F486406

General Info

Members Datasets Scaffolds Average Seq Length
944 385 1888 252

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0094170|Ga0395901_0094170_2166_3029
Length 287
Sequence VGGRDVIAGRRXXXPGVVVDDAMTPAAEAGQGGAPSLQVSDLAFSYPDGHRALDGVDLEIGRGERVALLGPNGAGKTTLVLHLNGILQPERGSVTVAGLAVDKPSLREIRRRVGIVFQDPDDQLFMPTVRDDVAFGPANLGLRGRELDARVDHALTLVGMQAYAERPPNHLSYGQRRRVAVATVLAMEPEVLVLDEPSSNLDPASRRELAEILDGLDVTLLMVTHDLPYALELCPRSLVMGEGRIVADGPTADVLGDEDLMRANRLELPFGFDPRWAVRHAGGGAGR

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
107 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
108 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
127 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
134 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
135 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
136 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
137 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
267 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
281 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
282 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
283 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
284 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
285 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
286 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
287 2643221548 Streptomyces sp. Root55 Isolate Unclassified
288 2643221575 Microbacterium sp. Root61 Isolate Unclassified
289 2643221578 Streptomyces sp. Root63 Isolate Unclassified
290 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
291 2643221647 Streptomyces sp. Root369 Isolate Unclassified
292 2643221670 Streptomyces sp. Root431 Isolate Unclassified
293 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
294 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
295 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
296 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
297 2671180195 Frankia sp. CcI49 Isolate Nodule
298 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
299 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
300 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
301 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
302 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
303 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
304 2773857922 Frankia sp. CcI49 Isolate Nodule
305 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
306 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
307 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
308 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
309 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
310 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
311 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
312 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
313 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
314 2808606448 Streptomyces sp. 193411 Isolate Unclassified
315 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
316 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
317 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
318 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
319 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
320 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
321 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
322 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
323 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
324 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
325 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
326 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
327 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
328 2858868258 Micromonospora sp. MH33 Isolate Unclassified
329 2858882152 Micromonospora noduli MED15 Isolate Nodule
330 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
331 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
332 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
333 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
334 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
335 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
336 2867369537 Streptomyces sp. Z26 Isolate Unclassified
337 2867428634 Streptomyces sp. RP5T Isolate Unclassified
338 2867475112 Streptomyces sp. TM32 Isolate Unclassified
339 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
340 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
341 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
342 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
343 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
344 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
345 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
346 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
347 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
348 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
349 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
350 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
351 2902582711 Micromonospora sp. AP08 Isolate Unclassified
352 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
353 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
354 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
355 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
356 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
357 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
358 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
359 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
360 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
361 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
362 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
363 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
364 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
365 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
366 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
367 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
368 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
369 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
370 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
371 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
372 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
373 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
374 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
375 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
376 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
377 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
378 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
379 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
380 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
381 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
382 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
383 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
384 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
385 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.92
Metatranscriptomes 0.85
Isolates 11.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 1.06
Rhizoplane 1.38
Rhizosphere 82.73
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0094170 3300038443 Bacteria 3137
2 JGI24739J22299_10036082 3300001989 Bacteria 1672
3 JGI24737J22298_10006965 3300001990 Bacteria 3833
4 rootH1_10007500 3300003316 Bacteria 12200
5 rootH2_10041617 3300003320 Bacteria 2667
6 rootH1_10005128 3300003323 Bacteria 8259
7 JGI25160J50197_1022820 3300003354 Bacteria 1825
8 JGI25160J50197_1023936 3300003354 Bacteria 1745
9 JGI25407J50210_10000257 3300003373 Bacteria 9414
10 Ga0006562J51391_1072226 3300003578 Bacteria 10520
11 Ga0006562J51391_1072228 3300003578 Bacteria 6280
12 Ga0006562J51391_1195513 3300003578 Bacteria 3200
13 Ga0006562J51391_1195514 3300003578 Bacteria 3070
14 Ga0006562J51391_1218549 3300003578 Bacteria 3726
15 Ga0006562J51391_1218550 3300003578 Bacteria 3580
16 Ga0058692_1034166 3300003856 Bacteria 936
17 Ga0070683_100321129 3300005329 Bacteria 1474
18 Ga0070683_100502289 3300005329 Bacteria 1158
19 Ga0070660_100166225 3300005339 Bacteria 1780
20 Ga0070668_100793471 3300005347 Bacteria 841
21 Ga0070674_100073896 3300005356 Bacteria 2418
22 Ga0070667_100150841 3300005367 Bacteria 2042
23 Ga0070714_100034488 3300005435 Bacteria 4238
24 Ga0070700_100136807 3300005441 Bacteria 1660
25 Ga0070678_100628848 3300005456 Bacteria 961
26 Ga0070697_100403731 3300005536 Bacteria 1186
27 Ga0070665_100459744 3300005548 Bacteria 1283
28 Ga0070704_100395310 3300005549 Bacteria 1178
29 Ga0070664_100122756 3300005564 Bacteria 2275
30 Ga0068852_100956368 3300005616 Bacteria 875
31 Ga0068866_10250742 3300005718 Bacteria 1083
32 Ga0068870_10050081 3300005840 Bacteria 2206
33 Ga0081455_10021892 3300005937 Bacteria 5987
34 Ga0081455_10041551 3300005937 Bacteria 4042
35 Ga0081455_10082549 3300005937 Bacteria 2629
36 Ga0081455_10082877 3300005937 Bacteria 2622
37 Ga0081455_10127014 3300005937 Bacteria 1999
38 Ga0081455_10198944 3300005937 Bacteria 1502
39 Ga0081538_10000071 3300005981 Bacteria 96238
40 Ga0081538_10000636 3300005981 Bacteria 38924
41 Ga0081538_10000708 3300005981 Bacteria 36607
42 Ga0081538_10000786 3300005981 Bacteria 34645
43 Ga0081538_10000848 3300005981 Bacteria 33003
44 Ga0081538_10005143 3300005981 Bacteria 11857
45 Ga0081538_10015429 3300005981 Bacteria 5912
46 Ga0081538_10035476 3300005981 Bacteria 3276
47 Ga0081538_10044130 3300005981 Bacteria 2785
48 Ga0081538_10050185 3300005981 Bacteria 2522
49 Ga0081538_10057632 3300005981 Bacteria 2261
50 Ga0081538_10093866 3300005981 Bacteria 1539
51 Ga0075365_10001046 3300006038 Bacteria 11936
52 Ga0075365_10014479 3300006038 Bacteria 4747
53 Ga0075368_10004437 3300006042 Bacteria 4759
54 Ga0075368_10005106 3300006042 Bacteria 4496
55 Ga0075363_100048713 3300006048 Bacteria 2254
56 Ga0075363_100087411 3300006048 Bacteria 1712
57 Ga0075363_100340078 3300006048 Bacteria 875
58 Ga0075363_100401392 3300006048 Bacteria 806
59 Ga0075364_10001308 3300006051 Bacteria 13398
60 Ga0075364_10017255 3300006051 Bacteria 4506
61 Ga0075362_10034851 3300006177 Bacteria 2196
62 Ga0075367_10066726 3300006178 Bacteria 2156
63 Ga0075367_10211740 3300006178 Bacteria 1212
64 Ga0075369_10041418 3300006186 Bacteria 1972
65 Ga0075369_10051545 3300006186 Bacteria 1782
66 Ga0075370_10036461 3300006353 Bacteria 2762
67 Ga0075370_10038499 3300006353 Bacteria 2691
68 Ga0075370_10114138 3300006353 Bacteria 1570
69 Ga0075428_100005158 3300006844 Bacteria 14522
70 Ga0075428_100008238 3300006844 Bacteria 11557
71 Ga0075428_100030080 3300006844 Bacteria 6007
72 Ga0075428_100031174 3300006844 Bacteria 5896
73 Ga0075428_100275996 3300006844 Bacteria 1809
74 Ga0075430_100005719 3300006846 Bacteria 10488
75 Ga0075430_100033857 3300006846 Bacteria 4335
76 Ga0075430_100053015 3300006846 Bacteria 3415
77 Ga0075430_100068066 3300006846 Bacteria 2988
78 Ga0075430_100128622 3300006846 Bacteria 2111
79 Ga0075431_100004645 3300006847 Bacteria 13486
80 Ga0075431_100006078 3300006847 Bacteria 11967
81 Ga0075431_100026331 3300006847 Bacteria 5966
82 Ga0075431_100032094 3300006847 Bacteria 5412
83 Ga0075431_100060234 3300006847 Bacteria 3917
84 Ga0075431_100065749 3300006847 Bacteria 3744
85 Ga0075431_100336844 3300006847 Bacteria 1519
86 Ga0075431_100482424 3300006847 Bacteria 1232
87 Ga0075433_10141954 3300006852 Bacteria 2134
88 Ga0075433_10438702 3300006852 Bacteria 1151
89 Ga0075434_100046669 3300006871 Bacteria 4298
90 Ga0075429_100003826 3300006880 Bacteria 12851
91 Ga0075429_100015277 3300006880 Bacteria 6653
92 Ga0075429_100017988 3300006880 Bacteria 6112
93 Ga0075429_100063077 3300006880 Bacteria 3229
94 Ga0075429_100191001 3300006880 Bacteria 1794
95 Ga0068865_100174213 3300006881 Bacteria 1652
96 Ga0068865_100468966 3300006881 Bacteria 1044
97 Ga0099826_10097682 3300006948 Bacteria 1779
98 Ga0105240_10524579 3300009093 Bacteria 1314
99 Ga0111539_10028862 3300009094 Bacteria 6766
100 Ga0111539_10040555 3300009094 Bacteria 5603
101 Ga0111539_10105080 3300009094 Bacteria 3313
102 Ga0111539_10508740 3300009094 Bacteria 1403
103 Ga0114129_10005316 3300009147 Bacteria 18171
104 Ga0114129_10014842 3300009147 Bacteria 11101
105 Ga0114129_10030852 3300009147 Bacteria 7581
106 Ga0114129_10034885 3300009147 Bacteria 7106
107 Ga0114129_10159229 3300009147 Bacteria 3086
108 Ga0114129_10161999 3300009147 Bacteria 3055
109 Ga0114129_10260197 3300009147 Bacteria 2326
110 Ga0114129_10330218 3300009147 Bacteria 2025
111 Ga0114129_10893678 3300009147 Bacteria 1126
112 Ga0114129_11064087 3300009147 Bacteria 1015
113 Ga0105241_10409082 3300009174 Bacteria 1192
114 Ga0105242_10135188 3300009176 Bacteria 2133
115 Ga0105238_10000079 3300009551 Bacteria 109619
116 Ga0105028_103073 3300009993 Bacteria 1750
117 Ga0105239_10511048 3300010375 Bacteria 1366
118 Ga0105246_10136470 3300011119 Bacteria 1839
119 Ga0157370_10209938 3300013104 Bacteria 1805
120 Ga0157369_10036068 3300013105 Bacteria 5421
121 Ga0157372_10035360 3300013307 Bacteria 5499
122 Ga0157375_10022168 3300013308 Bacteria 5843
123 Ga0157380_10057803 3300014326 Bacteria 3090
124 Ga0157376_10172948 3300014969 Bacteria 1968
125 Ga0183367_1005 3300015688 Bacteria 652063
126 Ga0209758_1044091 3300025297 Bacteria 1635
127 Ga0207426_1001348 3300025302 Bacteria 20858
128 Ga0207426_1002109 3300025302 Bacteria 13660
129 Ga0207426_1007095 3300025302 Bacteria 4738
130 Ga0207426_1069139 3300025302 Bacteria 990
131 Ga0207647_10005257 3300025904 Bacteria 9528
132 Ga0207643_10111108 3300025908 Bacteria 1615
133 Ga0207694_10086266 3300025924 Bacteria 2472
134 Ga0207687_10100756 3300025927 Bacteria 2125
135 Ga0207664_10088587 3300025929 Bacteria 2533
136 Ga0207690_10074444 3300025932 Bacteria 2352
137 Ga0207706_10125184 3300025933 Bacteria 2260
138 Ga0207706_10419900 3300025933 Bacteria 1159
139 Ga0207669_10140596 3300025937 Bacteria 1675
140 Ga0207704_10155784 3300025938 Bacteria 1619
141 Ga0207661_10131294 3300025944 Bacteria 2146
142 Ga0207679_10209761 3300025945 Bacteria 1633
143 Ga0207658_10553241 3300025986 Bacteria 1030
144 Ga0207676_10519117 3300026095 Bacteria 1134
145 Ga0207674_10129666 3300026116 Bacteria 2486
146 Ga0209813_10000932 3300027866 Bacteria 6562
147 Ga0207428_10000623 3300027907 Bacteria 41755
148 Ga0207428_10071628 3300027907 Bacteria 2722
149 Ga0207428_10094843 3300027907 Bacteria 2312
150 Ga0207428_10168704 3300027907 Bacteria 1658
151 Ga0207428_10195863 3300027907 Bacteria 1522
152 Ga0307517_10004807 3300028786 Bacteria 20607
153 Ga0307515_10000054 3300028794 Bacteria 265489
154 Ga0307515_10211056 3300028794 Bacteria 1786
155 Ga0307511_10000467 3300030521 Bacteria 43772
156 Ga0307511_10016574 3300030521 Bacteria 7097
157 Ga0307512_10005063 3300030522 Bacteria 14015
158 Ga0307512_10171288 3300030522 Bacteria 1244
159 Ga0265327_10031703 3300031251 Bacteria 2966
160 Ga0307513_10053178 3300031456 Bacteria 4355
161 Ga0307509_10008190 3300031507 Bacteria 13384
162 Ga0307509_10016949 3300031507 Bacteria 8402
163 Ga0307408_100032153 3300031548 Bacteria 3658
164 Ga0307408_100385172 3300031548 Bacteria 1200
165 Ga0307508_10001920 3300031616 Bacteria 22822
166 Ga0307508_10239000 3300031616 Bacteria 1414
167 Ga0307514_10014887 3300031649 Bacteria 6424
168 Ga0307514_10074955 3300031649 Bacteria 2524
169 Ga0307514_10103233 3300031649 Bacteria 2041
170 Ga0307514_10257249 3300031649 Bacteria 1026
171 Ga0316575_10014010 3300031665 Bacteria 3004
172 Ga0316575_10069087 3300031665 Bacteria 1418
173 Ga0316579_10006654 3300031691 Bacteria 4726
174 Ga0316579_10077118 3300031691 Bacteria 1584
175 Ga0316576_10031701 3300031727 Bacteria 3752
176 Ga0316576_10040183 3300031727 Bacteria 3361
177 Ga0316576_10093974 3300031727 Bacteria 2235
178 Ga0316576_10153188 3300031727 Bacteria 1737
179 Ga0316576_10245064 3300031727 Bacteria 1346
180 Ga0316576_10332658 3300031727 Bacteria 1132
181 Ga0316576_10365452 3300031727 Bacteria 1072
182 Ga0316578_10087806 3300031728 Bacteria 1855
183 Ga0316578_10120993 3300031728 Bacteria 1574
184 Ga0307516_10001443 3300031730 Bacteria 32830
185 Ga0307516_10058416 3300031730 Bacteria 3755
186 Ga0307405_10226917 3300031731 Bacteria 1374
187 Ga0307405_10340311 3300031731 Bacteria 1153
188 Ga0316577_10039761 3300031733 Bacteria 2630
189 Ga0316577_10127655 3300031733 Bacteria 1430
190 Ga0316577_10277945 3300031733 Bacteria 948
191 Ga0307413_10032135 3300031824 Bacteria 2971
192 Ga0307413_10059286 3300031824 Bacteria 2351
193 Ga0307413_10070917 3300031824 Bacteria 2193
194 Ga0307413_10214426 3300031824 Bacteria 1401
195 Ga0307518_10040266 3300031838 Bacteria 3399
196 Ga0307518_10264678 3300031838 Bacteria 1079
197 Ga0307410_10062248 3300031852 Bacteria 2556
198 Ga0307410_10075295 3300031852 Bacteria 2353
199 Ga0307410_10101674 3300031852 Bacteria 2061
200 Ga0307410_10250866 3300031852 Bacteria 1376
201 Ga0307410_10475793 3300031852 Bacteria 1024
202 Ga0307406_10186254 3300031901 Bacteria 1516
203 Ga0307407_10016157 3300031903 Bacteria 3709
204 Ga0307407_10160409 3300031903 Bacteria 1471
205 Ga0307407_10222811 3300031903 Bacteria 1276
206 Ga0307412_10097967 3300031911 Bacteria 2067
207 Ga0307412_10291415 3300031911 Bacteria 1286
208 Ga0307409_100001075 3300031995 Bacteria 12880
209 Ga0307409_100025790 3300031995 Bacteria 4131
210 Ga0307409_100116265 3300031995 Bacteria 2254
211 Ga0307409_100131453 3300031995 Bacteria 2140
212 Ga0307409_100137726 3300031995 Bacteria 2098
213 Ga0307409_100996104 3300031995 Bacteria 856
214 Ga0307416_100012615 3300032002 Bacteria 5704
215 Ga0307416_100015839 3300032002 Bacteria 5221
216 Ga0307416_100262747 3300032002 Bacteria 1688
217 Ga0307416_100356040 3300032002 Bacteria 1483
218 Ga0307411_10012666 3300032005 Bacteria 4615
219 Ga0307411_10032985 3300032005 Bacteria 3207
220 Ga0307411_10112733 3300032005 Bacteria 1950
221 Ga0307415_100072733 3300032126 Bacteria 2422
222 Ga0316583_10003502 3300032133 Bacteria 5528
223 Ga0316583_10039865 3300032133 Bacteria 1663
224 Ga0316585_10001345 3300032137 Bacteria 6451
225 Ga0316585_10005153 3300032137 Bacteria 3678
226 Ga0316580_10000262 3300032139 Bacteria 11229
227 Ga0316580_10005722 3300032139 Bacteria 3646
228 Ga0316593_10009722 3300032168 Bacteria 2729
229 Ga0307507_10059352 3300033179 Bacteria 3582
230 Ga0307507_10063764 3300033179 Bacteria 3407
231 Ga0307507_10091993 3300033179 Bacteria 2592
232 Ga0307510_10021100 3300033180 Bacteria 7598
233 Ga0307510_10053296 3300033180 Bacteria 4254
234 Ga0316596_1020430 3300033541 Bacteria 1683
235 Ga0316574_0017698 3300035398 Bacteria 4176
236 Ga0316574_0093448 3300035398 Bacteria 1920
237 Ga0316574_0124021 3300035398 Bacteria 1660
238 Ga0316582_0001333 3300036647 Bacteria 10712
239 Ga0316582_0002112 3300036647 Bacteria 9181
240 Ga0316582_0051859 3300036647 Bacteria 2605
241 Ga0316582_0137932 3300036647 Bacteria 1643
242 Ga0316584_0000134 3300036712 Bacteria 32879
243 Ga0316584_0018979 3300036712 Bacteria 4968
244 Ga0316584_0026219 3300036712 Bacteria 4282
245 Ga0316584_0056682 3300036712 Bacteria 2933
246 Ga0316584_0168202 3300036712 Bacteria 1627
247 Ga0316584_0169357 3300036712 Bacteria 1621
248 Ga0395899_0043233 3300037312 Bacteria 3361
249 Ga0395900_0013600 3300037418 Bacteria 8312
250 Ga0395900_0696649 3300037418 Bacteria 950
251 Ga0395898_0002257 3300037466 Bacteria 23382
252 Ga0395898_0013578 3300037466 Bacteria 8382
253 Ga0395898_0127490 3300037466 Bacteria 2438
254 Ga0395905_0062160 3300037471 Bacteria 3493
255 Ga0395905_0084695 3300037471 Bacteria 2970
256 Ga0395901_0014461 3300038443 Bacteria 8028
257 Ga0395901_0114894 3300038443 Bacteria 2827
258 Ga0395901_0286597 3300038443 Bacteria 1710
259 Ga0400489_04604 3300039093 Bacteria 1136
260 Ga0400489_40306 3300039093 Bacteria 3218
261 Ga0400489_76681 3300039093 Bacteria 86059
262 Ga0436365_1051447 3300039437 Bacteria 9593
263 Ga0439436_0003819 3300041404 Bacteria 4608
264 Ga0439436_0003918 3300041404 Bacteria 4563
265 Ga0439436_0054527 3300041404 Bacteria 1124
266 Ga0439439_0002034 3300041406 Bacteria 4213
267 Ga0439465_0001411 3300041413 Bacteria 7769
268 Ga0451853_0486773 3300041512 Bacteria 3022
269 Ga0439433_0001200 3300041999 Bacteria 5332
270 Ga0439433_0031891 3300041999 Bacteria 1207
271 Ga0439442_013864 3300042002 Bacteria 1656
272 Ga0439443_011224 3300042003 Bacteria 1310
273 Ga0439448_0002553 3300042005 Bacteria 4960
274 Ga0439449_0007359 3300042007 Bacteria 4182
275 Ga0439455_0000958 3300042012 Bacteria 4501
276 Ga0439455_0040248 3300042012 Bacteria 1194
277 Ga0439457_001962 3300042014 Bacteria 6052
278 Ga0439457_012728 3300042014 Bacteria 1894
279 Ga0439462_0025982 3300042015 Bacteria 1542
280 Ga0450894_000304 3300042131 Bacteria 8801
281 Ga0450899_003582 3300042135 Bacteria 1668
282 Ga0450903_000066 3300042138 Bacteria 21042
283 Ga0450906_000460 3300042145 Bacteria 8514
284 Ga0439458_0003962 3300042157 Bacteria 3420
285 Ga0439460_0008826 3300042461 Bacteria 2549
286 Ga0439460_0125784 3300042461 Bacteria 842
287 Ga0451577_0003848 3300042876 Bacteria 16302
288 Ga0451577_0049114 3300042876 Bacteria 3768
289 Ga0439440_0029370 3300042993 Bacteria 1289
290 Ga0466969_0038112 3300044656 Bacteria 2420
291 Ga0466972_0002289 3300044658 Bacteria 9410
292 Ga0466972_0017323 3300044658 Bacteria 3606
293 Ga0466972_0017353 3300044658 Bacteria 3604
294 Ga0453683_0000038 3300044673 Bacteria 229847
295 Ga0453683_0007664 3300044673 Bacteria 7310
296 Ga0453683_0060447 3300044673 Bacteria 2369
297 Ga0453683_0063844 3300044673 Bacteria 2302
298 Ga0453683_0177183 3300044673 Bacteria 1351
299 Ga0453683_0270866 3300044673 Unclassified 1084
300 Ga0466965_0013841 3300044683 Bacteria 3811
301 Ga0466965_0014062 3300044683 Bacteria 3785
302 Ga0466965_0015058 3300044683 Bacteria 3670
303 Ga0466965_0015153 3300044683 Bacteria 3660
304 Ga0466965_0078483 3300044683 Bacteria 1668
305 Ga0466965_0090365 3300044683 Bacteria 1557
306 Ga0466966_0004695 3300044684 Bacteria 8988
307 Ga0466966_0014018 3300044684 Bacteria 5306
308 Ga0466961_0000718 3300044693 Bacteria 20868
309 Ga0466963_0005753 3300044694 Bacteria 7289
310 Ga0466963_0034858 3300044694 Bacteria 3276
311 Ga0466963_0142504 3300044694 Bacteria 1661
312 Ga0466964_0020724 3300044706 Bacteria 2534
313 Ga0453684_0000062 3300044712 Bacteria 487590
314 Ga0453684_0000071 3300044712 Bacteria 448904
315 Ga0453684_0008600 3300044712 Bacteria 18209
316 Ga0453684_0020669 3300044712 Bacteria 9906
317 Ga0453684_0022219 3300044712 Bacteria 9427
318 Ga0453684_0030643 3300044712 Bacteria 7591
319 Ga0453684_0095521 3300044712 Bacteria 3653
320 Ga0466971_0016404 3300044719 Bacteria 3268
321 Ga0466971_0021500 3300044719 Bacteria 2871
322 Ga0466968_0007041 3300044735 Bacteria 4263
323 Ga0466968_0027605 3300044735 Bacteria 2337
324 Ga0466970_0002176 3300044765 Bacteria 9466
325 Ga0466970_0002883 3300044765 Bacteria 8325
326 Ga0466957_0000779 3300044842 Bacteria 16304
327 Ga0466960_0001348 3300044901 Bacteria 8933
328 Ga0466960_0167602 3300044901 Bacteria 1183
329 Ga0466959_0004797 3300045049 Bacteria 9125
330 Ga0451576_0004322 3300045051 Bacteria 18559
331 Ga0451576_0037942 3300045051 Bacteria 5101
332 Ga0451576_0054268 3300045051 Bacteria 4197
333 Ga0451576_0069603 3300045051 Bacteria 3662
334 Ga0451576_0172253 3300045051 Bacteria 2259
335 Ga0451576_0329163 3300045051 Bacteria 1599
336 Ga0466958_0003100 3300045836 Bacteria 8534
337 Ga0466967_0003170 3300045976 Bacteria 10607
338 Ga0466967_0010111 3300045976 Bacteria 7053
339 Ga0466967_0052226 3300045976 Bacteria 3587
340 Ga0466967_0092975 3300045976 Bacteria 2743
341 Ga0466967_0339608 3300045976 Bacteria 1452
342 Ga0466967_0569609 3300045976 Bacteria 1116
343 Ga0495592_0004815 3300046454 Bacteria 9924
344 Ga0495592_0024165 3300046454 Bacteria 4619
345 Ga0495603_0001370 3300046455 Bacteria 14157
346 Ga0495603_0002153 3300046455 Bacteria 11585
347 Ga0495603_0016300 3300046455 Bacteria 4496
348 Ga0495603_0153248 3300046455 Bacteria 1338
349 Ga0495629_0003785 3300046459 Bacteria 11394
350 Ga0495629_0007890 3300046459 Bacteria 7831
351 Ga0495629_0019177 3300046459 Bacteria 4889
352 Ga0495629_0408298 3300046459 Bacteria 923
353 Ga0495638_0003378 3300046460 Bacteria 12584
354 Ga0495638_0008595 3300046460 Bacteria 7228
355 Ga0495653_0260464 3300046463 Bacteria 1147
356 Ga0495580_0151521 3300046472 Bacteria 1606
357 Ga0495605_0121331 3300046474 Bacteria 1184
358 Ga0495662_0003541 3300046476 Bacteria 7890
359 Ga0495662_0005344 3300046476 Bacteria 6433
360 Ga0495662_0009252 3300046476 Bacteria 4832
361 Ga0495662_0042315 3300046476 Bacteria 2198
362 Ga0495662_0043378 3300046476 Bacteria 2171
363 Ga0495664_0233213 3300046477 Bacteria 1113
364 Ga0495664_0303656 3300046477 Bacteria 963
365 Ga0495585_0014221 3300046492 Bacteria 4641
366 Ga0495594_0000491 3300046499 Bacteria 20171
367 Ga0495608_0034251 3300046511 Bacteria 3429
368 Ga0495620_0003260 3300046515 Bacteria 9304
369 Ga0495628_0451536 3300046516 Bacteria 933
370 Ga0495643_0003358 3300046522 Bacteria 11793
371 Ga0495652_0199080 3300046529 Bacteria 1521
372 Ga0495665_0013220 3300046531 Bacteria 4466
373 Ga0495640_0116564 3300046533 Bacteria 1739
374 Ga0495587_0181447 3300046536 Bacteria 1193
375 Ga0495597_0020606 3300046542 Bacteria 3069
376 Ga0495645_0028776 3300046543 Bacteria 4038
377 Ga0495622_0009074 3300046557 Bacteria 4605
378 Ga0495667_0084597 3300046559 Bacteria 2059
379 Ga0495634_0004159 3300046642 Bacteria 11433
380 Ga0495625_0004168 3300046660 Bacteria 13777
381 Ga0495625_0007968 3300046660 Bacteria 9103
382 Ga0495625_0057483 3300046660 Bacteria 2766
383 Ga0495635_0014699 3300046663 Bacteria 5475
384 Ga0495635_0061618 3300046663 Bacteria 2576
385 Ga0495588_0018527 3300046674 Bacteria 3396
386 Ga0495588_0080453 3300046674 Bacteria 1700
387 Ga0495588_0102379 3300046674 Bacteria 1505
388 Ga0495657_0016882 3300046675 Bacteria 5307
389 Ga0495657_0061601 3300046675 Bacteria 2481
390 Ga0495657_0338236 3300046675 Bacteria 892
391 Ga0495599_0230706 3300046678 Bacteria 1130
392 Ga0495623_0044298 3300046679 Bacteria 2828
393 Ga0495646_0075671 3300046680 Bacteria 1973
394 Ga0495658_0086210 3300046683 Bacteria 1852
395 Ga0495613_0000624 3300046689 Bacteria 28151
396 Ga0495613_0001608 3300046689 Bacteria 17165
397 Ga0495613_0002838 3300046689 Bacteria 12995
398 Ga0495613_0028098 3300046689 Bacteria 4185
399 Ga0495613_0078163 3300046689 Bacteria 2407
400 Ga0495613_0336524 3300046689 Bacteria 1039
401 Ga0495613_0365862 3300046689 Bacteria 988
402 Ga0495613_0539796 3300046689 Bacteria 781
403 Ga0495624_0076715 3300046690 Bacteria 2073
404 Ga0495671_0009078 3300046692 Bacteria 5573
405 Ga0495649_0024122 3300046694 Bacteria 3395
406 Ga0495589_0019195 3300046794 Bacteria 3507
407 Ga0495589_0019573 3300046794 Bacteria 3467
408 Ga0495589_0085636 3300046794 Bacteria 1531
409 Ga0495600_0048123 3300046809 Bacteria 2781
410 Ga0495600_0078277 3300046809 Bacteria 2159
411 Ga0495581_0056126 3300047315 Bacteria 2273
412 Ga0495581_0196954 3300047315 Bacteria 1178
413 Ga0495604_0005238 3300047317 Bacteria 10271
414 Ga0495604_0138755 3300047317 Bacteria 1739
415 Ga0495636_0029027 3300047318 Bacteria 2257
416 Ga0495636_0127017 3300047318 Bacteria 1132
417 Ga0495674_0104228 3300047319 Bacteria 2411
418 Ga0495674_0296054 3300047319 Bacteria 1322
419 Ga0495672_0109170 3300047320 Bacteria 1487
420 Ga0495672_0270826 3300047320 Bacteria 815
421 Ga0495676_0031051 3300047321 Bacteria 4524
422 Ga0495676_0038155 3300047321 Bacteria 3992
423 Ga0495676_0055204 3300047321 Bacteria 3151
424 Ga0495680_0031502 3300047322 Bacteria 4315
425 Ga0495687_016422 3300047443 Bacteria 3722
426 Ga0495675_0002845 3300047444 Bacteria 10375
427 Ga0495685_002845 3300047447 Bacteria 5462
428 Ga0495685_003637 3300047447 Bacteria 4929
429 Ga0495681_0000474 3300047470 Bacteria 30767
430 Ga0495681_0011681 3300047470 Bacteria 5211
431 Ga0495684_0060253 3300047471 Bacteria 2890
432 Ga0495593_0002842 3300047673 Bacteria 10430
433 Ga0495593_0052582 3300047673 Bacteria 2152
434 Ga0495602_0050641 3300048088 Bacteria 3709
435 Ga0495614_0000061 3300048089 Bacteria 34474
436 Ga0495614_0001224 3300048089 Bacteria 11044
437 Ga0495614_0017495 3300048089 Bacteria 3114
438 Ga0495614_0037703 3300048089 Bacteria 2074
439 Ga0495614_0131834 3300048089 Bacteria 1106
440 Ga0495614_0157986 3300048089 Bacteria 1013
441 Ga0496102_0105804 3300048905 Bacteria 2618
442 Ga0496104_0110872 3300048907 Bacteria 2631
443 Ga0496108_0007785 3300048911 Bacteria 8679
444 Ga0496108_0728248 3300048911 Bacteria 859
445 Ga0496109_0199730 3300048912 Bacteria 1880
446 Ga0496109_0809019 3300048912 Bacteria 875
447 Ga0496111_0291700 3300048914 Bacteria 1210
448 Ga0496114_0006498 3300048917 Bacteria 9210
449 Ga0496114_0008701 3300048917 Bacteria 8042
450 Ga0496114_0038056 3300048917 Bacteria 3980
451 Ga0496114_0070666 3300048917 Bacteria 2933
452 Ga0496114_0208102 3300048917 Bacteria 1715
453 Ga0496114_0284293 3300048917 Bacteria 1459
454 Ga0496126_0034787 3300048929 Bacteria 4727
455 Ga0496126_0144897 3300048929 Bacteria 2041
456 Ga0501031_0000810 3300049568 Bacteria 18799
457 Ga0501031_0003034 3300049568 Bacteria 10734
458 Ga0501031_0004140 3300049568 Bacteria 9368
459 Ga0501031_0013096 3300049568 Bacteria 5410
460 Ga0501031_0050009 3300049568 Bacteria 2724
461 Ga0501031_0077545 3300049568 Bacteria 2164
462 Ga0501031_0189096 3300049568 Bacteria 1345
463 Ga0501031_0196599 3300049568 Bacteria 1316
464 Ga0501031_0281926 3300049568 Bacteria 1078
465 Ga0501032_0017051 3300049569 Bacteria 5102
466 Ga0501032_0028932 3300049569 Bacteria 3805
467 Ga0501032_0090990 3300049569 Bacteria 2025
468 Ga0501032_0291172 3300049569 Bacteria 1056
469 Ga0501033_0001666 3300049570 Bacteria 19436
470 Ga0501033_0006703 3300049570 Bacteria 8996
471 Ga0501033_0007876 3300049570 Bacteria 8255
472 Ga0501033_0010528 3300049570 Bacteria 7092
473 Ga0501033_0020298 3300049570 Bacteria 5019
474 Ga0501033_0023202 3300049570 Bacteria 4680
475 Ga0501033_0116797 3300049570 Bacteria 1938
476 Ga0501033_0277232 3300049570 Bacteria 1184
477 Ga0501034_0000800 3300049571 Bacteria 46777
478 Ga0501034_0005910 3300049571 Bacteria 13280
479 Ga0501034_0011945 3300049571 Bacteria 8975
480 Ga0501034_0012696 3300049571 Bacteria 8692
481 Ga0501034_0027215 3300049571 Bacteria 5816
482 Ga0501034_0178790 3300049571 Bacteria 2087
483 Ga0501034_0639155 3300049571 Bacteria 967
484 Ga0501036_0000066 3300049572 Bacteria 67540
485 Ga0501036_0000874 3300049572 Bacteria 22446
486 Ga0501036_0001818 3300049572 Bacteria 16540
487 Ga0501036_0007768 3300049572 Bacteria 8768
488 Ga0501036_0015788 3300049572 Bacteria 6309
489 Ga0501036_0020590 3300049572 Bacteria 5540
490 Ga0501036_0056964 3300049572 Bacteria 3311
491 Ga0501036_0143715 3300049572 Bacteria 2012
492 Ga0501036_0146055 3300049572 Bacteria 1995
493 Ga0501036_0253943 3300049572 Bacteria 1473
494 Ga0501037_0007621 3300049573 Bacteria 7926
495 Ga0501037_0019818 3300049573 Bacteria 4963
496 Ga0501037_0043769 3300049573 Bacteria 3290
497 Ga0501037_0053537 3300049573 Bacteria 2952
498 Ga0501037_0203646 3300049573 Bacteria 1398
499 Ga0501037_0264510 3300049573 Bacteria 1201
500 Ga0501038_0000941 3300049574 Bacteria 25968
501 Ga0501038_0003246 3300049574 Bacteria 15159
502 Ga0501038_0013338 3300049574 Bacteria 7495
503 Ga0501038_0031253 3300049574 Bacteria 4706
504 Ga0501038_0090415 3300049574 Bacteria 2566
505 Ga0501038_0121279 3300049574 Bacteria 2155
506 Ga0501038_0127565 3300049574 Bacteria 2092
507 Ga0501038_0148433 3300049574 Bacteria 1913
508 Ga0501038_0269059 3300049574 Bacteria 1344
509 Ga0501038_0381105 3300049574 Bacteria 1094
510 Ga0501039_0000380 3300049575 Bacteria 31802
511 Ga0501039_0000868 3300049575 Bacteria 21888
512 Ga0501039_0015156 3300049575 Bacteria 5898
513 Ga0501039_0020742 3300049575 Bacteria 5036
514 Ga0501039_0046324 3300049575 Bacteria 3359
515 Ga0501039_0067465 3300049575 Bacteria 2778
516 Ga0501039_0069077 3300049575 Bacteria 2743
517 Ga0501039_0098207 3300049575 Bacteria 2284
518 Ga0501039_0107178 3300049575 Bacteria 2183
519 Ga0501039_0207081 3300049575 Bacteria 1542
520 Ga0501040_0000744 3300049576 Bacteria 20205
521 Ga0501040_0001405 3300049576 Bacteria 15219
522 Ga0501040_0004430 3300049576 Bacteria 9120
523 Ga0501040_0009363 3300049576 Bacteria 6382
524 Ga0501040_0012135 3300049576 Bacteria 5642
525 Ga0501040_0051837 3300049576 Bacteria 2807
526 Ga0501040_0058659 3300049576 Bacteria 2643
527 Ga0501040_0065753 3300049576 Bacteria 2498
528 Ga0501040_0075017 3300049576 Bacteria 2337
529 Ga0501040_0107243 3300049576 Bacteria 1952
530 Ga0501040_0113953 3300049576 Bacteria 1892
531 Ga0501040_0240540 3300049576 Bacteria 1290
532 Ga0501040_0244571 3300049576 Bacteria 1279
533 Ga0501040_0494106 3300049576 Bacteria 882
534 Ga0501041_0000702 3300049577 Bacteria 17800
535 Ga0501041_0003349 3300049577 Bacteria 9224
536 Ga0501041_0004869 3300049577 Bacteria 7800
537 Ga0501041_0017958 3300049577 Bacteria 4211
538 Ga0501041_0031434 3300049577 Bacteria 3207
539 Ga0501041_0052301 3300049577 Bacteria 2490
540 Ga0501041_0080194 3300049577 Bacteria 2010
541 Ga0501041_0108654 3300049577 Bacteria 1720
542 Ga0501041_0127204 3300049577 Bacteria 1586
543 Ga0501041_0213240 3300049577 Bacteria 1211
544 Ga0501041_0240645 3300049577 Bacteria 1137
545 Ga0501042_0001054 3300049578 Bacteria 15751
546 Ga0501042_0006923 3300049578 Bacteria 7400
547 Ga0501042_0018759 3300049578 Bacteria 4794
548 Ga0501042_0023219 3300049578 Bacteria 4338
549 Ga0501042_0039259 3300049578 Bacteria 3363
550 Ga0501042_0043676 3300049578 Bacteria 3192
551 Ga0501042_0048387 3300049578 Bacteria 3031
552 Ga0501042_0061312 3300049578 Bacteria 2687
553 Ga0501042_0076672 3300049578 Bacteria 2393
554 Ga0501042_0111666 3300049578 Bacteria 1968
555 Ga0501042_0114896 3300049578 Bacteria 1938
556 Ga0501042_0118268 3300049578 Bacteria 1908
557 Ga0501042_0153477 3300049578 Bacteria 1660
558 Ga0501042_0262412 3300049578 Bacteria 1247
559 Ga0501042_0314275 3300049578 Bacteria 1132
560 Ga0501043_0004985 3300049579 Bacteria 10741
561 Ga0501043_0020784 3300049579 Bacteria 5148
562 Ga0501043_0029861 3300049579 Bacteria 4283
563 Ga0501043_0040430 3300049579 Bacteria 3665
564 Ga0501043_0063211 3300049579 Bacteria 2906
565 Ga0501043_0085250 3300049579 Bacteria 2482
566 Ga0501043_0164967 3300049579 Bacteria 1730
567 Ga0501046_0000595 3300049580 Bacteria 35470
568 Ga0501046_0008429 3300049580 Bacteria 8991
569 Ga0501046_0033574 3300049580 Bacteria 4144
570 Ga0501046_0036536 3300049580 Bacteria 3953
571 Ga0501046_0100312 3300049580 Bacteria 2222
572 Ga0501046_0101645 3300049580 Bacteria 2205
573 Ga0501046_0109738 3300049580 Bacteria 2109
574 Ga0501046_0113400 3300049580 Bacteria 2069
575 Ga0501046_0211990 3300049580 Bacteria 1437
576 Ga0501046_0402752 3300049580 Bacteria 988
577 Ga0501047_0034845 3300049581 Bacteria 4860
578 Ga0501047_0055618 3300049581 Bacteria 3826
579 Ga0501047_0119235 3300049581 Bacteria 2520
580 Ga0501047_0175533 3300049581 Bacteria 2010
581 Ga0501047_0236142 3300049581 Bacteria 1680
582 Ga0501048_0000213 3300049582 Bacteria 37962
583 Ga0501048_0009825 3300049582 Bacteria 7173
584 Ga0501048_0019029 3300049582 Bacteria 5046
585 Ga0501048_0020402 3300049582 Bacteria 4856
586 Ga0501048_0028452 3300049582 Bacteria 4056
587 Ga0501048_0038044 3300049582 Bacteria 3454
588 Ga0501048_0056872 3300049582 Bacteria 2775
589 Ga0501048_0240401 3300049582 Bacteria 1285
590 Ga0501048_0337926 3300049582 Bacteria 1073
591 Ga0501067_0065969 3300049583 Bacteria 2004
592 Ga0501068_0006733 3300049584 Bacteria 6349
593 Ga0501068_0017727 3300049584 Bacteria 4120
594 Ga0501068_0032041 3300049584 Bacteria 3124
595 Ga0501068_0394620 3300049584 Bacteria 892
596 Ga0501069_0004037 3300049585 Bacteria 7576
597 Ga0501069_0098947 3300049585 Bacteria 1655
598 Ga0501070_0007592 3300049586 Bacteria 9211
599 Ga0501070_0077349 3300049586 Bacteria 2754
600 Ga0501070_0117090 3300049586 Bacteria 2201
601 Ga0501070_0208163 3300049586 Bacteria 1606
602 Ga0501070_0239371 3300049586 Bacteria 1486
603 Ga0501070_0547393 3300049586 Bacteria 927
604 Ga0501070_0568300 3300049586 Bacteria 906
605 Ga0501071_0000625 3300049587 Bacteria 18359
606 Ga0501071_0001040 3300049587 Bacteria 15362
607 Ga0501071_0003533 3300049587 Bacteria 9779
608 Ga0501071_0018103 3300049587 Bacteria 4872
609 Ga0501071_0018692 3300049587 Bacteria 4804
610 Ga0501071_0019426 3300049587 Bacteria 4715
611 Ga0501071_0084960 3300049587 Archaea 2320
612 Ga0501071_0151140 3300049587 Bacteria 1732
613 Ga0501071_0218460 3300049587 Bacteria 1434
614 Ga0501071_0241295 3300049587 Bacteria 1363
615 Ga0501072_0000303 3300049588 Bacteria 34901
616 Ga0501072_0002169 3300049588 Bacteria 14653
617 Ga0501072_0002715 3300049588 Bacteria 13289
618 Ga0501072_0013828 3300049588 Bacteria 6182
619 Ga0501072_0021954 3300049588 Bacteria 4952
620 Ga0501072_0054867 3300049588 Bacteria 3141
621 Ga0501072_0061960 3300049588 Bacteria 2950
622 Ga0501072_0104209 3300049588 Bacteria 2255
623 Ga0501072_0112972 3300049588 Bacteria 2162
624 Ga0501072_0149025 3300049588 Bacteria 1865
625 Ga0501072_0150470 3300049588 Bacteria 1855
626 Ga0501072_0204857 3300049588 Bacteria 1573
627 Ga0501072_0251259 3300049588 Archaea 1408
628 Ga0501072_0507575 3300049588 Bacteria 954
629 Ga0501072_0572855 3300049588 Bacteria 891
630 Ga0501072_0594781 3300049588 Bacteria 872
631 Ga0501073_0013367 3300049589 Bacteria 5975
632 Ga0501073_0142662 3300049589 Bacteria 1660
633 Ga0501074_0001971 3300049590 Bacteria 14111
634 Ga0501074_0008601 3300049590 Bacteria 7393
635 Ga0501074_0025663 3300049590 Bacteria 4277
636 Ga0501074_0047691 3300049590 Bacteria 3096
637 Ga0501074_0052872 3300049590 Bacteria 2931
638 Ga0501074_0198079 3300049590 Bacteria 1432
639 Ga0501074_0207345 3300049590 Bacteria 1397
640 Ga0501074_0233758 3300049590 Bacteria 1308
641 Ga0501074_0325858 3300049590 Bacteria 1091
642 Ga0501075_0001225 3300049591 Bacteria 16620
643 Ga0501075_0002238 3300049591 Bacteria 12815
644 Ga0501075_0006482 3300049591 Bacteria 8056
645 Ga0501075_0006573 3300049591 Bacteria 8008
646 Ga0501075_0030493 3300049591 Bacteria 3995
647 Ga0501075_0032162 3300049591 Bacteria 3896
648 Ga0501075_0035321 3300049591 Bacteria 3727
649 Ga0501075_0062825 3300049591 Bacteria 2799
650 Ga0501075_0081114 3300049591 Bacteria 2456
651 Ga0501075_0082016 3300049591 Bacteria 2442
652 Ga0501075_0096133 3300049591 Bacteria 2248
653 Ga0501075_0137162 3300049591 Bacteria 1864
654 Ga0501075_0185591 3300049591 Bacteria 1586
655 Ga0501075_0191052 3300049591 Bacteria 1562
656 Ga0501075_0225546 3300049591 Archaea 1429
657 Ga0501076_0000264 3300049592 Bacteria 32410
658 Ga0501076_0001986 3300049592 Bacteria 13978
659 Ga0501076_0004481 3300049592 Bacteria 9946
660 Ga0501076_0016346 3300049592 Bacteria 5627
661 Ga0501076_0037295 3300049592 Bacteria 3811
662 Ga0501076_0061513 3300049592 Bacteria 2988
663 Ga0501076_0067643 3300049592 Bacteria 2853
664 Ga0501076_0079834 3300049592 Bacteria 2625
665 Ga0501076_0095804 3300049592 Archaea 2390
666 Ga0501076_0096144 3300049592 Bacteria 2385
667 Ga0501076_0150358 3300049592 Bacteria 1894
668 Ga0501076_0333143 3300049592 Bacteria 1245
669 Ga0501076_0443600 3300049592 Bacteria 1068
670 Ga0501076_0470174 3300049592 Bacteria 1036
671 Ga0501077_0000998 3300049593 Bacteria 17063
672 Ga0501077_0005528 3300049593 Bacteria 7693
673 Ga0501077_0006282 3300049593 Bacteria 7268
674 Ga0501077_0014750 3300049593 Bacteria 4910
675 Ga0501077_0025059 3300049593 Bacteria 3789
676 Ga0501077_0127820 3300049593 Bacteria 1611
677 Ga0501077_0140237 3300049593 Bacteria 1533
678 Ga0501079_0000118 3300049741 Bacteria 41398
679 Ga0501079_0006591 3300049741 Bacteria 8735
680 Ga0501079_0008786 3300049741 Bacteria 7656
681 Ga0501079_0029642 3300049741 Bacteria 4202
682 Ga0501079_0036180 3300049741 Bacteria 3803
683 Ga0501079_0038811 3300049741 Bacteria 3672
684 Ga0501079_0041665 3300049741 Archaea 3546
685 Ga0501079_0057150 3300049741 Bacteria 3011
686 Ga0501079_0060717 3300049741 Bacteria 2916
687 Ga0501079_0106247 3300049741 Bacteria 2178
688 Ga0501079_0137967 3300049741 Bacteria 1899
689 Ga0501079_0185655 3300049741 Bacteria 1623
690 Ga0501079_0256685 3300049741 Bacteria 1366
691 Ga0501079_0300690 3300049741 Bacteria 1255
692 Ga0501079_0650688 3300049741 Bacteria 830
693 Ga0501080_0009462 3300049742 Bacteria 8888
694 Ga0501080_0016427 3300049742 Bacteria 6835
695 Ga0501080_0028679 3300049742 Bacteria 5181
696 Ga0501080_0050439 3300049742 Bacteria 3873
697 Ga0501080_0064991 3300049742 Bacteria 3394
698 Ga0501080_0092189 3300049742 Bacteria 2814
699 Ga0501080_0208077 3300049742 Bacteria 1794
700 Ga0501080_0257750 3300049742 Bacteria 1589
701 Ga0501080_0412888 3300049742 Bacteria 1213
702 Ga0501080_0486463 3300049742 Bacteria 1104
703 Ga0501081_0002839 3300049743 Bacteria 10999
704 Ga0501081_0034004 3300049743 Bacteria 3466
705 Ga0501081_0058151 3300049743 Bacteria 2675
706 Ga0501081_0070489 3300049743 Bacteria 2436
707 Ga0501081_0086298 3300049743 Bacteria 2203
708 Ga0501081_0143619 3300049743 Bacteria 1711
709 Ga0501081_0178824 3300049743 Bacteria 1534
710 Ga0501081_0254420 3300049743 Bacteria 1282
711 Ga0501081_0574221 3300049743 Bacteria 843
712 Ga0501083_0006538 3300049744 Bacteria 8268
713 Ga0501083_0009109 3300049744 Bacteria 7011
714 Ga0501083_0023559 3300049744 Bacteria 4268
715 Ga0501083_0115166 3300049744 Bacteria 1765
716 Ga0501035_0012203 3300049822 Bacteria 7944
717 Ga0501035_0017304 3300049822 Bacteria 6646
718 Ga0501035_0018600 3300049822 Bacteria 6399
719 Ga0501035_0023182 3300049822 Bacteria 5694
720 Ga0501035_0083843 3300049822 Bacteria 2812
721 Ga0501035_0151924 3300049822 Bacteria 2009
722 Ga0501035_0157153 3300049822 Bacteria 1970
723 Ga0501035_0333488 3300049822 Bacteria 1272
724 Ga0501044_0000401 3300049823 Bacteria 53413
725 Ga0501044_0001707 3300049823 Bacteria 25760
726 Ga0501044_0050448 3300049823 Bacteria 4293
727 Ga0501044_0089660 3300049823 Bacteria 3104
728 Ga0501044_0094159 3300049823 Bacteria 3020
729 Ga0501044_0396371 3300049823 Bacteria 1293
730 Ga0501044_0466886 3300049823 Bacteria 1167
731 Ga0501045_0000152 3300049824 Bacteria 37014
732 Ga0501045_0004273 3300049824 Bacteria 9849
733 Ga0501045_0010090 3300049824 Bacteria 6607
734 Ga0501045_0019749 3300049824 Bacteria 4808
735 Ga0501045_0020927 3300049824 Bacteria 4676
736 Ga0501045_0022986 3300049824 Bacteria 4467
737 Ga0501045_0037119 3300049824 Bacteria 3541
738 Ga0501045_0074808 3300049824 Bacteria 2494
739 Ga0501045_0081751 3300049824 Bacteria 2382
740 Ga0501045_0109448 3300049824 Bacteria 2048
741 Ga0501045_0121744 3300049824 Bacteria 1937
742 Ga0501045_0125369 3300049824 Bacteria 1908
743 Ga0501045_0147206 3300049824 Bacteria 1752
744 Ga0501045_0156527 3300049824 Bacteria 1695
745 Ga0501045_0259832 3300049824 Bacteria 1292
746 nmdc:mga00v17_2504_c1 3300050491 Bacteria 9400
747 nmdc:mga00v17_35056_c1 3300050491 Bacteria 2984
748 nmdc:mga0yw44_13970_c1 3300050492 Bacteria 4247
749 nmdc:mga0yw44_5760_c1 3300050492 Bacteria 5904
750 nmdc:mga06z11_4138_c1 3300050494 Bacteria 5673
751 nmdc:mga04h51_633_c1 3300050495 Bacteria 8256
752 nmdc:mga07m45_156921_c1 3300050496 Bacteria 1320
753 nmdc:mga07m45_23930_c1 3300050496 Bacteria 3341
754 nmdc:mga07m45_62252_c1 3300050496 Bacteria 2114
755 nmdc:mga05p37_132535_c1 3300050507 Bacteria 3057
756 nmdc:mga05p37_15942_c1 3300050507 Bacteria 9039
757 nmdc:mga05p37_2907_c1 3300050507 Bacteria 19878
758 nmdc:mga05p37_38627_c1 3300050507 Bacteria 5856
759 nmdc:mga05p37_497252_c1 3300050507 Bacteria 1401
760 nmdc:mga05p37_62893_c1 3300050507 Bacteria 4568
761 nmdc:mga05p37_881488_c1 3300050507 Bacteria 968
762 nmdc:mga09592_167807_c1 3300050508 Bacteria 1898
763 nmdc:mga09592_205623_c1 3300050508 Bacteria 1705
764 nmdc:mga09592_249_c1 3300050508 Bacteria 39234
765 nmdc:mga09592_29730_c1 3300050508 Bacteria 4544
766 nmdc:mga09592_318408_c1 3300050508 Bacteria 1348
767 nmdc:mga0qj67_25818_c1 3300050509 Bacteria 4544
768 nmdc:mga0qj67_423243_c1 3300050509 Bacteria 1074
769 nmdc:mga0qj67_534872_c1 3300050509 Bacteria 941
770 nmdc:mga0qj67_54379_c1 3300050509 Bacteria 3170
771 nmdc:mga06r32_12415_c1 3300050510 Bacteria 7687
772 nmdc:mga06r32_225_c4 3300050510 Bacteria 5549
773 nmdc:mga06r32_24715_c1 3300050510 Bacteria 5581
774 nmdc:mga06r32_256153_c1 3300050510 Bacteria 1738
775 nmdc:mga06r32_266_c1 3300050510 Bacteria 43245
776 nmdc:mga06r32_281000_c1 3300050510 Bacteria 1652
777 nmdc:mga06r32_85436_c1 3300050510 Bacteria 3077
778 nmdc:mga08y16_11013_c1 3300050511 Bacteria 9495
779 nmdc:mga08y16_231631_c1 3300050511 Bacteria 1911
780 nmdc:mga08y16_47858_c1 3300050511 Bacteria 4476
781 nmdc:mga08y16_57380_c1 3300050511 Bacteria 4069
782 nmdc:mga08y16_79044_c1 3300050511 Bacteria 3428
783 nmdc:mga0n895_25480_c1 3300050512 Bacteria 5588
784 nmdc:mga0a205_16948_c1 3300050515 Bacteria 6820
785 nmdc:mga0a205_201453_c1 3300050515 Bacteria 1881
786 nmdc:mga0sz30_21950_c1 3300050516 Bacteria 2588
787 nmdc:mga0sz30_92882_c1 3300050516 Bacteria 1314
788 Ga0500643_006718 3300053087 Bacteria 4756
789 Ga0500644_0003457 3300053088 Bacteria 3909
790 Ga0500560_017676 3300053107 Bacteria 1973
791 Ga0500608_139889 3300053122 Bacteria 1075
792 Ga0500652_008752 3300053131 Bacteria 3389
793 Ga0500658_0146002 3300053134 Bacteria 1064
794 Ga0500559_0158724 3300053136 Bacteria 1062
795 Ga0500568_0010217 3300053139 Bacteria 4408
796 Ga0500616_0003919 3300053153 Bacteria 10934
797 Ga0500616_0073033 3300053153 Bacteria 1743
798 Ga0500627_0017663 3300053158 Bacteria 2807
799 Ga0501084_0000607 3300054114 Bacteria 27348
800 Ga0501084_0008161 3300054114 Bacteria 8633
801 Ga0501084_0012072 3300054114 Bacteria 7155
802 Ga0501084_0014901 3300054114 Bacteria 6447
803 Ga0501084_0021076 3300054114 Bacteria 5436
804 Ga0501084_0021133 3300054114 Bacteria 5428
805 Ga0501084_0027041 3300054114 Bacteria 4793
806 Ga0501084_0081507 3300054114 Bacteria 2714
807 Ga0501084_0143679 3300054114 Bacteria 2010
808 Ga0501084_0649217 3300054114 Bacteria 891
809 Ga0590077_002424 3300059426 Bacteria 4000
810 Ga0501082_0000935 3300060353 Bacteria 25818
811 Ga0501082_0029743 3300060353 Bacteria 4706
812 Ga0501082_0034289 3300060353 Bacteria 4377
813 Ga0501082_0036856 3300060353 Bacteria 4213
814 Ga0501082_0039403 3300060353 Bacteria 4076
815 Ga0501082_0068014 3300060353 Bacteria 3067
816 Ga0501082_0079864 3300060353 Bacteria 2822
817 Ga0501082_0138348 3300060353 Bacteria 2113
818 Ga0501082_0158837 3300060353 Bacteria 1964
819 Ga0501082_0176406 3300060353 Bacteria 1858
820 Ga0501082_0177831 3300060353 Bacteria 1850
821 Ga0501082_0232975 3300060353 Bacteria 1603
822 Ga0501082_0391372 3300060353 Bacteria 1213
823 Ga0501082_0430902 3300060353 Bacteria 1152
824 Ga0466962_0029358 3300061719 Bacteria 2632
825 Ga0466962_0086277 3300061719 Bacteria 1503
826 Ga0530510_0000194 3300061734 Bacteria 37649
827 Ga0530510_0000238 3300061734 Bacteria 34506
828 Ga0530510_0005897 3300061734 Bacteria 8492
829 Ga0530510_0007361 3300061734 Bacteria 7663
830 Ga0530510_0012689 3300061734 Bacteria 5925
831 Ga0530510_0014615 3300061734 Bacteria 5541
832 Ga0530510_0025304 3300061734 Bacteria 4243
833 Ga0530510_0037808 3300061734 Bacteria 3482
834 Ga0530510_0046990 3300061734 Bacteria 3118
835 Ga0530510_0062928 3300061734 Bacteria 2686
836 Ga0530510_0115421 3300061734 Bacteria 1968
837 Ga0530510_0134115 3300061734 Bacteria 1822
838 Ga0530510_0199402 3300061734 Bacteria 1486
839 2515852908 2515154155 Bacteria 7985436
840 2547407995 2547132111 Bacteria 8013147
841 2552109224 2551306166 Bacteria 9731570
842 2585300126 2582581312 Bacteria 7308206
843 2585308654 2582581313 Bacteria 10042643
844 2616695301 2616644814 Bacteria 11555299
845 2623502007 2622736605 Bacteria 4992138
846 2643765688 2643221548 Bacteria 8053412
847 2643888294 2643221575 Bacteria 4022601
848 2643898519 2643221578 Bacteria 9213798
849 2643948258 2643221587 Bacteria 7586415
850 2644264094 2643221647 Bacteria 10741251
851 2644388780 2643221670 Bacteria 6497041
852 2644406435 2643221673 Bacteria 9196637
853 2644429731 2643221677 Bacteria 7584031
854 2644436981 2643221678 Bacteria 9540101
855 2644459800 2643221682 Bacteria 6743283
856 2671834166 2671180195 Bacteria 9757215
857 2676473210 2675903058 Bacteria 6822861
858 2676489927 2675903060 Bacteria 10051191
859 2686538362 2684623035 Bacteria 8032739
860 2689990065 2687453743 Bacteria 8361025
861 2723642281 2721755702 Bacteria 4373124
862 2744954526 2744054611 Bacteria 5611514
863 2774852322 2773857922 Bacteria 9757215
864 2776376671 2775506925 Bacteria 7237746
865 2784588448 2784132148 Bacteria 8627943
866 2785343522 2784746763 Bacteria 9783172
867 2785369277 2784746768 Bacteria 10036182
868 2786670415 2786546132 Bacteria 10419719
869 2791913641 2791354901 Bacteria 8322202
870 2795796103 2795385472 Bacteria 6627535
871 2808841879 2808606359 Bacteria 9866990
872 2808920414 2808606375 Bacteria 9466072
873 2809232044 2808606448 Bacteria 8656184
874 2812358378 2811994879 Bacteria 9313447
875 2812480729 2811994917 Bacteria 7761064
876 2816426012 2816332119 Bacteria 8120218
877 2819697932 2818991463 Bacteria 7948711
878 2827631808 2827628540 Bacteria 6858585
879 2836165142 2836160341 Unclassified 5867367
880 2837272279 2837268691 Bacteria 7850704
881 2842138372 2842134933 Bacteria 5847019
882 2852636875 2852635781 Bacteria 8251373
883 2855671264 2855670206 Bacteria 7120389
884 2855682530 2855676851 Bacteria 7063653
885 2857291959 2857288857 Bacteria 7189066
886 2858850747 2858848962 Bacteria 6963058
887 2858871998 2858868258 Bacteria 7683772
888 2858883879 2858882152 Bacteria 7230291
889 2858889967 2858888857 Bacteria 7060307
890 2858900819 2858895516 Bacteria 7378898
891 2862285479 2862281513 Bacteria 9621493
892 2862386354 2862382967 Bacteria 10317375
893 2863073499 2863067949 Bacteria 8541735
894 2866556311 2866552031 Bacteria 5824618
895 2867371719 2867369537 Bacteria 6501581
896 2867430402 2867428634 Bacteria 9590268
897 2867478221 2867475112 Bacteria 6909112
898 2869054566 2869048445 Bacteria 6875584
899 2869063731 2869061728 Bacteria 7112407
900 2869070953 2869068681 Bacteria 7205615
901 2873314402 2873314349 Bacteria 8512634
902 2875394400 2875391855 Bacteria 7600475
903 2877681274 2877676314 Bacteria 9512378
904 2880499049 2880495981 Bacteria 7340502
905 2884694757 2884693830 Bacteria 11273186
906 2891331771 2891326441 Bacteria 6439512
907 2895436382 2895427314 Bacteria 13147766
908 2895447189 2895442618 Bacteria 11027144
909 2895890329 2895880812 Bacteria 11255272
910 2902587213 2902582711 Bacteria 6187705
911 2912720263 2912715099 Bacteria 9460473
912 2919469677 2919468124 Bacteria 9133025
913 2928143596 2928142448 Bacteria 5288925
914 2929215005 2929212328 Bacteria 7708288
915 2929227635 2929226422 Bacteria 7248583
916 2946050209 2946045630 Bacteria 8527308
917 2946067500 2946064051 Bacteria 8957905
918 2954007678 2954002825 Bacteria 9173742
919 2954386417 2954380949 Bacteria 10050426
920 2954676761 2954673503 Bacteria 9685905
921 2954687405 2954682443 Bacteria 9862841
922 2954697094 2954691527 Bacteria 10720516
923 2954705042 2954701450 Bacteria 10834262
924 2954716400 2954711539 Bacteria 10867210
925 2954726344 2954721474 Bacteria 10456478
926 2954735466 2954731030 Bacteria 10243860
927 2954745267 2954740390 Bacteria 10229294
928 2954754321 2954749733 Bacteria 10366972
929 2954764243 2954759201 Bacteria 9358192
930 2966602717 2966598605 Bacteria 7676064
931 2997600978 2997600082 Bacteria 9896405
932 3006496231 3006493962 Bacteria 8825450
933 8001783635 8001781756 Bacteria 9586736
934 8023628863 8023623736 Bacteria 8593882
935 8025536583 8025530807 Bacteria 8495698
936 8033691251 8033684223 Bacteria 6906479
937 8048134632 8048127548 Bacteria 11053136
938 8048410221 8048406513 Bacteria 8936924
939 8054164095 8054160619 Bacteria 7783213
940 8054705053 8054704163 Bacteria 7247792
941 8054735962 8054734606 Bacteria 6947278
942 8055071169 8055066027 Bacteria 9479577
943 8055175970 8055172936 Bacteria 9305943
944 8056671919 8056667051 Bacteria 6953971
945 Ga0395901_0094170
946 JGI24739J22299_10036082
947 JGI24737J22298_10006965
948 rootH1_10007500
949 rootH2_10041617
950 rootH1_10005128
951 JGI25160J50197_1022820
952 JGI25160J50197_1023936
953 JGI25407J50210_10000257
954 Ga0006562J51391_1072226
955 Ga0006562J51391_1072228
956 Ga0006562J51391_1195513
957 Ga0006562J51391_1195514
958 Ga0006562J51391_1218549
959 Ga0006562J51391_1218550
960 Ga0058692_1034166
961 Ga0070683_100321129
962 Ga0070683_100502289
963 Ga0070660_100166225
964 Ga0070668_100793471
965 Ga0070674_100073896
966 Ga0070667_100150841
967 Ga0070714_100034488
968 Ga0070700_100136807
969 Ga0070678_100628848
970 Ga0070697_100403731
971 Ga0070665_100459744
972 Ga0070704_100395310
973 Ga0070664_100122756
974 Ga0068852_100956368
975 Ga0068866_10250742
976 Ga0068870_10050081
977 Ga0081455_10021892
978 Ga0081455_10041551
979 Ga0081455_10082549
980 Ga0081455_10082877
981 Ga0081455_10127014
982 Ga0081455_10198944
983 Ga0081538_10000071
984 Ga0081538_10000636
985 Ga0081538_10000708
986 Ga0081538_10000786
987 Ga0081538_10000848
988 Ga0081538_10005143
989 Ga0081538_10015429
990 Ga0081538_10035476
991 Ga0081538_10044130
992 Ga0081538_10050185
993 Ga0081538_10057632
994 Ga0081538_10093866
995 Ga0075365_10001046
996 Ga0075365_10014479
997 Ga0075368_10004437
998 Ga0075368_10005106
999 Ga0075363_100048713
1000 Ga0075363_100087411
1001 Ga0075363_100340078
1002 Ga0075363_100401392
1003 Ga0075364_10001308
1004 Ga0075364_10017255
1005 Ga0075362_10034851
1006 Ga0075367_10066726
1007 Ga0075367_10211740
1008 Ga0075369_10041418
1009 Ga0075369_10051545
1010 Ga0075370_10036461
1011 Ga0075370_10038499
1012 Ga0075370_10114138
1013 Ga0075428_100005158
1014 Ga0075428_100008238
1015 Ga0075428_100030080
1016 Ga0075428_100031174
1017 Ga0075428_100275996
1018 Ga0075430_100005719
1019 Ga0075430_100033857
1020 Ga0075430_100053015
1021 Ga0075430_100068066
1022 Ga0075430_100128622
1023 Ga0075431_100004645
1024 Ga0075431_100006078
1025 Ga0075431_100026331
1026 Ga0075431_100032094
1027 Ga0075431_100060234
1028 Ga0075431_100065749
1029 Ga0075431_100336844
1030 Ga0075431_100482424
1031 Ga0075433_10141954
1032 Ga0075433_10438702
1033 Ga0075434_100046669
1034 Ga0075429_100003826
1035 Ga0075429_100015277
1036 Ga0075429_100017988
1037 Ga0075429_100063077
1038 Ga0075429_100191001
1039 Ga0068865_100174213
1040 Ga0068865_100468966
1041 Ga0099826_10097682
1042 Ga0105240_10524579
1043 Ga0111539_10028862
1044 Ga0111539_10040555
1045 Ga0111539_10105080
1046 Ga0111539_10508740
1047 Ga0114129_10005316
1048 Ga0114129_10014842
1049 Ga0114129_10030852
1050 Ga0114129_10034885
1051 Ga0114129_10159229
1052 Ga0114129_10161999
1053 Ga0114129_10260197
1054 Ga0114129_10330218
1055 Ga0114129_10893678
1056 Ga0114129_11064087
1057 Ga0105241_10409082
1058 Ga0105242_10135188
1059 Ga0105238_10000079
1060 Ga0105028_103073
1061 Ga0105239_10511048
1062 Ga0105246_10136470
1063 Ga0157370_10209938
1064 Ga0157369_10036068
1065 Ga0157372_10035360
1066 Ga0157375_10022168
1067 Ga0157380_10057803
1068 Ga0157376_10172948
1069 Ga0183367_1005
1070 Ga0209758_1044091
1071 Ga0207426_1001348
1072 Ga0207426_1002109
1073 Ga0207426_1007095
1074 Ga0207426_1069139
1075 Ga0207647_10005257
1076 Ga0207643_10111108
1077 Ga0207694_10086266
1078 Ga0207687_10100756
1079 Ga0207664_10088587
1080 Ga0207690_10074444
1081 Ga0207706_10125184
1082 Ga0207706_10419900
1083 Ga0207669_10140596
1084 Ga0207704_10155784
1085 Ga0207661_10131294
1086 Ga0207679_10209761
1087 Ga0207658_10553241
1088 Ga0207676_10519117
1089 Ga0207674_10129666
1090 Ga0209813_10000932
1091 Ga0207428_10000623
1092 Ga0207428_10071628
1093 Ga0207428_10094843
1094 Ga0207428_10168704
1095 Ga0207428_10195863
1096 Ga0307517_10004807
1097 Ga0307515_10000054
1098 Ga0307515_10211056
1099 Ga0307511_10000467
1100 Ga0307511_10016574
1101 Ga0307512_10005063
1102 Ga0307512_10171288
1103 Ga0265327_10031703
1104 Ga0307513_10053178
1105 Ga0307509_10008190
1106 Ga0307509_10016949
1107 Ga0307408_100032153
1108 Ga0307408_100385172
1109 Ga0307508_10001920
1110 Ga0307508_10239000
1111 Ga0307514_10014887
1112 Ga0307514_10074955
1113 Ga0307514_10103233
1114 Ga0307514_10257249
1115 Ga0316575_10014010
1116 Ga0316575_10069087
1117 Ga0316579_10006654
1118 Ga0316579_10077118
1119 Ga0316576_10031701
1120 Ga0316576_10040183
1121 Ga0316576_10093974
1122 Ga0316576_10153188
1123 Ga0316576_10245064
1124 Ga0316576_10332658
1125 Ga0316576_10365452
1126 Ga0316578_10087806
1127 Ga0316578_10120993
1128 Ga0307516_10001443
1129 Ga0307516_10058416
1130 Ga0307405_10226917
1131 Ga0307405_10340311
1132 Ga0316577_10039761
1133 Ga0316577_10127655
1134 Ga0316577_10277945
1135 Ga0307413_10032135
1136 Ga0307413_10059286
1137 Ga0307413_10070917
1138 Ga0307413_10214426
1139 Ga0307518_10040266
1140 Ga0307518_10264678
1141 Ga0307410_10062248
1142 Ga0307410_10075295
1143 Ga0307410_10101674
1144 Ga0307410_10250866
1145 Ga0307410_10475793
1146 Ga0307406_10186254
1147 Ga0307407_10016157
1148 Ga0307407_10160409
1149 Ga0307407_10222811
1150 Ga0307412_10097967
1151 Ga0307412_10291415
1152 Ga0307409_100001075
1153 Ga0307409_100025790
1154 Ga0307409_100116265
1155 Ga0307409_100131453
1156 Ga0307409_100137726
1157 Ga0307409_100996104
1158 Ga0307416_100012615
1159 Ga0307416_100015839
1160 Ga0307416_100262747
1161 Ga0307416_100356040
1162 Ga0307411_10012666
1163 Ga0307411_10032985
1164 Ga0307411_10112733
1165 Ga0307415_100072733
1166 Ga0316583_10003502
1167 Ga0316583_10039865
1168 Ga0316585_10001345
1169 Ga0316585_10005153
1170 Ga0316580_10000262
1171 Ga0316580_10005722
1172 Ga0316593_10009722
1173 Ga0307507_10059352
1174 Ga0307507_10063764
1175 Ga0307507_10091993
1176 Ga0307510_10021100
1177 Ga0307510_10053296
1178 Ga0316596_1020430
1179 Ga0316574_0017698
1180 Ga0316574_0093448
1181 Ga0316574_0124021
1182 Ga0316582_0001333
1183 Ga0316582_0002112
1184 Ga0316582_0051859
1185 Ga0316582_0137932
1186 Ga0316584_0000134
1187 Ga0316584_0018979
1188 Ga0316584_0026219
1189 Ga0316584_0056682
1190 Ga0316584_0168202
1191 Ga0316584_0169357
1192 Ga0395899_0043233
1193 Ga0395900_0013600
1194 Ga0395900_0696649
1195 Ga0395898_0002257
1196 Ga0395898_0013578
1197 Ga0395898_0127490
1198 Ga0395905_0062160
1199 Ga0395905_0084695
1200 Ga0395901_0014461
1201 Ga0395901_0114894
1202 Ga0395901_0286597
1203 Ga0400489_04604
1204 Ga0400489_40306
1205 Ga0400489_76681
1206 Ga0436365_1051447
1207 Ga0439436_0003819
1208 Ga0439436_0003918
1209 Ga0439436_0054527
1210 Ga0439439_0002034
1211 Ga0439465_0001411
1212 Ga0451853_0486773
1213 Ga0439433_0001200
1214 Ga0439433_0031891
1215 Ga0439442_013864
1216 Ga0439443_011224
1217 Ga0439448_0002553
1218 Ga0439449_0007359
1219 Ga0439455_0000958
1220 Ga0439455_0040248
1221 Ga0439457_001962
1222 Ga0439457_012728
1223 Ga0439462_0025982
1224 Ga0450894_000304
1225 Ga0450899_003582
1226 Ga0450903_000066
1227 Ga0450906_000460
1228 Ga0439458_0003962
1229 Ga0439460_0008826
1230 Ga0439460_0125784
1231 Ga0451577_0003848
1232 Ga0451577_0049114
1233 Ga0439440_0029370
1234 Ga0466969_0038112
1235 Ga0466972_0002289
1236 Ga0466972_0017323
1237 Ga0466972_0017353
1238 Ga0453683_0000038
1239 Ga0453683_0007664
1240 Ga0453683_0060447
1241 Ga0453683_0063844
1242 Ga0453683_0177183
1243 Ga0453683_0270866
1244 Ga0466965_0013841
1245 Ga0466965_0014062
1246 Ga0466965_0015058
1247 Ga0466965_0015153
1248 Ga0466965_0078483
1249 Ga0466965_0090365
1250 Ga0466966_0004695
1251 Ga0466966_0014018
1252 Ga0466961_0000718
1253 Ga0466963_0005753
1254 Ga0466963_0034858
1255 Ga0466963_0142504
1256 Ga0466964_0020724
1257 Ga0453684_0000062
1258 Ga0453684_0000071
1259 Ga0453684_0008600
1260 Ga0453684_0020669
1261 Ga0453684_0022219
1262 Ga0453684_0030643
1263 Ga0453684_0095521
1264 Ga0466971_0016404
1265 Ga0466971_0021500
1266 Ga0466968_0007041
1267 Ga0466968_0027605
1268 Ga0466970_0002176
1269 Ga0466970_0002883
1270 Ga0466957_0000779
1271 Ga0466960_0001348
1272 Ga0466960_0167602
1273 Ga0466959_0004797
1274 Ga0451576_0004322
1275 Ga0451576_0037942
1276 Ga0451576_0054268
1277 Ga0451576_0069603
1278 Ga0451576_0172253
1279 Ga0451576_0329163
1280 Ga0466958_0003100
1281 Ga0466967_0003170
1282 Ga0466967_0010111
1283 Ga0466967_0052226
1284 Ga0466967_0092975
1285 Ga0466967_0339608
1286 Ga0466967_0569609
1287 Ga0495592_0004815
1288 Ga0495592_0024165
1289 Ga0495603_0001370
1290 Ga0495603_0002153
1291 Ga0495603_0016300
1292 Ga0495603_0153248
1293 Ga0495629_0003785
1294 Ga0495629_0007890
1295 Ga0495629_0019177
1296 Ga0495629_0408298
1297 Ga0495638_0003378
1298 Ga0495638_0008595
1299 Ga0495653_0260464
1300 Ga0495580_0151521
1301 Ga0495605_0121331
1302 Ga0495662_0003541
1303 Ga0495662_0005344
1304 Ga0495662_0009252
1305 Ga0495662_0042315
1306 Ga0495662_0043378
1307 Ga0495664_0233213
1308 Ga0495664_0303656
1309 Ga0495585_0014221
1310 Ga0495594_0000491
1311 Ga0495608_0034251
1312 Ga0495620_0003260
1313 Ga0495628_0451536
1314 Ga0495643_0003358
1315 Ga0495652_0199080
1316 Ga0495665_0013220
1317 Ga0495640_0116564
1318 Ga0495587_0181447
1319 Ga0495597_0020606
1320 Ga0495645_0028776
1321 Ga0495622_0009074
1322 Ga0495667_0084597
1323 Ga0495634_0004159
1324 Ga0495625_0004168
1325 Ga0495625_0007968
1326 Ga0495625_0057483
1327 Ga0495635_0014699
1328 Ga0495635_0061618
1329 Ga0495588_0018527
1330 Ga0495588_0080453
1331 Ga0495588_0102379
1332 Ga0495657_0016882
1333 Ga0495657_0061601
1334 Ga0495657_0338236
1335 Ga0495599_0230706
1336 Ga0495623_0044298
1337 Ga0495646_0075671
1338 Ga0495658_0086210
1339 Ga0495613_0000624
1340 Ga0495613_0001608
1341 Ga0495613_0002838
1342 Ga0495613_0028098
1343 Ga0495613_0078163
1344 Ga0495613_0336524
1345 Ga0495613_0365862
1346 Ga0495613_0539796
1347 Ga0495624_0076715
1348 Ga0495671_0009078
1349 Ga0495649_0024122
1350 Ga0495589_0019195
1351 Ga0495589_0019573
1352 Ga0495589_0085636
1353 Ga0495600_0048123
1354 Ga0495600_0078277
1355 Ga0495581_0056126
1356 Ga0495581_0196954
1357 Ga0495604_0005238
1358 Ga0495604_0138755
1359 Ga0495636_0029027
1360 Ga0495636_0127017
1361 Ga0495674_0104228
1362 Ga0495674_0296054
1363 Ga0495672_0109170
1364 Ga0495672_0270826
1365 Ga0495676_0031051
1366 Ga0495676_0038155
1367 Ga0495676_0055204
1368 Ga0495680_0031502
1369 Ga0495687_016422
1370 Ga0495675_0002845
1371 Ga0495685_002845
1372 Ga0495685_003637
1373 Ga0495681_0000474
1374 Ga0495681_0011681
1375 Ga0495684_0060253
1376 Ga0495593_0002842
1377 Ga0495593_0052582
1378 Ga0495602_0050641
1379 Ga0495614_0000061
1380 Ga0495614_0001224
1381 Ga0495614_0017495
1382 Ga0495614_0037703
1383 Ga0495614_0131834
1384 Ga0495614_0157986
1385 Ga0496102_0105804
1386 Ga0496104_0110872
1387 Ga0496108_0007785
1388 Ga0496108_0728248
1389 Ga0496109_0199730
1390 Ga0496109_0809019
1391 Ga0496111_0291700
1392 Ga0496114_0006498
1393 Ga0496114_0008701
1394 Ga0496114_0038056
1395 Ga0496114_0070666
1396 Ga0496114_0208102
1397 Ga0496114_0284293
1398 Ga0496126_0034787
1399 Ga0496126_0144897
1400 Ga0501031_0000810
1401 Ga0501031_0003034
1402 Ga0501031_0004140
1403 Ga0501031_0013096
1404 Ga0501031_0050009
1405 Ga0501031_0077545
1406 Ga0501031_0189096
1407 Ga0501031_0196599
1408 Ga0501031_0281926
1409 Ga0501032_0017051
1410 Ga0501032_0028932
1411 Ga0501032_0090990
1412 Ga0501032_0291172
1413 Ga0501033_0001666
1414 Ga0501033_0006703
1415 Ga0501033_0007876
1416 Ga0501033_0010528
1417 Ga0501033_0020298
1418 Ga0501033_0023202
1419 Ga0501033_0116797
1420 Ga0501033_0277232
1421 Ga0501034_0000800
1422 Ga0501034_0005910
1423 Ga0501034_0011945
1424 Ga0501034_0012696
1425 Ga0501034_0027215
1426 Ga0501034_0178790
1427 Ga0501034_0639155
1428 Ga0501036_0000066
1429 Ga0501036_0000874
1430 Ga0501036_0001818
1431 Ga0501036_0007768
1432 Ga0501036_0015788
1433 Ga0501036_0020590
1434 Ga0501036_0056964
1435 Ga0501036_0143715
1436 Ga0501036_0146055
1437 Ga0501036_0253943
1438 Ga0501037_0007621
1439 Ga0501037_0019818
1440 Ga0501037_0043769
1441 Ga0501037_0053537
1442 Ga0501037_0203646
1443 Ga0501037_0264510
1444 Ga0501038_0000941
1445 Ga0501038_0003246
1446 Ga0501038_0013338
1447 Ga0501038_0031253
1448 Ga0501038_0090415
1449 Ga0501038_0121279
1450 Ga0501038_0127565
1451 Ga0501038_0148433
1452 Ga0501038_0269059
1453 Ga0501038_0381105
1454 Ga0501039_0000380
1455 Ga0501039_0000868
1456 Ga0501039_0015156
1457 Ga0501039_0020742
1458 Ga0501039_0046324
1459 Ga0501039_0067465
1460 Ga0501039_0069077
1461 Ga0501039_0098207
1462 Ga0501039_0107178
1463 Ga0501039_0207081
1464 Ga0501040_0000744
1465 Ga0501040_0001405
1466 Ga0501040_0004430
1467 Ga0501040_0009363
1468 Ga0501040_0012135
1469 Ga0501040_0051837
1470 Ga0501040_0058659
1471 Ga0501040_0065753
1472 Ga0501040_0075017
1473 Ga0501040_0107243
1474 Ga0501040_0113953
1475 Ga0501040_0240540
1476 Ga0501040_0244571
1477 Ga0501040_0494106
1478 Ga0501041_0000702
1479 Ga0501041_0003349
1480 Ga0501041_0004869
1481 Ga0501041_0017958
1482 Ga0501041_0031434
1483 Ga0501041_0052301
1484 Ga0501041_0080194
1485 Ga0501041_0108654
1486 Ga0501041_0127204
1487 Ga0501041_0213240
1488 Ga0501041_0240645
1489 Ga0501042_0001054
1490 Ga0501042_0006923
1491 Ga0501042_0018759
1492 Ga0501042_0023219
1493 Ga0501042_0039259
1494 Ga0501042_0043676
1495 Ga0501042_0048387
1496 Ga0501042_0061312
1497 Ga0501042_0076672
1498 Ga0501042_0111666
1499 Ga0501042_0114896
1500 Ga0501042_0118268
1501 Ga0501042_0153477
1502 Ga0501042_0262412
1503 Ga0501042_0314275
1504 Ga0501043_0004985
1505 Ga0501043_0020784
1506 Ga0501043_0029861
1507 Ga0501043_0040430
1508 Ga0501043_0063211
1509 Ga0501043_0085250
1510 Ga0501043_0164967
1511 Ga0501046_0000595
1512 Ga0501046_0008429
1513 Ga0501046_0033574
1514 Ga0501046_0036536
1515 Ga0501046_0100312
1516 Ga0501046_0101645
1517 Ga0501046_0109738
1518 Ga0501046_0113400
1519 Ga0501046_0211990
1520 Ga0501046_0402752
1521 Ga0501047_0034845
1522 Ga0501047_0055618
1523 Ga0501047_0119235
1524 Ga0501047_0175533
1525 Ga0501047_0236142
1526 Ga0501048_0000213
1527 Ga0501048_0009825
1528 Ga0501048_0019029
1529 Ga0501048_0020402
1530 Ga0501048_0028452
1531 Ga0501048_0038044
1532 Ga0501048_0056872
1533 Ga0501048_0240401
1534 Ga0501048_0337926
1535 Ga0501067_0065969
1536 Ga0501068_0006733
1537 Ga0501068_0017727
1538 Ga0501068_0032041
1539 Ga0501068_0394620
1540 Ga0501069_0004037
1541 Ga0501069_0098947
1542 Ga0501070_0007592
1543 Ga0501070_0077349
1544 Ga0501070_0117090
1545 Ga0501070_0208163
1546 Ga0501070_0239371
1547 Ga0501070_0547393
1548 Ga0501070_0568300
1549 Ga0501071_0000625
1550 Ga0501071_0001040
1551 Ga0501071_0003533
1552 Ga0501071_0018103
1553 Ga0501071_0018692
1554 Ga0501071_0019426
1555 Ga0501071_0084960
1556 Ga0501071_0151140
1557 Ga0501071_0218460
1558 Ga0501071_0241295
1559 Ga0501072_0000303
1560 Ga0501072_0002169
1561 Ga0501072_0002715
1562 Ga0501072_0013828
1563 Ga0501072_0021954
1564 Ga0501072_0054867
1565 Ga0501072_0061960
1566 Ga0501072_0104209
1567 Ga0501072_0112972
1568 Ga0501072_0149025
1569 Ga0501072_0150470
1570 Ga0501072_0204857
1571 Ga0501072_0251259
1572 Ga0501072_0507575
1573 Ga0501072_0572855
1574 Ga0501072_0594781
1575 Ga0501073_0013367
1576 Ga0501073_0142662
1577 Ga0501074_0001971
1578 Ga0501074_0008601
1579 Ga0501074_0025663
1580 Ga0501074_0047691
1581 Ga0501074_0052872
1582 Ga0501074_0198079
1583 Ga0501074_0207345
1584 Ga0501074_0233758
1585 Ga0501074_0325858
1586 Ga0501075_0001225
1587 Ga0501075_0002238
1588 Ga0501075_0006482
1589 Ga0501075_0006573
1590 Ga0501075_0030493
1591 Ga0501075_0032162
1592 Ga0501075_0035321
1593 Ga0501075_0062825
1594 Ga0501075_0081114
1595 Ga0501075_0082016
1596 Ga0501075_0096133
1597 Ga0501075_0137162
1598 Ga0501075_0185591
1599 Ga0501075_0191052
1600 Ga0501075_0225546
1601 Ga0501076_0000264
1602 Ga0501076_0001986
1603 Ga0501076_0004481
1604 Ga0501076_0016346
1605 Ga0501076_0037295
1606 Ga0501076_0061513
1607 Ga0501076_0067643
1608 Ga0501076_0079834
1609 Ga0501076_0095804
1610 Ga0501076_0096144
1611 Ga0501076_0150358
1612 Ga0501076_0333143
1613 Ga0501076_0443600
1614 Ga0501076_0470174
1615 Ga0501077_0000998
1616 Ga0501077_0005528
1617 Ga0501077_0006282
1618 Ga0501077_0014750
1619 Ga0501077_0025059
1620 Ga0501077_0127820
1621 Ga0501077_0140237
1622 Ga0501079_0000118
1623 Ga0501079_0006591
1624 Ga0501079_0008786
1625 Ga0501079_0029642
1626 Ga0501079_0036180
1627 Ga0501079_0038811
1628 Ga0501079_0041665
1629 Ga0501079_0057150
1630 Ga0501079_0060717
1631 Ga0501079_0106247
1632 Ga0501079_0137967
1633 Ga0501079_0185655
1634 Ga0501079_0256685
1635 Ga0501079_0300690
1636 Ga0501079_0650688
1637 Ga0501080_0009462
1638 Ga0501080_0016427
1639 Ga0501080_0028679
1640 Ga0501080_0050439
1641 Ga0501080_0064991
1642 Ga0501080_0092189
1643 Ga0501080_0208077
1644 Ga0501080_0257750
1645 Ga0501080_0412888
1646 Ga0501080_0486463
1647 Ga0501081_0002839
1648 Ga0501081_0034004
1649 Ga0501081_0058151
1650 Ga0501081_0070489
1651 Ga0501081_0086298
1652 Ga0501081_0143619
1653 Ga0501081_0178824
1654 Ga0501081_0254420
1655 Ga0501081_0574221
1656 Ga0501083_0006538
1657 Ga0501083_0009109
1658 Ga0501083_0023559
1659 Ga0501083_0115166
1660 Ga0501035_0012203
1661 Ga0501035_0017304
1662 Ga0501035_0018600
1663 Ga0501035_0023182
1664 Ga0501035_0083843
1665 Ga0501035_0151924
1666 Ga0501035_0157153
1667 Ga0501035_0333488
1668 Ga0501044_0000401
1669 Ga0501044_0001707
1670 Ga0501044_0050448
1671 Ga0501044_0089660
1672 Ga0501044_0094159
1673 Ga0501044_0396371
1674 Ga0501044_0466886
1675 Ga0501045_0000152
1676 Ga0501045_0004273
1677 Ga0501045_0010090
1678 Ga0501045_0019749
1679 Ga0501045_0020927
1680 Ga0501045_0022986
1681 Ga0501045_0037119
1682 Ga0501045_0074808
1683 Ga0501045_0081751
1684 Ga0501045_0109448
1685 Ga0501045_0121744
1686 Ga0501045_0125369
1687 Ga0501045_0147206
1688 Ga0501045_0156527
1689 Ga0501045_0259832
1690 nmdc:mga00v17_2504_c1
1691 nmdc:mga00v17_35056_c1
1692 nmdc:mga0yw44_13970_c1
1693 nmdc:mga0yw44_5760_c1
1694 nmdc:mga06z11_4138_c1
1695 nmdc:mga04h51_633_c1
1696 nmdc:mga07m45_156921_c1
1697 nmdc:mga07m45_23930_c1
1698 nmdc:mga07m45_62252_c1
1699 nmdc:mga05p37_132535_c1
1700 nmdc:mga05p37_15942_c1
1701 nmdc:mga05p37_2907_c1
1702 nmdc:mga05p37_38627_c1
1703 nmdc:mga05p37_497252_c1
1704 nmdc:mga05p37_62893_c1
1705 nmdc:mga05p37_881488_c1
1706 nmdc:mga09592_167807_c1
1707 nmdc:mga09592_205623_c1
1708 nmdc:mga09592_249_c1
1709 nmdc:mga09592_29730_c1
1710 nmdc:mga09592_318408_c1
1711 nmdc:mga0qj67_25818_c1
1712 nmdc:mga0qj67_423243_c1
1713 nmdc:mga0qj67_534872_c1
1714 nmdc:mga0qj67_54379_c1
1715 nmdc:mga06r32_12415_c1
1716 nmdc:mga06r32_225_c4
1717 nmdc:mga06r32_24715_c1
1718 nmdc:mga06r32_256153_c1
1719 nmdc:mga06r32_266_c1
1720 nmdc:mga06r32_281000_c1
1721 nmdc:mga06r32_85436_c1
1722 nmdc:mga08y16_11013_c1
1723 nmdc:mga08y16_231631_c1
1724 nmdc:mga08y16_47858_c1
1725 nmdc:mga08y16_57380_c1
1726 nmdc:mga08y16_79044_c1
1727 nmdc:mga0n895_25480_c1
1728 nmdc:mga0a205_16948_c1
1729 nmdc:mga0a205_201453_c1
1730 nmdc:mga0sz30_21950_c1
1731 nmdc:mga0sz30_92882_c1
1732 Ga0500643_006718
1733 Ga0500644_0003457
1734 Ga0500560_017676
1735 Ga0500608_139889
1736 Ga0500652_008752
1737 Ga0500658_0146002
1738 Ga0500559_0158724
1739 Ga0500568_0010217
1740 Ga0500616_0003919
1741 Ga0500616_0073033
1742 Ga0500627_0017663
1743 Ga0501084_0000607
1744 Ga0501084_0008161
1745 Ga0501084_0012072
1746 Ga0501084_0014901
1747 Ga0501084_0021076
1748 Ga0501084_0021133
1749 Ga0501084_0027041
1750 Ga0501084_0081507
1751 Ga0501084_0143679
1752 Ga0501084_0649217
1753 Ga0590077_002424
1754 Ga0501082_0000935
1755 Ga0501082_0029743
1756 Ga0501082_0034289
1757 Ga0501082_0036856
1758 Ga0501082_0039403
1759 Ga0501082_0068014
1760 Ga0501082_0079864
1761 Ga0501082_0138348
1762 Ga0501082_0158837
1763 Ga0501082_0176406
1764 Ga0501082_0177831
1765 Ga0501082_0232975
1766 Ga0501082_0391372
1767 Ga0501082_0430902
1768 Ga0466962_0029358
1769 Ga0466962_0086277
1770 Ga0530510_0000194
1771 Ga0530510_0000238
1772 Ga0530510_0005897
1773 Ga0530510_0007361
1774 Ga0530510_0012689
1775 Ga0530510_0014615
1776 Ga0530510_0025304
1777 Ga0530510_0037808
1778 Ga0530510_0046990
1779 Ga0530510_0062928
1780 Ga0530510_0115421
1781 Ga0530510_0134115
1782 Ga0530510_0199402
1783 2515852908
1784 2547407995
1785 2552109224
1786 2585300126
1787 2585308654
1788 2616695301
1789 2623502007
1790 2643765688
1791 2643888294
1792 2643898519
1793 2643948258
1794 2644264094
1795 2644388780
1796 2644406435
1797 2644429731
1798 2644436981
1799 2644459800
1800 2671834166
1801 2676473210
1802 2676489927
1803 2686538362
1804 2689990065
1805 2723642281
1806 2744954526
1807 2774852322
1808 2776376671
1809 2784588448
1810 2785343522
1811 2785369277
1812 2786670415
1813 2791913641
1814 2795796103
1815 2808841879
1816 2808920414
1817 2809232044
1818 2812358378
1819 2812480729
1820 2816426012
1821 2819697932
1822 2827631808
1823 2836165142
1824 2837272279
1825 2842138372
1826 2852636875
1827 2855671264
1828 2855682530
1829 2857291959
1830 2858850747
1831 2858871998
1832 2858883879
1833 2858889967
1834 2858900819
1835 2862285479
1836 2862386354
1837 2863073499
1838 2866556311
1839 2867371719
1840 2867430402
1841 2867478221
1842 2869054566
1843 2869063731
1844 2869070953
1845 2873314402
1846 2875394400
1847 2877681274
1848 2880499049
1849 2884694757
1850 2891331771
1851 2895436382
1852 2895447189
1853 2895890329
1854 2902587213
1855 2912720263
1856 2919469677
1857 2928143596
1858 2929215005
1859 2929227635
1860 2946050209
1861 2946067500
1862 2954007678
1863 2954386417
1864 2954676761
1865 2954687405
1866 2954697094
1867 2954705042
1868 2954716400
1869 2954726344
1870 2954735466
1871 2954745267
1872 2954754321
1873 2954764243
1874 2966602717
1875 2997600978
1876 3006496231
1877 8001783635
1878 8023628863
1879 8025536583
1880 8033691251
1881 8048134632
1882 8048410221
1883 8054164095
1884 8054705053
1885 8054735962
1886 8055071169
1887 8055175970
1888 8056671919

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

53

199

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

131

232

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9376 4 241
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9332 4 245
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.9328 3 242
5x41-assembly1.cif.gz_A 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9294 4 241
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9205 4 227
ID Description Score Start End Superfamily
af_Q2FUT2_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9451 1 241 3.40.50.300
af_Q2FW34_4_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9359 4 242 3.40.50.300
5x41A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9294 4 241 3.40.50.300
af_Q2FUT2_290_554_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9274 2 236 3.40.50.300
4huqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9228 6 242 3.40.50.300
ID Description Score Start End GO Terms
AF-D3PWB8-F1-model_v4 Cobalt ABC transporter, ATPase subunit 0.9872 6 244 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A4Q8CKR6-F1-model_v4 deleted 0.9755 1 251
AF-A0A357ZJT9-F1-model_v4 ABC transporter 0.966 2 222 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-F0T0Y4-F1-model_v4 Phosphonate-transporting ATPase (EC 3.6.3.28) 0.9632 6 242 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A6P2AC68-F1-model_v4 ABC transporter ATP-binding protein 0.9609 2 242 GO:0005524
GO:0016887
GO:0042626
GO:0043190

Map