207664_10088587 | |||
| 1080 | Ga0207690_10074444 | |||
| 1081 | Ga0207706_10125184 | |||
| 1082 | Ga0207706_10419900 | |||
| 1083 | Ga0207669_10140596 | |||
| 1084 | Ga0207704_10155784 | |||
| 1085 | Ga0207661_10131294 | |||
| 1086 | Ga0207679_10209761 | |||
| 1087 | Ga0207658_10553241 | |||
| 1088 | Ga0207676_10519117 | |||
| 1089 | Ga0207674_10129666 | |||
| 1090 | Ga0209813_10000932 | |||
| 1091 | Ga0207428_10000623 | |||
| 1092 | Ga0207428_10071628 | |||
| 1093 | Ga0207428_10094843 | |||
| 1094 | Ga0207428_10168704 | |||
| 1095 | Ga0207428_10195863 | |||
| 1096 | Ga0307517_10004807 | |||
| 1097 | Ga0307515_10000054 | |||
| 1098 | Ga0307515_10211056 | |||
| 1099 | Ga0307511_10000467 | |||
| 1100 | Ga0307511_10016574 | |||
| 1101 | Ga0307512_10005063 | |||
| 1102 | Ga0307512_10171288 | |||
| 1103 | Ga0265327_10031703 | |||
| 1104 | Ga0307513_10053178 | |||
| 1105 | Ga0307509_10008190 | |||
| 1106 | Ga0307509_10016949 | |||
| 1107 | Ga0307408_100032153 | |||
| 1108 | Ga0307408_100385172 | |||
| 1109 | Ga0307508_10001920 | |||
| 1110 | Ga0307508_10239000 | |||
| 1111 | Ga0307514_10014887 | |||
| 1112 | Ga0307514_10074955 | |||
| 1113 | Ga0307514_10103233 | |||
| 1114 | Ga0307514_10257249 | |||
| 1115 | Ga0316575_10014010 | |||
| 1116 | Ga0316575_10069087 | |||
| 1117 | Ga0316579_10006654 | |||
| 1118 | Ga0316579_10077118 | |||
| 1119 | Ga0316576_10031701 | |||
| 1120 | Ga0316576_10040183 | |||
| 1121 | Ga0316576_10093974 | |||
| 1122 | Ga0316576_10153188 | |||
| 1123 | Ga0316576_10245064 | |||
| 1124 | Ga0316576_10332658 | |||
| 1125 | Ga0316576_10365452 | |||
| 1126 | Ga0316578_10087806 | |||
| 1127 | Ga0316578_10120993 | |||
| 1128 | Ga0307516_10001443 | |||
| 1129 | Ga0307516_10058416 | |||
| 1130 | Ga0307405_10226917 | |||
| 1131 | Ga0307405_10340311 | |||
| 1132 | Ga0316577_10039761 | |||
| 1133 | Ga0316577_10127655 | |||
| 1134 | Ga0316577_10277945 | |||
| 1135 | Ga0307413_10032135 | |||
| 1136 | Ga0307413_10059286 | |||
| 1137 | Ga0307413_10070917 | |||
| 1138 | Ga0307413_10214426 | |||
| 1139 | Ga0307518_10040266 | |||
| 1140 | Ga0307518_10264678 | |||
| 1141 | Ga0307410_10062248 | |||
| 1142 | Ga0307410_10075295 | |||
| 1143 | Ga0307410_10101674 | |||
| 1144 | Ga0307410_10250866 | |||
| 1145 | Ga0307410_10475793 | |||
| 1146 | Ga0307406_10186254 | |||
| 1147 | Ga0307407_10016157 | |||
| 1148 | Ga0307407_10160409 | |||
| 1149 | Ga0307407_10222811 | |||
| 1150 | Ga0307412_10097967 | |||
| 1151 | Ga0307412_10291415 | |||
| 1152 | Ga0307409_100001075 | |||
| 1153 | Ga0307409_100025790 | |||
| 1154 | Ga0307409_100116265 | |||
| 1155 | Ga0307409_100131453 | |||
| 1156 | Ga0307409_100137726 | |||
| 1157 | Ga0307409_100996104 | |||
| 1158 | Ga0307416_100012615 | |||
| 1159 | Ga0307416_100015839 | |||
| 1160 | Ga0307416_100262747 | |||
| 1161 | Ga0307416_100356040 | |||
| 1162 | Ga0307411_10012666 | |||
| 1163 | Ga0307411_10032985 | |||
| 1164 | Ga0307411_10112733 | |||
| 1165 | Ga0307415_100072733 | |||
| 1166 | Ga0316583_10003502 | |||
| 1167 | Ga0316583_10039865 | |||
| 1168 | Ga0316585_10001345 | |||
| 1169 | Ga0316585_10005153 | |||
| 1170 | Ga0316580_10000262 | |||
| 1171 | Ga0316580_10005722 | |||
| 1172 | Ga0316593_10009722 | |||
| 1173 | Ga0307507_10059352 | |||
| 1174 | Ga0307507_10063764 | |||
| 1175 | Ga0307507_10091993 | |||
| 1176 | Ga0307510_10021100 | |||
| 1177 | Ga0307510_10053296 | |||
| 1178 | Ga0316596_1020430 | |||
| 1179 | Ga0316574_0017698 | |||
| 1180 | Ga0316574_0093448 | |||
| 1181 | Ga0316574_0124021 | |||
| 1182 | Ga0316582_0001333 | |||
| 1183 | Ga0316582_0002112 | |||
| 1184 | Ga0316582_0051859 | |||
| 1185 | Ga0316582_0137932 | |||
| 1186 | Ga0316584_0000134 | |||
| 1187 | Ga0316584_0018979 | |||
| 1188 | Ga0316584_0026219 | |||
| 1189 | Ga0316584_0056682 | |||
| 1190 | Ga0316584_0168202 | |||
| 1191 | Ga0316584_0169357 | |||
| 1192 | Ga0395899_0043233 | |||
| 1193 | Ga0395900_0013600 | |||
| 1194 | Ga0395900_0696649 | |||
| 1195 | Ga0395898_0002257 | |||
| 1196 | Ga0395898_0013578 | |||
| 1197 | Ga0395898_0127490 | |||
| 1198 | Ga0395905_0062160 | |||
| 1199 | Ga0395905_0084695 | |||
| 1200 | Ga0395901_0014461 | |||
| 1201 | Ga0395901_0114894 | |||
| 1202 | Ga0395901_0286597 | |||
| 1203 | Ga0400489_04604 | |||
| 1204 | Ga0400489_40306 | |||
| 1205 | Ga0400489_76681 | |||
| 1206 | Ga0436365_1051447 | |||
| 1207 | Ga0439436_0003819 | |||
| 1208 | Ga0439436_0003918 | |||
| 1209 | Ga0439436_0054527 | |||
| 1210 | Ga0439439_0002034 | |||
| 1211 | Ga0439465_0001411 | |||
| 1212 | Ga0451853_0486773 | |||
| 1213 | Ga0439433_0001200 | |||
| 1214 | Ga0439433_0031891 | |||
| 1215 | Ga0439442_013864 | |||
| 1216 | Ga0439443_011224 | |||
| 1217 | Ga0439448_0002553 | |||
| 1218 | Ga0439449_0007359 | |||
| 1219 | Ga0439455_0000958 | |||
| 1220 | Ga0439455_0040248 | |||
| 1221 | Ga0439457_001962 | |||
| 1222 | Ga0439457_012728 | |||
| 1223 | Ga0439462_0025982 | |||
| 1224 | Ga0450894_000304 | |||
| 1225 | Ga0450899_003582 | |||
| 1226 | Ga0450903_000066 | |||
| 1227 | Ga0450906_000460 | |||
| 1228 | Ga0439458_0003962 | |||
| 1229 | Ga0439460_0008826 | |||
| 1230 | Ga0439460_0125784 | |||
| 1231 | Ga0451577_0003848 | |||
| 1232 | Ga0451577_0049114 | |||
| 1233 | Ga0439440_0029370 | |||
| 1234 | Ga0466969_0038112 | |||
| 1235 | Ga0466972_0002289 | |||
| 1236 | Ga0466972_0017323 | |||
| 1237 | Ga0466972_0017353 | |||
| 1238 | Ga0453683_0000038 | |||
| 1239 | Ga0453683_0007664 | |||
| 1240 | Ga0453683_0060447 | |||
| 1241 | Ga0453683_0063844 | |||
| 1242 | Ga0453683_0177183 | |||
| 1243 | Ga0453683_0270866 | |||
| 1244 | Ga0466965_0013841 | |||
| 1245 | Ga0466965_0014062 | |||
| 1246 | Ga0466965_0015058 | |||
| 1247 | Ga0466965_0015153 | |||
| 1248 | Ga0466965_0078483 | |||
| 1249 | Ga0466965_0090365 | |||
| 1250 | Ga0466966_0004695 | |||
| 1251 | Ga0466966_0014018 | |||
| 1252 | Ga0466961_0000718 | |||
| 1253 | Ga0466963_0005753 | |||
| 1254 | Ga0466963_0034858 | |||
| 1255 | Ga0466963_0142504 | |||
| 1256 | Ga0466964_0020724 | |||
| 1257 | Ga0453684_0000062 | |||
| 1258 | Ga0453684_0000071 | |||
| 1259 | Ga0453684_0008600 | |||
| 1260 | Ga0453684_0020669 | |||
| 1261 | Ga0453684_0022219 | |||
| 1262 | Ga0453684_0030643 | |||
| 1263 | Ga0453684_0095521 | |||
| 1264 | Ga0466971_0016404 | |||
| 1265 | Ga0466971_0021500 | |||
| 1266 | Ga0466968_0007041 | |||
| 1267 | Ga0466968_0027605 | |||
| 1268 | Ga0466970_0002176 | |||
| 1269 | Ga0466970_0002883 | |||
| 1270 | Ga0466957_0000779 | |||
| 1271 | Ga0466960_0001348 | |||
| 1272 | Ga0466960_0167602 | |||
| 1273 | Ga0466959_0004797 | |||
| 1274 | Ga0451576_0004322 | |||
| 1275 | Ga0451576_0037942 | |||
| 1276 | Ga0451576_0054268 | |||
| 1277 | Ga0451576_0069603 | |||
| 1278 | Ga0451576_0172253 | |||
| 1279 | Ga0451576_0329163 | |||
| 1280 | Ga0466958_0003100 | |||
| 1281 | Ga0466967_0003170 | |||
| 1282 | Ga0466967_0010111 | |||
| 1283 | Ga0466967_0052226 | |||
| 1284 | Ga0466967_0092975 | |||
| 1285 | Ga0466967_0339608 | |||
| 1286 | Ga0466967_0569609 | |||
| 1287 | Ga0495592_0004815 | |||
| 1288 | Ga0495592_0024165 | |||
| 1289 | Ga0495603_0001370 | |||
| 1290 | Ga0495603_0002153 | |||
| 1291 | Ga0495603_0016300 | |||
| 1292 | Ga0495603_0153248 | |||
| 1293 | Ga0495629_0003785 | |||
| 1294 | Ga0495629_0007890 | |||
| 1295 | Ga0495629_0019177 | |||
| 1296 | Ga0495629_0408298 | |||
| 1297 | Ga0495638_0003378 | |||
| 1298 | Ga0495638_0008595 | |||
| 1299 | Ga0495653_0260464 | |||
| 1300 | Ga0495580_0151521 | |||
| 1301 | Ga0495605_0121331 | |||
| 1302 | Ga0495662_0003541 | |||
| 1303 | Ga0495662_0005344 | |||
| 1304 | Ga0495662_0009252 | |||
| 1305 | Ga0495662_0042315 | |||
| 1306 | Ga0495662_0043378 | |||
| 1307 | Ga0495664_0233213 | |||
| 1308 | Ga0495664_0303656 | |||
| 1309 | Ga0495585_0014221 | |||
| 1310 | Ga0495594_0000491 | |||
| 1311 | Ga0495608_0034251 | |||
| 1312 | Ga0495620_0003260 | |||
| 1313 | Ga0495628_0451536 | |||
| 1314 | Ga0495643_0003358 | |||
| 1315 | Ga0495652_0199080 | |||
| 1316 | Ga0495665_0013220 | |||
| 1317 | Ga0495640_0116564 | |||
| 1318 | Ga0495587_0181447 | |||
| 1319 | Ga0495597_0020606 | |||
| 1320 | Ga0495645_0028776 | |||
| 1321 | Ga0495622_0009074 | |||
| 1322 | Ga0495667_0084597 | |||
| 1323 | Ga0495634_0004159 | |||
| 1324 | Ga0495625_0004168 | |||
| 1325 | Ga0495625_0007968 | |||
| 1326 | Ga0495625_0057483 | |||
| 1327 | Ga0495635_0014699 | |||
| 1328 | Ga0495635_0061618 | |||
| 1329 | Ga0495588_0018527 | |||
| 1330 | Ga0495588_0080453 | |||
| 1331 | Ga0495588_0102379 | |||
| 1332 | Ga0495657_0016882 | |||
| 1333 | Ga0495657_0061601 | |||
| 1334 | Ga0495657_0338236 | |||
| 1335 | Ga0495599_0230706 | |||
| 1336 | Ga0495623_0044298 | |||
| 1337 | Ga0495646_0075671 | |||
| 1338 | Ga0495658_0086210 | |||
| 1339 | Ga0495613_0000624 | |||
| 1340 | Ga0495613_0001608 | |||
| 1341 | Ga0495613_0002838 | |||
| 1342 | Ga0495613_0028098 | |||
| 1343 | Ga0495613_0078163 | |||
| 1344 | Ga0495613_0336524 | |||
| 1345 | Ga0495613_0365862 | |||
| 1346 | Ga0495613_0539796 | |||
| 1347 | Ga0495624_0076715 | |||
| 1348 | Ga0495671_0009078 | |||
| 1349 | Ga0495649_0024122 | |||
| 1350 | Ga0495589_0019195 | |||
| 1351 | Ga0495589_0019573 | |||
| 1352 | Ga0495589_0085636 | |||
| 1353 | Ga0495600_0048123 | |||
| 1354 | Ga0495600_0078277 | |||
| 1355 | Ga0495581_0056126 | |||
| 1356 | Ga0495581_0196954 | |||
| 1357 | Ga0495604_0005238 | |||
| 1358 | Ga0495604_0138755 | |||
| 1359 | Ga0495636_0029027 | |||
| 1360 | Ga0495636_0127017 | |||
| 1361 | Ga0495674_0104228 | |||
| 1362 | Ga0495674_0296054 | |||
| 1363 | Ga0495672_0109170 | |||
| 1364 | Ga0495672_0270826 | |||
| 1365 | Ga0495676_0031051 | |||
| 1366 | Ga0495676_0038155 | |||
| 1367 | Ga0495676_0055204 | |||
| 1368 | Ga0495680_0031502 | |||
| 1369 | Ga0495687_016422 | |||
| 1370 | Ga0495675_0002845 | |||
| 1371 | Ga0495685_002845 | |||
| 1372 | Ga0495685_003637 | |||
| 1373 | Ga0495681_0000474 | |||
| 1374 | Ga0495681_0011681 | |||
| 1375 | Ga0495684_0060253 | |||
| 1376 | Ga0495593_0002842 | |||
| 1377 | Ga0495593_0052582 | |||
| 1378 | Ga0495602_0050641 | |||
| 1379 | Ga0495614_0000061 | |||
| 1380 | Ga0495614_0001224 | |||
| 1381 | Ga0495614_0017495 | |||
| 1382 | Ga0495614_0037703 | |||
| 1383 | Ga0495614_0131834 | |||
| 1384 | Ga0495614_0157986 | |||
| 1385 | Ga0496102_0105804 | |||
| 1386 | Ga0496104_0110872 | |||
| 1387 | Ga0496108_0007785 | |||
| 1388 | Ga0496108_0728248 | |||
| 1389 | Ga0496109_0199730 | |||
| 1390 | Ga0496109_0809019 | |||
| 1391 | Ga0496111_0291700 | |||
| 1392 | Ga0496114_0006498 | |||
| 1393 | Ga0496114_0008701 | |||
| 1394 | Ga0496114_0038056 | |||
| 1395 | Ga0496114_0070666 | |||
| 1396 | Ga0496114_0208102 | |||
| 1397 | Ga0496114_0284293 | |||
| 1398 | Ga0496126_0034787 | |||
| 1399 | Ga0496126_0144897 | |||
| 1400 | Ga0501031_0000810 | |||
| 1401 | Ga0501031_0003034 | |||
| 1402 | Ga0501031_0004140 | |||
| 1403 | Ga0501031_0013096 | |||
| 1404 | Ga0501031_0050009 | |||
| 1405 | Ga0501031_0077545 | |||
| 1406 | Ga0501031_0189096 | |||
| 1407 | Ga0501031_0196599 | |||
| 1408 | Ga0501031_0281926 | |||
| 1409 | Ga0501032_0017051 | |||
| 1410 | Ga0501032_0028932 | |||
| 1411 | Ga0501032_0090990 | |||
| 1412 | Ga0501032_0291172 | |||
| 1413 | Ga0501033_0001666 | |||
| 1414 | Ga0501033_0006703 | |||
| 1415 | Ga0501033_0007876 | |||
| 1416 | Ga0501033_0010528 | |||
| 1417 | Ga0501033_0020298 | |||
| 1418 | Ga0501033_0023202 | |||
| 1419 | Ga0501033_0116797 | |||
| 1420 | Ga0501033_0277232 | |||
| 1421 | Ga0501034_0000800 | |||
| 1422 | Ga0501034_0005910 | |||
| 1423 | Ga0501034_0011945 | |||
| 1424 | Ga0501034_0012696 | |||
| 1425 | Ga0501034_0027215 | |||
| 1426 | Ga0501034_0178790 | |||
| 1427 | Ga0501034_0639155 | |||
| 1428 | Ga0501036_0000066 | |||
| 1429 | Ga0501036_0000874 | |||
| 1430 | Ga0501036_0001818 | |||
| 1431 | Ga0501036_0007768 | |||
| 1432 | Ga0501036_0015788 | |||
| 1433 | Ga0501036_0020590 | |||
| 1434 | Ga0501036_0056964 | |||
| 1435 | Ga0501036_0143715 | |||
| 1436 | Ga0501036_0146055 | |||
| 1437 | Ga0501036_0253943 | |||
| 1438 | Ga0501037_0007621 | |||
| 1439 | Ga0501037_0019818 | |||
| 1440 | Ga0501037_0043769 | |||
| 1441 | Ga0501037_0053537 | |||
| 1442 | Ga0501037_0203646 | |||
| 1443 | Ga0501037_0264510 | |||
| 1444 | Ga0501038_0000941 | |||
| 1445 | Ga0501038_0003246 | |||
| 1446 | Ga0501038_0013338 | |||
| 1447 | Ga0501038_0031253 | |||
| 1448 | Ga0501038_0090415 | |||
| 1449 | Ga0501038_0121279 | |||
| 1450 | Ga0501038_0127565 | |||
| 1451 | Ga0501038_0148433 | |||
| 1452 | Ga0501038_0269059 | |||
| 1453 | Ga0501038_0381105 | |||
| 1454 | Ga0501039_0000380 | |||
| 1455 | Ga0501039_0000868 | |||
| 1456 | Ga0501039_0015156 | |||
| 1457 | Ga0501039_0020742 | |||
| 1458 | Ga0501039_0046324 | |||
| 1459 | Ga0501039_0067465 | |||
| 1460 | Ga0501039_0069077 | |||
| 1461 | Ga0501039_0098207 | |||
| 1462 | Ga0501039_0107178 | |||
| 1463 | Ga0501039_0207081 | |||
| 1464 | Ga0501040_0000744 | |||
| 1465 | Ga0501040_0001405 | |||
| 1466 | Ga0501040_0004430 | |||
| 1467 | Ga0501040_0009363 | |||
| 1468 | Ga0501040_0012135 | |||
| 1469 | Ga0501040_0051837 | |||
| 1470 | Ga0501040_0058659 | |||
| 1471 | Ga0501040_0065753 | |||
| 1472 | Ga0501040_0075017 | |||
| 1473 | Ga0501040_0107243 | |||
| 1474 | Ga0501040_0113953 | |||
| 1475 | Ga0501040_0240540 | |||
| 1476 | Ga0501040_0244571 | |||
| 1477 | Ga0501040_0494106 | |||
| 1478 | Ga0501041_0000702 | |||
| 1479 | Ga0501041_0003349 | |||
| 1480 | Ga0501041_0004869 | |||
| 1481 | Ga0501041_0017958 | |||
| 1482 | Ga0501041_0031434 | |||
| 1483 | Ga0501041_0052301 | |||
| 1484 | Ga0501041_0080194 | |||
| 1485 | Ga0501041_0108654 | |||
| 1486 | Ga0501041_0127204 | |||
| 1487 | Ga0501041_0213240 | |||
| 1488 | Ga0501041_0240645 | |||
| 1489 | Ga0501042_0001054 | |||
| 1490 | Ga0501042_0006923 | |||
| 1491 | Ga0501042_0018759 | |||
| 1492 | Ga0501042_0023219 | |||
| 1493 | Ga0501042_0039259 | |||
| 1494 | Ga0501042_0043676 | |||
| 1495 | Ga0501042_0048387 | |||
| 1496 | Ga0501042_0061312 | |||
| 1497 | Ga0501042_0076672 | |||
| 1498 | Ga0501042_0111666 | |||
| 1499 | Ga0501042_0114896 | |||
| 1500 | Ga0501042_0118268 | |||
| 1501 | Ga0501042_0153477 | |||
| 1502 | Ga0501042_0262412 | |||
| 1503 | Ga0501042_0314275 | |||
| 1504 | Ga0501043_0004985 | |||
| 1505 | Ga0501043_0020784 | |||
| 1506 | Ga0501043_0029861 | |||
| 1507 | Ga0501043_0040430 | |||
| 1508 | Ga0501043_0063211 | |||
| 1509 | Ga0501043_0085250 | |||
| 1510 | Ga0501043_0164967 | |||
| 1511 | Ga0501046_0000595 | |||
| 1512 | Ga0501046_0008429 | |||
| 1513 | Ga0501046_0033574 | |||
| 1514 | Ga0501046_0036536 | |||
| 1515 | Ga0501046_0100312 | |||
| 1516 | Ga0501046_0101645 | |||
| 1517 | Ga0501046_0109738 | |||
| 1518 | Ga0501046_0113400 | |||
| 1519 | Ga0501046_0211990 | |||
| 1520 | Ga0501046_0402752 | |||
| 1521 | Ga0501047_0034845 | |||
| 1522 | Ga0501047_0055618 | |||
| 1523 | Ga0501047_0119235 | |||
| 1524 | Ga0501047_0175533 | |||
| 1525 | Ga0501047_0236142 | |||
| 1526 | Ga0501048_0000213 | |||
| 1527 | Ga0501048_0009825 | |||
| 1528 | Ga0501048_0019029 | |||
| 1529 | Ga0501048_0020402 | |||
| 1530 | Ga0501048_0028452 | |||
| 1531 | Ga0501048_0038044 | |||
| 1532 | Ga0501048_0056872 | |||
| 1533 | Ga0501048_0240401 | |||
| 1534 | Ga0501048_0337926 | |||
| 1535 | Ga0501067_0065969 | |||
| 1536 | Ga0501068_0006733 | |||
| 1537 | Ga0501068_0017727 | |||
| 1538 | Ga0501068_0032041 | |||
| 1539 | Ga0501068_0394620 | |||
| 1540 | Ga0501069_0004037 | |||
| 1541 | Ga0501069_0098947 | |||
| 1542 | Ga0501070_0007592 | |||
| 1543 | Ga0501070_0077349 | |||
| 1544 | Ga0501070_0117090 | |||
| 1545 | Ga0501070_0208163 | |||
| 1546 | Ga0501070_0239371 | |||
| 1547 | Ga0501070_0547393 | |||
| 1548 | Ga0501070_0568300 | |||
| 1549 | Ga0501071_0000625 | |||
| 1550 | Ga0501071_0001040 | |||
| 1551 | Ga0501071_0003533 | |||
| 1552 | Ga0501071_0018103 | |||
| 1553 | Ga0501071_0018692 | |||
| 1554 | Ga0501071_0019426 | |||
| 1555 | Ga0501071_0084960 | |||
| 1556 | Ga0501071_0151140 | |||
| 1557 | Ga0501071_0218460 | |||
| 1558 | Ga0501071_0241295 | |||
| 1559 | Ga0501072_0000303 | |||
| 1560 | Ga0501072_0002169 | |||
| 1561 | Ga0501072_0002715 | |||
| 1562 | Ga0501072_0013828 | |||
| 1563 | Ga0501072_0021954 | |||
| 1564 | Ga0501072_0054867 | |||
| 1565 | Ga0501072_0061960 | |||
| 1566 | Ga0501072_0104209 | |||
| 1567 | Ga0501072_0112972 | |||
| 1568 | Ga0501072_0149025 | |||
| 1569 | Ga0501072_0150470 | |||
| 1570 | Ga0501072_0204857 | |||
| 1571 | Ga0501072_0251259 | |||
| 1572 | Ga0501072_0507575 | |||
| 1573 | Ga0501072_0572855 | |||
| 1574 | Ga0501072_0594781 | |||
| 1575 | Ga0501073_0013367 | |||
| 1576 | Ga0501073_0142662 | |||
| 1577 | Ga0501074_0001971 | |||
| 1578 | Ga0501074_0008601 | |||
| 1579 | Ga0501074_0025663 | |||
| 1580 | Ga0501074_0047691 | |||
| 1581 | Ga0501074_0052872 | |||
| 1582 | Ga0501074_0198079 | |||
| 1583 | Ga0501074_0207345 | |||
| 1584 | Ga0501074_0233758 | |||
| 1585 | Ga0501074_0325858 | |||
| 1586 | Ga0501075_0001225 | |||
| 1587 | Ga0501075_0002238 | |||
| 1588 | Ga0501075_0006482 | |||
| 1589 | Ga0501075_0006573 | |||
| 1590 | Ga0501075_0030493 | |||
| 1591 | Ga0501075_0032162 | |||
| 1592 | Ga0501075_0035321 | |||
| 1593 | Ga0501075_0062825 | |||
| 1594 | Ga0501075_0081114 | |||
| 1595 | Ga0501075_0082016 | |||
| 1596 | Ga0501075_0096133 | |||
| 1597 | Ga0501075_0137162 | |||
| 1598 | Ga0501075_0185591 | |||
| 1599 | Ga0501075_0191052 | |||
| 1600 | Ga0501075_0225546 | |||
| 1601 | Ga0501076_0000264 | |||
| 1602 | Ga0501076_0001986 | |||
| 1603 | Ga0501076_0004481 | |||
| 1604 | Ga0501076_0016346 | |||
| 1605 | Ga0501076_0037295 | |||
| 1606 | Ga0501076_0061513 | |||
| 1607 | Ga0501076_0067643 | |||
| 1608 | Ga0501076_0079834 | |||
| 1609 | Ga0501076_0095804 | |||
| 1610 | Ga0501076_0096144 | |||
| 1611 | Ga0501076_0150358 | |||
| 1612 | Ga0501076_0333143 | |||
| 1613 | Ga0501076_0443600 | |||
| 1614 | Ga0501076_0470174 | |||
| 1615 | Ga0501077_0000998 | |||
| 1616 | Ga0501077_0005528 | |||
| 1617 | Ga0501077_0006282 | |||
| 1618 | Ga0501077_0014750 | |||
| 1619 | Ga0501077_0025059 | |||
| 1620 | Ga0501077_0127820 | |||
| 1621 | Ga0501077_0140237 | |||
| 1622 | Ga0501079_0000118 | |||
| 1623 | Ga0501079_0006591 | |||
| 1624 | Ga0501079_0008786 | |||
| 1625 | Ga0501079_0029642 | |||
| 1626 | Ga0501079_0036180 | |||
| 1627 | Ga0501079_0038811 | |||
| 1628 | Ga0501079_0041665 | |||
| 1629 | Ga0501079_0057150 | |||
| 1630 | Ga0501079_0060717 | |||
| 1631 | Ga0501079_0106247 | |||
| 1632 | Ga0501079_0137967 | |||
| 1633 | Ga0501079_0185655 | |||
| 1634 | Ga0501079_0256685 | |||
| 1635 | Ga0501079_0300690 | |||
| 1636 | Ga0501079_0650688 | |||
| 1637 | Ga0501080_0009462 | |||
| 1638 | Ga0501080_0016427 | |||
| 1639 | Ga0501080_0028679 | |||
| 1640 | Ga0501080_0050439 | |||
| 1641 | Ga0501080_0064991 | |||
| 1642 | Ga0501080_0092189 | |||
| 1643 | Ga0501080_0208077 | |||
| 1644 | Ga0501080_0257750 | |||
| 1645 | Ga0501080_0412888 | |||
| 1646 | Ga0501080_0486463 | |||
| 1647 | Ga0501081_0002839 | |||
| 1648 | Ga0501081_0034004 | |||
| 1649 | Ga0501081_0058151 | |||
| 1650 | Ga0501081_0070489 | |||
| 1651 | Ga0501081_0086298 | |||
| 1652 | Ga0501081_0143619 | |||
| 1653 | Ga0501081_0178824 | |||
| 1654 | Ga0501081_0254420 | |||
| 1655 | Ga0501081_0574221 | |||
| 1656 | Ga0501083_0006538 | |||
| 1657 | Ga0501083_0009109 | |||
| 1658 | Ga0501083_0023559 | |||
| 1659 | Ga0501083_0115166 | |||
| 1660 | Ga0501035_0012203 | |||
| 1661 | Ga0501035_0017304 | |||
| 1662 | Ga0501035_0018600 | |||
| 1663 | Ga0501035_0023182 | |||
| 1664 | Ga0501035_0083843 | |||
| 1665 | Ga0501035_0151924 | |||
| 1666 | Ga0501035_0157153 | |||
| 1667 | Ga0501035_0333488 | |||
| 1668 | Ga0501044_0000401 | |||
| 1669 | Ga0501044_0001707 | |||
| 1670 | Ga0501044_0050448 | |||
| 1671 | Ga0501044_0089660 | |||
| 1672 | Ga0501044_0094159 | |||
| 1673 | Ga0501044_0396371 | |||
| 1674 | Ga0501044_0466886 | |||
| 1675 | Ga0501045_0000152 | |||
| 1676 | Ga0501045_0004273 | |||
| 1677 | Ga0501045_0010090 | |||
| 1678 | Ga0501045_0019749 | |||
| 1679 | Ga0501045_0020927 | |||
| 1680 | Ga0501045_0022986 | |||
| 1681 | Ga0501045_0037119 | |||
| 1682 | Ga0501045_0074808 | |||
| 1683 | Ga0501045_0081751 | |||
| 1684 | Ga0501045_0109448 | |||
| 1685 | Ga0501045_0121744 | |||
| 1686 | Ga0501045_0125369 | |||
| 1687 | Ga0501045_0147206 | |||
| 1688 | Ga0501045_0156527 | |||
| 1689 | Ga0501045_0259832 | |||
| 1690 | nmdc:mga00v17_2504_c1 | |||
| 1691 | nmdc:mga00v17_35056_c1 | |||
| 1692 | nmdc:mga0yw44_13970_c1 | |||
| 1693 | nmdc:mga0yw44_5760_c1 | |||
| 1694 | nmdc:mga06z11_4138_c1 | |||
| 1695 | nmdc:mga04h51_633_c1 | |||
| 1696 | nmdc:mga07m45_156921_c1 | |||
| 1697 | nmdc:mga07m45_23930_c1 | |||
| 1698 | nmdc:mga07m45_62252_c1 | |||
| 1699 | nmdc:mga05p37_132535_c1 | |||
| 1700 | nmdc:mga05p37_15942_c1 | |||
| 1701 | nmdc:mga05p37_2907_c1 | |||
| 1702 | nmdc:mga05p37_38627_c1 | |||
| 1703 | nmdc:mga05p37_497252_c1 | |||
| 1704 | nmdc:mga05p37_62893_c1 | |||
| 1705 | nmdc:mga05p37_881488_c1 | |||
| 1706 | nmdc:mga09592_167807_c1 | |||
| 1707 | nmdc:mga09592_205623_c1 | |||
| 1708 | nmdc:mga09592_249_c1 | |||
| 1709 | nmdc:mga09592_29730_c1 | |||
| 1710 | nmdc:mga09592_318408_c1 | |||
| 1711 | nmdc:mga0qj67_25818_c1 | |||
| 1712 | nmdc:mga0qj67_423243_c1 | |||
| 1713 | nmdc:mga0qj67_534872_c1 | |||
| 1714 | nmdc:mga0qj67_54379_c1 | |||
| 1715 | nmdc:mga06r32_12415_c1 | |||
| 1716 | nmdc:mga06r32_225_c4 | |||
| 1717 | nmdc:mga06r32_24715_c1 | |||
| 1718 | nmdc:mga06r32_256153_c1 | |||
| 1719 | nmdc:mga06r32_266_c1 | |||
| 1720 | nmdc:mga06r32_281000_c1 | |||
| 1721 | nmdc:mga06r32_85436_c1 | |||
| 1722 | nmdc:mga08y16_11013_c1 | |||
| 1723 | nmdc:mga08y16_231631_c1 | |||
| 1724 | nmdc:mga08y16_47858_c1 | |||
| 1725 | nmdc:mga08y16_57380_c1 | |||
| 1726 | nmdc:mga08y16_79044_c1 | |||
| 1727 | nmdc:mga0n895_25480_c1 | |||
| 1728 | nmdc:mga0a205_16948_c1 | |||
| 1729 | nmdc:mga0a205_201453_c1 | |||
| 1730 | nmdc:mga0sz30_21950_c1 | |||
| 1731 | nmdc:mga0sz30_92882_c1 | |||
| 1732 | Ga0500643_006718 | |||
| 1733 | Ga0500644_0003457 | |||
| 1734 | Ga0500560_017676 | |||
| 1735 | Ga0500608_139889 | |||
| 1736 | Ga0500652_008752 | |||
| 1737 | Ga0500658_0146002 | |||
| 1738 | Ga0500559_0158724 | |||
| 1739 | Ga0500568_0010217 | |||
| 1740 | Ga0500616_0003919 | |||
| 1741 | Ga0500616_0073033 | |||
| 1742 | Ga0500627_0017663 | |||
| 1743 | Ga0501084_0000607 | |||
| 1744 | Ga0501084_0008161 | |||
| 1745 | Ga0501084_0012072 | |||
| 1746 | Ga0501084_0014901 | |||
| 1747 | Ga0501084_0021076 | |||
| 1748 | Ga0501084_0021133 | |||
| 1749 | Ga0501084_0027041 | |||
| 1750 | Ga0501084_0081507 | |||
| 1751 | Ga0501084_0143679 | |||
| 1752 | Ga0501084_0649217 | |||
| 1753 | Ga0590077_002424 | |||
| 1754 | Ga0501082_0000935 | |||
| 1755 | Ga0501082_0029743 | |||
| 1756 | Ga0501082_0034289 | |||
| 1757 | Ga0501082_0036856 | |||
| 1758 | Ga0501082_0039403 | |||
| 1759 | Ga0501082_0068014 | |||
| 1760 | Ga0501082_0079864 | |||
| 1761 | Ga0501082_0138348 | |||
| 1762 | Ga0501082_0158837 | |||
| 1763 | Ga0501082_0176406 | |||
| 1764 | Ga0501082_0177831 | |||
| 1765 | Ga0501082_0232975 | |||
| 1766 | Ga0501082_0391372 | |||
| 1767 | Ga0501082_0430902 | |||
| 1768 | Ga0466962_0029358 | |||
| 1769 | Ga0466962_0086277 | |||
| 1770 | Ga0530510_0000194 | |||
| 1771 | Ga0530510_0000238 | |||
| 1772 | Ga0530510_0005897 | |||
| 1773 | Ga0530510_0007361 | |||
| 1774 | Ga0530510_0012689 | |||
| 1775 | Ga0530510_0014615 | |||
| 1776 | Ga0530510_0025304 | |||
| 1777 | Ga0530510_0037808 | |||
| 1778 | Ga0530510_0046990 | |||
| 1779 | Ga0530510_0062928 | |||
| 1780 | Ga0530510_0115421 | |||
| 1781 | Ga0530510_0134115 | |||
| 1782 | Ga0530510_0199402 | |||
| 1783 | 2515852908 | |||
| 1784 | 2547407995 | |||
| 1785 | 2552109224 | |||
| 1786 | 2585300126 | |||
| 1787 | 2585308654 | |||
| 1788 | 2616695301 | |||
| 1789 | 2623502007 | |||
| 1790 | 2643765688 | |||
| 1791 | 2643888294 | |||
| 1792 | 2643898519 | |||
| 1793 | 2643948258 | |||
| 1794 | 2644264094 | |||
| 1795 | 2644388780 | |||
| 1796 | 2644406435 | |||
| 1797 | 2644429731 | |||
| 1798 | 2644436981 | |||
| 1799 | 2644459800 | |||
| 1800 | 2671834166 | |||
| 1801 | 2676473210 | |||
| 1802 | 2676489927 | |||
| 1803 | 2686538362 | |||
| 1804 | 2689990065 | |||
| 1805 | 2723642281 | |||
| 1806 | 2744954526 | |||
| 1807 | 2774852322 | |||
| 1808 | 2776376671 | |||
| 1809 | 2784588448 | |||
| 1810 | 2785343522 | |||
| 1811 | 2785369277 | |||
| 1812 | 2786670415 | |||
| 1813 | 2791913641 | |||
| 1814 | 2795796103 | |||
| 1815 | 2808841879 | |||
| 1816 | 2808920414 | |||
| 1817 | 2809232044 | |||
| 1818 | 2812358378 | |||
| 1819 | 2812480729 | |||
| 1820 | 2816426012 | |||
| 1821 | 2819697932 | |||
| 1822 | 2827631808 | |||
| 1823 | 2836165142 | |||
| 1824 | 2837272279 | |||
| 1825 | 2842138372 | |||
| 1826 | 2852636875 | |||
| 1827 | 2855671264 | |||
| 1828 | 2855682530 | |||
| 1829 | 2857291959 | |||
| 1830 | 2858850747 | |||
| 1831 | 2858871998 | |||
| 1832 | 2858883879 | |||
| 1833 | 2858889967 | |||
| 1834 | 2858900819 | |||
| 1835 | 2862285479 | |||
| 1836 | 2862386354 | |||
| 1837 | 2863073499 | |||
| 1838 | 2866556311 | |||
| 1839 | 2867371719 | |||
| 1840 | 2867430402 | |||
| 1841 | 2867478221 | |||
| 1842 | 2869054566 | |||
| 1843 | 2869063731 | |||
| 1844 | 2869070953 | |||
| 1845 | 2873314402 | |||
| 1846 | 2875394400 | |||
| 1847 | 2877681274 | |||
| 1848 | 2880499049 | |||
| 1849 | 2884694757 | |||
| 1850 | 2891331771 | |||
| 1851 | 2895436382 | |||
| 1852 | 2895447189 | |||
| 1853 | 2895890329 | |||
| 1854 | 2902587213 | |||
| 1855 | 2912720263 | |||
| 1856 | 2919469677 | |||
| 1857 | 2928143596 | |||
| 1858 | 2929215005 | |||
| 1859 | 2929227635 | |||
| 1860 | 2946050209 | |||
| 1861 | 2946067500 | |||
| 1862 | 2954007678 | |||
| 1863 | 2954386417 | |||
| 1864 | 2954676761 | |||
| 1865 | 2954687405 | |||
| 1866 | 2954697094 | |||
| 1867 | 2954705042 | |||
| 1868 | 2954716400 | |||
| 1869 | 2954726344 | |||
| 1870 | 2954735466 | |||
| 1871 | 2954745267 | |||
| 1872 | 2954754321 | |||
| 1873 | 2954764243 | |||
| 1874 | 2966602717 | |||
| 1875 | 2997600978 | |||
| 1876 | 3006496231 | |||
| 1877 | 8001783635 | |||
| 1878 | 8023628863 | |||
| 1879 | 8025536583 | |||
| 1880 | 8033691251 | |||
| 1881 | 8048134632 | |||
| 1882 | 8048410221 | |||
| 1883 | 8054164095 | |||
| 1884 | 8054705053 | |||
| 1885 | 8054735962 | |||
| 1886 | 8055071169 | |||
| 1887 | 8055175970 | |||
| 1888 | 8056671919 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x41-assembly2.cif.gz_D | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9376 | 4 | 241 |
| 5x41-assembly1.cif.gz_B | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9332 | 4 | 245 |
| 7nnu-assembly1.cif.gz_A | cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs | 0.9328 | 3 | 242 |
| 5x41-assembly1.cif.gz_A | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9294 | 4 | 241 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9205 | 4 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUT2_1_260_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9451 | 1 | 241 | 3.40.50.300 |
| af_Q2FW34_4_263_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9359 | 4 | 242 | 3.40.50.300 |
| 5x41A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9294 | 4 | 241 | 3.40.50.300 |
| af_Q2FUT2_290_554_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9274 | 2 | 236 | 3.40.50.300 |
| 4huqB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9228 | 6 | 242 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D3PWB8-F1-model_v4 | Cobalt ABC transporter, ATPase subunit | 0.9872 | 6 | 244 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |
| AF-A0A4Q8CKR6-F1-model_v4 | deleted | 0.9755 | 1 | 251 |
|
| AF-A0A357ZJT9-F1-model_v4 | ABC transporter | 0.966 | 2 | 222 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |
| AF-F0T0Y4-F1-model_v4 | Phosphonate-transporting ATPase (EC 3.6.3.28) | 0.9632 | 6 | 242 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |
| AF-A0A6P2AC68-F1-model_v4 | ABC transporter ATP-binding protein | 0.9609 | 2 | 242 |
GO:0005524
GO:0016887 GO:0042626 GO:0043190 |