F486386

General Info

Members Datasets Scaffolds Average Seq Length
943 368 933 149

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10403012|Ga0163161_104030121
Length 170
Sequence MAVSRTRPPMAFRRFEGKYRMRSFEHLTDLQPLVGQTIGVSDWITVTQERIQLFADATGDHQWIHLDAERAAKGPFGTTIAHGFLTLSLLPEMGASAFEVRDTRMGVNYGLGKVRFPAPVPSGSRLRGHFKLTRYEPLEGGAQLTVEVSMEREGSDKPVCVAESLARRYT

Samples

Sample ID Description Type Environment
1 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
2 2643221576 Nocardioides sp. Root614 Isolate Unclassified
3 2643221590 Nocardioides sp. Root682 Isolate Unclassified
4 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
7 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
8 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
9 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
238 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
239 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
242 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
243 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
244 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
245 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
279 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
331 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
351 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
354 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
355 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
356 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
357 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
358 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
359 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
360 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
363 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
364 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
365 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
368 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 0.53
Rhizoplane 1.7
Rhizosphere 79.96
Stem 0
Stem Tuber 0
Unclassified 6.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10037517 3300003320 Bacteria 1107
2 JGI25404J52841_10016749 3300003659 Bacteria 1590
3 JGI25404J52841_10054809 3300003659 Bacteria 837
4 Ga0055530_10004946 3300003791 Bacteria 6594
5 Ga0055530_10027959 3300003791 Bacteria 1530
6 Ga0055540_1000002 3300003792 Bacteria 436954
7 Ga0065715_10585454 3300005293 Bacteria 717
8 Ga0070658_10124698 3300005327 Bacteria 2143
9 Ga0070658_10314389 3300005327 Bacteria 1337
10 Ga0070676_10001571 3300005328 Bacteria 11600
11 Ga0070676_10042317 3300005328 Bacteria 2644
12 Ga0070676_10068364 3300005328 Bacteria 2126
13 Ga0070676_10387222 3300005328 Bacteria 969
14 Ga0070676_10546457 3300005328 Bacteria 828
15 Ga0070690_100033930 3300005330 Bacteria 3196
16 Ga0070670_100016337 3300005331 Bacteria 6375
17 Ga0070670_100023097 3300005331 Bacteria 5352
18 Ga0070670_100123241 3300005331 Bacteria 2236
19 Ga0070670_100141375 3300005331 Bacteria 2081
20 Ga0070670_100359317 3300005331 Bacteria 1280
21 Ga0070670_100374642 3300005331 Bacteria 1253
22 Ga0070670_100417055 3300005331 Bacteria 1186
23 Ga0070670_100954434 3300005331 Bacteria 779
24 Ga0070677_10082838 3300005333 Bacteria 1377
25 Ga0070677_10136908 3300005333 Bacteria 1125
26 Ga0068869_100239701 3300005334 Bacteria 1444
27 Ga0068869_100351437 3300005334 Bacteria 1202
28 Ga0068869_101320958 3300005334 Bacteria 637
29 Ga0068869_101787187 3300005334 Bacteria 550
30 Ga0070666_10003543 3300005335 Bacteria 9465
31 Ga0070666_10420505 3300005335 Bacteria 962
32 Ga0070666_10445832 3300005335 Bacteria 934
33 Ga0070666_10775274 3300005335 Bacteria 705
34 Ga0070666_10783492 3300005335 Bacteria 702
35 Ga0070680_100091888 3300005336 Bacteria 2513
36 Ga0070682_100280917 3300005337 Bacteria 1213
37 Ga0068868_100028329 3300005338 Bacteria 4281
38 Ga0068868_100034873 3300005338 Bacteria 3887
39 Ga0068868_100034996 3300005338 Bacteria 3881
40 Ga0068868_100057236 3300005338 Bacteria 3080
41 Ga0068868_100077111 3300005338 Bacteria 2666
42 Ga0068868_100106500 3300005338 Bacteria 2274
43 Ga0068868_100302618 3300005338 Bacteria 1358
44 Ga0070660_100047371 3300005339 Bacteria 3298
45 Ga0070660_100169936 3300005339 Bacteria 1760
46 Ga0070689_100584904 3300005340 Bacteria 965
47 Ga0070689_100929303 3300005340 Bacteria 771
48 Ga0070691_10117972 3300005341 Bacteria 1333
49 Ga0070691_10284518 3300005341 Bacteria 898
50 Ga0070687_100364528 3300005343 Bacteria 936
51 Ga0070661_100094009 3300005344 Bacteria 2221
52 Ga0070661_100484173 3300005344 Bacteria 988
53 Ga0070661_100511186 3300005344 Bacteria 962
54 Ga0070692_10303525 3300005345 Bacteria 975
55 Ga0070668_100045003 3300005347 Bacteria 3386
56 Ga0070668_100642543 3300005347 Bacteria 932
57 Ga0070668_100821385 3300005347 Bacteria 827
58 Ga0070669_100165601 3300005353 Bacteria 1720
59 Ga0070669_100176804 3300005353 Bacteria 1667
60 Ga0070669_100373046 3300005353 Bacteria 1162
61 Ga0070669_100545138 3300005353 Bacteria 966
62 Ga0070669_101486088 3300005353 Bacteria 589
63 Ga0070675_100063197 3300005354 Bacteria 3060
64 Ga0070675_100090116 3300005354 Bacteria 2568
65 Ga0070675_100154040 3300005354 Bacteria 1972
66 Ga0070675_100254286 3300005354 Bacteria 1538
67 Ga0070675_100289345 3300005354 Bacteria 1442
68 Ga0070671_100002227 3300005355 Bacteria 14969
69 Ga0070671_100045288 3300005355 Bacteria 3657
70 Ga0070671_100050018 3300005355 Bacteria 3477
71 Ga0070671_100167435 3300005355 Bacteria 1858
72 Ga0070671_100481259 3300005355 Bacteria 1067
73 Ga0070671_100499381 3300005355 Bacteria 1046
74 Ga0070671_101256382 3300005355 Bacteria 652
75 Ga0070674_100032527 3300005356 Bacteria 3464
76 Ga0070674_100033008 3300005356 Bacteria 3442
77 Ga0070674_100176767 3300005356 Bacteria 1632
78 Ga0070674_100284726 3300005356 Bacteria 1311
79 Ga0070674_100309447 3300005356 Bacteria 1262
80 Ga0070673_100018256 3300005364 Bacteria 5007
81 Ga0070673_100053712 3300005364 Bacteria 3166
82 Ga0070673_100069128 3300005364 Bacteria 2830
83 Ga0070673_100256307 3300005364 Bacteria 1527
84 Ga0070673_100332974 3300005364 Bacteria 1343
85 Ga0070673_100527740 3300005364 Bacteria 1070
86 Ga0070673_100639520 3300005364 Bacteria 973
87 Ga0070659_100147324 3300005366 Bacteria 1918
88 Ga0070659_100395090 3300005366 Bacteria 1166
89 Ga0070659_100537561 3300005366 Bacteria 999
90 Ga0070667_100000702 3300005367 Bacteria 32315
91 Ga0070667_100003128 3300005367 Bacteria 14211
92 Ga0070667_100108277 3300005367 Bacteria 2407
93 Ga0070667_100175632 3300005367 Bacteria 1893
94 Ga0070667_100400269 3300005367 Bacteria 1250
95 Ga0070667_100580586 3300005367 Bacteria 1032
96 Ga0070700_100024707 3300005441 Bacteria 3531
97 Ga0070708_100651983 3300005445 Bacteria 992
98 Ga0070663_100022607 3300005455 Bacteria 4206
99 Ga0070663_100037279 3300005455 Bacteria 3383
100 Ga0070663_100040976 3300005455 Bacteria 3245
101 Ga0070663_100273542 3300005455 Bacteria 1344
102 Ga0070663_100293745 3300005455 Bacteria 1299
103 Ga0070663_100736600 3300005455 Bacteria 841
104 Ga0070678_100015805 3300005456 Bacteria 4807
105 Ga0070678_100033253 3300005456 Bacteria 3578
106 Ga0070678_100117756 3300005456 Bacteria 2089
107 Ga0070678_100340408 3300005456 Bacteria 1287
108 Ga0070678_100776117 3300005456 Bacteria 868
109 Ga0070678_101122836 3300005456 Bacteria 726
110 Ga0070678_101827763 3300005456 Bacteria 573
111 Ga0070662_100010591 3300005457 Bacteria 6060
112 Ga0070662_100057619 3300005457 Bacteria 2823
113 Ga0070662_100117017 3300005457 Bacteria 2038
114 Ga0070662_100131601 3300005457 Bacteria 1929
115 Ga0070662_100393068 3300005457 Bacteria 1143
116 Ga0070662_100833994 3300005457 Unclassified 785
117 Ga0070681_10273319 3300005458 Bacteria 1601
118 Ga0068867_100002735 3300005459 Bacteria 12433
119 Ga0068867_100061849 3300005459 Bacteria 2781
120 Ga0068867_100068826 3300005459 Bacteria 2642
121 Ga0068867_100135893 3300005459 Bacteria 1916
122 Ga0068867_100166447 3300005459 Bacteria 1742
123 Ga0070685_10333550 3300005466 Bacteria 1032
124 Ga0070685_10746709 3300005466 Bacteria 717
125 Ga0070706_100000671 3300005467 Bacteria 38797
126 Ga0070706_100070158 3300005467 Bacteria 3241
127 Ga0070707_100009411 3300005468 Bacteria 9069
128 Ga0070679_100026370 3300005530 Bacteria 5709
129 Ga0070679_100547700 3300005530 Bacteria 1101
130 Ga0070684_101140537 3300005535 Bacteria 733
131 Ga0068853_100108400 3300005539 Bacteria 2464
132 Ga0068853_100433149 3300005539 Bacteria 1235
133 Ga0070672_100002315 3300005543 Bacteria 12032
134 Ga0070672_100028972 3300005543 Bacteria 4146
135 Ga0070672_100038652 3300005543 Bacteria 3649
136 Ga0070672_100084456 3300005543 Bacteria 2549
137 Ga0070672_100090945 3300005543 Bacteria 2462
138 Ga0070672_100136490 3300005543 Bacteria 2020
139 Ga0070672_100171686 3300005543 Bacteria 1804
140 Ga0070672_100224675 3300005543 Bacteria 1576
141 Ga0070672_100259699 3300005543 Bacteria 1464
142 Ga0070672_100397711 3300005543 Bacteria 1181
143 Ga0070672_100410615 3300005543 Bacteria 1162
144 Ga0070672_100665794 3300005543 Bacteria 910
145 Ga0070693_100071429 3300005547 Bacteria 2045
146 Ga0070665_100233384 3300005548 Bacteria 1840
147 Ga0070704_100545621 3300005549 Bacteria 1012
148 Ga0068855_100004988 3300005563 Bacteria 16202
149 Ga0068855_100729089 3300005563 Bacteria 1058
150 Ga0070664_100033760 3300005564 Bacteria 4288
151 Ga0070664_100182376 3300005564 Bacteria 1866
152 Ga0070664_100871420 3300005564 Bacteria 843
153 Ga0070664_101279357 3300005564 Bacteria 692
154 Ga0068857_100013080 3300005577 Bacteria 7231
155 Ga0068857_100089872 3300005577 Bacteria 2748
156 Ga0068854_100045777 3300005578 Bacteria 3112
157 Ga0068854_100530591 3300005578 Bacteria 995
158 Ga0068854_100543221 3300005578 Bacteria 984
159 Ga0068854_100678904 3300005578 Bacteria 887
160 Ga0070702_100150142 3300005615 Bacteria 1495
161 Ga0068852_100192879 3300005616 Bacteria 1923
162 Ga0068852_100264517 3300005616 Bacteria 1652
163 Ga0068852_100273340 3300005616 Bacteria 1627
164 Ga0068852_100409503 3300005616 Bacteria 1335
165 Ga0068852_100585553 3300005616 Bacteria 1119
166 Ga0068852_100871834 3300005616 Bacteria 916
167 Ga0068852_101784896 3300005616 Bacteria 637
168 Ga0068859_100055119 3300005617 Bacteria 4000
169 Ga0068859_100351485 3300005617 Bacteria 1569
170 Ga0068859_101416460 3300005617 Bacteria 767
171 Ga0068864_100043014 3300005618 Bacteria 3866
172 Ga0068864_100048474 3300005618 Bacteria 3652
173 Ga0068864_100181312 3300005618 Bacteria 1925
174 Ga0068866_10027930 3300005718 Bacteria 2684
175 Ga0068866_10412886 3300005718 Bacteria 874
176 Ga0068861_100004858 3300005719 Bacteria 9039
177 Ga0068861_100374752 3300005719 Bacteria 1256
178 Ga0068851_10041380 3300005834 Bacteria 2316
179 Ga0068863_100018157 3300005841 Bacteria 6736
180 Ga0068863_100023761 3300005841 Bacteria 5848
181 Ga0068863_100052850 3300005841 Bacteria 3849
182 Ga0068863_100059049 3300005841 Bacteria 3629
183 Ga0068863_100237760 3300005841 Bacteria 1758
184 Ga0068863_100971013 3300005841 Bacteria 852
185 Ga0068863_101171557 3300005841 Bacteria 774
186 Ga0068863_101516845 3300005841 Bacteria 679
187 Ga0068858_100051286 3300005842 Bacteria 3817
188 Ga0068860_100055844 3300005843 Bacteria 3754
189 Ga0068860_100064811 3300005843 Bacteria 3470
190 Ga0068860_100359658 3300005843 Bacteria 1434
191 Ga0068862_100124433 3300005844 Bacteria 2275
192 Ga0068862_101071626 3300005844 Bacteria 800
193 Ga0081455_10504311 3300005937 Bacteria 812
194 Ga0081540_1000011 3300005983 Bacteria 191880
195 Ga0081540_1000327 3300005983 Bacteria 49238
196 Ga0081540_1006280 3300005983 Bacteria 8696
197 Ga0081540_1019580 3300005983 Bacteria 4105
198 Ga0075365_10001258 3300006038 Bacteria 11238
199 Ga0075365_10013219 3300006038 Bacteria 4926
200 Ga0075365_10105522 3300006038 Bacteria 1933
201 Ga0075365_10311037 3300006038 Bacteria 1109
202 Ga0075368_10018388 3300006042 Bacteria 2626
203 Ga0075363_100006739 3300006048 Bacteria 5244
204 Ga0075363_100180366 3300006048 Bacteria 1201
205 Ga0075363_100370142 3300006048 Bacteria 839
206 Ga0075363_100722228 3300006048 Bacteria 603
207 Ga0075364_10004205 3300006051 Bacteria 8261
208 Ga0070716_100198683 3300006173 Bacteria 1331
209 Ga0075362_10009819 3300006177 Bacteria 3715
210 Ga0075362_10017212 3300006177 Bacteria 2975
211 Ga0075362_10030180 3300006177 Bacteria 2340
212 Ga0075362_10073657 3300006177 Bacteria 1563
213 Ga0075367_10000286 3300006178 Bacteria 17670
214 Ga0075367_10010668 3300006178 Bacteria 4835
215 Ga0075367_10015646 3300006178 Bacteria 4129
216 Ga0075367_10066306 3300006178 Bacteria 2163
217 Ga0075367_10186438 3300006178 Bacteria 1294
218 Ga0075369_10001735 3300006186 Bacteria 7544
219 Ga0075369_10066707 3300006186 Bacteria 1579
220 Ga0075366_10001659 3300006195 Bacteria 11175
221 Ga0075366_10140627 3300006195 Bacteria 1459
222 Ga0075366_10141490 3300006195 Bacteria 1455
223 Ga0075366_10188777 3300006195 Bacteria 1252
224 Ga0075366_10510727 3300006195 Bacteria 743
225 Ga0097621_100027899 3300006237 Bacteria 4445
226 Ga0097621_100267567 3300006237 Bacteria 1501
227 Ga0097621_100282822 3300006237 Bacteria 1460
228 Ga0097621_100513610 3300006237 Bacteria 1087
229 Ga0097621_100822595 3300006237 Bacteria 861
230 Ga0097621_101136710 3300006237 Bacteria 734
231 Ga0097621_101230784 3300006237 Bacteria 706
232 Ga0097621_101385036 3300006237 Bacteria 666
233 Ga0075370_10003013 3300006353 Bacteria 7936
234 Ga0075370_10008160 3300006353 Bacteria 5373
235 Ga0075370_10031485 3300006353 Bacteria 2961
236 Ga0075370_10040724 3300006353 Bacteria 2621
237 Ga0075370_10091911 3300006353 Bacteria 1751
238 Ga0075370_10298113 3300006353 Bacteria 958
239 Ga0075370_10345216 3300006353 Bacteria 889
240 Ga0075370_10582564 3300006353 Bacteria 677
241 Ga0068871_100048558 3300006358 Bacteria 3427
242 Ga0068871_100094270 3300006358 Bacteria 2499
243 Ga0068871_100120272 3300006358 Bacteria 2218
244 Ga0068871_100213010 3300006358 Bacteria 1671
245 Ga0068871_100240650 3300006358 Bacteria 1573
246 Ga0068871_100608077 3300006358 Bacteria 995
247 Ga0075428_100041134 3300006844 Bacteria 5084
248 Ga0075428_101223213 3300006844 Unclassified 791
249 Ga0075428_101874561 3300006844 Bacteria 623
250 Ga0075430_100146389 3300006846 Bacteria 1967
251 Ga0075430_100317471 3300006846 Bacteria 1288
252 Ga0075431_100016231 3300006847 Bacteria 7555
253 Ga0075431_100086702 3300006847 Bacteria 3231
254 Ga0075431_100274045 3300006847 Unclassified 1709
255 Ga0075429_100047414 3300006880 Bacteria 3738
256 Ga0075429_100511611 3300006880 Bacteria 1052
257 Ga0075429_100693419 3300006880 Bacteria 892
258 Ga0068865_100004931 3300006881 Bacteria 8069
259 Ga0068865_100008008 3300006881 Bacteria 6525
260 Ga0068865_100111196 3300006881 Bacteria 2021
261 Ga0068865_100282035 3300006881 Bacteria 1323
262 Ga0068865_100478896 3300006881 Bacteria 1034
263 Ga0068865_100676425 3300006881 Bacteria 880
264 Ga0075436_101000948 3300006914 Bacteria 627
265 Ga0097620_100055123 3300006931 Bacteria 4000
266 Ga0097620_100351509 3300006931 Bacteria 1569
267 Ga0097620_101416543 3300006931 Bacteria 767
268 Ga0079104_1000839 3300006946 Bacteria 25542
269 Ga0099795_10000876 3300007788 Bacteria 6045
270 Ga0099795_10011399 3300007788 Bacteria 2657
271 Ga0105240_10156411 3300009093 Bacteria 2710
272 Ga0105240_10156460 3300009093 Bacteria 2710
273 Ga0111539_10022520 3300009094 Bacteria 7740
274 Ga0111539_10030368 3300009094 Bacteria 6569
275 Ga0111539_10483084 3300009094 Bacteria 1443
276 Ga0111539_11104195 3300009094 Bacteria 922
277 Ga0105245_10189019 3300009098 Bacteria 1972
278 Ga0105245_10472989 3300009098 Bacteria 1265
279 Ga0105245_10568449 3300009098 Bacteria 1157
280 Ga0105245_10606543 3300009098 Bacteria 1122
281 Ga0105245_10875070 3300009098 Bacteria 939
282 Ga0105247_10287505 3300009101 Bacteria 1136
283 Ga0105247_10354331 3300009101 Bacteria 1033
284 Ga0114129_10025035 3300009147 Bacteria 8460
285 Ga0114129_10360430 3300009147 Bacteria 1924
286 Ga0114129_13056944 3300009147 Bacteria 548
287 Ga0105243_10262108 3300009148 Bacteria 1548
288 Ga0105243_10418367 3300009148 Bacteria 1249
289 Ga0105243_10690076 3300009148 Bacteria 994
290 Ga0105243_11475344 3300009148 Bacteria 703
291 Ga0105241_10331738 3300009174 Bacteria 1315
292 Ga0105242_10057880 3300009176 Bacteria 3175
293 Ga0105242_10541384 3300009176 Bacteria 1114
294 Ga0105242_10704468 3300009176 Bacteria 988
295 Ga0105248_10015932 3300009177 Bacteria 8278
296 Ga0105248_10044985 3300009177 Bacteria 4950
297 Ga0105248_10059293 3300009177 Bacteria 4299
298 Ga0105248_10146437 3300009177 Bacteria 2665
299 Ga0105248_10584820 3300009177 Bacteria 1260
300 Ga0105248_10648769 3300009177 Bacteria 1191
301 Ga0105248_10712936 3300009177 Bacteria 1132
302 Ga0105248_10746295 3300009177 Bacteria 1104
303 Ga0105248_10784767 3300009177 Bacteria 1075
304 Ga0105248_11176691 3300009177 Bacteria 867
305 Ga0105248_12203579 3300009177 Bacteria 627
306 Ga0105237_10015172 3300009545 Bacteria 8028
307 Ga0105237_10121851 3300009545 Bacteria 2602
308 Ga0105237_10298827 3300009545 Bacteria 1613
309 Ga0105238_10005340 3300009551 Bacteria 12696
310 Ga0105238_10063203 3300009551 Bacteria 3702
311 Ga0105238_11562495 3300009551 Bacteria 689
312 Ga0105249_10006344 3300009553 Bacteria 10278
313 Ga0105249_10010010 3300009553 Bacteria 8320
314 Ga0105249_10393485 3300009553 Bacteria 1414
315 Ga0105249_11885151 3300009553 Bacteria 670
316 Ga0099796_10093126 3300010159 Bacteria 1123
317 Ga0105239_10071838 3300010375 Bacteria 3802
318 Ga0105239_10079663 3300010375 Bacteria 3604
319 Ga0105246_10311415 3300011119 Bacteria 1275
320 Ga0105246_10613197 3300011119 Bacteria 942
321 Ga0157369_10323014 3300013105 Bacteria 1604
322 Ga0157374_10003619 3300013296 Bacteria 13010
323 Ga0157374_10040378 3300013296 Bacteria 4297
324 Ga0157374_10218393 3300013296 Bacteria 1870
325 Ga0157374_10516831 3300013296 Bacteria 1200
326 Ga0157374_10638186 3300013296 Bacteria 1076
327 Ga0157374_10716923 3300013296 Bacteria 1014
328 Ga0157378_10129320 3300013297 Bacteria 2336
329 Ga0157378_10743273 3300013297 Bacteria 1003
330 Ga0163162_10005745 3300013306 Bacteria 11999
331 Ga0163162_10131671 3300013306 Bacteria 2609
332 Ga0163162_10169211 3300013306 Bacteria 2310
333 Ga0163162_10346750 3300013306 Bacteria 1618
334 Ga0163162_10414512 3300013306 Bacteria 1479
335 Ga0163162_10957664 3300013306 Bacteria 967
336 Ga0163162_11105783 3300013306 Bacteria 898
337 Ga0163162_11152829 3300013306 Bacteria 879
338 Ga0163162_11900402 3300013306 Bacteria 681
339 Ga0157372_11888685 3300013307 Bacteria 686
340 Ga0157375_10015577 3300013308 Bacteria 6809
341 Ga0157375_10040729 3300013308 Bacteria 4481
342 Ga0157375_10087592 3300013308 Bacteria 3166
343 Ga0157375_10132947 3300013308 Bacteria 2609
344 Ga0157375_10194002 3300013308 Bacteria 2186
345 Ga0157375_10593668 3300013308 Bacteria 1267
346 Ga0157375_10807015 3300013308 Bacteria 1087
347 Ga0163163_10958237 3300014325 Bacteria 919
348 Ga0157380_10009952 3300014326 Bacteria 6824
349 Ga0157380_10044486 3300014326 Bacteria 3480
350 Ga0157380_11619408 3300014326 Bacteria 703
351 Ga0182008_10158316 3300014497 Unclassified 1138
352 Ga0157377_10830713 3300014745 Unclassified 684
353 Ga0157379_10008063 3300014968 Bacteria 9147
354 Ga0157379_10160745 3300014968 Bacteria 2027
355 Ga0157379_10387042 3300014968 Bacteria 1284
356 Ga0157376_10016653 3300014969 Bacteria 5587
357 Ga0157376_10059288 3300014969 Bacteria 3209
358 Ga0157376_10221927 3300014969 Bacteria 1751
359 Ga0157376_10673285 3300014969 Bacteria 1037
360 Ga0157376_10893854 3300014969 Bacteria 906
361 Ga0157376_11337024 3300014969 Bacteria 747
362 Ga0157376_12112069 3300014969 Bacteria 602
363 Ga0163161_10107886 3300017792 Bacteria 2078
364 Ga0163161_10403012 3300017792 Bacteria 1097
365 Ga0163161_10596864 3300017792 Bacteria 910
366 Ga0213875_10136673 3300021388 Bacteria 1146
367 Ga0209675_1015366 3300025291 Bacteria 2277
368 Ga0209050_1001035 3300025298 Bacteria 34509
369 Ga0209050_1007995 3300025298 Bacteria 5770
370 Ga0209256_1000143 3300025299 Bacteria 151331
371 Ga0209051_1000024 3300025303 Bacteria 437007
372 Ga0209257_1000079 3300025304 Bacteria 316420
373 Ga0209257_1040119 3300025304 Bacteria 1400
374 Ga0207697_10011942 3300025315 Bacteria 3658
375 Ga0207697_10036965 3300025315 Bacteria 2000
376 Ga0207656_10084860 3300025321 Bacteria 1429
377 Ga0207656_10341297 3300025321 Bacteria 746
378 Ga0207682_10009193 3300025893 Bacteria 3903
379 Ga0207682_10018630 3300025893 Bacteria 2715
380 Ga0207682_10088909 3300025893 Bacteria 1336
381 Ga0207642_10004867 3300025899 Bacteria 4349
382 Ga0207642_10168536 3300025899 Bacteria 1183
383 Ga0207688_10077825 3300025901 Bacteria 1890
384 Ga0207688_10335936 3300025901 Bacteria 929
385 Ga0207680_10014466 3300025903 Bacteria 4085
386 Ga0207680_10379220 3300025903 Bacteria 997
387 Ga0207680_10388298 3300025903 Bacteria 985
388 Ga0207685_10145266 3300025905 Bacteria 1068
389 Ga0207645_10001208 3300025907 Bacteria 21313
390 Ga0207645_10063363 3300025907 Bacteria 2362
391 Ga0207645_10221700 3300025907 Bacteria 1247
392 Ga0207645_10230742 3300025907 Bacteria 1222
393 Ga0207645_10235704 3300025907 Bacteria 1208
394 Ga0207645_10276870 3300025907 Bacteria 1114
395 Ga0207645_10448855 3300025907 Bacteria 870
396 Ga0207643_10058333 3300025908 Bacteria 2200
397 Ga0207643_10141221 3300025908 Bacteria 1439
398 Ga0207643_10375273 3300025908 Bacteria 896
399 Ga0207705_10100307 3300025909 Bacteria 2129
400 Ga0207705_10531408 3300025909 Bacteria 914
401 Ga0207684_10000939 3300025910 Bacteria 32889
402 Ga0207684_10213189 3300025910 Bacteria 1666
403 Ga0207654_10150347 3300025911 Bacteria 1494
404 Ga0207695_10139621 3300025913 Bacteria 2373
405 Ga0207671_10026777 3300025914 Bacteria 4315
406 Ga0207671_10113189 3300025914 Bacteria 2067
407 Ga0207671_10320783 3300025914 Bacteria 1226
408 Ga0207660_10625957 3300025917 Bacteria 877
409 Ga0207662_10025459 3300025918 Bacteria 3408
410 Ga0207657_10039408 3300025919 Bacteria 4200
411 Ga0207657_10288215 3300025919 Bacteria 1302
412 Ga0207657_10544963 3300025919 Bacteria 907
413 Ga0207657_10739657 3300025919 Bacteria 762
414 Ga0207652_10096850 3300025921 Bacteria 2600
415 Ga0207652_10433227 3300025921 Bacteria 1186
416 Ga0207646_10163030 3300025922 Bacteria 2012
417 Ga0207646_10742048 3300025922 Bacteria 876
418 Ga0207681_10004559 3300025923 Bacteria 8524
419 Ga0207681_10058879 3300025923 Bacteria 2632
420 Ga0207694_10067262 3300025924 Bacteria 2797
421 Ga0207694_10168524 3300025924 Bacteria 1772
422 Ga0207650_10002985 3300025925 Bacteria 11671
423 Ga0207650_10005604 3300025925 Bacteria 8578
424 Ga0207650_10074941 3300025925 Bacteria 2552
425 Ga0207650_10101123 3300025925 Bacteria 2219
426 Ga0207650_10292567 3300025925 Bacteria 1328
427 Ga0207650_10423975 3300025925 Bacteria 1104
428 Ga0207650_10453781 3300025925 Bacteria 1067
429 Ga0207650_10713305 3300025925 Bacteria 848
430 Ga0207659_10069997 3300025926 Bacteria 2557
431 Ga0207659_10095714 3300025926 Bacteria 2227
432 Ga0207659_10116718 3300025926 Bacteria 2038
433 Ga0207659_10165772 3300025926 Bacteria 1739
434 Ga0207659_10261958 3300025926 Bacteria 1407
435 Ga0207659_10298933 3300025926 Bacteria 1321
436 Ga0207659_10319657 3300025926 Bacteria 1280
437 Ga0207659_10335299 3300025926 Bacteria 1251
438 Ga0207659_10580741 3300025926 Bacteria 954
439 Ga0207687_10075351 3300025927 Bacteria 2421
440 Ga0207687_10082961 3300025927 Bacteria 2319
441 Ga0207687_10118635 3300025927 Bacteria 1975
442 Ga0207664_10685375 3300025929 Bacteria 921
443 Ga0207644_10008221 3300025931 Bacteria 6834
444 Ga0207644_10086886 3300025931 Bacteria 2323
445 Ga0207644_10127733 3300025931 Bacteria 1942
446 Ga0207644_10153745 3300025931 Bacteria 1782
447 Ga0207644_10155868 3300025931 Bacteria 1771
448 Ga0207644_10304472 3300025931 Bacteria 1285
449 Ga0207644_10618399 3300025931 Bacteria 900
450 Ga0207690_11545370 3300025932 Bacteria 555
451 Ga0207706_10013363 3300025933 Bacteria 7469
452 Ga0207706_10102439 3300025933 Bacteria 2519
453 Ga0207706_10159032 3300025933 Bacteria 1986
454 Ga0207706_10172280 3300025933 Bacteria 1902
455 Ga0207706_10355061 3300025933 Bacteria 1274
456 Ga0207706_10395302 3300025933 Bacteria 1199
457 Ga0207706_10709514 3300025933 Bacteria 859
458 Ga0207706_11265749 3300025933 Bacteria 611
459 Ga0207686_10012711 3300025934 Bacteria 4634
460 Ga0207686_10236380 3300025934 Bacteria 1328
461 Ga0207686_11108665 3300025934 Bacteria 645
462 Ga0207709_10010252 3300025935 Bacteria 5162
463 Ga0207709_10102813 3300025935 Bacteria 1892
464 Ga0207709_10131907 3300025935 Bacteria 1704
465 Ga0207709_10314345 3300025935 Bacteria 1170
466 Ga0207670_10664012 3300025936 Bacteria 860
467 Ga0207670_11307063 3300025936 Bacteria 615
468 Ga0207669_10003010 3300025937 Bacteria 7252
469 Ga0207669_10025177 3300025937 Bacteria 3211
470 Ga0207669_10174143 3300025937 Bacteria 1535
471 Ga0207669_10655080 3300025937 Bacteria 859
472 Ga0207704_10090498 3300025938 Bacteria 2008
473 Ga0207704_10127219 3300025938 Bacteria 1756
474 Ga0207704_10415419 3300025938 Bacteria 1065
475 Ga0207704_10571005 3300025938 Bacteria 922
476 Ga0207704_10896347 3300025938 Bacteria 746
477 Ga0207691_10001739 3300025940 Bacteria 21471
478 Ga0207691_10004984 3300025940 Bacteria 12808
479 Ga0207691_10005163 3300025940 Bacteria 12608
480 Ga0207691_10075981 3300025940 Bacteria 3028
481 Ga0207691_10195709 3300025940 Bacteria 1761
482 Ga0207691_10215824 3300025940 Bacteria 1665
483 Ga0207691_10267612 3300025940 Bacteria 1472
484 Ga0207691_10369720 3300025940 Bacteria 1225
485 Ga0207691_10371320 3300025940 Bacteria 1222
486 Ga0207691_10654788 3300025940 Bacteria 887
487 Ga0207711_10006629 3300025941 Bacteria 9754
488 Ga0207711_10011087 3300025941 Bacteria 7491
489 Ga0207711_10121741 3300025941 Bacteria 2330
490 Ga0207711_10307864 3300025941 Bacteria 1462
491 Ga0207711_10474460 3300025941 Bacteria 1165
492 Ga0207689_10043632 3300025942 Bacteria 3707
493 Ga0207689_10178173 3300025942 Bacteria 1753
494 Ga0207689_10184318 3300025942 Bacteria 1722
495 Ga0207689_10241921 3300025942 Bacteria 1492
496 Ga0207689_10249506 3300025942 Bacteria 1468
497 Ga0207689_10310633 3300025942 Bacteria 1307
498 Ga0207689_11000290 3300025942 Bacteria 705
499 Ga0207679_10192108 3300025945 Bacteria 1698
500 Ga0207679_11274601 3300025945 Bacteria 674
501 Ga0207679_11685404 3300025945 Bacteria 580
502 Ga0207667_10126181 3300025949 Bacteria 2636
503 Ga0207667_10589870 3300025949 Bacteria 1121
504 Ga0207651_10017871 3300025960 Bacteria 4202
505 Ga0207651_10051418 3300025960 Bacteria 2803
506 Ga0207651_10055941 3300025960 Bacteria 2712
507 Ga0207651_10085627 3300025960 Bacteria 2287
508 Ga0207651_10153823 3300025960 Bacteria 1794
509 Ga0207651_10218471 3300025960 Bacteria 1539
510 Ga0207651_10758327 3300025960 Bacteria 858
511 Ga0207651_11344336 3300025960 Bacteria 643
512 Ga0207712_10024976 3300025961 Bacteria 3965
513 Ga0207668_10001265 3300025972 Bacteria 15064
514 Ga0207668_10177563 3300025972 Unclassified 1677
515 Ga0207668_10457355 3300025972 Bacteria 1091
516 Ga0207668_10566690 3300025972 Bacteria 986
517 Ga0207640_10028863 3300025981 Bacteria 3398
518 Ga0207640_10029852 3300025981 Bacteria 3352
519 Ga0207640_10086364 3300025981 Bacteria 2160
520 Ga0207640_10849834 3300025981 Bacteria 794
521 Ga0207640_11077226 3300025981 Bacteria 710
522 Ga0207658_10001317 3300025986 Bacteria 19462
523 Ga0207658_10001833 3300025986 Bacteria 15912
524 Ga0207658_10101284 3300025986 Bacteria 2257
525 Ga0207658_10233773 3300025986 Bacteria 1553
526 Ga0207658_10971784 3300025986 Bacteria 774
527 Ga0207677_10039410 3300026023 Bacteria 3106
528 Ga0207677_10042848 3300026023 Bacteria 3005
529 Ga0207677_10069882 3300026023 Bacteria 2472
530 Ga0207677_10072814 3300026023 Bacteria 2431
531 Ga0207677_10113911 3300026023 Bacteria 2020
532 Ga0207677_10316112 3300026023 Bacteria 1296
533 Ga0207677_10502920 3300026023 Bacteria 1048
534 Ga0207677_11191401 3300026023 Bacteria 697
535 Ga0207703_10010751 3300026035 Bacteria 7144
536 Ga0207703_10772824 3300026035 Bacteria 916
537 Ga0207639_10417404 3300026041 Bacteria 1212
538 Ga0207639_10451271 3300026041 Bacteria 1167
539 Ga0207639_10611751 3300026041 Bacteria 1005
540 Ga0207678_10041283 3300026067 Bacteria 4000
541 Ga0207678_10139706 3300026067 Bacteria 2067
542 Ga0207678_10164477 3300026067 Bacteria 1895
543 Ga0207678_10169289 3300026067 Bacteria 1865
544 Ga0207678_10189384 3300026067 Bacteria 1758
545 Ga0207678_11067837 3300026067 Bacteria 715
546 Ga0207708_10004053 3300026075 Bacteria 10768
547 Ga0207708_10254625 3300026075 Bacteria 1416
548 Ga0207708_11277283 3300026075 Bacteria 643
549 Ga0207702_10260894 3300026078 Bacteria 1631
550 Ga0207641_10004293 3300026088 Bacteria 12387
551 Ga0207641_10009403 3300026088 Bacteria 8054
552 Ga0207641_10044969 3300026088 Bacteria 3715
553 Ga0207641_10180189 3300026088 Bacteria 1935
554 Ga0207641_10556671 3300026088 Bacteria 1119
555 Ga0207648_10002159 3300026089 Bacteria 21380
556 Ga0207648_10023940 3300026089 Bacteria 5459
557 Ga0207648_10035287 3300026089 Bacteria 4406
558 Ga0207648_10048342 3300026089 Bacteria 3724
559 Ga0207648_10156235 3300026089 Bacteria 2014
560 Ga0207648_10328313 3300026089 Bacteria 1376
561 Ga0207648_10389766 3300026089 Bacteria 1261
562 Ga0207648_10429984 3300026089 Bacteria 1200
563 Ga0207676_10017462 3300026095 Bacteria 5200
564 Ga0207676_10032829 3300026095 Bacteria 3916
565 Ga0207676_10073828 3300026095 Bacteria 2746
566 Ga0207676_10429247 3300026095 Bacteria 1241
567 Ga0207676_10786405 3300026095 Bacteria 927
568 Ga0207674_10029584 3300026116 Bacteria 5766
569 Ga0207674_11771012 3300026116 Bacteria 585
570 Ga0207675_100003876 3300026118 Bacteria 14539
571 Ga0207675_100290182 3300026118 Bacteria 1591
572 Ga0207683_10045327 3300026121 Bacteria 3845
573 Ga0207683_10075715 3300026121 Bacteria 2979
574 Ga0207683_10076066 3300026121 Bacteria 2973
575 Ga0207683_10153509 3300026121 Bacteria 2079
576 Ga0207683_10164948 3300026121 Bacteria 2004
577 Ga0207683_10274998 3300026121 Bacteria 1539
578 Ga0207698_10095185 3300026142 Bacteria 2451
579 Ga0207698_10154618 3300026142 Bacteria 1996
580 Ga0207698_10160940 3300026142 Bacteria 1963
581 Ga0207698_10197965 3300026142 Bacteria 1796
582 Ga0207698_10240499 3300026142 Bacteria 1650
583 Ga0209281_1000307 3300027111 Bacteria 87401
584 Ga0209813_10001234 3300027866 Bacteria 5705
585 Ga0209813_10089852 3300027866 Bacteria 1029
586 Ga0207428_10018366 3300027907 Bacteria 5975
587 Ga0268266_10187818 3300028379 Bacteria 1885
588 Ga0268266_10197401 3300028379 Bacteria 1840
589 Ga0268266_10617744 3300028379 Bacteria 1042
590 Ga0268265_10006093 3300028380 Bacteria 8188
591 Ga0268265_11781884 3300028380 Bacteria 622
592 Ga0268264_10001228 3300028381 Bacteria 24612
593 Ga0268264_10426928 3300028381 Bacteria 1279
594 Ga0307517_10001591 3300028786 Bacteria 37812
595 Ga0307517_10088858 3300028786 Bacteria 2550
596 Ga0307517_10138346 3300028786 Bacteria 1721
597 Ga0307515_10058252 3300028794 Bacteria 5567
598 Ga0307515_10092799 3300028794 Bacteria 3752
599 Ga0307515_10311869 3300028794 Bacteria 1247
600 Ga0307515_10543742 3300028794 Bacteria 771
601 Ga0265338_10136903 3300028800 Bacteria 1924
602 Ga0307511_10000025 3300030521 Bacteria 112344
603 Ga0307512_10022579 3300030522 Bacteria 5647
604 Ga0307512_10135032 3300030522 Bacteria 1531
605 Ga0307512_10137616 3300030522 Bacteria 1506
606 Ga0265316_10286091 3300031344 Bacteria 1204
607 Ga0307513_10016408 3300031456 Bacteria 8931
608 Ga0307513_10512147 3300031456 Bacteria 916
609 Ga0307509_10002193 3300031507 Bacteria 32050
610 Ga0307509_10004459 3300031507 Bacteria 20160
611 Ga0307509_10050222 3300031507 Bacteria 4467
612 Ga0307509_10117181 3300031507 Bacteria 2651
613 Ga0307509_10137647 3300031507 Bacteria 2384
614 Ga0307509_10159898 3300031507 Bacteria 2152
615 Ga0307509_10271111 3300031507 Bacteria 1465
616 Ga0307509_10276381 3300031507 Bacteria 1444
617 Ga0307509_10417158 3300031507 Bacteria 1044
618 Ga0307408_100075405 3300031548 Bacteria 2506
619 Ga0307508_10002730 3300031616 Bacteria 18451
620 Ga0307508_10036341 3300031616 Bacteria 4435
621 Ga0307508_10129465 3300031616 Bacteria 2127
622 Ga0307508_10468456 3300031616 Bacteria 853
623 Ga0307514_10158267 3300031649 Bacteria 1505
624 Ga0307514_10288771 3300031649 Bacteria 930
625 Ga0307516_10047244 3300031730 Bacteria 4243
626 Ga0307516_10112068 3300031730 Bacteria 2529
627 Ga0307516_10382196 3300031730 Bacteria 1069
628 Ga0307516_10539309 3300031730 Bacteria 820
629 Ga0307516_10981260 3300031730 Bacteria 516
630 Ga0307405_10012488 3300031731 Bacteria 4499
631 Ga0307405_10656239 3300031731 Bacteria 863
632 Ga0307405_11600751 3300031731 Bacteria 575
633 Ga0307405_12071108 3300031731 Bacteria 510
634 Ga0307413_10267905 3300031824 Bacteria 1277
635 Ga0307410_10116241 3300031852 Bacteria 1943
636 Ga0307410_10203428 3300031852 Bacteria 1513
637 Ga0307410_10953155 3300031852 Bacteria 738
638 Ga0307406_10010094 3300031901 Bacteria 5318
639 Ga0307406_10029558 3300031901 Bacteria 3320
640 Ga0307406_10704297 3300031901 Bacteria 843
641 Ga0307406_11041100 3300031901 Bacteria 704
642 Ga0307407_10145162 3300031903 Bacteria 1535
643 Ga0307407_10219073 3300031903 Bacteria 1286
644 Ga0307409_100003397 3300031995 Bacteria 8643
645 Ga0307409_100036260 3300031995 Bacteria 3623
646 Ga0307409_101023067 3300031995 Bacteria 845
647 Ga0307416_100019017 3300032002 Bacteria 4859
648 Ga0307416_100082465 3300032002 Bacteria 2724
649 Ga0307416_101101464 3300032002 Bacteria 899
650 Ga0307414_10028282 3300032004 Bacteria 3634
651 Ga0307411_10009952 3300032005 Bacteria 5037
652 Ga0307411_10070966 3300032005 Bacteria 2359
653 Ga0307411_10075739 3300032005 Bacteria 2298
654 Ga0307415_100152118 3300032126 Bacteria 1782
655 Ga0307415_100332020 3300032126 Bacteria 1273
656 Ga0307415_100407844 3300032126 Bacteria 1162
657 Ga0307507_10273752 3300033179 Bacteria 1063
658 Ga0307510_10000290 3300033180 Bacteria 46315
659 Ga0307510_10106360 3300033180 Bacteria 2569
660 Ga0307510_10170824 3300033180 Bacteria 1753
661 Ga0373926_0003365 3300035083 Bacteria 5148
662 Ga0373934_0072616 3300035086 Bacteria 1377
663 Ga0373944_0049245 3300035089 Bacteria 1324
664 Ga0373944_0201187 3300035089 Bacteria 721
665 Ga0373923_0008893 3300035111 Bacteria 3603
666 Ga0373939_0140269 3300035114 Bacteria 871
667 Ga0373953_0000591 3300035117 Bacteria 10025
668 Ga0373953_0050953 3300035117 Bacteria 1673
669 Ga0373953_0578843 3300035117 Bacteria 500
670 Ga0373954_0006821 3300035118 Bacteria 4981
671 Ga0373956_0006342 3300035119 Bacteria 4735
672 Ga0373956_0229057 3300035119 Bacteria 882
673 Ga0373957_0015885 3300035120 Bacteria 2598
674 Ga0373955_0015611 3300035172 Bacteria 3722
675 Ga0373955_0039413 3300035172 Bacteria 2522
676 Ga0373924_0021284 3300035410 Bacteria 2528
677 Ga0373931_0054081 3300035691 Bacteria 2145
678 Ga0373935_0030940 3300035692 Bacteria 3318
679 Ga0373935_0110270 3300035692 Bacteria 1826
680 Ga0373935_0613644 3300035692 Bacteria 796
681 Ga0373927_0416894 3300035695 Bacteria 886
682 Ga0373933_0022323 3300035724 Bacteria 3602
683 Ga0373933_0227461 3300035724 Bacteria 1198
684 Ga0373947_0741903 3300035725 Bacteria 670
685 Ga0373937_0054971 3300036401 Bacteria 3654
686 Ga0373937_0074503 3300036401 Bacteria 3132
687 Ga0373925_0350985 3300037068 Bacteria 1198
688 Ga0373925_0476659 3300037068 Bacteria 1023
689 Ga0373925_0827938 3300037068 Bacteria 763
690 Ga0395899_0272876 3300037312 Bacteria 1153
691 Ga0395900_0009709 3300037418 Bacteria 9860
692 Ga0395900_1784244 3300037418 Bacteria 526
693 Ga0395898_0018925 3300037466 Bacteria 7016
694 Ga0395898_0088174 3300037466 Bacteria 2987
695 Ga0395905_0038456 3300037471 Bacteria 4490
696 Ga0395905_0048196 3300037471 Bacteria 3994
697 Ga0395905_1468561 3300037471 Bacteria 586
698 Ga0395901_0243359 3300038443 Bacteria 1876
699 Ga0451789_0060154 3300041443 Bacteria 1432
700 Ga0451789_0231164 3300041443 Bacteria 648
701 Ga0451789_1057507 3300041443 Bacteria 1119
702 Ga0451800_1025911 3300041459 Bacteria 860
703 Ga0451802_1266583 3300041460 Bacteria 864
704 Ga0451833_0913082 3300041491 Bacteria 783
705 Ga0451835_0713309 3300041492 Bacteria 860
706 Ga0451845_0412393 3300041501 Bacteria 727
707 Ga0451849_0639518 3300041505 Bacteria 677
708 Ga0451851_0957251 3300041507 Bacteria 811
709 Ga0451843_0227149 3300041509 Bacteria 874
710 Ga0451843_0336977 3300041509 Bacteria 1282
711 Ga0451853_1441017 3300041512 Bacteria 1832
712 Ga0451853_1589172 3300041512 Bacteria 622
713 Ga0451853_3936543 3300041512 Bacteria 763
714 Ga0439445_0100753 3300042004 Bacteria 819
715 Ga0439449_0130857 3300042007 Bacteria 933
716 Ga0439464_0018357 3300042439 Bacteria 1902
717 Ga0439460_0020142 3300042461 Bacteria 1812
718 Ga0466972_0184829 3300044658 Bacteria 977
719 Ga0453684_0006446 3300044712 Bacteria 22283
720 Ga0466960_0304251 3300044901 Bacteria 899
721 Ga0495592_0000758 3300046454 Bacteria 22458
722 Ga0495592_0000815 3300046454 Bacteria 21606
723 Ga0495592_0003273 3300046454 Bacteria 11610
724 Ga0495629_0001921 3300046459 Bacteria 16199
725 Ga0495629_0032728 3300046459 Bacteria 3680
726 Ga0495629_0070696 3300046459 Bacteria 2435
727 Ga0495629_0215131 3300046459 Bacteria 1327
728 Ga0495638_0148189 3300046460 Bacteria 1363
729 Ga0495641_0147210 3300046461 Bacteria 1052
730 Ga0495641_0214107 3300046461 Bacteria 864
731 Ga0495651_0016519 3300046462 Bacteria 5717
732 Ga0495651_0091103 3300046462 Bacteria 2286
733 Ga0495651_0771196 3300046462 Bacteria 595
734 Ga0495653_0000973 3300046463 Bacteria 21997
735 Ga0495650_0093757 3300046471 Bacteria 1138
736 Ga0495650_0140279 3300046471 Bacteria 875
737 Ga0495580_0346800 3300046472 Bacteria 1006
738 Ga0495639_0403009 3300046475 Bacteria 691
739 Ga0495584_0287920 3300046491 Bacteria 835
740 Ga0495584_0339190 3300046491 Bacteria 763
741 Ga0495606_0114523 3300046507 Bacteria 1622
742 Ga0495606_0194859 3300046507 Bacteria 1159
743 Ga0495606_0404241 3300046507 Bacteria 710
744 Ga0495608_0031249 3300046511 Bacteria 3601
745 Ga0495608_0415652 3300046511 Bacteria 821
746 Ga0495610_0015791 3300046512 Bacteria 4373
747 Ga0495616_0287770 3300046513 Bacteria 697
748 Ga0495618_0034797 3300046514 Bacteria 3161
749 Ga0495620_0051533 3300046515 Bacteria 1751
750 Ga0495620_0069357 3300046515 Bacteria 1446
751 Ga0495628_0000483 3300046516 Bacteria 36474
752 Ga0495628_0017699 3300046516 Bacteria 5924
753 Ga0495628_0253578 3300046516 Bacteria 1313
754 Ga0495631_0187702 3300046518 Bacteria 885
755 Ga0495632_0012805 3300046519 Bacteria 4815
756 Ga0495632_0113327 3300046519 Bacteria 1272
757 Ga0495643_0086659 3300046522 Bacteria 1622
758 Ga0495643_0262358 3300046522 Bacteria 802
759 Ga0495666_0070603 3300046526 Bacteria 1661
760 Ga0495652_0002769 3300046529 Bacteria 17726
761 Ga0495652_0049870 3300046529 Bacteria 3581
762 Ga0495640_0001223 3300046533 Bacteria 20101
763 Ga0495587_0010373 3300046536 Bacteria 5933
764 Ga0495598_0038578 3300046537 Bacteria 1384
765 Ga0495597_0029318 3300046542 Bacteria 2513
766 Ga0495645_0000423 3300046543 Bacteria 29063
767 Ga0495645_0011453 3300046543 Bacteria 6241
768 Ga0495645_0018798 3300046543 Bacteria 4971
769 Ga0495645_0034733 3300046543 Bacteria 3676
770 Ga0495622_0082507 3300046557 Bacteria 1479
771 Ga0495622_0274280 3300046557 Bacteria 738
772 Ga0495667_0021548 3300046559 Bacteria 4348
773 Ga0495668_0086724 3300046616 Bacteria 1717
774 Ga0495668_0151358 3300046616 Bacteria 1271
775 Ga0495634_0006090 3300046642 Bacteria 9195
776 Ga0495611_0091661 3300046648 Bacteria 1405
777 Ga0495611_0454406 3300046648 Bacteria 584
778 Ga0495625_0012637 3300046660 Bacteria 6834
779 Ga0495625_0366343 3300046660 Bacteria 907
780 Ga0495625_0730573 3300046660 Bacteria 582
781 Ga0495635_0001062 3300046663 Bacteria 18194
782 Ga0495635_0406090 3300046663 Bacteria 904
783 Ga0495657_0069620 3300046675 Bacteria 2301
784 Ga0495599_0000508 3300046678 Bacteria 22226
785 Ga0495599_0015764 3300046678 Bacteria 4691
786 Ga0495599_0665069 3300046678 Bacteria 603
787 Ga0495646_0001205 3300046680 Bacteria 15141
788 Ga0495646_0135299 3300046680 Bacteria 1383
789 Ga0495646_0145124 3300046680 Bacteria 1324
790 Ga0495647_0216257 3300046681 Bacteria 845
791 Ga0495647_0489872 3300046681 Bacteria 572
792 Ga0495658_0041005 3300046683 Bacteria 2576
793 Ga0495658_0125129 3300046683 Bacteria 1559
794 Ga0495658_0361455 3300046683 Bacteria 923
795 Ga0495613_0122566 3300046689 Bacteria 1866
796 Ga0495613_0213878 3300046689 Bacteria 1355
797 Ga0495624_0013479 3300046690 Bacteria 5573
798 Ga0495671_0067505 3300046692 Bacteria 1759
799 Ga0495671_0427783 3300046692 Bacteria 633
800 Ga0495649_0003846 3300046694 Bacteria 9942
801 Ga0495649_0659494 3300046694 Bacteria 514
802 Ga0495600_0129650 3300046809 Bacteria 1640
803 Ga0495600_0162451 3300046809 Bacteria 1443
804 Ga0495660_0016913 3300046810 Bacteria 4201
805 Ga0495581_0485219 3300047315 Bacteria 719
806 Ga0495674_0018073 3300047319 Bacteria 6564
807 Ga0495674_0485452 3300047319 Bacteria 990
808 Ga0495676_0059742 3300047321 Bacteria 2992
809 Ga0495680_0075594 3300047322 Bacteria 2555
810 Ga0495683_0278981 3300047323 Bacteria 724
811 Ga0495687_002581 3300047443 Bacteria 14284
812 Ga0495687_002812 3300047443 Bacteria 13428
813 Ga0495687_003084 3300047443 Bacteria 12483
814 Ga0495675_0409438 3300047444 Bacteria 789
815 Ga0495675_0657236 3300047444 Bacteria 590
816 Ga0495677_0174788 3300047445 Bacteria 832
817 Ga0495677_0200358 3300047445 Bacteria 776
818 Ga0495673_0054349 3300047469 Bacteria 1742
819 Ga0495673_0100002 3300047469 Bacteria 1174
820 Ga0495681_0137244 3300047470 Bacteria 1036
821 Ga0495684_0005299 3300047471 Bacteria 10042
822 Ga0495684_0181812 3300047471 Bacteria 1558
823 Ga0495686_0002064 3300047472 Bacteria 19764
824 Ga0495686_0082946 3300047472 Bacteria 1956
825 Ga0495593_0006629 3300047673 Bacteria 6775
826 Ga0495593_0024096 3300047673 Bacteria 3376
827 Ga0495614_0222708 3300048089 Bacteria 858
828 Ga0495626_0077277 3300048091 Bacteria 1484
829 Ga0496106_0112626 3300048909 Bacteria 2120
830 Ga0496108_0050302 3300048911 Bacteria 3488
831 Ga0496108_0607566 3300048911 Bacteria 953
832 Ga0496109_0084287 3300048912 Bacteria 2932
833 Ga0496110_0298147 3300048913 Bacteria 1468
834 Ga0496111_0539514 3300048914 Bacteria 857
835 Ga0496113_0130349 3300048916 Bacteria 1973
836 Ga0496113_0361350 3300048916 Bacteria 1165
837 Ga0496114_0000832 3300048917 Bacteria 23157
838 Ga0496114_0040638 3300048917 Bacteria 3851
839 Ga0496115_0108657 3300048918 Bacteria 2277
840 Ga0496117_0047473 3300048920 Bacteria 3078
841 Ga0496121_0021499 3300048924 Bacteria 6316
842 Ga0496124_0126090 3300048927 Bacteria 2039
843 Ga0496124_0273030 3300048927 Bacteria 1237
844 Ga0496125_0542280 3300048928 Bacteria 646
845 Ga0496126_0040934 3300048929 Bacteria 4293
846 Ga0495682_0072566 3300049460 Bacteria 1239
847 Ga0495682_0131467 3300049460 Bacteria 895
848 Ga0501047_0398470 3300049581 Bacteria 1209
849 Ga0501067_0538504 3300049583 Bacteria 654
850 Ga0501249_109039 3300049679 Bacteria 668
851 Ga0501259_175117 3300049688 Bacteria 541
852 nmdc:mga03683_20325_c1 3300050489 Bacteria 2547
853 nmdc:mga03683_300970_c1 3300050489 Bacteria 752
854 nmdc:mga03683_511647_c1 3300050489 Bacteria 582
855 nmdc:mga03683_6668_c1 3300050489 Bacteria 3966
856 nmdc:mga03n38_4787_c1 3300050490 Bacteria 4529
857 nmdc:mga03n38_58059_c1 3300050490 Bacteria 1752
858 nmdc:mga00v17_4622_c1 3300050491 Bacteria 7179
859 nmdc:mga00v17_55469_c1 3300050491 Bacteria 2420
860 nmdc:mga0yw44_11763_c1 3300050492 Bacteria 4535
861 nmdc:mga0yw44_29766_c1 3300050492 Bacteria 3156
862 nmdc:mga0yw44_44241_c1 3300050492 Bacteria 2662
863 nmdc:mga0k408_20661_c1 3300050493 Bacteria 3692
864 nmdc:mga0k408_2209_c1 3300050493 Bacteria 10430
865 nmdc:mga0k408_257960_c1 3300050493 Bacteria 1041
866 nmdc:mga0k408_37370_c1 3300050493 Bacteria 2788
867 nmdc:mga0k408_447946_c1 3300050493 Bacteria 767
868 nmdc:mga0k408_496228_c1 3300050493 Bacteria 724
869 nmdc:mga0k408_67699_c1 3300050493 Bacteria 2081
870 nmdc:mga0k408_83737_c1 3300050493 Bacteria 1870
871 nmdc:mga0k408_87493_c1 3300050493 Bacteria 1830
872 nmdc:mga0k408_985_c1 3300050493 Bacteria 15642
873 nmdc:mga06z11_175711_c1 3300050494 Bacteria 1232
874 nmdc:mga06z11_17881_c1 3300050494 Bacteria 3228
875 nmdc:mga06z11_284694_c1 3300050494 Bacteria 980
876 nmdc:mga06z11_57994_c1 3300050494 Bacteria 2007
877 nmdc:mga06z11_6814_c1 3300050494 Bacteria 4670
878 nmdc:mga04h51_30995_c1 3300050495 Bacteria 1687
879 nmdc:mga04h51_6047_c1 3300050495 Bacteria 3117
880 nmdc:mga07m45_106891_c1 3300050496 Bacteria 1610
881 nmdc:mga07m45_107520_c1 3300050496 Bacteria 1605
882 nmdc:mga07m45_11967_c1 3300050496 Bacteria 4572
883 nmdc:mga07m45_17318_c1 3300050496 Bacteria 3868
884 nmdc:mga07m45_1848_c1 3300050496 Bacteria 9781
885 nmdc:mga07m45_50505_c1 3300050496 Bacteria 2344
886 nmdc:mga07m45_59404_c1 3300050496 Bacteria 2164
887 nmdc:mga05p37_2001070_c1 3300050507 Bacteria 548
888 nmdc:mga05p37_3939_c1 3300050507 Bacteria 17392
889 nmdc:mga05p37_534475_c1 3300050507 Bacteria 1338
890 nmdc:mga09592_28393_c1 3300050508 Bacteria 4648
891 nmdc:mga09592_496959_c1 3300050508 Bacteria 1050
892 nmdc:mga09592_725890_c1 3300050508 Bacteria 844
893 nmdc:mga0qj67_104673_c1 3300050509 Bacteria 890
894 nmdc:mga0qj67_144969_c1 3300050509 Bacteria 1925
895 nmdc:mga06r32_4044_c1 3300050510 Bacteria 13148
896 nmdc:mga06r32_71366_c1 3300050510 Bacteria 3360
897 nmdc:mga06r32_76546_c1 3300050510 Bacteria 3249
898 nmdc:mga08y16_22844_c1 3300050511 Bacteria 6601
899 nmdc:mga08y16_274643_c1 3300050511 Bacteria 1739
900 nmdc:mga08y16_386921_c1 3300050511 Bacteria 1433
901 nmdc:mga0sz30_116965_c1 3300050516 Bacteria 1170
902 nmdc:mga0sz30_210323_c1 3300050516 Bacteria 864
903 nmdc:mga0sz30_53753_c1 3300050516 Bacteria 1712
904 Ga0495601_0031890 3300053077 Bacteria 3277
905 Ga0495601_0122040 3300053077 Bacteria 1693
906 Ga0495601_0195595 3300053077 Bacteria 1322
907 Ga0495612_0008508 3300053078 Bacteria 4161
908 Ga0495595_0008389 3300053084 Bacteria 4241
909 Ga0495595_0086143 3300053084 Bacteria 1503
910 Ga0495619_0011988 3300053085 Bacteria 5461
911 Ga0495619_0290279 3300053085 Bacteria 1133
912 Ga0500644_0036236 3300053088 Bacteria 1604
913 Ga0500646_0150626 3300053090 Bacteria 770
914 Ga0500583_0071453 3300053092 Bacteria 1660
915 Ga0500583_0200296 3300053092 Bacteria 992
916 Ga0500641_0006688 3300053096 Bacteria 4097
917 Ga0500650_0164861 3300053098 Bacteria 1021
918 Ga0500556_0000486 3300053104 Bacteria 27714
919 Ga0500594_0040029 3300053118 Bacteria 1277
920 Ga0500595_001646 3300053119 Bacteria 11737
921 Ga0500595_195075 3300053119 Bacteria 560
922 Ga0500607_139792 3300053121 Bacteria 1141
923 Ga0500618_115570 3300053125 Bacteria 607
924 Ga0500655_021221 3300053133 Bacteria 1217
925 Ga0500559_0000126 3300053136 Bacteria 59577
926 Ga0500559_0563093 3300053136 Bacteria 519
927 Ga0500589_229657 3300053147 Bacteria 693
928 Ga0500619_108190 3300053154 Bacteria 945
929 Ga0500622_0005314 3300053156 Bacteria 7764
930 Ga0500627_0392127 3300053158 Bacteria 593
931 Ga0500645_008546 3300053730 Bacteria 3490
932 Ga0500587_000588 3300053739 Bacteria 4525
933 Ga0500587_009217 3300053739 Bacteria 1263

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019597564 8019601492 123
2 3300046471 Ga0495650_0093757 Ga0495650_0093757_60_440 126
3 3300046557 Ga0495622_0082507 Ga0495622_0082507_191_571 126
4 3300025972 Ga0207668_10566690 Ga0207668_105666902 128
5 3300035118 Ga0373954_0006821 Ga0373954_0006821_1515_1907 130
6 3300035172 Ga0373955_0015611 Ga0373955_0015611_2935_3327 130
7 3300036401 Ga0373937_0074503 Ga0373937_0074503_2634_3026 130
8 3300046463 Ga0495653_0000973 Ga0495653_0000973_15317_15709 130
9 3300046529 Ga0495652_0049870 Ga0495652_0049870_2830_3222 130
10 3300046543 Ga0495645_0034733 Ga0495645_0034733_2982_3374 130
11 3300046663 Ga0495635_0001062 Ga0495635_0001062_1549_1941 130
12 3300046680 Ga0495646_0001205 Ga0495646_0001205_11675_12067 130
13 3300046689 Ga0495613_0122566 Ga0495613_0122566_716_1108 130
14 3300046809 Ga0495600_0162451 Ga0495600_0162451_488_880 130
15 3300047319 Ga0495674_0018073 Ga0495674_0018073_3966_4358 130
16 3300047444 Ga0495675_0409438 Ga0495675_0409438_360_752 130
17 3300053084 Ga0495595_0008389 Ga0495595_0008389_2292_2684 130
18 3300017792 Ga0163161_10596864 Ga0163161_105968641 136
19 3300005335 Ga0070666_10783492 Ga0070666_107834922 137
20 3300005841 Ga0068863_101516845 Ga0068863_1015168452 137
21 3300006358 Ga0068871_100240650 Ga0068871_1002406503 137
22 3300009177 Ga0105248_10146437 Ga0105248_101464372 137
23 3300014969 Ga0157376_10059288 Ga0157376_100592883 137
24 3300026088 Ga0207641_10556671 Ga0207641_105566712 137
25 3300028800 Ga0265338_10136903 Ga0265338_101369032 137
26 3300035117 Ga0373953_0578843 Ga0373953_0578843_10_462 137
27 3300005355 Ga0070671_100481259 Ga0070671_1004812592 138
28 3300005841 Ga0068863_101171557 Ga0068863_1011715572 138
29 3300006237 Ga0097621_101230784 Ga0097621_1012307841 138
30 3300025931 Ga0207644_10618399 Ga0207644_106183992 138
31 3300035692 Ga0373935_0030940 Ga0373935_0030940_2552_3010 138
32 3300046616 Ga0495668_0151358 Ga0495668_0151358_645_1103 138
33 3300042439 Ga0439464_0018357 Ga0439464_0018357_1282_1734 139
34 3300042461 Ga0439460_0020142 Ga0439460_0020142_688_1140 139
35 3300046681 Ga0495647_0489872 Ga0495647_0489872_70_522 139
36 3300005293 Ga0065715_10585454 Ga0065715_105854542 140
37 3300005327 Ga0070658_10124698 Ga0070658_101246983 140
38 3300005331 Ga0070670_100023097 Ga0070670_1000230974 140
39 3300005338 Ga0068868_100077111 Ga0068868_1000771112 140
40 3300005353 Ga0070669_101486088 Ga0070669_1014860881 140
41 3300005364 Ga0070673_100018256 Ga0070673_1000182563 140
42 3300005366 Ga0070659_100147324 Ga0070659_1001473243 140
43 3300005367 Ga0070667_100580586 Ga0070667_1005805862 140
44 3300005456 Ga0070678_100015805 Ga0070678_1000158052 140
45 3300005457 Ga0070662_100131601 Ga0070662_1001316012 140
46 3300005467 Ga0070706_100070158 Ga0070706_1000701582 140
47 3300005564 Ga0070664_101279357 Ga0070664_1012793571 140
48 3300009177 Ga0105248_10784767 Ga0105248_107847671 140
49 3300014497 Ga0182008_10158316 Ga0182008_101583162 140
50 3300014745 Ga0157377_10830713 Ga0157377_108307131 140
51 3300025893 Ga0207682_10018630 Ga0207682_100186303 140
52 3300025901 Ga0207688_10077825 Ga0207688_100778252 140
53 3300025908 Ga0207643_10375273 Ga0207643_103752732 140
54 3300025910 Ga0207684_10213189 Ga0207684_102131892 140
55 3300025922 Ga0207646_10742048 Ga0207646_107420481 140
56 3300025925 Ga0207650_10423975 Ga0207650_104239752 140
57 3300025926 Ga0207659_10165772 Ga0207659_101657722 140
58 3300025931 Ga0207644_10155868 Ga0207644_101558682 140
59 3300025933 Ga0207706_10159032 Ga0207706_101590322 140
60 3300025936 Ga0207670_11307063 Ga0207670_113070631 140
61 3300025945 Ga0207679_10192108 Ga0207679_101921082 140
62 3300025960 Ga0207651_10085627 Ga0207651_100856273 140
63 3300025986 Ga0207658_10101284 Ga0207658_101012843 140
64 3300026075 Ga0207708_10254625 Ga0207708_102546252 140
65 3300026121 Ga0207683_10153509 Ga0207683_101535092 140
66 3300048927 Ga0496124_0273030 Ga0496124_0273030_251_703 140
67 3300031730 Ga0307516_10981260 Ga0307516_109812601 141
68 3300005563 Ga0068855_100004988 Ga0068855_1000049884 142
69 3300005937 Ga0081455_10504311 Ga0081455_105043112 142
70 3300007788 Ga0099795_10000876 Ga0099795_100008761 142
71 3300013105 Ga0157369_10323014 Ga0157369_103230143 142
72 3300013306 Ga0163162_10414512 Ga0163162_104145121 142
73 3300025909 Ga0207705_10531408 Ga0207705_105314082 142
74 3300025917 Ga0207660_10625957 Ga0207660_106259571 142
75 3300025919 Ga0207657_10039408 Ga0207657_100394084 142
76 3300025921 Ga0207652_10096850 Ga0207652_100968503 142
77 3300025929 Ga0207664_10685375 Ga0207664_106853751 142
78 3300025942 Ga0207689_10249506 Ga0207689_102495062 142
79 3300025981 Ga0207640_10028863 Ga0207640_100288633 142
80 3300037418 Ga0395900_1784244 Ga0395900_1784244_24_482 142
81 3300037466 Ga0395898_0018925 Ga0395898_0018925_301_759 142
82 3300037471 Ga0395905_0048196 Ga0395905_0048196_2711_3169 142
83 3300047323 Ga0495683_0278981 Ga0495683_0278981_33_491 142
84 3300003659 JGI25404J52841_10054809 JGI25404J52841_100548092 143
85 3300005353 Ga0070669_100545138 Ga0070669_1005451381 143
86 3300005983 Ga0081540_1006280 Ga0081540_10062806 143
87 3300014326 Ga0157380_11619408 Ga0157380_116194082 143
88 3300025908 Ga0207643_10058333 Ga0207643_100583333 143
89 3300025923 Ga0207681_10058879 Ga0207681_100588793 143
90 3300026075 Ga0207708_11277283 Ga0207708_112772832 143
91 3300037418 Ga0395900_0009709 Ga0395900_0009709_575_1033 143
92 3300037466 Ga0395898_0088174 Ga0395898_0088174_868_1326 143
93 3300038443 Ga0395901_0243359 Ga0395901_0243359_339_797 143
94 3300047469 Ga0495673_0100002 Ga0495673_0100002_71_529 143
95 3300050493 nmdc:mga0k408_257960_c1 nmdc:mga0k408_257960_c1_35_493 143
96 3300053096 Ga0500641_0006688 Ga0500641_0006688_2513_2971 143
97 3300053147 Ga0500589_229657 Ga0500589_229657_62_520 143
98 3300005455 Ga0070663_100293745 Ga0070663_1002937451 144
99 3300047445 Ga0495677_0174788 Ga0495677_0174788_208_666 144
100 3300005983 Ga0081540_1000327 Ga0081540_100032735 145
101 3300010159 Ga0099796_10093126 Ga0099796_100931261 145
102 iso_pu_bacteria 2643221644 2644245846 146
103 iso_pu_bacteria 2643221654 2644302775 146
104 iso_pu_bacteria 2545555834 2545678417 148
105 iso_pu_bacteria 2888419890 2888424104 148
106 iso_pu_bacteria 2904690495 2904694345 148
107 iso_pu_bacteria 2906635258 2906643067 148
108 iso_pu_bacteria 2906660503 2906661953 148
109 3300041443 Ga0451789_0231164 Ga0451789_0231164_38_487 149
110 3300003791 Ga0055530_10004946 Ga0055530_100049466 150
111 3300003791 Ga0055530_10027959 Ga0055530_100279592 150
112 3300003792 Ga0055540_1000002 Ga0055540_100000219 150
113 3300005328 Ga0070676_10001571 Ga0070676_1000157113 150
114 3300005328 Ga0070676_10042317 Ga0070676_100423172 150
115 3300005328 Ga0070676_10068364 Ga0070676_100683642 150
116 3300005328 Ga0070676_10387222 Ga0070676_103872222 150
117 3300005328 Ga0070676_10546457 Ga0070676_105464572 150
118 3300005330 Ga0070690_100033930 Ga0070690_1000339301 150
119 3300005331 Ga0070670_100016337 Ga0070670_1000163372 150
120 3300005331 Ga0070670_100123241 Ga0070670_1001232412 150
121 3300005331 Ga0070670_100141375 Ga0070670_1001413752 150
122 3300005331 Ga0070670_100359317 Ga0070670_1003593172 150
123 3300005331 Ga0070670_100374642 Ga0070670_1003746422 150
124 3300005331 Ga0070670_100417055 Ga0070670_1004170551 150
125 3300005331 Ga0070670_100954434 Ga0070670_1009544342 150
126 3300005333 Ga0070677_10082838 Ga0070677_100828382 150
127 3300005333 Ga0070677_10136908 Ga0070677_101369082 150
128 3300005334 Ga0068869_100239701 Ga0068869_1002397012 150
129 3300005334 Ga0068869_100351437 Ga0068869_1003514372 150
130 3300005334 Ga0068869_101320958 Ga0068869_1013209581 150
131 3300005334 Ga0068869_101787187 Ga0068869_1017871871 150
132 3300005335 Ga0070666_10003543 Ga0070666_100035437 150
133 3300005335 Ga0070666_10420505 Ga0070666_104205052 150
134 3300005335 Ga0070666_10445832 Ga0070666_104458322 150
135 3300005335 Ga0070666_10775274 Ga0070666_107752741 150
136 3300005337 Ga0070682_100280917 Ga0070682_1002809172 150
137 3300005338 Ga0068868_100028329 Ga0068868_1000283292 150
138 3300005338 Ga0068868_100034873 Ga0068868_1000348734 150
139 3300005338 Ga0068868_100034996 Ga0068868_1000349962 150
140 3300005338 Ga0068868_100057236 Ga0068868_1000572364 150
141 3300005338 Ga0068868_100302618 Ga0068868_1003026182 150
142 3300005339 Ga0070660_100169936 Ga0070660_1001699362 150
143 3300005340 Ga0070689_100584904 Ga0070689_1005849041 150
144 3300005340 Ga0070689_100929303 Ga0070689_1009293032 150
145 3300005341 Ga0070691_10284518 Ga0070691_102845181 150
146 3300005343 Ga0070687_100364528 Ga0070687_1003645282 150
147 3300005344 Ga0070661_100094009 Ga0070661_1000940092 150
148 3300005344 Ga0070661_100484173 Ga0070661_1004841732 150
149 3300005344 Ga0070661_100511186 Ga0070661_1005111862 150
150 3300005345 Ga0070692_10303525 Ga0070692_103035252 150
151 3300005347 Ga0070668_100045003 Ga0070668_1000450033 150
152 3300005347 Ga0070668_100642543 Ga0070668_1006425432 150
153 3300005347 Ga0070668_100821385 Ga0070668_1008213851 150
154 3300005353 Ga0070669_100165601 Ga0070669_1001656013 150
155 3300005353 Ga0070669_100373046 Ga0070669_1003730462 150
156 3300005354 Ga0070675_100063197 Ga0070675_1000631973 150
157 3300005354 Ga0070675_100090116 Ga0070675_1000901164 150
158 3300005354 Ga0070675_100154040 Ga0070675_1001540404 150
159 3300005354 Ga0070675_100254286 Ga0070675_1002542862 150
160 3300005355 Ga0070671_100002227 Ga0070671_1000022279 150
161 3300005355 Ga0070671_100045288 Ga0070671_1000452883 150
162 3300005355 Ga0070671_100050018 Ga0070671_1000500183 150
163 3300005355 Ga0070671_100167435 Ga0070671_1001674352 150
164 3300005355 Ga0070671_100499381 Ga0070671_1004993812 150
165 3300005355 Ga0070671_101256382 Ga0070671_1012563822 150
166 3300005356 Ga0070674_100032527 Ga0070674_1000325273 150
167 3300005356 Ga0070674_100033008 Ga0070674_1000330081 150
168 3300005356 Ga0070674_100176767 Ga0070674_1001767672 150
169 3300005356 Ga0070674_100284726 Ga0070674_1002847262 150
170 3300005356 Ga0070674_100309447 Ga0070674_1003094472 150
171 3300005364 Ga0070673_100053712 Ga0070673_1000537123 150
172 3300005364 Ga0070673_100069128 Ga0070673_1000691284 150
173 3300005364 Ga0070673_100256307 Ga0070673_1002563072 150
174 3300005364 Ga0070673_100332974 Ga0070673_1003329742 150
175 3300005364 Ga0070673_100527740 Ga0070673_1005277402 150
176 3300005364 Ga0070673_100639520 Ga0070673_1006395201 150
177 3300005366 Ga0070659_100395090 Ga0070659_1003950902 150
178 3300005366 Ga0070659_100537561 Ga0070659_1005375612 150
179 3300005367 Ga0070667_100000702 Ga0070667_10000070217 150
180 3300005367 Ga0070667_100003128 Ga0070667_10000312811 150
181 3300005367 Ga0070667_100108277 Ga0070667_1001082772 150
182 3300005367 Ga0070667_100175632 Ga0070667_1001756323 150
183 3300005367 Ga0070667_100400269 Ga0070667_1004002692 150
184 3300005441 Ga0070700_100024707 Ga0070700_1000247073 150
185 3300005445 Ga0070708_100651983 Ga0070708_1006519831 150
186 3300005455 Ga0070663_100022607 Ga0070663_1000226074 150
187 3300005455 Ga0070663_100040976 Ga0070663_1000409763 150
188 3300005455 Ga0070663_100273542 Ga0070663_1002735422 150
189 3300005455 Ga0070663_100736600 Ga0070663_1007366001 150
190 3300005456 Ga0070678_100033253 Ga0070678_1000332534 150
191 3300005456 Ga0070678_100117756 Ga0070678_1001177561 150
192 3300005456 Ga0070678_100340408 Ga0070678_1003404082 150
193 3300005456 Ga0070678_100776117 Ga0070678_1007761172 150
194 3300005456 Ga0070678_101122836 Ga0070678_1011228361 150
195 3300005456 Ga0070678_101827763 Ga0070678_1018277631 150
196 3300005457 Ga0070662_100010591 Ga0070662_1000105913 150
197 3300005457 Ga0070662_100057619 Ga0070662_1000576192 150
198 3300005457 Ga0070662_100117017 Ga0070662_1001170173 150
199 3300005457 Ga0070662_100393068 Ga0070662_1003930681 150
200 3300005459 Ga0068867_100002735 Ga0068867_1000027355 150
201 3300005459 Ga0068867_100061849 Ga0068867_1000618491 150
202 3300005459 Ga0068867_100068826 Ga0068867_1000688262 150
203 3300005459 Ga0068867_100135893 Ga0068867_1001358932 150
204 3300005459 Ga0068867_100166447 Ga0068867_1001664472 150
205 3300005466 Ga0070685_10333550 Ga0070685_103335502 150
206 3300005466 Ga0070685_10746709 Ga0070685_107467092 150
207 3300005467 Ga0070706_100000671 Ga0070706_1000006719 150
208 3300005468 Ga0070707_100009411 Ga0070707_1000094113 150
209 3300005530 Ga0070679_100547700 Ga0070679_1005477002 150
210 3300005539 Ga0068853_100433149 Ga0068853_1004331492 150
211 3300005543 Ga0070672_100002315 Ga0070672_10000231511 150
212 3300005543 Ga0070672_100028972 Ga0070672_1000289722 150
213 3300005543 Ga0070672_100038652 Ga0070672_1000386521 150
214 3300005543 Ga0070672_100084456 Ga0070672_1000844563 150
215 3300005543 Ga0070672_100090945 Ga0070672_1000909452 150
216 3300005543 Ga0070672_100136490 Ga0070672_1001364902 150
217 3300005543 Ga0070672_100171686 Ga0070672_1001716862 150
218 3300005543 Ga0070672_100224675 Ga0070672_1002246753 150
219 3300005543 Ga0070672_100259699 Ga0070672_1002596991 150
220 3300005543 Ga0070672_100410615 Ga0070672_1004106152 150
221 3300005547 Ga0070693_100071429 Ga0070693_1000714293 150
222 3300005548 Ga0070665_100233384 Ga0070665_1002333842 150
223 3300005549 Ga0070704_100545621 Ga0070704_1005456212 150
224 3300005564 Ga0070664_100033760 Ga0070664_1000337602 150
225 3300005564 Ga0070664_100182376 Ga0070664_1001823762 150
226 3300005564 Ga0070664_100871420 Ga0070664_1008714202 150
227 3300005577 Ga0068857_100013080 Ga0068857_1000130807 150
228 3300005577 Ga0068857_100089872 Ga0068857_1000898722 150
229 3300005578 Ga0068854_100045777 Ga0068854_1000457773 150
230 3300005578 Ga0068854_100530591 Ga0068854_1005305912 150
231 3300005578 Ga0068854_100543221 Ga0068854_1005432212 150
232 3300005578 Ga0068854_100678904 Ga0068854_1006789042 150
233 3300005615 Ga0070702_100150142 Ga0070702_1001501422 150
234 3300005616 Ga0068852_100192879 Ga0068852_1001928792 150
235 3300005616 Ga0068852_100264517 Ga0068852_1002645172 150
236 3300005616 Ga0068852_100273340 Ga0068852_1002733403 150
237 3300005616 Ga0068852_100409503 Ga0068852_1004095032 150
238 3300005616 Ga0068852_100585553 Ga0068852_1005855532 150
239 3300005616 Ga0068852_100871834 Ga0068852_1008718342 150
240 3300005616 Ga0068852_101784896 Ga0068852_1017848961 150
241 3300005617 Ga0068859_100055119 Ga0068859_1000551192 150
242 3300005617 Ga0068859_100351485 Ga0068859_1003514852 150
243 3300005617 Ga0068859_101416460 Ga0068859_1014164601 150
244 3300005618 Ga0068864_100043014 Ga0068864_1000430143 150
245 3300005618 Ga0068864_100048474 Ga0068864_1000484741 150
246 3300005618 Ga0068864_100181312 Ga0068864_1001813123 150
247 3300005718 Ga0068866_10027930 Ga0068866_100279301 150
248 3300005718 Ga0068866_10412886 Ga0068866_104128862 150
249 3300005719 Ga0068861_100004858 Ga0068861_1000048589 150
250 3300005719 Ga0068861_100374752 Ga0068861_1003747522 150
251 3300005834 Ga0068851_10041380 Ga0068851_100413803 150
252 3300005841 Ga0068863_100018157 Ga0068863_1000181574 150
253 3300005841 Ga0068863_100023761 Ga0068863_1000237617 150
254 3300005841 Ga0068863_100052850 Ga0068863_1000528502 150
255 3300005841 Ga0068863_100059049 Ga0068863_1000590494 150
256 3300005841 Ga0068863_100237760 Ga0068863_1002377602 150
257 3300005841 Ga0068863_100971013 Ga0068863_1009710132 150
258 3300005842 Ga0068858_100051286 Ga0068858_1000512864 150
259 3300005843 Ga0068860_100055844 Ga0068860_1000558443 150
260 3300005843 Ga0068860_100064811 Ga0068860_1000648113 150
261 3300005843 Ga0068860_100359658 Ga0068860_1003596582 150
262 3300005844 Ga0068862_100124433 Ga0068862_1001244332 150
263 3300005844 Ga0068862_101071626 Ga0068862_1010716262 150
264 3300006038 Ga0075365_10105522 Ga0075365_101055222 150
265 3300006042 Ga0075368_10018388 Ga0075368_100183883 150
266 3300006048 Ga0075363_100006739 Ga0075363_1000067393 150
267 3300006048 Ga0075363_100180366 Ga0075363_1001803662 150
268 3300006048 Ga0075363_100722228 Ga0075363_1007222282 150
269 3300006173 Ga0070716_100198683 Ga0070716_1001986832 150
270 3300006177 Ga0075362_10009819 Ga0075362_100098194 150
271 3300006177 Ga0075362_10030180 Ga0075362_100301804 150
272 3300006177 Ga0075362_10073657 Ga0075362_100736571 150
273 3300006178 Ga0075367_10000286 Ga0075367_100002862 150
274 3300006178 Ga0075367_10010668 Ga0075367_100106685 150
275 3300006178 Ga0075367_10066306 Ga0075367_100663063 150
276 3300006186 Ga0075369_10001735 Ga0075369_100017357 150
277 3300006195 Ga0075366_10001659 Ga0075366_1000165911 150
278 3300006195 Ga0075366_10141490 Ga0075366_101414902 150
279 3300006195 Ga0075366_10188777 Ga0075366_101887772 150
280 3300006237 Ga0097621_100027899 Ga0097621_1000278996 150
281 3300006237 Ga0097621_100267567 Ga0097621_1002675671 150
282 3300006237 Ga0097621_100282822 Ga0097621_1002828222 150
283 3300006237 Ga0097621_100513610 Ga0097621_1005136102 150
284 3300006237 Ga0097621_100822595 Ga0097621_1008225951 150
285 3300006237 Ga0097621_101136710 Ga0097621_1011367102 150
286 3300006237 Ga0097621_101385036 Ga0097621_1013850362 150
287 3300006353 Ga0075370_10003013 Ga0075370_100030137 150
288 3300006353 Ga0075370_10008160 Ga0075370_100081602 150
289 3300006353 Ga0075370_10031485 Ga0075370_100314852 150
290 3300006353 Ga0075370_10040724 Ga0075370_100407243 150
291 3300006353 Ga0075370_10091911 Ga0075370_100919112 150
292 3300006353 Ga0075370_10298113 Ga0075370_102981132 150
293 3300006353 Ga0075370_10345216 Ga0075370_103452162 150
294 3300006353 Ga0075370_10582564 Ga0075370_105825642 150
295 3300006358 Ga0068871_100048558 Ga0068871_1000485582 150
296 3300006358 Ga0068871_100094270 Ga0068871_1000942704 150
297 3300006358 Ga0068871_100120272 Ga0068871_1001202722 150
298 3300006358 Ga0068871_100213010 Ga0068871_1002130102 150
299 3300006358 Ga0068871_100608077 Ga0068871_1006080772 150
300 3300006844 Ga0075428_101874561 Ga0075428_1018745612 150
301 3300006881 Ga0068865_100004931 Ga0068865_1000049313 150
302 3300006881 Ga0068865_100008008 Ga0068865_1000080082 150
303 3300006881 Ga0068865_100111196 Ga0068865_1001111963 150
304 3300006881 Ga0068865_100282035 Ga0068865_1002820352 150
305 3300006881 Ga0068865_100478896 Ga0068865_1004788962 150
306 3300006881 Ga0068865_100676425 Ga0068865_1006764252 150
307 3300006931 Ga0097620_100055123 Ga0097620_1000551232 150
308 3300006931 Ga0097620_100351509 Ga0097620_1003515092 150
309 3300006931 Ga0097620_101416543 Ga0097620_1014165431 150
310 3300006946 Ga0079104_1000839 Ga0079104_100083912 150
311 3300009093 Ga0105240_10156460 Ga0105240_101564604 150
312 3300009094 Ga0111539_10483084 Ga0111539_104830842 150
313 3300009098 Ga0105245_10189019 Ga0105245_101890193 150
314 3300009098 Ga0105245_10472989 Ga0105245_104729892 150
315 3300009098 Ga0105245_10568449 Ga0105245_105684492 150
316 3300009098 Ga0105245_10606543 Ga0105245_106065432 150
317 3300009098 Ga0105245_10875070 Ga0105245_108750702 150
318 3300009101 Ga0105247_10354331 Ga0105247_103543312 150
319 3300009147 Ga0114129_13056944 Ga0114129_130569441 150
320 3300009148 Ga0105243_10262108 Ga0105243_102621082 150
321 3300009148 Ga0105243_10418367 Ga0105243_104183672 150
322 3300009148 Ga0105243_10690076 Ga0105243_106900762 150
323 3300009148 Ga0105243_11475344 Ga0105243_114753442 150
324 3300009174 Ga0105241_10331738 Ga0105241_103317382 150
325 3300009176 Ga0105242_10057880 Ga0105242_100578803 150
326 3300009176 Ga0105242_10541384 Ga0105242_105413842 150
327 3300009176 Ga0105242_10704468 Ga0105242_107044682 150
328 3300009177 Ga0105248_10015932 Ga0105248_100159325 150
329 3300009177 Ga0105248_10044985 Ga0105248_100449852 150
330 3300009177 Ga0105248_10059293 Ga0105248_100592935 150
331 3300009177 Ga0105248_10584820 Ga0105248_105848202 150
332 3300009177 Ga0105248_10648769 Ga0105248_106487691 150
333 3300009177 Ga0105248_10712936 Ga0105248_107129362 150
334 3300009177 Ga0105248_10746295 Ga0105248_107462952 150
335 3300009177 Ga0105248_11176691 Ga0105248_111766912 150
336 3300009177 Ga0105248_12203579 Ga0105248_122035791 150
337 3300009545 Ga0105237_10121851 Ga0105237_101218512 150
338 3300009545 Ga0105237_10298827 Ga0105237_102988272 150
339 3300009551 Ga0105238_11562495 Ga0105238_115624951 150
340 3300009553 Ga0105249_10006344 Ga0105249_1000634411 150
341 3300009553 Ga0105249_10010010 Ga0105249_1001001010 150
342 3300010375 Ga0105239_10071838 Ga0105239_100718383 150
343 3300011119 Ga0105246_10311415 Ga0105246_103114152 150
344 3300011119 Ga0105246_10613197 Ga0105246_106131972 150
345 3300013296 Ga0157374_10040378 Ga0157374_100403782 150
346 3300013296 Ga0157374_10218393 Ga0157374_102183932 150
347 3300013296 Ga0157374_10516831 Ga0157374_105168311 150
348 3300013296 Ga0157374_10638186 Ga0157374_106381862 150
349 3300013296 Ga0157374_10716923 Ga0157374_107169232 150
350 3300013297 Ga0157378_10129320 Ga0157378_101293202 150
351 3300013297 Ga0157378_10743273 Ga0157378_107432732 150
352 3300013306 Ga0163162_10005745 Ga0163162_100057454 150
353 3300013306 Ga0163162_10131671 Ga0163162_101316712 150
354 3300013306 Ga0163162_10169211 Ga0163162_101692112 150
355 3300013306 Ga0163162_10957664 Ga0163162_109576642 150
356 3300013306 Ga0163162_11900402 Ga0163162_119004021 150
357 3300013307 Ga0157372_11888685 Ga0157372_118886852 150
358 3300013308 Ga0157375_10015577 Ga0157375_100155772 150
359 3300013308 Ga0157375_10040729 Ga0157375_100407294 150
360 3300013308 Ga0157375_10087592 Ga0157375_100875922 150
361 3300013308 Ga0157375_10132947 Ga0157375_101329472 150
362 3300013308 Ga0157375_10194002 Ga0157375_101940023 150
363 3300013308 Ga0157375_10593668 Ga0157375_105936682 150
364 3300013308 Ga0157375_10807015 Ga0157375_108070152 150
365 3300014325 Ga0163163_10958237 Ga0163163_109582371 150
366 3300014326 Ga0157380_10009952 Ga0157380_100099528 150
367 3300014968 Ga0157379_10008063 Ga0157379_100080634 150
368 3300014968 Ga0157379_10160745 Ga0157379_101607454 150
369 3300014968 Ga0157379_10387042 Ga0157379_103870422 150
370 3300014969 Ga0157376_10221927 Ga0157376_102219272 150
371 3300014969 Ga0157376_10673285 Ga0157376_106732852 150
372 3300014969 Ga0157376_10893854 Ga0157376_108938542 150
373 3300014969 Ga0157376_11337024 Ga0157376_113370241 150
374 3300014969 Ga0157376_12112069 Ga0157376_121120692 150
375 3300017792 Ga0163161_10107886 Ga0163161_101078863 150
376 3300017792 Ga0163161_10403012 Ga0163161_104030121 150
377 3300025291 Ga0209675_1015366 Ga0209675_10153661 150
378 3300025298 Ga0209050_1001035 Ga0209050_100103518 150
379 3300025298 Ga0209050_1007995 Ga0209050_10079955 150
380 3300025299 Ga0209256_1000143 Ga0209256_100014388 150
381 3300025303 Ga0209051_1000024 Ga0209051_100002419 150
382 3300025304 Ga0209257_1000079 Ga0209257_100007919 150
383 3300025304 Ga0209257_1040119 Ga0209257_10401192 150
384 3300025315 Ga0207697_10011942 Ga0207697_100119422 150
385 3300025315 Ga0207697_10036965 Ga0207697_100369652 150
386 3300025321 Ga0207656_10084860 Ga0207656_100848602 150
387 3300025321 Ga0207656_10341297 Ga0207656_103412972 150
388 3300025893 Ga0207682_10009193 Ga0207682_100091934 150
389 3300025893 Ga0207682_10088909 Ga0207682_100889092 150
390 3300025899 Ga0207642_10004867 Ga0207642_100048673 150
391 3300025899 Ga0207642_10168536 Ga0207642_101685362 150
392 3300025901 Ga0207688_10335936 Ga0207688_103359362 150
393 3300025903 Ga0207680_10014466 Ga0207680_100144664 150
394 3300025903 Ga0207680_10379220 Ga0207680_103792202 150
395 3300025903 Ga0207680_10388298 Ga0207680_103882982 150
396 3300025905 Ga0207685_10145266 Ga0207685_101452661 150
397 3300025907 Ga0207645_10001208 Ga0207645_1000120813 150
398 3300025907 Ga0207645_10063363 Ga0207645_100633634 150
399 3300025907 Ga0207645_10221700 Ga0207645_102217002 150
400 3300025907 Ga0207645_10230742 Ga0207645_102307422 150
401 3300025907 Ga0207645_10235704 Ga0207645_102357042 150
402 3300025907 Ga0207645_10276870 Ga0207645_102768702 150
403 3300025907 Ga0207645_10448855 Ga0207645_104488552 150
404 3300025908 Ga0207643_10141221 Ga0207643_101412212 150
405 3300025909 Ga0207705_10100307 Ga0207705_101003073 150
406 3300025910 Ga0207684_10000939 Ga0207684_1000093912 150
407 3300025911 Ga0207654_10150347 Ga0207654_101503472 150
408 3300025913 Ga0207695_10139621 Ga0207695_101396213 150
409 3300025914 Ga0207671_10113189 Ga0207671_101131892 150
410 3300025914 Ga0207671_10320783 Ga0207671_103207832 150
411 3300025918 Ga0207662_10025459 Ga0207662_100254592 150
412 3300025919 Ga0207657_10288215 Ga0207657_102882151 150
413 3300025919 Ga0207657_10544963 Ga0207657_105449632 150
414 3300025919 Ga0207657_10739657 Ga0207657_107396572 150
415 3300025921 Ga0207652_10433227 Ga0207652_104332272 150
416 3300025922 Ga0207646_10163030 Ga0207646_101630302 150
417 3300025923 Ga0207681_10004559 Ga0207681_100045598 150
418 3300025924 Ga0207694_10168524 Ga0207694_101685242 150
419 3300025925 Ga0207650_10002985 Ga0207650_100029859 150
420 3300025925 Ga0207650_10005604 Ga0207650_100056044 150
421 3300025925 Ga0207650_10074941 Ga0207650_100749414 150
422 3300025925 Ga0207650_10101123 Ga0207650_101011231 150
423 3300025925 Ga0207650_10292567 Ga0207650_102925672 150
424 3300025925 Ga0207650_10453781 Ga0207650_104537813 150
425 3300025925 Ga0207650_10713305 Ga0207650_107133052 150
426 3300025926 Ga0207659_10069997 Ga0207659_100699972 150
427 3300025926 Ga0207659_10095714 Ga0207659_100957142 150
428 3300025926 Ga0207659_10261958 Ga0207659_102619581 150
429 3300025926 Ga0207659_10298933 Ga0207659_102989332 150
430 3300025926 Ga0207659_10319657 Ga0207659_103196572 150
431 3300025926 Ga0207659_10335299 Ga0207659_103352992 150
432 3300025926 Ga0207659_10580741 Ga0207659_105807412 150
433 3300025927 Ga0207687_10075351 Ga0207687_100753513 150
434 3300025927 Ga0207687_10082961 Ga0207687_100829614 150
435 3300025927 Ga0207687_10118635 Ga0207687_101186352 150
436 3300025931 Ga0207644_10008221 Ga0207644_100082213 150
437 3300025931 Ga0207644_10086886 Ga0207644_100868863 150
438 3300025931 Ga0207644_10127733 Ga0207644_101277332 150
439 3300025931 Ga0207644_10153745 Ga0207644_101537452 150
440 3300025931 Ga0207644_10304472 Ga0207644_103044722 150
441 3300025932 Ga0207690_11545370 Ga0207690_115453701 150
442 3300025933 Ga0207706_10013363 Ga0207706_100133639 150
443 3300025933 Ga0207706_10102439 Ga0207706_101024392 150
444 3300025933 Ga0207706_10172280 Ga0207706_101722803 150
445 3300025933 Ga0207706_10355061 Ga0207706_103550611 150
446 3300025933 Ga0207706_10395302 Ga0207706_103953022 150
447 3300025933 Ga0207706_10709514 Ga0207706_107095142 150
448 3300025933 Ga0207706_11265749 Ga0207706_112657491 150
449 3300025934 Ga0207686_10012711 Ga0207686_100127112 150
450 3300025934 Ga0207686_10236380 Ga0207686_102363802 150
451 3300025934 Ga0207686_11108665 Ga0207686_111086651 150
452 3300025935 Ga0207709_10010252 Ga0207709_100102522 150
453 3300025935 Ga0207709_10102813 Ga0207709_101028133 150
454 3300025935 Ga0207709_10131907 Ga0207709_101319073 150
455 3300025935 Ga0207709_10314345 Ga0207709_103143452 150
456 3300025936 Ga0207670_10664012 Ga0207670_106640122 150
457 3300025937 Ga0207669_10003010 Ga0207669_100030109 150
458 3300025937 Ga0207669_10025177 Ga0207669_100251772 150
459 3300025937 Ga0207669_10174143 Ga0207669_101741433 150
460 3300025937 Ga0207669_10655080 Ga0207669_106550801 150
461 3300025938 Ga0207704_10090498 Ga0207704_100904982 150
462 3300025938 Ga0207704_10127219 Ga0207704_101272192 150
463 3300025938 Ga0207704_10415419 Ga0207704_104154192 150
464 3300025938 Ga0207704_10571005 Ga0207704_105710051 150
465 3300025938 Ga0207704_10896347 Ga0207704_108963472 150
466 3300025940 Ga0207691_10001739 Ga0207691_100017393 150
467 3300025940 Ga0207691_10004984 Ga0207691_100049845 150
468 3300025940 Ga0207691_10005163 Ga0207691_100051633 150
469 3300025940 Ga0207691_10075981 Ga0207691_100759812 150
470 3300025940 Ga0207691_10195709 Ga0207691_101957092 150
471 3300025940 Ga0207691_10215824 Ga0207691_102158243 150
472 3300025940 Ga0207691_10267612 Ga0207691_102676122 150
473 3300025940 Ga0207691_10369720 Ga0207691_103697202 150
474 3300025940 Ga0207691_10371320 Ga0207691_103713202 150
475 3300025941 Ga0207711_10006629 Ga0207711_100066292 150
476 3300025941 Ga0207711_10011087 Ga0207711_100110879 150
477 3300025941 Ga0207711_10121741 Ga0207711_101217411 150
478 3300025941 Ga0207711_10307864 Ga0207711_103078642 150
479 3300025941 Ga0207711_10474460 Ga0207711_104744601 150
480 3300025942 Ga0207689_10043632 Ga0207689_100436324 150
481 3300025942 Ga0207689_10178173 Ga0207689_101781732 150
482 3300025942 Ga0207689_10184318 Ga0207689_101843182 150
483 3300025942 Ga0207689_10310633 Ga0207689_103106332 150
484 3300025942 Ga0207689_11000290 Ga0207689_110002901 150
485 3300025945 Ga0207679_11274601 Ga0207679_112746012 150
486 3300025945 Ga0207679_11685404 Ga0207679_116854041 150
487 3300025960 Ga0207651_10017871 Ga0207651_100178713 150
488 3300025960 Ga0207651_10051418 Ga0207651_100514183 150
489 3300025960 Ga0207651_10055941 Ga0207651_100559413 150
490 3300025960 Ga0207651_10153823 Ga0207651_101538233 150
491 3300025960 Ga0207651_10218471 Ga0207651_102184712 150
492 3300025960 Ga0207651_10758327 Ga0207651_107583272 150
493 3300025960 Ga0207651_11344336 Ga0207651_113443362 150
494 3300025961 Ga0207712_10024976 Ga0207712_100249765 150
495 3300025972 Ga0207668_10001265 Ga0207668_1000126510 150
496 3300025972 Ga0207668_10457355 Ga0207668_104573552 150
497 3300025981 Ga0207640_10029852 Ga0207640_100298524 150
498 3300025981 Ga0207640_10086364 Ga0207640_100863642 150
499 3300025981 Ga0207640_10849834 Ga0207640_108498342 150
500 3300025981 Ga0207640_11077226 Ga0207640_110772261 150
501 3300025986 Ga0207658_10001317 Ga0207658_100013174 150
502 3300025986 Ga0207658_10001833 Ga0207658_1000183315 150
503 3300025986 Ga0207658_10233773 Ga0207658_102337734 150
504 3300025986 Ga0207658_10971784 Ga0207658_109717842 150
505 3300026023 Ga0207677_10042848 Ga0207677_100428482 150
506 3300026023 Ga0207677_10069882 Ga0207677_100698823 150
507 3300026023 Ga0207677_10072814 Ga0207677_100728142 150
508 3300026023 Ga0207677_10113911 Ga0207677_101139112 150
509 3300026023 Ga0207677_10316112 Ga0207677_103161122 150
510 3300026023 Ga0207677_10502920 Ga0207677_105029202 150
511 3300026023 Ga0207677_11191401 Ga0207677_111914012 150
512 3300026035 Ga0207703_10010751 Ga0207703_100107513 150
513 3300026035 Ga0207703_10772824 Ga0207703_107728243 150
514 3300026041 Ga0207639_10417404 Ga0207639_104174042 150
515 3300026041 Ga0207639_10451271 Ga0207639_104512712 150
516 3300026067 Ga0207678_10139706 Ga0207678_101397063 150
517 3300026067 Ga0207678_10164477 Ga0207678_101644772 150
518 3300026067 Ga0207678_10169289 Ga0207678_101692893 150
519 3300026067 Ga0207678_10189384 Ga0207678_101893842 150
520 3300026067 Ga0207678_11067837 Ga0207678_110678372 150
521 3300026075 Ga0207708_10004053 Ga0207708_100040537 150
522 3300026078 Ga0207702_10260894 Ga0207702_102608942 150
523 3300026088 Ga0207641_10004293 Ga0207641_100042936 150
524 3300026088 Ga0207641_10009403 Ga0207641_100094033 150
525 3300026088 Ga0207641_10044969 Ga0207641_100449694 150
526 3300026088 Ga0207641_10180189 Ga0207641_101801892 150
527 3300026089 Ga0207648_10002159 Ga0207648_100021592 150
528 3300026089 Ga0207648_10023940 Ga0207648_100239402 150
529 3300026089 Ga0207648_10035287 Ga0207648_100352874 150
530 3300026089 Ga0207648_10048342 Ga0207648_100483422 150
531 3300026089 Ga0207648_10156235 Ga0207648_101562352 150
532 3300026089 Ga0207648_10328313 Ga0207648_103283132 150
533 3300026089 Ga0207648_10429984 Ga0207648_104299842 150
534 3300026095 Ga0207676_10017462 Ga0207676_100174626 150
535 3300026095 Ga0207676_10032829 Ga0207676_100328293 150
536 3300026095 Ga0207676_10073828 Ga0207676_100738284 150
537 3300026095 Ga0207676_10429247 Ga0207676_104292472 150
538 3300026095 Ga0207676_10786405 Ga0207676_107864052 150
539 3300026116 Ga0207674_10029584 Ga0207674_100295847 150
540 3300026116 Ga0207674_11771012 Ga0207674_117710121 150
541 3300026118 Ga0207675_100003876 Ga0207675_1000038762 150
542 3300026118 Ga0207675_100290182 Ga0207675_1002901822 150
543 3300026121 Ga0207683_10045327 Ga0207683_100453272 150
544 3300026121 Ga0207683_10075715 Ga0207683_100757152 150
545 3300026121 Ga0207683_10076066 Ga0207683_100760664 150
546 3300026121 Ga0207683_10164948 Ga0207683_101649483 150
547 3300026121 Ga0207683_10274998 Ga0207683_102749982 150
548 3300026142 Ga0207698_10095185 Ga0207698_100951852 150
549 3300026142 Ga0207698_10154618 Ga0207698_101546182 150
550 3300026142 Ga0207698_10160940 Ga0207698_101609403 150
551 3300026142 Ga0207698_10197965 Ga0207698_101979652 150
552 3300026142 Ga0207698_10240499 Ga0207698_102404992 150
553 3300027111 Ga0209281_1000307 Ga0209281_100030776 150
554 3300027866 Ga0209813_10001234 Ga0209813_100012342 150
555 3300027866 Ga0209813_10089852 Ga0209813_100898522 150
556 3300028379 Ga0268266_10187818 Ga0268266_101878182 150
557 3300028379 Ga0268266_10197401 Ga0268266_101974012 150
558 3300028379 Ga0268266_10617744 Ga0268266_106177442 150
559 3300028380 Ga0268265_10006093 Ga0268265_100060935 150
560 3300028380 Ga0268265_11781884 Ga0268265_117818842 150
561 3300028381 Ga0268264_10001228 Ga0268264_1000122820 150
562 3300028381 Ga0268264_10426928 Ga0268264_104269282 150
563 3300028786 Ga0307517_10001591 Ga0307517_1000159127 150
564 3300028786 Ga0307517_10088858 Ga0307517_100888582 150
565 3300028786 Ga0307517_10138346 Ga0307517_101383462 150
566 3300028794 Ga0307515_10058252 Ga0307515_100582522 150
567 3300028794 Ga0307515_10092799 Ga0307515_100927994 150
568 3300028794 Ga0307515_10311869 Ga0307515_103118692 150
569 3300028794 Ga0307515_10543742 Ga0307515_105437422 150
570 3300030521 Ga0307511_10000025 Ga0307511_1000002519 150
571 3300030522 Ga0307512_10022579 Ga0307512_100225794 150
572 3300030522 Ga0307512_10135032 Ga0307512_101350323 150
573 3300030522 Ga0307512_10137616 Ga0307512_101376162 150
574 3300031456 Ga0307513_10016408 Ga0307513_100164085 150
575 3300031456 Ga0307513_10512147 Ga0307513_105121472 150
576 3300031507 Ga0307509_10002193 Ga0307509_1000219317 150
577 3300031507 Ga0307509_10004459 Ga0307509_100044594 150
578 3300031507 Ga0307509_10050222 Ga0307509_100502224 150
579 3300031507 Ga0307509_10117181 Ga0307509_101171814 150
580 3300031507 Ga0307509_10137647 Ga0307509_101376472 150
581 3300031507 Ga0307509_10159898 Ga0307509_101598982 150
582 3300031507 Ga0307509_10271111 Ga0307509_102711112 150
583 3300031507 Ga0307509_10276381 Ga0307509_102763812 150
584 3300031507 Ga0307509_10417158 Ga0307509_104171581 150
585 3300031548 Ga0307408_100075405 Ga0307408_1000754052 150
586 3300031616 Ga0307508_10002730 Ga0307508_100027302 150
587 3300031616 Ga0307508_10036341 Ga0307508_100363412 150
588 3300031616 Ga0307508_10129465 Ga0307508_101294653 150
589 3300031616 Ga0307508_10468456 Ga0307508_104684561 150
590 3300031649 Ga0307514_10158267 Ga0307514_101582673 150
591 3300031649 Ga0307514_10288771 Ga0307514_102887712 150
592 3300031730 Ga0307516_10047244 Ga0307516_100472443 150
593 3300031730 Ga0307516_10112068 Ga0307516_101120683 150
594 3300031730 Ga0307516_10382196 Ga0307516_103821961 150
595 3300031730 Ga0307516_10539309 Ga0307516_105393091 150
596 3300031731 Ga0307405_10012488 Ga0307405_100124882 150
597 3300031731 Ga0307405_10656239 Ga0307405_106562392 150
598 3300031731 Ga0307405_12071108 Ga0307405_120711081 150
599 3300031824 Ga0307413_10267905 Ga0307413_102679052 150
600 3300031852 Ga0307410_10116241 Ga0307410_101162412 150
601 3300031852 Ga0307410_10203428 Ga0307410_102034282 150
602 3300031852 Ga0307410_10953155 Ga0307410_109531551 150
603 3300031901 Ga0307406_10010094 Ga0307406_100100944 150
604 3300031901 Ga0307406_10029558 Ga0307406_100295582 150
605 3300031901 Ga0307406_10704297 Ga0307406_107042972 150
606 3300031901 Ga0307406_11041100 Ga0307406_110411002 150
607 3300031903 Ga0307407_10145162 Ga0307407_101451622 150
608 3300031903 Ga0307407_10219073 Ga0307407_102190732 150
609 3300031995 Ga0307409_100003397 Ga0307409_10000339711 150
610 3300031995 Ga0307409_100036260 Ga0307409_1000362603 150
611 3300032002 Ga0307416_100019017 Ga0307416_1000190174 150
612 3300032002 Ga0307416_100082465 Ga0307416_1000824652 150
613 3300032004 Ga0307414_10028282 Ga0307414_100282822 150
614 3300032005 Ga0307411_10009952 Ga0307411_100099522 150
615 3300032005 Ga0307411_10070966 Ga0307411_100709663 150
616 3300032005 Ga0307411_10075739 Ga0307411_100757392 150
617 3300032126 Ga0307415_100152118 Ga0307415_1001521183 150
618 3300032126 Ga0307415_100332020 Ga0307415_1003320202 150
619 3300032126 Ga0307415_100407844 Ga0307415_1004078441 150
620 3300033179 Ga0307507_10273752 Ga0307507_102737521 150
621 3300033180 Ga0307510_10000290 Ga0307510_1000029029 150
622 3300033180 Ga0307510_10106360 Ga0307510_101063604 150
623 3300033180 Ga0307510_10170824 Ga0307510_101708242 150
624 3300035089 Ga0373944_0049245 Ga0373944_0049245_386_838 150
625 3300035114 Ga0373939_0140269 Ga0373939_0140269_22_474 150
626 3300035117 Ga0373953_0050953 Ga0373953_0050953_501_953 150
627 3300035119 Ga0373956_0229057 Ga0373956_0229057_164_616 150
628 3300035172 Ga0373955_0039413 Ga0373955_0039413_1836_2288 150
629 3300035410 Ga0373924_0021284 Ga0373924_0021284_891_1343 150
630 3300035691 Ga0373931_0054081 Ga0373931_0054081_329_781 150
631 3300035692 Ga0373935_0110270 Ga0373935_0110270_643_1095 150
632 3300035692 Ga0373935_0613644 Ga0373935_0613644_276_728 150
633 3300035695 Ga0373927_0416894 Ga0373927_0416894_321_773 150
634 3300035724 Ga0373933_0227461 Ga0373933_0227461_691_1143 150
635 3300035725 Ga0373947_0741903 Ga0373947_0741903_166_618 150
636 3300036401 Ga0373937_0054971 Ga0373937_0054971_447_899 150
637 3300037068 Ga0373925_0350985 Ga0373925_0350985_239_691 150
638 3300037068 Ga0373925_0476659 Ga0373925_0476659_78_530 150
639 3300037068 Ga0373925_0827938 Ga0373925_0827938_219_671 150
640 3300037471 Ga0395905_0038456 Ga0395905_0038456_443_895 150
641 3300041443 Ga0451789_0060154 Ga0451789_0060154_849_1301 150
642 3300041443 Ga0451789_1057507 Ga0451789_1057507_68_520 150
643 3300041459 Ga0451800_1025911 Ga0451800_1025911_301_753 150
644 3300041460 Ga0451802_1266583 Ga0451802_1266583_239_691 150
645 3300041491 Ga0451833_0913082 Ga0451833_0913082_274_729 150
646 3300041492 Ga0451835_0713309 Ga0451835_0713309_283_741 150
647 3300041501 Ga0451845_0412393 Ga0451845_0412393_170_622 150
648 3300041505 Ga0451849_0639518 Ga0451849_0639518_19_471 150
649 3300041507 Ga0451851_0957251 Ga0451851_0957251_245_697 150
650 3300041509 Ga0451843_0227149 Ga0451843_0227149_212_664 150
651 3300041512 Ga0451853_1441017 Ga0451853_1441017_1312_1776 150
652 3300041512 Ga0451853_1589172 Ga0451853_1589172_21_473 150
653 3300041512 Ga0451853_3936543 Ga0451853_3936543_140_592 150
654 3300042004 Ga0439445_0100753 Ga0439445_0100753_211_693 150
655 3300042007 Ga0439449_0130857 Ga0439449_0130857_300_782 150
656 3300044658 Ga0466972_0184829 Ga0466972_0184829_313_765 150
657 3300044712 Ga0453684_0006446 Ga0453684_0006446_9905_10357 150
658 3300044901 Ga0466960_0304251 Ga0466960_0304251_31_513 150
659 3300046454 Ga0495592_0000758 Ga0495592_0000758_2669_3121 150
660 3300046454 Ga0495592_0003273 Ga0495592_0003273_1081_1539 150
661 3300046459 Ga0495629_0070696 Ga0495629_0070696_549_1001 150
662 3300046459 Ga0495629_0215131 Ga0495629_0215131_294_746 150
663 3300046460 Ga0495638_0148189 Ga0495638_0148189_459_911 150
664 3300046461 Ga0495641_0147210 Ga0495641_0147210_509_961 150
665 3300046461 Ga0495641_0214107 Ga0495641_0214107_64_516 150
666 3300046462 Ga0495651_0771196 Ga0495651_0771196_89_541 150
667 3300046471 Ga0495650_0140279 Ga0495650_0140279_206_658 150
668 3300046472 Ga0495580_0346800 Ga0495580_0346800_176_628 150
669 3300046475 Ga0495639_0403009 Ga0495639_0403009_45_497 150
670 3300046491 Ga0495584_0287920 Ga0495584_0287920_214_666 150
671 3300046507 Ga0495606_0114523 Ga0495606_0114523_326_778 150
672 3300046507 Ga0495606_0194859 Ga0495606_0194859_47_499 150
673 3300046507 Ga0495606_0404241 Ga0495606_0404241_230_682 150
674 3300046511 Ga0495608_0415652 Ga0495608_0415652_206_658 150
675 3300046512 Ga0495610_0015791 Ga0495610_0015791_3337_3789 150
676 3300046513 Ga0495616_0287770 Ga0495616_0287770_227_679 150
677 3300046515 Ga0495620_0051533 Ga0495620_0051533_21_473 150
678 3300046515 Ga0495620_0069357 Ga0495620_0069357_224_676 150
679 3300046516 Ga0495628_0000483 Ga0495628_0000483_4852_5310 150
680 3300046516 Ga0495628_0253578 Ga0495628_0253578_41_493 150
681 3300046518 Ga0495631_0187702 Ga0495631_0187702_282_734 150
682 3300046519 Ga0495632_0012805 Ga0495632_0012805_2881_3333 150
683 3300046519 Ga0495632_0113327 Ga0495632_0113327_736_1188 150
684 3300046522 Ga0495643_0086659 Ga0495643_0086659_265_717 150
685 3300046522 Ga0495643_0262358 Ga0495643_0262358_220_672 150
686 3300046526 Ga0495666_0070603 Ga0495666_0070603_766_1218 150
687 3300046529 Ga0495652_0002769 Ga0495652_0002769_15698_16156 150
688 3300046537 Ga0495598_0038578 Ga0495598_0038578_314_766 150
689 3300046542 Ga0495597_0029318 Ga0495597_0029318_1423_1875 150
690 3300046543 Ga0495645_0000423 Ga0495645_0000423_10121_10579 150
691 3300046543 Ga0495645_0011453 Ga0495645_0011453_3802_4254 150
692 3300046543 Ga0495645_0018798 Ga0495645_0018798_3049_3501 150
693 3300046557 Ga0495622_0274280 Ga0495622_0274280_70_522 150
694 3300046616 Ga0495668_0086724 Ga0495668_0086724_752_1204 150
695 3300046648 Ga0495611_0091661 Ga0495611_0091661_34_486 150
696 3300046648 Ga0495611_0454406 Ga0495611_0454406_107_559 150
697 3300046660 Ga0495625_0012637 Ga0495625_0012637_4588_5058 150
698 3300046660 Ga0495625_0366343 Ga0495625_0366343_128_580 150
699 3300046660 Ga0495625_0730573 Ga0495625_0730573_32_484 150
700 3300046663 Ga0495635_0406090 Ga0495635_0406090_417_869 150
701 3300046678 Ga0495599_0000508 Ga0495599_0000508_3098_3556 150
702 3300046678 Ga0495599_0665069 Ga0495599_0665069_57_509 150
703 3300046680 Ga0495646_0135299 Ga0495646_0135299_493_945 150
704 3300046681 Ga0495647_0216257 Ga0495647_0216257_236_688 150
705 3300046683 Ga0495658_0041005 Ga0495658_0041005_888_1340 150
706 3300046683 Ga0495658_0125129 Ga0495658_0125129_209_661 150
707 3300046683 Ga0495658_0361455 Ga0495658_0361455_130_582 150
708 3300046689 Ga0495613_0213878 Ga0495613_0213878_725_1177 150
709 3300046690 Ga0495624_0013479 Ga0495624_0013479_3928_4380 150
710 3300046692 Ga0495671_0067505 Ga0495671_0067505_400_852 150
711 3300046692 Ga0495671_0427783 Ga0495671_0427783_67_519 150
712 3300046694 Ga0495649_0003846 Ga0495649_0003846_2671_3123 150
713 3300046694 Ga0495649_0659494 Ga0495649_0659494_16_468 150
714 3300046809 Ga0495600_0129650 Ga0495600_0129650_1068_1520 150
715 3300046810 Ga0495660_0016913 Ga0495660_0016913_438_890 150
716 3300047315 Ga0495581_0485219 Ga0495581_0485219_77_529 150
717 3300047319 Ga0495674_0485452 Ga0495674_0485452_196_648 150
718 3300047321 Ga0495676_0059742 Ga0495676_0059742_1483_1935 150
719 3300047443 Ga0495687_002581 Ga0495687_002581_3698_4150 150
720 3300047443 Ga0495687_002812 Ga0495687_002812_2962_3414 150
721 3300047443 Ga0495687_003084 Ga0495687_003084_9075_9527 150
722 3300047444 Ga0495675_0657236 Ga0495675_0657236_83_535 150
723 3300047445 Ga0495677_0200358 Ga0495677_0200358_303_755 150
724 3300047469 Ga0495673_0054349 Ga0495673_0054349_11_463 150
725 3300047470 Ga0495681_0137244 Ga0495681_0137244_384_872 150
726 3300047471 Ga0495684_0181812 Ga0495684_0181812_384_836 150
727 3300047472 Ga0495686_0002064 Ga0495686_0002064_14200_14652 150
728 3300047472 Ga0495686_0082946 Ga0495686_0082946_112_564 150
729 3300047673 Ga0495593_0006629 Ga0495593_0006629_3409_3861 150
730 3300048089 Ga0495614_0222708 Ga0495614_0222708_222_674 150
731 3300048091 Ga0495626_0077277 Ga0495626_0077277_190_642 150
732 3300048909 Ga0496106_0112626 Ga0496106_0112626_1622_2074 150
733 3300048911 Ga0496108_0050302 Ga0496108_0050302_849_1301 150
734 3300048911 Ga0496108_0607566 Ga0496108_0607566_127_579 150
735 3300048912 Ga0496109_0084287 Ga0496109_0084287_734_1186 150
736 3300048913 Ga0496110_0298147 Ga0496110_0298147_560_1012 150
737 3300048914 Ga0496111_0539514 Ga0496111_0539514_347_799 150
738 3300048916 Ga0496113_0130349 Ga0496113_0130349_766_1218 150
739 3300048916 Ga0496113_0361350 Ga0496113_0361350_208_699 150
740 3300048917 Ga0496114_0000832 Ga0496114_0000832_15074_15526 150
741 3300048917 Ga0496114_0040638 Ga0496114_0040638_299_751 150
742 3300049460 Ga0495682_0131467 Ga0495682_0131467_104_556 150
743 3300049581 Ga0501047_0398470 Ga0501047_0398470_606_1058 150
744 3300049583 Ga0501067_0538504 Ga0501067_0538504_44_496 150
745 3300049679 Ga0501249_109039 Ga0501249_109039_190_642 150
746 3300049688 Ga0501259_175117 Ga0501259_175117_29_481 150
747 3300050489 nmdc:mga03683_20325_c1 nmdc:mga03683_20325_c1_153_605 150
748 3300050489 nmdc:mga03683_300970_c1 nmdc:mga03683_300970_c1_290_742 150
749 3300050490 nmdc:mga03n38_4787_c1 nmdc:mga03n38_4787_c1_2532_2984 150
750 3300050490 nmdc:mga03n38_58059_c1 nmdc:mga03n38_58059_c1_943_1395 150
751 3300050491 nmdc:mga00v17_55469_c1 nmdc:mga00v17_55469_c1_1665_2117 150
752 3300050493 nmdc:mga0k408_20661_c1 nmdc:mga0k408_20661_c1_3069_3521 150
753 3300050493 nmdc:mga0k408_2209_c1 nmdc:mga0k408_2209_c1_180_632 150
754 3300050493 nmdc:mga0k408_37370_c1 nmdc:mga0k408_37370_c1_786_1238 150
755 3300050493 nmdc:mga0k408_447946_c1 nmdc:mga0k408_447946_c1_26_478 150
756 3300050493 nmdc:mga0k408_496228_c1 nmdc:mga0k408_496228_c1_147_599 150
757 3300050493 nmdc:mga0k408_67699_c1 nmdc:mga0k408_67699_c1_1067_1519 150
758 3300050493 nmdc:mga0k408_87493_c1 nmdc:mga0k408_87493_c1_720_1172 150
759 3300050493 nmdc:mga0k408_985_c1 nmdc:mga0k408_985_c1_10094_10546 150
760 3300050494 nmdc:mga06z11_175711_c1 nmdc:mga06z11_175711_c1_131_583 150
761 3300050494 nmdc:mga06z11_17881_c1 nmdc:mga06z11_17881_c1_501_953 150
762 3300050494 nmdc:mga06z11_57994_c1 nmdc:mga06z11_57994_c1_16_468 150
763 3300050494 nmdc:mga06z11_6814_c1 nmdc:mga06z11_6814_c1_3026_3478 150
764 3300050495 nmdc:mga04h51_30995_c1 nmdc:mga04h51_30995_c1_151_603 150
765 3300050495 nmdc:mga04h51_6047_c1 nmdc:mga04h51_6047_c1_1586_2038 150
766 3300050496 nmdc:mga07m45_106891_c1 nmdc:mga07m45_106891_c1_288_740 150
767 3300050496 nmdc:mga07m45_107520_c1 nmdc:mga07m45_107520_c1_467_919 150
768 3300050496 nmdc:mga07m45_11967_c1 nmdc:mga07m45_11967_c1_1828_2301 150
769 3300050496 nmdc:mga07m45_17318_c1 nmdc:mga07m45_17318_c1_3321_3773 150
770 3300050496 nmdc:mga07m45_1848_c1 nmdc:mga07m45_1848_c1_7914_8366 150
771 3300050496 nmdc:mga07m45_50505_c1 nmdc:mga07m45_50505_c1_786_1238 150
772 3300050496 nmdc:mga07m45_59404_c1 nmdc:mga07m45_59404_c1_1040_1492 150
773 3300050507 nmdc:mga05p37_2001070_c1 nmdc:mga05p37_2001070_c1_68_520 150
774 3300050508 nmdc:mga09592_725890_c1 nmdc:mga09592_725890_c1_322_774 150
775 3300050511 nmdc:mga08y16_274643_c1 nmdc:mga08y16_274643_c1_581_1033 150
776 3300050511 nmdc:mga08y16_386921_c1 nmdc:mga08y16_386921_c1_584_1036 150
777 3300050516 nmdc:mga0sz30_210323_c1 nmdc:mga0sz30_210323_c1_125_577 150
778 3300050516 nmdc:mga0sz30_53753_c1 nmdc:mga0sz30_53753_c1_1169_1621 150
779 3300053077 Ga0495601_0031890 Ga0495601_0031890_1149_1607 150
780 3300053077 Ga0495601_0122040 Ga0495601_0122040_1194_1646 150
781 3300053084 Ga0495595_0086143 Ga0495595_0086143_969_1421 150
782 3300053085 Ga0495619_0290279 Ga0495619_0290279_94_546 150
783 3300053088 Ga0500644_0036236 Ga0500644_0036236_282_734 150
784 3300053090 Ga0500646_0150626 Ga0500646_0150626_66_518 150
785 3300053092 Ga0500583_0071453 Ga0500583_0071453_1090_1542 150
786 3300053098 Ga0500650_0164861 Ga0500650_0164861_301_753 150
787 3300053104 Ga0500556_0000486 Ga0500556_0000486_1246_1698 150
788 3300053118 Ga0500594_0040029 Ga0500594_0040029_666_1118 150
789 3300053121 Ga0500607_139792 Ga0500607_139792_271_723 150
790 3300053125 Ga0500618_115570 Ga0500618_115570_66_524 150
791 3300053133 Ga0500655_021221 Ga0500655_021221_42_500 150
792 3300053136 Ga0500559_0000126 Ga0500559_0000126_54977_55429 150
793 3300053136 Ga0500559_0563093 Ga0500559_0563093_35_487 150
794 3300053154 Ga0500619_108190 Ga0500619_108190_441_893 150
795 3300053156 Ga0500622_0005314 Ga0500622_0005314_3946_4398 150
796 3300053158 Ga0500627_0392127 Ga0500627_0392127_88_540 150
797 3300053730 Ga0500645_008546 Ga0500645_008546_1407_1859 150
798 3300053739 Ga0500587_000588 Ga0500587_000588_74_526 150
799 3300053739 Ga0500587_009217 Ga0500587_009217_495_947 150
800 iso_pu_bacteria 2643221576 2643892645 150
801 iso_pu_bacteria 2643221590 2643962094 150
802 3300005327 Ga0070658_10314389 Ga0070658_103143892 151
803 3300005336 Ga0070680_100091888 Ga0070680_1000918882 151
804 3300005338 Ga0068868_100106500 Ga0068868_1001065004 151
805 3300005339 Ga0070660_100047371 Ga0070660_1000473713 151
806 3300005341 Ga0070691_10117972 Ga0070691_101179722 151
807 3300005458 Ga0070681_10273319 Ga0070681_102733193 151
808 3300005530 Ga0070679_100026370 Ga0070679_1000263703 151
809 3300006038 Ga0075365_10001258 Ga0075365_100012586 151
810 3300006038 Ga0075365_10013219 Ga0075365_100132196 151
811 3300006051 Ga0075364_10004205 Ga0075364_100042058 151
812 3300006177 Ga0075362_10017212 Ga0075362_100172122 151
813 3300006178 Ga0075367_10015646 Ga0075367_100156462 151
814 3300006186 Ga0075369_10066707 Ga0075369_100667072 151
815 3300006195 Ga0075366_10510727 Ga0075366_105107271 151
816 3300009093 Ga0105240_10156411 Ga0105240_101564112 151
817 3300009147 Ga0114129_10360430 Ga0114129_103604301 151
818 3300009551 Ga0105238_10063203 Ga0105238_100632034 151
819 3300014969 Ga0157376_10016653 Ga0157376_100166532 151
820 3300025942 Ga0207689_10241921 Ga0207689_102419212 151
821 3300026023 Ga0207677_10039410 Ga0207677_100394104 151
822 3300037471 Ga0395905_1468561 Ga0395905_1468561_112_567 151
823 3300050489 nmdc:mga03683_6668_c1 nmdc:mga03683_6668_c1_760_1215 151
824 3300050491 nmdc:mga00v17_4622_c1 nmdc:mga00v17_4622_c1_3330_3785 151
825 3300050492 nmdc:mga0yw44_11763_c1 nmdc:mga0yw44_11763_c1_3939_4394 151
826 3300050492 nmdc:mga0yw44_29766_c1 nmdc:mga0yw44_29766_c1_2499_2954 151
827 3300050494 nmdc:mga06z11_284694_c1 nmdc:mga06z11_284694_c1_493_948 151
828 3300050507 nmdc:mga05p37_534475_c1 nmdc:mga05p37_534475_c1_677_1132 151
829 3300050516 nmdc:mga0sz30_116965_c1 nmdc:mga0sz30_116965_c1_289_744 151
830 3300003320 rootH2_10037517 rootH2_100375172 152
831 3300003659 JGI25404J52841_10016749 JGI25404J52841_100167492 152
832 3300005353 Ga0070669_100176804 Ga0070669_1001768042 152
833 3300005354 Ga0070675_100289345 Ga0070675_1002893452 152
834 3300005455 Ga0070663_100037279 Ga0070663_1000372793 152
835 3300005457 Ga0070662_100833994 Ga0070662_1008339941 152
836 3300005535 Ga0070684_101140537 Ga0070684_1011405372 152
837 3300005539 Ga0068853_100108400 Ga0068853_1001084002 152
838 3300005543 Ga0070672_100397711 Ga0070672_1003977112 152
839 3300005543 Ga0070672_100665794 Ga0070672_1006657942 152
840 3300005563 Ga0068855_100729089 Ga0068855_1007290892 152
841 3300005983 Ga0081540_1000011 Ga0081540_100001170 152
842 3300005983 Ga0081540_1019580 Ga0081540_10195802 152
843 3300006038 Ga0075365_10311037 Ga0075365_103110372 152
844 3300006048 Ga0075363_100370142 Ga0075363_1003701422 152
845 3300006178 Ga0075367_10186438 Ga0075367_101864382 152
846 3300006195 Ga0075366_10140627 Ga0075366_101406272 152
847 3300006844 Ga0075428_100041134 Ga0075428_1000411341 152
848 3300006844 Ga0075428_101223213 Ga0075428_1012232132 152
849 3300006846 Ga0075430_100146389 Ga0075430_1001463892 152
850 3300006846 Ga0075430_100317471 Ga0075430_1003174712 152
851 3300006847 Ga0075431_100016231 Ga0075431_1000162317 152
852 3300006847 Ga0075431_100086702 Ga0075431_1000867024 152
853 3300006847 Ga0075431_100274045 Ga0075431_1002740453 152
854 3300006880 Ga0075429_100047414 Ga0075429_1000474142 152
855 3300006880 Ga0075429_100511611 Ga0075429_1005116111 152
856 3300006880 Ga0075429_100693419 Ga0075429_1006934192 152
857 3300006914 Ga0075436_101000948 Ga0075436_1010009482 152
858 3300007788 Ga0099795_10011399 Ga0099795_100113992 152
859 3300009094 Ga0111539_10022520 Ga0111539_100225206 152
860 3300009094 Ga0111539_10030368 Ga0111539_100303683 152
861 3300009094 Ga0111539_11104195 Ga0111539_111041952 152
862 3300009101 Ga0105247_10287505 Ga0105247_102875052 152
863 3300009147 Ga0114129_10025035 Ga0114129_100250352 152
864 3300009545 Ga0105237_10015172 Ga0105237_1001517211 152
865 3300009551 Ga0105238_10005340 Ga0105238_1000534012 152
866 3300009553 Ga0105249_10393485 Ga0105249_103934852 152
867 3300009553 Ga0105249_11885151 Ga0105249_118851512 152
868 3300010375 Ga0105239_10079663 Ga0105239_100796632 152
869 3300013296 Ga0157374_10003619 Ga0157374_100036192 152
870 3300013306 Ga0163162_10346750 Ga0163162_103467503 152
871 3300013306 Ga0163162_11105783 Ga0163162_111057831 152
872 3300013306 Ga0163162_11152829 Ga0163162_111528291 152
873 3300014326 Ga0157380_10044486 Ga0157380_100444862 152
874 3300021388 Ga0213875_10136673 Ga0213875_101366732 152
875 3300025914 Ga0207671_10026777 Ga0207671_100267772 152
876 3300025924 Ga0207694_10067262 Ga0207694_100672622 152
877 3300025926 Ga0207659_10116718 Ga0207659_101167182 152
878 3300025940 Ga0207691_10654788 Ga0207691_106547882 152
879 3300025949 Ga0207667_10126181 Ga0207667_101261812 152
880 3300025949 Ga0207667_10589870 Ga0207667_105898702 152
881 3300025972 Ga0207668_10177563 Ga0207668_101775632 152
882 3300026041 Ga0207639_10611751 Ga0207639_106117511 152
883 3300026067 Ga0207678_10041283 Ga0207678_100412834 152
884 3300026089 Ga0207648_10389766 Ga0207648_103897662 152
885 3300027907 Ga0207428_10018366 Ga0207428_100183664 152
886 3300031344 Ga0265316_10286091 Ga0265316_102860911 152
887 3300031731 Ga0307405_11600751 Ga0307405_116007511 152
888 3300031995 Ga0307409_101023067 Ga0307409_1010230672 152
889 3300032002 Ga0307416_101101464 Ga0307416_1011014641 152
890 3300035083 Ga0373926_0003365 Ga0373926_0003365_4111_4578 152
891 3300035086 Ga0373934_0072616 Ga0373934_0072616_421_879 152
892 3300035089 Ga0373944_0201187 Ga0373944_0201187_167_625 152
893 3300035111 Ga0373923_0008893 Ga0373923_0008893_676_1134 152
894 3300035117 Ga0373953_0000591 Ga0373953_0000591_1147_1605 152
895 3300035119 Ga0373956_0006342 Ga0373956_0006342_2785_3243 152
896 3300035120 Ga0373957_0015885 Ga0373957_0015885_931_1389 152
897 3300035724 Ga0373933_0022323 Ga0373933_0022323_2727_3185 152
898 3300037312 Ga0395899_0272876 Ga0395899_0272876_388_846 152
899 3300041509 Ga0451843_0336977 Ga0451843_0336977_785_1249 152
900 3300046454 Ga0495592_0000815 Ga0495592_0000815_4348_4806 152
901 3300046459 Ga0495629_0001921 Ga0495629_0001921_12980_13438 152
902 3300046459 Ga0495629_0032728 Ga0495629_0032728_2210_2677 152
903 3300046462 Ga0495651_0016519 Ga0495651_0016519_4742_5200 152
904 3300046462 Ga0495651_0091103 Ga0495651_0091103_1249_1707 152
905 3300046491 Ga0495584_0339190 Ga0495584_0339190_104_562 152
906 3300046511 Ga0495608_0031249 Ga0495608_0031249_1191_1649 152
907 3300046514 Ga0495618_0034797 Ga0495618_0034797_2095_2553 152
908 3300046516 Ga0495628_0017699 Ga0495628_0017699_4950_5408 152
909 3300046533 Ga0495640_0001223 Ga0495640_0001223_16967_17425 152
910 3300046536 Ga0495587_0010373 Ga0495587_0010373_2824_3282 152
911 3300046559 Ga0495667_0021548 Ga0495667_0021548_2652_3110 152
912 3300046642 Ga0495634_0006090 Ga0495634_0006090_7614_8072 152
913 3300046675 Ga0495657_0069620 Ga0495657_0069620_1484_1942 152
914 3300046678 Ga0495599_0015764 Ga0495599_0015764_1368_1826 152
915 3300046680 Ga0495646_0145124 Ga0495646_0145124_807_1265 152
916 3300047322 Ga0495680_0075594 Ga0495680_0075594_390_848 152
917 3300047471 Ga0495684_0005299 Ga0495684_0005299_8084_8542 152
918 3300047673 Ga0495593_0024096 Ga0495593_0024096_804_1262 152
919 3300048918 Ga0496115_0108657 Ga0496115_0108657_840_1298 152
920 3300048920 Ga0496117_0047473 Ga0496117_0047473_1868_2347 152
921 3300048924 Ga0496121_0021499 Ga0496121_0021499_2034_2492 152
922 3300048927 Ga0496124_0126090 Ga0496124_0126090_604_1062 152
923 3300048928 Ga0496125_0542280 Ga0496125_0542280_83_541 152
924 3300048929 Ga0496126_0040934 Ga0496126_0040934_1889_2347 152
925 3300049460 Ga0495682_0072566 Ga0495682_0072566_288_746 152
926 3300050489 nmdc:mga03683_511647_c1 nmdc:mga03683_511647_c1_114_572 152
927 3300050492 nmdc:mga0yw44_44241_c1 nmdc:mga0yw44_44241_c1_1782_2240 152
928 3300050493 nmdc:mga0k408_83737_c1 nmdc:mga0k408_83737_c1_739_1197 152
929 3300050507 nmdc:mga05p37_3939_c1 nmdc:mga05p37_3939_c1_10770_11228 152
930 3300050508 nmdc:mga09592_28393_c1 nmdc:mga09592_28393_c1_2360_2818 152
931 3300050508 nmdc:mga09592_496959_c1 nmdc:mga09592_496959_c1_438_896 152
932 3300050509 nmdc:mga0qj67_104673_c1 nmdc:mga0qj67_104673_c1_214_672 152
933 3300050509 nmdc:mga0qj67_144969_c1 nmdc:mga0qj67_144969_c1_1112_1570 152
934 3300050510 nmdc:mga06r32_4044_c1 nmdc:mga06r32_4044_c1_428_886 152
935 3300050510 nmdc:mga06r32_71366_c1 nmdc:mga06r32_71366_c1_630_1088 152
936 3300050510 nmdc:mga06r32_76546_c1 nmdc:mga06r32_76546_c1_2439_2897 152
937 3300050511 nmdc:mga08y16_22844_c1 nmdc:mga08y16_22844_c1_19_477 152
938 3300053077 Ga0495601_0195595 Ga0495601_0195595_152_610 152
939 3300053078 Ga0495612_0008508 Ga0495612_0008508_709_1167 152
940 3300053085 Ga0495619_0011988 Ga0495619_0011988_1307_1765 152
941 3300053092 Ga0500583_0200296 Ga0500583_0200296_59_517 152
942 3300053119 Ga0500595_001646 Ga0500595_001646_7900_8358 152
943 3300053119 Ga0500595_195075 Ga0500595_195075_59_517 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

29

154

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9436 2 152
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.9375 2 152
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.837 14 148
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8195 19 152
2bhm-assembly2.cif.gz_D crystal structure of virb8 from brucella suis 0.8025 107 149
ID Description Score Start End Superfamily
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9425 2 152 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9417 1 151 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9364 2 152 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9357 1 151 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.837 14 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2S6RXT6-F1-model_v4 Putative enoyl-CoA hydratase 1 (EC 4.2.1.17) 0.9839 1 152 GO:0004300
AF-A0A2D9XR98-F1-model_v4 deleted 0.9791 1 152
AF-A9BSV1-F1-model_v4 MaoC domain protein dehydratase 0.9788 1 151
AF-A0A6N7A1J6-F1-model_v4 deleted 0.9784 2 151
AF-A0A1B3PGS9-F1-model_v4 Putative enoyl-CoA hydratase 1 0.9776 1 151

Feature Viewer

pLDDT pTM Quality
97.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map