F486386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 943 | 368 | 933 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10403012|Ga0163161_104030121 |
| Length | 170 |
| Sequence | MAVSRTRPPMAFRRFEGKYRMRSFEHLTDLQPLVGQTIGVSDWITVTQERIQLFADATGDHQWIHLDAERAAKGPFGTTIAHGFLTLSLLPEMGASAFEVRDTRMGVNYGLGKVRFPAPVPSGSRLRGHFKLTRYEPLEGGAQLTVEVSMEREGSDKPVCVAESLARRYT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 2 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 3 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 4 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 7 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 8 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 9 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 215 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 241 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 242 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 243 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 244 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 245 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 248 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 331 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 332 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 337 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 346 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 352 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 353 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 354 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 356 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 361 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 362 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 363 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 365 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 368 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 0 |
| Isolates | 1.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.24 |
| Nodule | 0.53 |
| Rhizoplane | 1.7 |
| Rhizosphere | 79.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10037517 | 3300003320 | Bacteria | 1107 |
| 2 | JGI25404J52841_10016749 | 3300003659 | Bacteria | 1590 |
| 3 | JGI25404J52841_10054809 | 3300003659 | Bacteria | 837 |
| 4 | Ga0055530_10004946 | 3300003791 | Bacteria | 6594 |
| 5 | Ga0055530_10027959 | 3300003791 | Bacteria | 1530 |
| 6 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 7 | Ga0065715_10585454 | 3300005293 | Bacteria | 717 |
| 8 | Ga0070658_10124698 | 3300005327 | Bacteria | 2143 |
| 9 | Ga0070658_10314389 | 3300005327 | Bacteria | 1337 |
| 10 | Ga0070676_10001571 | 3300005328 | Bacteria | 11600 |
| 11 | Ga0070676_10042317 | 3300005328 | Bacteria | 2644 |
| 12 | Ga0070676_10068364 | 3300005328 | Bacteria | 2126 |
| 13 | Ga0070676_10387222 | 3300005328 | Bacteria | 969 |
| 14 | Ga0070676_10546457 | 3300005328 | Bacteria | 828 |
| 15 | Ga0070690_100033930 | 3300005330 | Bacteria | 3196 |
| 16 | Ga0070670_100016337 | 3300005331 | Bacteria | 6375 |
| 17 | Ga0070670_100023097 | 3300005331 | Bacteria | 5352 |
| 18 | Ga0070670_100123241 | 3300005331 | Bacteria | 2236 |
| 19 | Ga0070670_100141375 | 3300005331 | Bacteria | 2081 |
| 20 | Ga0070670_100359317 | 3300005331 | Bacteria | 1280 |
| 21 | Ga0070670_100374642 | 3300005331 | Bacteria | 1253 |
| 22 | Ga0070670_100417055 | 3300005331 | Bacteria | 1186 |
| 23 | Ga0070670_100954434 | 3300005331 | Bacteria | 779 |
| 24 | Ga0070677_10082838 | 3300005333 | Bacteria | 1377 |
| 25 | Ga0070677_10136908 | 3300005333 | Bacteria | 1125 |
| 26 | Ga0068869_100239701 | 3300005334 | Bacteria | 1444 |
| 27 | Ga0068869_100351437 | 3300005334 | Bacteria | 1202 |
| 28 | Ga0068869_101320958 | 3300005334 | Bacteria | 637 |
| 29 | Ga0068869_101787187 | 3300005334 | Bacteria | 550 |
| 30 | Ga0070666_10003543 | 3300005335 | Bacteria | 9465 |
| 31 | Ga0070666_10420505 | 3300005335 | Bacteria | 962 |
| 32 | Ga0070666_10445832 | 3300005335 | Bacteria | 934 |
| 33 | Ga0070666_10775274 | 3300005335 | Bacteria | 705 |
| 34 | Ga0070666_10783492 | 3300005335 | Bacteria | 702 |
| 35 | Ga0070680_100091888 | 3300005336 | Bacteria | 2513 |
| 36 | Ga0070682_100280917 | 3300005337 | Bacteria | 1213 |
| 37 | Ga0068868_100028329 | 3300005338 | Bacteria | 4281 |
| 38 | Ga0068868_100034873 | 3300005338 | Bacteria | 3887 |
| 39 | Ga0068868_100034996 | 3300005338 | Bacteria | 3881 |
| 40 | Ga0068868_100057236 | 3300005338 | Bacteria | 3080 |
| 41 | Ga0068868_100077111 | 3300005338 | Bacteria | 2666 |
| 42 | Ga0068868_100106500 | 3300005338 | Bacteria | 2274 |
| 43 | Ga0068868_100302618 | 3300005338 | Bacteria | 1358 |
| 44 | Ga0070660_100047371 | 3300005339 | Bacteria | 3298 |
| 45 | Ga0070660_100169936 | 3300005339 | Bacteria | 1760 |
| 46 | Ga0070689_100584904 | 3300005340 | Bacteria | 965 |
| 47 | Ga0070689_100929303 | 3300005340 | Bacteria | 771 |
| 48 | Ga0070691_10117972 | 3300005341 | Bacteria | 1333 |
| 49 | Ga0070691_10284518 | 3300005341 | Bacteria | 898 |
| 50 | Ga0070687_100364528 | 3300005343 | Bacteria | 936 |
| 51 | Ga0070661_100094009 | 3300005344 | Bacteria | 2221 |
| 52 | Ga0070661_100484173 | 3300005344 | Bacteria | 988 |
| 53 | Ga0070661_100511186 | 3300005344 | Bacteria | 962 |
| 54 | Ga0070692_10303525 | 3300005345 | Bacteria | 975 |
| 55 | Ga0070668_100045003 | 3300005347 | Bacteria | 3386 |
| 56 | Ga0070668_100642543 | 3300005347 | Bacteria | 932 |
| 57 | Ga0070668_100821385 | 3300005347 | Bacteria | 827 |
| 58 | Ga0070669_100165601 | 3300005353 | Bacteria | 1720 |
| 59 | Ga0070669_100176804 | 3300005353 | Bacteria | 1667 |
| 60 | Ga0070669_100373046 | 3300005353 | Bacteria | 1162 |
| 61 | Ga0070669_100545138 | 3300005353 | Bacteria | 966 |
| 62 | Ga0070669_101486088 | 3300005353 | Bacteria | 589 |
| 63 | Ga0070675_100063197 | 3300005354 | Bacteria | 3060 |
| 64 | Ga0070675_100090116 | 3300005354 | Bacteria | 2568 |
| 65 | Ga0070675_100154040 | 3300005354 | Bacteria | 1972 |
| 66 | Ga0070675_100254286 | 3300005354 | Bacteria | 1538 |
| 67 | Ga0070675_100289345 | 3300005354 | Bacteria | 1442 |
| 68 | Ga0070671_100002227 | 3300005355 | Bacteria | 14969 |
| 69 | Ga0070671_100045288 | 3300005355 | Bacteria | 3657 |
| 70 | Ga0070671_100050018 | 3300005355 | Bacteria | 3477 |
| 71 | Ga0070671_100167435 | 3300005355 | Bacteria | 1858 |
| 72 | Ga0070671_100481259 | 3300005355 | Bacteria | 1067 |
| 73 | Ga0070671_100499381 | 3300005355 | Bacteria | 1046 |
| 74 | Ga0070671_101256382 | 3300005355 | Bacteria | 652 |
| 75 | Ga0070674_100032527 | 3300005356 | Bacteria | 3464 |
| 76 | Ga0070674_100033008 | 3300005356 | Bacteria | 3442 |
| 77 | Ga0070674_100176767 | 3300005356 | Bacteria | 1632 |
| 78 | Ga0070674_100284726 | 3300005356 | Bacteria | 1311 |
| 79 | Ga0070674_100309447 | 3300005356 | Bacteria | 1262 |
| 80 | Ga0070673_100018256 | 3300005364 | Bacteria | 5007 |
| 81 | Ga0070673_100053712 | 3300005364 | Bacteria | 3166 |
| 82 | Ga0070673_100069128 | 3300005364 | Bacteria | 2830 |
| 83 | Ga0070673_100256307 | 3300005364 | Bacteria | 1527 |
| 84 | Ga0070673_100332974 | 3300005364 | Bacteria | 1343 |
| 85 | Ga0070673_100527740 | 3300005364 | Bacteria | 1070 |
| 86 | Ga0070673_100639520 | 3300005364 | Bacteria | 973 |
| 87 | Ga0070659_100147324 | 3300005366 | Bacteria | 1918 |
| 88 | Ga0070659_100395090 | 3300005366 | Bacteria | 1166 |
| 89 | Ga0070659_100537561 | 3300005366 | Bacteria | 999 |
| 90 | Ga0070667_100000702 | 3300005367 | Bacteria | 32315 |
| 91 | Ga0070667_100003128 | 3300005367 | Bacteria | 14211 |
| 92 | Ga0070667_100108277 | 3300005367 | Bacteria | 2407 |
| 93 | Ga0070667_100175632 | 3300005367 | Bacteria | 1893 |
| 94 | Ga0070667_100400269 | 3300005367 | Bacteria | 1250 |
| 95 | Ga0070667_100580586 | 3300005367 | Bacteria | 1032 |
| 96 | Ga0070700_100024707 | 3300005441 | Bacteria | 3531 |
| 97 | Ga0070708_100651983 | 3300005445 | Bacteria | 992 |
| 98 | Ga0070663_100022607 | 3300005455 | Bacteria | 4206 |
| 99 | Ga0070663_100037279 | 3300005455 | Bacteria | 3383 |
| 100 | Ga0070663_100040976 | 3300005455 | Bacteria | 3245 |
| 101 | Ga0070663_100273542 | 3300005455 | Bacteria | 1344 |
| 102 | Ga0070663_100293745 | 3300005455 | Bacteria | 1299 |
| 103 | Ga0070663_100736600 | 3300005455 | Bacteria | 841 |
| 104 | Ga0070678_100015805 | 3300005456 | Bacteria | 4807 |
| 105 | Ga0070678_100033253 | 3300005456 | Bacteria | 3578 |
| 106 | Ga0070678_100117756 | 3300005456 | Bacteria | 2089 |
| 107 | Ga0070678_100340408 | 3300005456 | Bacteria | 1287 |
| 108 | Ga0070678_100776117 | 3300005456 | Bacteria | 868 |
| 109 | Ga0070678_101122836 | 3300005456 | Bacteria | 726 |
| 110 | Ga0070678_101827763 | 3300005456 | Bacteria | 573 |
| 111 | Ga0070662_100010591 | 3300005457 | Bacteria | 6060 |
| 112 | Ga0070662_100057619 | 3300005457 | Bacteria | 2823 |
| 113 | Ga0070662_100117017 | 3300005457 | Bacteria | 2038 |
| 114 | Ga0070662_100131601 | 3300005457 | Bacteria | 1929 |
| 115 | Ga0070662_100393068 | 3300005457 | Bacteria | 1143 |
| 116 | Ga0070662_100833994 | 3300005457 | Unclassified | 785 |
| 117 | Ga0070681_10273319 | 3300005458 | Bacteria | 1601 |
| 118 | Ga0068867_100002735 | 3300005459 | Bacteria | 12433 |
| 119 | Ga0068867_100061849 | 3300005459 | Bacteria | 2781 |
| 120 | Ga0068867_100068826 | 3300005459 | Bacteria | 2642 |
| 121 | Ga0068867_100135893 | 3300005459 | Bacteria | 1916 |
| 122 | Ga0068867_100166447 | 3300005459 | Bacteria | 1742 |
| 123 | Ga0070685_10333550 | 3300005466 | Bacteria | 1032 |
| 124 | Ga0070685_10746709 | 3300005466 | Bacteria | 717 |
| 125 | Ga0070706_100000671 | 3300005467 | Bacteria | 38797 |
| 126 | Ga0070706_100070158 | 3300005467 | Bacteria | 3241 |
| 127 | Ga0070707_100009411 | 3300005468 | Bacteria | 9069 |
| 128 | Ga0070679_100026370 | 3300005530 | Bacteria | 5709 |
| 129 | Ga0070679_100547700 | 3300005530 | Bacteria | 1101 |
| 130 | Ga0070684_101140537 | 3300005535 | Bacteria | 733 |
| 131 | Ga0068853_100108400 | 3300005539 | Bacteria | 2464 |
| 132 | Ga0068853_100433149 | 3300005539 | Bacteria | 1235 |
| 133 | Ga0070672_100002315 | 3300005543 | Bacteria | 12032 |
| 134 | Ga0070672_100028972 | 3300005543 | Bacteria | 4146 |
| 135 | Ga0070672_100038652 | 3300005543 | Bacteria | 3649 |
| 136 | Ga0070672_100084456 | 3300005543 | Bacteria | 2549 |
| 137 | Ga0070672_100090945 | 3300005543 | Bacteria | 2462 |
| 138 | Ga0070672_100136490 | 3300005543 | Bacteria | 2020 |
| 139 | Ga0070672_100171686 | 3300005543 | Bacteria | 1804 |
| 140 | Ga0070672_100224675 | 3300005543 | Bacteria | 1576 |
| 141 | Ga0070672_100259699 | 3300005543 | Bacteria | 1464 |
| 142 | Ga0070672_100397711 | 3300005543 | Bacteria | 1181 |
| 143 | Ga0070672_100410615 | 3300005543 | Bacteria | 1162 |
| 144 | Ga0070672_100665794 | 3300005543 | Bacteria | 910 |
| 145 | Ga0070693_100071429 | 3300005547 | Bacteria | 2045 |
| 146 | Ga0070665_100233384 | 3300005548 | Bacteria | 1840 |
| 147 | Ga0070704_100545621 | 3300005549 | Bacteria | 1012 |
| 148 | Ga0068855_100004988 | 3300005563 | Bacteria | 16202 |
| 149 | Ga0068855_100729089 | 3300005563 | Bacteria | 1058 |
| 150 | Ga0070664_100033760 | 3300005564 | Bacteria | 4288 |
| 151 | Ga0070664_100182376 | 3300005564 | Bacteria | 1866 |
| 152 | Ga0070664_100871420 | 3300005564 | Bacteria | 843 |
| 153 | Ga0070664_101279357 | 3300005564 | Bacteria | 692 |
| 154 | Ga0068857_100013080 | 3300005577 | Bacteria | 7231 |
| 155 | Ga0068857_100089872 | 3300005577 | Bacteria | 2748 |
| 156 | Ga0068854_100045777 | 3300005578 | Bacteria | 3112 |
| 157 | Ga0068854_100530591 | 3300005578 | Bacteria | 995 |
| 158 | Ga0068854_100543221 | 3300005578 | Bacteria | 984 |
| 159 | Ga0068854_100678904 | 3300005578 | Bacteria | 887 |
| 160 | Ga0070702_100150142 | 3300005615 | Bacteria | 1495 |
| 161 | Ga0068852_100192879 | 3300005616 | Bacteria | 1923 |
| 162 | Ga0068852_100264517 | 3300005616 | Bacteria | 1652 |
| 163 | Ga0068852_100273340 | 3300005616 | Bacteria | 1627 |
| 164 | Ga0068852_100409503 | 3300005616 | Bacteria | 1335 |
| 165 | Ga0068852_100585553 | 3300005616 | Bacteria | 1119 |
| 166 | Ga0068852_100871834 | 3300005616 | Bacteria | 916 |
| 167 | Ga0068852_101784896 | 3300005616 | Bacteria | 637 |
| 168 | Ga0068859_100055119 | 3300005617 | Bacteria | 4000 |
| 169 | Ga0068859_100351485 | 3300005617 | Bacteria | 1569 |
| 170 | Ga0068859_101416460 | 3300005617 | Bacteria | 767 |
| 171 | Ga0068864_100043014 | 3300005618 | Bacteria | 3866 |
| 172 | Ga0068864_100048474 | 3300005618 | Bacteria | 3652 |
| 173 | Ga0068864_100181312 | 3300005618 | Bacteria | 1925 |
| 174 | Ga0068866_10027930 | 3300005718 | Bacteria | 2684 |
| 175 | Ga0068866_10412886 | 3300005718 | Bacteria | 874 |
| 176 | Ga0068861_100004858 | 3300005719 | Bacteria | 9039 |
| 177 | Ga0068861_100374752 | 3300005719 | Bacteria | 1256 |
| 178 | Ga0068851_10041380 | 3300005834 | Bacteria | 2316 |
| 179 | Ga0068863_100018157 | 3300005841 | Bacteria | 6736 |
| 180 | Ga0068863_100023761 | 3300005841 | Bacteria | 5848 |
| 181 | Ga0068863_100052850 | 3300005841 | Bacteria | 3849 |
| 182 | Ga0068863_100059049 | 3300005841 | Bacteria | 3629 |
| 183 | Ga0068863_100237760 | 3300005841 | Bacteria | 1758 |
| 184 | Ga0068863_100971013 | 3300005841 | Bacteria | 852 |
| 185 | Ga0068863_101171557 | 3300005841 | Bacteria | 774 |
| 186 | Ga0068863_101516845 | 3300005841 | Bacteria | 679 |
| 187 | Ga0068858_100051286 | 3300005842 | Bacteria | 3817 |
| 188 | Ga0068860_100055844 | 3300005843 | Bacteria | 3754 |
| 189 | Ga0068860_100064811 | 3300005843 | Bacteria | 3470 |
| 190 | Ga0068860_100359658 | 3300005843 | Bacteria | 1434 |
| 191 | Ga0068862_100124433 | 3300005844 | Bacteria | 2275 |
| 192 | Ga0068862_101071626 | 3300005844 | Bacteria | 800 |
| 193 | Ga0081455_10504311 | 3300005937 | Bacteria | 812 |
| 194 | Ga0081540_1000011 | 3300005983 | Bacteria | 191880 |
| 195 | Ga0081540_1000327 | 3300005983 | Bacteria | 49238 |
| 196 | Ga0081540_1006280 | 3300005983 | Bacteria | 8696 |
| 197 | Ga0081540_1019580 | 3300005983 | Bacteria | 4105 |
| 198 | Ga0075365_10001258 | 3300006038 | Bacteria | 11238 |
| 199 | Ga0075365_10013219 | 3300006038 | Bacteria | 4926 |
| 200 | Ga0075365_10105522 | 3300006038 | Bacteria | 1933 |
| 201 | Ga0075365_10311037 | 3300006038 | Bacteria | 1109 |
| 202 | Ga0075368_10018388 | 3300006042 | Bacteria | 2626 |
| 203 | Ga0075363_100006739 | 3300006048 | Bacteria | 5244 |
| 204 | Ga0075363_100180366 | 3300006048 | Bacteria | 1201 |
| 205 | Ga0075363_100370142 | 3300006048 | Bacteria | 839 |
| 206 | Ga0075363_100722228 | 3300006048 | Bacteria | 603 |
| 207 | Ga0075364_10004205 | 3300006051 | Bacteria | 8261 |
| 208 | Ga0070716_100198683 | 3300006173 | Bacteria | 1331 |
| 209 | Ga0075362_10009819 | 3300006177 | Bacteria | 3715 |
| 210 | Ga0075362_10017212 | 3300006177 | Bacteria | 2975 |
| 211 | Ga0075362_10030180 | 3300006177 | Bacteria | 2340 |
| 212 | Ga0075362_10073657 | 3300006177 | Bacteria | 1563 |
| 213 | Ga0075367_10000286 | 3300006178 | Bacteria | 17670 |
| 214 | Ga0075367_10010668 | 3300006178 | Bacteria | 4835 |
| 215 | Ga0075367_10015646 | 3300006178 | Bacteria | 4129 |
| 216 | Ga0075367_10066306 | 3300006178 | Bacteria | 2163 |
| 217 | Ga0075367_10186438 | 3300006178 | Bacteria | 1294 |
| 218 | Ga0075369_10001735 | 3300006186 | Bacteria | 7544 |
| 219 | Ga0075369_10066707 | 3300006186 | Bacteria | 1579 |
| 220 | Ga0075366_10001659 | 3300006195 | Bacteria | 11175 |
| 221 | Ga0075366_10140627 | 3300006195 | Bacteria | 1459 |
| 222 | Ga0075366_10141490 | 3300006195 | Bacteria | 1455 |
| 223 | Ga0075366_10188777 | 3300006195 | Bacteria | 1252 |
| 224 | Ga0075366_10510727 | 3300006195 | Bacteria | 743 |
| 225 | Ga0097621_100027899 | 3300006237 | Bacteria | 4445 |
| 226 | Ga0097621_100267567 | 3300006237 | Bacteria | 1501 |
| 227 | Ga0097621_100282822 | 3300006237 | Bacteria | 1460 |
| 228 | Ga0097621_100513610 | 3300006237 | Bacteria | 1087 |
| 229 | Ga0097621_100822595 | 3300006237 | Bacteria | 861 |
| 230 | Ga0097621_101136710 | 3300006237 | Bacteria | 734 |
| 231 | Ga0097621_101230784 | 3300006237 | Bacteria | 706 |
| 232 | Ga0097621_101385036 | 3300006237 | Bacteria | 666 |
| 233 | Ga0075370_10003013 | 3300006353 | Bacteria | 7936 |
| 234 | Ga0075370_10008160 | 3300006353 | Bacteria | 5373 |
| 235 | Ga0075370_10031485 | 3300006353 | Bacteria | 2961 |
| 236 | Ga0075370_10040724 | 3300006353 | Bacteria | 2621 |
| 237 | Ga0075370_10091911 | 3300006353 | Bacteria | 1751 |
| 238 | Ga0075370_10298113 | 3300006353 | Bacteria | 958 |
| 239 | Ga0075370_10345216 | 3300006353 | Bacteria | 889 |
| 240 | Ga0075370_10582564 | 3300006353 | Bacteria | 677 |
| 241 | Ga0068871_100048558 | 3300006358 | Bacteria | 3427 |
| 242 | Ga0068871_100094270 | 3300006358 | Bacteria | 2499 |
| 243 | Ga0068871_100120272 | 3300006358 | Bacteria | 2218 |
| 244 | Ga0068871_100213010 | 3300006358 | Bacteria | 1671 |
| 245 | Ga0068871_100240650 | 3300006358 | Bacteria | 1573 |
| 246 | Ga0068871_100608077 | 3300006358 | Bacteria | 995 |
| 247 | Ga0075428_100041134 | 3300006844 | Bacteria | 5084 |
| 248 | Ga0075428_101223213 | 3300006844 | Unclassified | 791 |
| 249 | Ga0075428_101874561 | 3300006844 | Bacteria | 623 |
| 250 | Ga0075430_100146389 | 3300006846 | Bacteria | 1967 |
| 251 | Ga0075430_100317471 | 3300006846 | Bacteria | 1288 |
| 252 | Ga0075431_100016231 | 3300006847 | Bacteria | 7555 |
| 253 | Ga0075431_100086702 | 3300006847 | Bacteria | 3231 |
| 254 | Ga0075431_100274045 | 3300006847 | Unclassified | 1709 |
| 255 | Ga0075429_100047414 | 3300006880 | Bacteria | 3738 |
| 256 | Ga0075429_100511611 | 3300006880 | Bacteria | 1052 |
| 257 | Ga0075429_100693419 | 3300006880 | Bacteria | 892 |
| 258 | Ga0068865_100004931 | 3300006881 | Bacteria | 8069 |
| 259 | Ga0068865_100008008 | 3300006881 | Bacteria | 6525 |
| 260 | Ga0068865_100111196 | 3300006881 | Bacteria | 2021 |
| 261 | Ga0068865_100282035 | 3300006881 | Bacteria | 1323 |
| 262 | Ga0068865_100478896 | 3300006881 | Bacteria | 1034 |
| 263 | Ga0068865_100676425 | 3300006881 | Bacteria | 880 |
| 264 | Ga0075436_101000948 | 3300006914 | Bacteria | 627 |
| 265 | Ga0097620_100055123 | 3300006931 | Bacteria | 4000 |
| 266 | Ga0097620_100351509 | 3300006931 | Bacteria | 1569 |
| 267 | Ga0097620_101416543 | 3300006931 | Bacteria | 767 |
| 268 | Ga0079104_1000839 | 3300006946 | Bacteria | 25542 |
| 269 | Ga0099795_10000876 | 3300007788 | Bacteria | 6045 |
| 270 | Ga0099795_10011399 | 3300007788 | Bacteria | 2657 |
| 271 | Ga0105240_10156411 | 3300009093 | Bacteria | 2710 |
| 272 | Ga0105240_10156460 | 3300009093 | Bacteria | 2710 |
| 273 | Ga0111539_10022520 | 3300009094 | Bacteria | 7740 |
| 274 | Ga0111539_10030368 | 3300009094 | Bacteria | 6569 |
| 275 | Ga0111539_10483084 | 3300009094 | Bacteria | 1443 |
| 276 | Ga0111539_11104195 | 3300009094 | Bacteria | 922 |
| 277 | Ga0105245_10189019 | 3300009098 | Bacteria | 1972 |
| 278 | Ga0105245_10472989 | 3300009098 | Bacteria | 1265 |
| 279 | Ga0105245_10568449 | 3300009098 | Bacteria | 1157 |
| 280 | Ga0105245_10606543 | 3300009098 | Bacteria | 1122 |
| 281 | Ga0105245_10875070 | 3300009098 | Bacteria | 939 |
| 282 | Ga0105247_10287505 | 3300009101 | Bacteria | 1136 |
| 283 | Ga0105247_10354331 | 3300009101 | Bacteria | 1033 |
| 284 | Ga0114129_10025035 | 3300009147 | Bacteria | 8460 |
| 285 | Ga0114129_10360430 | 3300009147 | Bacteria | 1924 |
| 286 | Ga0114129_13056944 | 3300009147 | Bacteria | 548 |
| 287 | Ga0105243_10262108 | 3300009148 | Bacteria | 1548 |
| 288 | Ga0105243_10418367 | 3300009148 | Bacteria | 1249 |
| 289 | Ga0105243_10690076 | 3300009148 | Bacteria | 994 |
| 290 | Ga0105243_11475344 | 3300009148 | Bacteria | 703 |
| 291 | Ga0105241_10331738 | 3300009174 | Bacteria | 1315 |
| 292 | Ga0105242_10057880 | 3300009176 | Bacteria | 3175 |
| 293 | Ga0105242_10541384 | 3300009176 | Bacteria | 1114 |
| 294 | Ga0105242_10704468 | 3300009176 | Bacteria | 988 |
| 295 | Ga0105248_10015932 | 3300009177 | Bacteria | 8278 |
| 296 | Ga0105248_10044985 | 3300009177 | Bacteria | 4950 |
| 297 | Ga0105248_10059293 | 3300009177 | Bacteria | 4299 |
| 298 | Ga0105248_10146437 | 3300009177 | Bacteria | 2665 |
| 299 | Ga0105248_10584820 | 3300009177 | Bacteria | 1260 |
| 300 | Ga0105248_10648769 | 3300009177 | Bacteria | 1191 |
| 301 | Ga0105248_10712936 | 3300009177 | Bacteria | 1132 |
| 302 | Ga0105248_10746295 | 3300009177 | Bacteria | 1104 |
| 303 | Ga0105248_10784767 | 3300009177 | Bacteria | 1075 |
| 304 | Ga0105248_11176691 | 3300009177 | Bacteria | 867 |
| 305 | Ga0105248_12203579 | 3300009177 | Bacteria | 627 |
| 306 | Ga0105237_10015172 | 3300009545 | Bacteria | 8028 |
| 307 | Ga0105237_10121851 | 3300009545 | Bacteria | 2602 |
| 308 | Ga0105237_10298827 | 3300009545 | Bacteria | 1613 |
| 309 | Ga0105238_10005340 | 3300009551 | Bacteria | 12696 |
| 310 | Ga0105238_10063203 | 3300009551 | Bacteria | 3702 |
| 311 | Ga0105238_11562495 | 3300009551 | Bacteria | 689 |
| 312 | Ga0105249_10006344 | 3300009553 | Bacteria | 10278 |
| 313 | Ga0105249_10010010 | 3300009553 | Bacteria | 8320 |
| 314 | Ga0105249_10393485 | 3300009553 | Bacteria | 1414 |
| 315 | Ga0105249_11885151 | 3300009553 | Bacteria | 670 |
| 316 | Ga0099796_10093126 | 3300010159 | Bacteria | 1123 |
| 317 | Ga0105239_10071838 | 3300010375 | Bacteria | 3802 |
| 318 | Ga0105239_10079663 | 3300010375 | Bacteria | 3604 |
| 319 | Ga0105246_10311415 | 3300011119 | Bacteria | 1275 |
| 320 | Ga0105246_10613197 | 3300011119 | Bacteria | 942 |
| 321 | Ga0157369_10323014 | 3300013105 | Bacteria | 1604 |
| 322 | Ga0157374_10003619 | 3300013296 | Bacteria | 13010 |
| 323 | Ga0157374_10040378 | 3300013296 | Bacteria | 4297 |
| 324 | Ga0157374_10218393 | 3300013296 | Bacteria | 1870 |
| 325 | Ga0157374_10516831 | 3300013296 | Bacteria | 1200 |
| 326 | Ga0157374_10638186 | 3300013296 | Bacteria | 1076 |
| 327 | Ga0157374_10716923 | 3300013296 | Bacteria | 1014 |
| 328 | Ga0157378_10129320 | 3300013297 | Bacteria | 2336 |
| 329 | Ga0157378_10743273 | 3300013297 | Bacteria | 1003 |
| 330 | Ga0163162_10005745 | 3300013306 | Bacteria | 11999 |
| 331 | Ga0163162_10131671 | 3300013306 | Bacteria | 2609 |
| 332 | Ga0163162_10169211 | 3300013306 | Bacteria | 2310 |
| 333 | Ga0163162_10346750 | 3300013306 | Bacteria | 1618 |
| 334 | Ga0163162_10414512 | 3300013306 | Bacteria | 1479 |
| 335 | Ga0163162_10957664 | 3300013306 | Bacteria | 967 |
| 336 | Ga0163162_11105783 | 3300013306 | Bacteria | 898 |
| 337 | Ga0163162_11152829 | 3300013306 | Bacteria | 879 |
| 338 | Ga0163162_11900402 | 3300013306 | Bacteria | 681 |
| 339 | Ga0157372_11888685 | 3300013307 | Bacteria | 686 |
| 340 | Ga0157375_10015577 | 3300013308 | Bacteria | 6809 |
| 341 | Ga0157375_10040729 | 3300013308 | Bacteria | 4481 |
| 342 | Ga0157375_10087592 | 3300013308 | Bacteria | 3166 |
| 343 | Ga0157375_10132947 | 3300013308 | Bacteria | 2609 |
| 344 | Ga0157375_10194002 | 3300013308 | Bacteria | 2186 |
| 345 | Ga0157375_10593668 | 3300013308 | Bacteria | 1267 |
| 346 | Ga0157375_10807015 | 3300013308 | Bacteria | 1087 |
| 347 | Ga0163163_10958237 | 3300014325 | Bacteria | 919 |
| 348 | Ga0157380_10009952 | 3300014326 | Bacteria | 6824 |
| 349 | Ga0157380_10044486 | 3300014326 | Bacteria | 3480 |
| 350 | Ga0157380_11619408 | 3300014326 | Bacteria | 703 |
| 351 | Ga0182008_10158316 | 3300014497 | Unclassified | 1138 |
| 352 | Ga0157377_10830713 | 3300014745 | Unclassified | 684 |
| 353 | Ga0157379_10008063 | 3300014968 | Bacteria | 9147 |
| 354 | Ga0157379_10160745 | 3300014968 | Bacteria | 2027 |
| 355 | Ga0157379_10387042 | 3300014968 | Bacteria | 1284 |
| 356 | Ga0157376_10016653 | 3300014969 | Bacteria | 5587 |
| 357 | Ga0157376_10059288 | 3300014969 | Bacteria | 3209 |
| 358 | Ga0157376_10221927 | 3300014969 | Bacteria | 1751 |
| 359 | Ga0157376_10673285 | 3300014969 | Bacteria | 1037 |
| 360 | Ga0157376_10893854 | 3300014969 | Bacteria | 906 |
| 361 | Ga0157376_11337024 | 3300014969 | Bacteria | 747 |
| 362 | Ga0157376_12112069 | 3300014969 | Bacteria | 602 |
| 363 | Ga0163161_10107886 | 3300017792 | Bacteria | 2078 |
| 364 | Ga0163161_10403012 | 3300017792 | Bacteria | 1097 |
| 365 | Ga0163161_10596864 | 3300017792 | Bacteria | 910 |
| 366 | Ga0213875_10136673 | 3300021388 | Bacteria | 1146 |
| 367 | Ga0209675_1015366 | 3300025291 | Bacteria | 2277 |
| 368 | Ga0209050_1001035 | 3300025298 | Bacteria | 34509 |
| 369 | Ga0209050_1007995 | 3300025298 | Bacteria | 5770 |
| 370 | Ga0209256_1000143 | 3300025299 | Bacteria | 151331 |
| 371 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 372 | Ga0209257_1000079 | 3300025304 | Bacteria | 316420 |
| 373 | Ga0209257_1040119 | 3300025304 | Bacteria | 1400 |
| 374 | Ga0207697_10011942 | 3300025315 | Bacteria | 3658 |
| 375 | Ga0207697_10036965 | 3300025315 | Bacteria | 2000 |
| 376 | Ga0207656_10084860 | 3300025321 | Bacteria | 1429 |
| 377 | Ga0207656_10341297 | 3300025321 | Bacteria | 746 |
| 378 | Ga0207682_10009193 | 3300025893 | Bacteria | 3903 |
| 379 | Ga0207682_10018630 | 3300025893 | Bacteria | 2715 |
| 380 | Ga0207682_10088909 | 3300025893 | Bacteria | 1336 |
| 381 | Ga0207642_10004867 | 3300025899 | Bacteria | 4349 |
| 382 | Ga0207642_10168536 | 3300025899 | Bacteria | 1183 |
| 383 | Ga0207688_10077825 | 3300025901 | Bacteria | 1890 |
| 384 | Ga0207688_10335936 | 3300025901 | Bacteria | 929 |
| 385 | Ga0207680_10014466 | 3300025903 | Bacteria | 4085 |
| 386 | Ga0207680_10379220 | 3300025903 | Bacteria | 997 |
| 387 | Ga0207680_10388298 | 3300025903 | Bacteria | 985 |
| 388 | Ga0207685_10145266 | 3300025905 | Bacteria | 1068 |
| 389 | Ga0207645_10001208 | 3300025907 | Bacteria | 21313 |
| 390 | Ga0207645_10063363 | 3300025907 | Bacteria | 2362 |
| 391 | Ga0207645_10221700 | 3300025907 | Bacteria | 1247 |
| 392 | Ga0207645_10230742 | 3300025907 | Bacteria | 1222 |
| 393 | Ga0207645_10235704 | 3300025907 | Bacteria | 1208 |
| 394 | Ga0207645_10276870 | 3300025907 | Bacteria | 1114 |
| 395 | Ga0207645_10448855 | 3300025907 | Bacteria | 870 |
| 396 | Ga0207643_10058333 | 3300025908 | Bacteria | 2200 |
| 397 | Ga0207643_10141221 | 3300025908 | Bacteria | 1439 |
| 398 | Ga0207643_10375273 | 3300025908 | Bacteria | 896 |
| 399 | Ga0207705_10100307 | 3300025909 | Bacteria | 2129 |
| 400 | Ga0207705_10531408 | 3300025909 | Bacteria | 914 |
| 401 | Ga0207684_10000939 | 3300025910 | Bacteria | 32889 |
| 402 | Ga0207684_10213189 | 3300025910 | Bacteria | 1666 |
| 403 | Ga0207654_10150347 | 3300025911 | Bacteria | 1494 |
| 404 | Ga0207695_10139621 | 3300025913 | Bacteria | 2373 |
| 405 | Ga0207671_10026777 | 3300025914 | Bacteria | 4315 |
| 406 | Ga0207671_10113189 | 3300025914 | Bacteria | 2067 |
| 407 | Ga0207671_10320783 | 3300025914 | Bacteria | 1226 |
| 408 | Ga0207660_10625957 | 3300025917 | Bacteria | 877 |
| 409 | Ga0207662_10025459 | 3300025918 | Bacteria | 3408 |
| 410 | Ga0207657_10039408 | 3300025919 | Bacteria | 4200 |
| 411 | Ga0207657_10288215 | 3300025919 | Bacteria | 1302 |
| 412 | Ga0207657_10544963 | 3300025919 | Bacteria | 907 |
| 413 | Ga0207657_10739657 | 3300025919 | Bacteria | 762 |
| 414 | Ga0207652_10096850 | 3300025921 | Bacteria | 2600 |
| 415 | Ga0207652_10433227 | 3300025921 | Bacteria | 1186 |
| 416 | Ga0207646_10163030 | 3300025922 | Bacteria | 2012 |
| 417 | Ga0207646_10742048 | 3300025922 | Bacteria | 876 |
| 418 | Ga0207681_10004559 | 3300025923 | Bacteria | 8524 |
| 419 | Ga0207681_10058879 | 3300025923 | Bacteria | 2632 |
| 420 | Ga0207694_10067262 | 3300025924 | Bacteria | 2797 |
| 421 | Ga0207694_10168524 | 3300025924 | Bacteria | 1772 |
| 422 | Ga0207650_10002985 | 3300025925 | Bacteria | 11671 |
| 423 | Ga0207650_10005604 | 3300025925 | Bacteria | 8578 |
| 424 | Ga0207650_10074941 | 3300025925 | Bacteria | 2552 |
| 425 | Ga0207650_10101123 | 3300025925 | Bacteria | 2219 |
| 426 | Ga0207650_10292567 | 3300025925 | Bacteria | 1328 |
| 427 | Ga0207650_10423975 | 3300025925 | Bacteria | 1104 |
| 428 | Ga0207650_10453781 | 3300025925 | Bacteria | 1067 |
| 429 | Ga0207650_10713305 | 3300025925 | Bacteria | 848 |
| 430 | Ga0207659_10069997 | 3300025926 | Bacteria | 2557 |
| 431 | Ga0207659_10095714 | 3300025926 | Bacteria | 2227 |
| 432 | Ga0207659_10116718 | 3300025926 | Bacteria | 2038 |
| 433 | Ga0207659_10165772 | 3300025926 | Bacteria | 1739 |
| 434 | Ga0207659_10261958 | 3300025926 | Bacteria | 1407 |
| 435 | Ga0207659_10298933 | 3300025926 | Bacteria | 1321 |
| 436 | Ga0207659_10319657 | 3300025926 | Bacteria | 1280 |
| 437 | Ga0207659_10335299 | 3300025926 | Bacteria | 1251 |
| 438 | Ga0207659_10580741 | 3300025926 | Bacteria | 954 |
| 439 | Ga0207687_10075351 | 3300025927 | Bacteria | 2421 |
| 440 | Ga0207687_10082961 | 3300025927 | Bacteria | 2319 |
| 441 | Ga0207687_10118635 | 3300025927 | Bacteria | 1975 |
| 442 | Ga0207664_10685375 | 3300025929 | Bacteria | 921 |
| 443 | Ga0207644_10008221 | 3300025931 | Bacteria | 6834 |
| 444 | Ga0207644_10086886 | 3300025931 | Bacteria | 2323 |
| 445 | Ga0207644_10127733 | 3300025931 | Bacteria | 1942 |
| 446 | Ga0207644_10153745 | 3300025931 | Bacteria | 1782 |
| 447 | Ga0207644_10155868 | 3300025931 | Bacteria | 1771 |
| 448 | Ga0207644_10304472 | 3300025931 | Bacteria | 1285 |
| 449 | Ga0207644_10618399 | 3300025931 | Bacteria | 900 |
| 450 | Ga0207690_11545370 | 3300025932 | Bacteria | 555 |
| 451 | Ga0207706_10013363 | 3300025933 | Bacteria | 7469 |
| 452 | Ga0207706_10102439 | 3300025933 | Bacteria | 2519 |
| 453 | Ga0207706_10159032 | 3300025933 | Bacteria | 1986 |
| 454 | Ga0207706_10172280 | 3300025933 | Bacteria | 1902 |
| 455 | Ga0207706_10355061 | 3300025933 | Bacteria | 1274 |
| 456 | Ga0207706_10395302 | 3300025933 | Bacteria | 1199 |
| 457 | Ga0207706_10709514 | 3300025933 | Bacteria | 859 |
| 458 | Ga0207706_11265749 | 3300025933 | Bacteria | 611 |
| 459 | Ga0207686_10012711 | 3300025934 | Bacteria | 4634 |
| 460 | Ga0207686_10236380 | 3300025934 | Bacteria | 1328 |
| 461 | Ga0207686_11108665 | 3300025934 | Bacteria | 645 |
| 462 | Ga0207709_10010252 | 3300025935 | Bacteria | 5162 |
| 463 | Ga0207709_10102813 | 3300025935 | Bacteria | 1892 |
| 464 | Ga0207709_10131907 | 3300025935 | Bacteria | 1704 |
| 465 | Ga0207709_10314345 | 3300025935 | Bacteria | 1170 |
| 466 | Ga0207670_10664012 | 3300025936 | Bacteria | 860 |
| 467 | Ga0207670_11307063 | 3300025936 | Bacteria | 615 |
| 468 | Ga0207669_10003010 | 3300025937 | Bacteria | 7252 |
| 469 | Ga0207669_10025177 | 3300025937 | Bacteria | 3211 |
| 470 | Ga0207669_10174143 | 3300025937 | Bacteria | 1535 |
| 471 | Ga0207669_10655080 | 3300025937 | Bacteria | 859 |
| 472 | Ga0207704_10090498 | 3300025938 | Bacteria | 2008 |
| 473 | Ga0207704_10127219 | 3300025938 | Bacteria | 1756 |
| 474 | Ga0207704_10415419 | 3300025938 | Bacteria | 1065 |
| 475 | Ga0207704_10571005 | 3300025938 | Bacteria | 922 |
| 476 | Ga0207704_10896347 | 3300025938 | Bacteria | 746 |
| 477 | Ga0207691_10001739 | 3300025940 | Bacteria | 21471 |
| 478 | Ga0207691_10004984 | 3300025940 | Bacteria | 12808 |
| 479 | Ga0207691_10005163 | 3300025940 | Bacteria | 12608 |
| 480 | Ga0207691_10075981 | 3300025940 | Bacteria | 3028 |
| 481 | Ga0207691_10195709 | 3300025940 | Bacteria | 1761 |
| 482 | Ga0207691_10215824 | 3300025940 | Bacteria | 1665 |
| 483 | Ga0207691_10267612 | 3300025940 | Bacteria | 1472 |
| 484 | Ga0207691_10369720 | 3300025940 | Bacteria | 1225 |
| 485 | Ga0207691_10371320 | 3300025940 | Bacteria | 1222 |
| 486 | Ga0207691_10654788 | 3300025940 | Bacteria | 887 |
| 487 | Ga0207711_10006629 | 3300025941 | Bacteria | 9754 |
| 488 | Ga0207711_10011087 | 3300025941 | Bacteria | 7491 |
| 489 | Ga0207711_10121741 | 3300025941 | Bacteria | 2330 |
| 490 | Ga0207711_10307864 | 3300025941 | Bacteria | 1462 |
| 491 | Ga0207711_10474460 | 3300025941 | Bacteria | 1165 |
| 492 | Ga0207689_10043632 | 3300025942 | Bacteria | 3707 |
| 493 | Ga0207689_10178173 | 3300025942 | Bacteria | 1753 |
| 494 | Ga0207689_10184318 | 3300025942 | Bacteria | 1722 |
| 495 | Ga0207689_10241921 | 3300025942 | Bacteria | 1492 |
| 496 | Ga0207689_10249506 | 3300025942 | Bacteria | 1468 |
| 497 | Ga0207689_10310633 | 3300025942 | Bacteria | 1307 |
| 498 | Ga0207689_11000290 | 3300025942 | Bacteria | 705 |
| 499 | Ga0207679_10192108 | 3300025945 | Bacteria | 1698 |
| 500 | Ga0207679_11274601 | 3300025945 | Bacteria | 674 |
| 501 | Ga0207679_11685404 | 3300025945 | Bacteria | 580 |
| 502 | Ga0207667_10126181 | 3300025949 | Bacteria | 2636 |
| 503 | Ga0207667_10589870 | 3300025949 | Bacteria | 1121 |
| 504 | Ga0207651_10017871 | 3300025960 | Bacteria | 4202 |
| 505 | Ga0207651_10051418 | 3300025960 | Bacteria | 2803 |
| 506 | Ga0207651_10055941 | 3300025960 | Bacteria | 2712 |
| 507 | Ga0207651_10085627 | 3300025960 | Bacteria | 2287 |
| 508 | Ga0207651_10153823 | 3300025960 | Bacteria | 1794 |
| 509 | Ga0207651_10218471 | 3300025960 | Bacteria | 1539 |
| 510 | Ga0207651_10758327 | 3300025960 | Bacteria | 858 |
| 511 | Ga0207651_11344336 | 3300025960 | Bacteria | 643 |
| 512 | Ga0207712_10024976 | 3300025961 | Bacteria | 3965 |
| 513 | Ga0207668_10001265 | 3300025972 | Bacteria | 15064 |
| 514 | Ga0207668_10177563 | 3300025972 | Unclassified | 1677 |
| 515 | Ga0207668_10457355 | 3300025972 | Bacteria | 1091 |
| 516 | Ga0207668_10566690 | 3300025972 | Bacteria | 986 |
| 517 | Ga0207640_10028863 | 3300025981 | Bacteria | 3398 |
| 518 | Ga0207640_10029852 | 3300025981 | Bacteria | 3352 |
| 519 | Ga0207640_10086364 | 3300025981 | Bacteria | 2160 |
| 520 | Ga0207640_10849834 | 3300025981 | Bacteria | 794 |
| 521 | Ga0207640_11077226 | 3300025981 | Bacteria | 710 |
| 522 | Ga0207658_10001317 | 3300025986 | Bacteria | 19462 |
| 523 | Ga0207658_10001833 | 3300025986 | Bacteria | 15912 |
| 524 | Ga0207658_10101284 | 3300025986 | Bacteria | 2257 |
| 525 | Ga0207658_10233773 | 3300025986 | Bacteria | 1553 |
| 526 | Ga0207658_10971784 | 3300025986 | Bacteria | 774 |
| 527 | Ga0207677_10039410 | 3300026023 | Bacteria | 3106 |
| 528 | Ga0207677_10042848 | 3300026023 | Bacteria | 3005 |
| 529 | Ga0207677_10069882 | 3300026023 | Bacteria | 2472 |
| 530 | Ga0207677_10072814 | 3300026023 | Bacteria | 2431 |
| 531 | Ga0207677_10113911 | 3300026023 | Bacteria | 2020 |
| 532 | Ga0207677_10316112 | 3300026023 | Bacteria | 1296 |
| 533 | Ga0207677_10502920 | 3300026023 | Bacteria | 1048 |
| 534 | Ga0207677_11191401 | 3300026023 | Bacteria | 697 |
| 535 | Ga0207703_10010751 | 3300026035 | Bacteria | 7144 |
| 536 | Ga0207703_10772824 | 3300026035 | Bacteria | 916 |
| 537 | Ga0207639_10417404 | 3300026041 | Bacteria | 1212 |
| 538 | Ga0207639_10451271 | 3300026041 | Bacteria | 1167 |
| 539 | Ga0207639_10611751 | 3300026041 | Bacteria | 1005 |
| 540 | Ga0207678_10041283 | 3300026067 | Bacteria | 4000 |
| 541 | Ga0207678_10139706 | 3300026067 | Bacteria | 2067 |
| 542 | Ga0207678_10164477 | 3300026067 | Bacteria | 1895 |
| 543 | Ga0207678_10169289 | 3300026067 | Bacteria | 1865 |
| 544 | Ga0207678_10189384 | 3300026067 | Bacteria | 1758 |
| 545 | Ga0207678_11067837 | 3300026067 | Bacteria | 715 |
| 546 | Ga0207708_10004053 | 3300026075 | Bacteria | 10768 |
| 547 | Ga0207708_10254625 | 3300026075 | Bacteria | 1416 |
| 548 | Ga0207708_11277283 | 3300026075 | Bacteria | 643 |
| 549 | Ga0207702_10260894 | 3300026078 | Bacteria | 1631 |
| 550 | Ga0207641_10004293 | 3300026088 | Bacteria | 12387 |
| 551 | Ga0207641_10009403 | 3300026088 | Bacteria | 8054 |
| 552 | Ga0207641_10044969 | 3300026088 | Bacteria | 3715 |
| 553 | Ga0207641_10180189 | 3300026088 | Bacteria | 1935 |
| 554 | Ga0207641_10556671 | 3300026088 | Bacteria | 1119 |
| 555 | Ga0207648_10002159 | 3300026089 | Bacteria | 21380 |
| 556 | Ga0207648_10023940 | 3300026089 | Bacteria | 5459 |
| 557 | Ga0207648_10035287 | 3300026089 | Bacteria | 4406 |
| 558 | Ga0207648_10048342 | 3300026089 | Bacteria | 3724 |
| 559 | Ga0207648_10156235 | 3300026089 | Bacteria | 2014 |
| 560 | Ga0207648_10328313 | 3300026089 | Bacteria | 1376 |
| 561 | Ga0207648_10389766 | 3300026089 | Bacteria | 1261 |
| 562 | Ga0207648_10429984 | 3300026089 | Bacteria | 1200 |
| 563 | Ga0207676_10017462 | 3300026095 | Bacteria | 5200 |
| 564 | Ga0207676_10032829 | 3300026095 | Bacteria | 3916 |
| 565 | Ga0207676_10073828 | 3300026095 | Bacteria | 2746 |
| 566 | Ga0207676_10429247 | 3300026095 | Bacteria | 1241 |
| 567 | Ga0207676_10786405 | 3300026095 | Bacteria | 927 |
| 568 | Ga0207674_10029584 | 3300026116 | Bacteria | 5766 |
| 569 | Ga0207674_11771012 | 3300026116 | Bacteria | 585 |
| 570 | Ga0207675_100003876 | 3300026118 | Bacteria | 14539 |
| 571 | Ga0207675_100290182 | 3300026118 | Bacteria | 1591 |
| 572 | Ga0207683_10045327 | 3300026121 | Bacteria | 3845 |
| 573 | Ga0207683_10075715 | 3300026121 | Bacteria | 2979 |
| 574 | Ga0207683_10076066 | 3300026121 | Bacteria | 2973 |
| 575 | Ga0207683_10153509 | 3300026121 | Bacteria | 2079 |
| 576 | Ga0207683_10164948 | 3300026121 | Bacteria | 2004 |
| 577 | Ga0207683_10274998 | 3300026121 | Bacteria | 1539 |
| 578 | Ga0207698_10095185 | 3300026142 | Bacteria | 2451 |
| 579 | Ga0207698_10154618 | 3300026142 | Bacteria | 1996 |
| 580 | Ga0207698_10160940 | 3300026142 | Bacteria | 1963 |
| 581 | Ga0207698_10197965 | 3300026142 | Bacteria | 1796 |
| 582 | Ga0207698_10240499 | 3300026142 | Bacteria | 1650 |
| 583 | Ga0209281_1000307 | 3300027111 | Bacteria | 87401 |
| 584 | Ga0209813_10001234 | 3300027866 | Bacteria | 5705 |
| 585 | Ga0209813_10089852 | 3300027866 | Bacteria | 1029 |
| 586 | Ga0207428_10018366 | 3300027907 | Bacteria | 5975 |
| 587 | Ga0268266_10187818 | 3300028379 | Bacteria | 1885 |
| 588 | Ga0268266_10197401 | 3300028379 | Bacteria | 1840 |
| 589 | Ga0268266_10617744 | 3300028379 | Bacteria | 1042 |
| 590 | Ga0268265_10006093 | 3300028380 | Bacteria | 8188 |
| 591 | Ga0268265_11781884 | 3300028380 | Bacteria | 622 |
| 592 | Ga0268264_10001228 | 3300028381 | Bacteria | 24612 |
| 593 | Ga0268264_10426928 | 3300028381 | Bacteria | 1279 |
| 594 | Ga0307517_10001591 | 3300028786 | Bacteria | 37812 |
| 595 | Ga0307517_10088858 | 3300028786 | Bacteria | 2550 |
| 596 | Ga0307517_10138346 | 3300028786 | Bacteria | 1721 |
| 597 | Ga0307515_10058252 | 3300028794 | Bacteria | 5567 |
| 598 | Ga0307515_10092799 | 3300028794 | Bacteria | 3752 |
| 599 | Ga0307515_10311869 | 3300028794 | Bacteria | 1247 |
| 600 | Ga0307515_10543742 | 3300028794 | Bacteria | 771 |
| 601 | Ga0265338_10136903 | 3300028800 | Bacteria | 1924 |
| 602 | Ga0307511_10000025 | 3300030521 | Bacteria | 112344 |
| 603 | Ga0307512_10022579 | 3300030522 | Bacteria | 5647 |
| 604 | Ga0307512_10135032 | 3300030522 | Bacteria | 1531 |
| 605 | Ga0307512_10137616 | 3300030522 | Bacteria | 1506 |
| 606 | Ga0265316_10286091 | 3300031344 | Bacteria | 1204 |
| 607 | Ga0307513_10016408 | 3300031456 | Bacteria | 8931 |
| 608 | Ga0307513_10512147 | 3300031456 | Bacteria | 916 |
| 609 | Ga0307509_10002193 | 3300031507 | Bacteria | 32050 |
| 610 | Ga0307509_10004459 | 3300031507 | Bacteria | 20160 |
| 611 | Ga0307509_10050222 | 3300031507 | Bacteria | 4467 |
| 612 | Ga0307509_10117181 | 3300031507 | Bacteria | 2651 |
| 613 | Ga0307509_10137647 | 3300031507 | Bacteria | 2384 |
| 614 | Ga0307509_10159898 | 3300031507 | Bacteria | 2152 |
| 615 | Ga0307509_10271111 | 3300031507 | Bacteria | 1465 |
| 616 | Ga0307509_10276381 | 3300031507 | Bacteria | 1444 |
| 617 | Ga0307509_10417158 | 3300031507 | Bacteria | 1044 |
| 618 | Ga0307408_100075405 | 3300031548 | Bacteria | 2506 |
| 619 | Ga0307508_10002730 | 3300031616 | Bacteria | 18451 |
| 620 | Ga0307508_10036341 | 3300031616 | Bacteria | 4435 |
| 621 | Ga0307508_10129465 | 3300031616 | Bacteria | 2127 |
| 622 | Ga0307508_10468456 | 3300031616 | Bacteria | 853 |
| 623 | Ga0307514_10158267 | 3300031649 | Bacteria | 1505 |
| 624 | Ga0307514_10288771 | 3300031649 | Bacteria | 930 |
| 625 | Ga0307516_10047244 | 3300031730 | Bacteria | 4243 |
| 626 | Ga0307516_10112068 | 3300031730 | Bacteria | 2529 |
| 627 | Ga0307516_10382196 | 3300031730 | Bacteria | 1069 |
| 628 | Ga0307516_10539309 | 3300031730 | Bacteria | 820 |
| 629 | Ga0307516_10981260 | 3300031730 | Bacteria | 516 |
| 630 | Ga0307405_10012488 | 3300031731 | Bacteria | 4499 |
| 631 | Ga0307405_10656239 | 3300031731 | Bacteria | 863 |
| 632 | Ga0307405_11600751 | 3300031731 | Bacteria | 575 |
| 633 | Ga0307405_12071108 | 3300031731 | Bacteria | 510 |
| 634 | Ga0307413_10267905 | 3300031824 | Bacteria | 1277 |
| 635 | Ga0307410_10116241 | 3300031852 | Bacteria | 1943 |
| 636 | Ga0307410_10203428 | 3300031852 | Bacteria | 1513 |
| 637 | Ga0307410_10953155 | 3300031852 | Bacteria | 738 |
| 638 | Ga0307406_10010094 | 3300031901 | Bacteria | 5318 |
| 639 | Ga0307406_10029558 | 3300031901 | Bacteria | 3320 |
| 640 | Ga0307406_10704297 | 3300031901 | Bacteria | 843 |
| 641 | Ga0307406_11041100 | 3300031901 | Bacteria | 704 |
| 642 | Ga0307407_10145162 | 3300031903 | Bacteria | 1535 |
| 643 | Ga0307407_10219073 | 3300031903 | Bacteria | 1286 |
| 644 | Ga0307409_100003397 | 3300031995 | Bacteria | 8643 |
| 645 | Ga0307409_100036260 | 3300031995 | Bacteria | 3623 |
| 646 | Ga0307409_101023067 | 3300031995 | Bacteria | 845 |
| 647 | Ga0307416_100019017 | 3300032002 | Bacteria | 4859 |
| 648 | Ga0307416_100082465 | 3300032002 | Bacteria | 2724 |
| 649 | Ga0307416_101101464 | 3300032002 | Bacteria | 899 |
| 650 | Ga0307414_10028282 | 3300032004 | Bacteria | 3634 |
| 651 | Ga0307411_10009952 | 3300032005 | Bacteria | 5037 |
| 652 | Ga0307411_10070966 | 3300032005 | Bacteria | 2359 |
| 653 | Ga0307411_10075739 | 3300032005 | Bacteria | 2298 |
| 654 | Ga0307415_100152118 | 3300032126 | Bacteria | 1782 |
| 655 | Ga0307415_100332020 | 3300032126 | Bacteria | 1273 |
| 656 | Ga0307415_100407844 | 3300032126 | Bacteria | 1162 |
| 657 | Ga0307507_10273752 | 3300033179 | Bacteria | 1063 |
| 658 | Ga0307510_10000290 | 3300033180 | Bacteria | 46315 |
| 659 | Ga0307510_10106360 | 3300033180 | Bacteria | 2569 |
| 660 | Ga0307510_10170824 | 3300033180 | Bacteria | 1753 |
| 661 | Ga0373926_0003365 | 3300035083 | Bacteria | 5148 |
| 662 | Ga0373934_0072616 | 3300035086 | Bacteria | 1377 |
| 663 | Ga0373944_0049245 | 3300035089 | Bacteria | 1324 |
| 664 | Ga0373944_0201187 | 3300035089 | Bacteria | 721 |
| 665 | Ga0373923_0008893 | 3300035111 | Bacteria | 3603 |
| 666 | Ga0373939_0140269 | 3300035114 | Bacteria | 871 |
| 667 | Ga0373953_0000591 | 3300035117 | Bacteria | 10025 |
| 668 | Ga0373953_0050953 | 3300035117 | Bacteria | 1673 |
| 669 | Ga0373953_0578843 | 3300035117 | Bacteria | 500 |
| 670 | Ga0373954_0006821 | 3300035118 | Bacteria | 4981 |
| 671 | Ga0373956_0006342 | 3300035119 | Bacteria | 4735 |
| 672 | Ga0373956_0229057 | 3300035119 | Bacteria | 882 |
| 673 | Ga0373957_0015885 | 3300035120 | Bacteria | 2598 |
| 674 | Ga0373955_0015611 | 3300035172 | Bacteria | 3722 |
| 675 | Ga0373955_0039413 | 3300035172 | Bacteria | 2522 |
| 676 | Ga0373924_0021284 | 3300035410 | Bacteria | 2528 |
| 677 | Ga0373931_0054081 | 3300035691 | Bacteria | 2145 |
| 678 | Ga0373935_0030940 | 3300035692 | Bacteria | 3318 |
| 679 | Ga0373935_0110270 | 3300035692 | Bacteria | 1826 |
| 680 | Ga0373935_0613644 | 3300035692 | Bacteria | 796 |
| 681 | Ga0373927_0416894 | 3300035695 | Bacteria | 886 |
| 682 | Ga0373933_0022323 | 3300035724 | Bacteria | 3602 |
| 683 | Ga0373933_0227461 | 3300035724 | Bacteria | 1198 |
| 684 | Ga0373947_0741903 | 3300035725 | Bacteria | 670 |
| 685 | Ga0373937_0054971 | 3300036401 | Bacteria | 3654 |
| 686 | Ga0373937_0074503 | 3300036401 | Bacteria | 3132 |
| 687 | Ga0373925_0350985 | 3300037068 | Bacteria | 1198 |
| 688 | Ga0373925_0476659 | 3300037068 | Bacteria | 1023 |
| 689 | Ga0373925_0827938 | 3300037068 | Bacteria | 763 |
| 690 | Ga0395899_0272876 | 3300037312 | Bacteria | 1153 |
| 691 | Ga0395900_0009709 | 3300037418 | Bacteria | 9860 |
| 692 | Ga0395900_1784244 | 3300037418 | Bacteria | 526 |
| 693 | Ga0395898_0018925 | 3300037466 | Bacteria | 7016 |
| 694 | Ga0395898_0088174 | 3300037466 | Bacteria | 2987 |
| 695 | Ga0395905_0038456 | 3300037471 | Bacteria | 4490 |
| 696 | Ga0395905_0048196 | 3300037471 | Bacteria | 3994 |
| 697 | Ga0395905_1468561 | 3300037471 | Bacteria | 586 |
| 698 | Ga0395901_0243359 | 3300038443 | Bacteria | 1876 |
| 699 | Ga0451789_0060154 | 3300041443 | Bacteria | 1432 |
| 700 | Ga0451789_0231164 | 3300041443 | Bacteria | 648 |
| 701 | Ga0451789_1057507 | 3300041443 | Bacteria | 1119 |
| 702 | Ga0451800_1025911 | 3300041459 | Bacteria | 860 |
| 703 | Ga0451802_1266583 | 3300041460 | Bacteria | 864 |
| 704 | Ga0451833_0913082 | 3300041491 | Bacteria | 783 |
| 705 | Ga0451835_0713309 | 3300041492 | Bacteria | 860 |
| 706 | Ga0451845_0412393 | 3300041501 | Bacteria | 727 |
| 707 | Ga0451849_0639518 | 3300041505 | Bacteria | 677 |
| 708 | Ga0451851_0957251 | 3300041507 | Bacteria | 811 |
| 709 | Ga0451843_0227149 | 3300041509 | Bacteria | 874 |
| 710 | Ga0451843_0336977 | 3300041509 | Bacteria | 1282 |
| 711 | Ga0451853_1441017 | 3300041512 | Bacteria | 1832 |
| 712 | Ga0451853_1589172 | 3300041512 | Bacteria | 622 |
| 713 | Ga0451853_3936543 | 3300041512 | Bacteria | 763 |
| 714 | Ga0439445_0100753 | 3300042004 | Bacteria | 819 |
| 715 | Ga0439449_0130857 | 3300042007 | Bacteria | 933 |
| 716 | Ga0439464_0018357 | 3300042439 | Bacteria | 1902 |
| 717 | Ga0439460_0020142 | 3300042461 | Bacteria | 1812 |
| 718 | Ga0466972_0184829 | 3300044658 | Bacteria | 977 |
| 719 | Ga0453684_0006446 | 3300044712 | Bacteria | 22283 |
| 720 | Ga0466960_0304251 | 3300044901 | Bacteria | 899 |
| 721 | Ga0495592_0000758 | 3300046454 | Bacteria | 22458 |
| 722 | Ga0495592_0000815 | 3300046454 | Bacteria | 21606 |
| 723 | Ga0495592_0003273 | 3300046454 | Bacteria | 11610 |
| 724 | Ga0495629_0001921 | 3300046459 | Bacteria | 16199 |
| 725 | Ga0495629_0032728 | 3300046459 | Bacteria | 3680 |
| 726 | Ga0495629_0070696 | 3300046459 | Bacteria | 2435 |
| 727 | Ga0495629_0215131 | 3300046459 | Bacteria | 1327 |
| 728 | Ga0495638_0148189 | 3300046460 | Bacteria | 1363 |
| 729 | Ga0495641_0147210 | 3300046461 | Bacteria | 1052 |
| 730 | Ga0495641_0214107 | 3300046461 | Bacteria | 864 |
| 731 | Ga0495651_0016519 | 3300046462 | Bacteria | 5717 |
| 732 | Ga0495651_0091103 | 3300046462 | Bacteria | 2286 |
| 733 | Ga0495651_0771196 | 3300046462 | Bacteria | 595 |
| 734 | Ga0495653_0000973 | 3300046463 | Bacteria | 21997 |
| 735 | Ga0495650_0093757 | 3300046471 | Bacteria | 1138 |
| 736 | Ga0495650_0140279 | 3300046471 | Bacteria | 875 |
| 737 | Ga0495580_0346800 | 3300046472 | Bacteria | 1006 |
| 738 | Ga0495639_0403009 | 3300046475 | Bacteria | 691 |
| 739 | Ga0495584_0287920 | 3300046491 | Bacteria | 835 |
| 740 | Ga0495584_0339190 | 3300046491 | Bacteria | 763 |
| 741 | Ga0495606_0114523 | 3300046507 | Bacteria | 1622 |
| 742 | Ga0495606_0194859 | 3300046507 | Bacteria | 1159 |
| 743 | Ga0495606_0404241 | 3300046507 | Bacteria | 710 |
| 744 | Ga0495608_0031249 | 3300046511 | Bacteria | 3601 |
| 745 | Ga0495608_0415652 | 3300046511 | Bacteria | 821 |
| 746 | Ga0495610_0015791 | 3300046512 | Bacteria | 4373 |
| 747 | Ga0495616_0287770 | 3300046513 | Bacteria | 697 |
| 748 | Ga0495618_0034797 | 3300046514 | Bacteria | 3161 |
| 749 | Ga0495620_0051533 | 3300046515 | Bacteria | 1751 |
| 750 | Ga0495620_0069357 | 3300046515 | Bacteria | 1446 |
| 751 | Ga0495628_0000483 | 3300046516 | Bacteria | 36474 |
| 752 | Ga0495628_0017699 | 3300046516 | Bacteria | 5924 |
| 753 | Ga0495628_0253578 | 3300046516 | Bacteria | 1313 |
| 754 | Ga0495631_0187702 | 3300046518 | Bacteria | 885 |
| 755 | Ga0495632_0012805 | 3300046519 | Bacteria | 4815 |
| 756 | Ga0495632_0113327 | 3300046519 | Bacteria | 1272 |
| 757 | Ga0495643_0086659 | 3300046522 | Bacteria | 1622 |
| 758 | Ga0495643_0262358 | 3300046522 | Bacteria | 802 |
| 759 | Ga0495666_0070603 | 3300046526 | Bacteria | 1661 |
| 760 | Ga0495652_0002769 | 3300046529 | Bacteria | 17726 |
| 761 | Ga0495652_0049870 | 3300046529 | Bacteria | 3581 |
| 762 | Ga0495640_0001223 | 3300046533 | Bacteria | 20101 |
| 763 | Ga0495587_0010373 | 3300046536 | Bacteria | 5933 |
| 764 | Ga0495598_0038578 | 3300046537 | Bacteria | 1384 |
| 765 | Ga0495597_0029318 | 3300046542 | Bacteria | 2513 |
| 766 | Ga0495645_0000423 | 3300046543 | Bacteria | 29063 |
| 767 | Ga0495645_0011453 | 3300046543 | Bacteria | 6241 |
| 768 | Ga0495645_0018798 | 3300046543 | Bacteria | 4971 |
| 769 | Ga0495645_0034733 | 3300046543 | Bacteria | 3676 |
| 770 | Ga0495622_0082507 | 3300046557 | Bacteria | 1479 |
| 771 | Ga0495622_0274280 | 3300046557 | Bacteria | 738 |
| 772 | Ga0495667_0021548 | 3300046559 | Bacteria | 4348 |
| 773 | Ga0495668_0086724 | 3300046616 | Bacteria | 1717 |
| 774 | Ga0495668_0151358 | 3300046616 | Bacteria | 1271 |
| 775 | Ga0495634_0006090 | 3300046642 | Bacteria | 9195 |
| 776 | Ga0495611_0091661 | 3300046648 | Bacteria | 1405 |
| 777 | Ga0495611_0454406 | 3300046648 | Bacteria | 584 |
| 778 | Ga0495625_0012637 | 3300046660 | Bacteria | 6834 |
| 779 | Ga0495625_0366343 | 3300046660 | Bacteria | 907 |
| 780 | Ga0495625_0730573 | 3300046660 | Bacteria | 582 |
| 781 | Ga0495635_0001062 | 3300046663 | Bacteria | 18194 |
| 782 | Ga0495635_0406090 | 3300046663 | Bacteria | 904 |
| 783 | Ga0495657_0069620 | 3300046675 | Bacteria | 2301 |
| 784 | Ga0495599_0000508 | 3300046678 | Bacteria | 22226 |
| 785 | Ga0495599_0015764 | 3300046678 | Bacteria | 4691 |
| 786 | Ga0495599_0665069 | 3300046678 | Bacteria | 603 |
| 787 | Ga0495646_0001205 | 3300046680 | Bacteria | 15141 |
| 788 | Ga0495646_0135299 | 3300046680 | Bacteria | 1383 |
| 789 | Ga0495646_0145124 | 3300046680 | Bacteria | 1324 |
| 790 | Ga0495647_0216257 | 3300046681 | Bacteria | 845 |
| 791 | Ga0495647_0489872 | 3300046681 | Bacteria | 572 |
| 792 | Ga0495658_0041005 | 3300046683 | Bacteria | 2576 |
| 793 | Ga0495658_0125129 | 3300046683 | Bacteria | 1559 |
| 794 | Ga0495658_0361455 | 3300046683 | Bacteria | 923 |
| 795 | Ga0495613_0122566 | 3300046689 | Bacteria | 1866 |
| 796 | Ga0495613_0213878 | 3300046689 | Bacteria | 1355 |
| 797 | Ga0495624_0013479 | 3300046690 | Bacteria | 5573 |
| 798 | Ga0495671_0067505 | 3300046692 | Bacteria | 1759 |
| 799 | Ga0495671_0427783 | 3300046692 | Bacteria | 633 |
| 800 | Ga0495649_0003846 | 3300046694 | Bacteria | 9942 |
| 801 | Ga0495649_0659494 | 3300046694 | Bacteria | 514 |
| 802 | Ga0495600_0129650 | 3300046809 | Bacteria | 1640 |
| 803 | Ga0495600_0162451 | 3300046809 | Bacteria | 1443 |
| 804 | Ga0495660_0016913 | 3300046810 | Bacteria | 4201 |
| 805 | Ga0495581_0485219 | 3300047315 | Bacteria | 719 |
| 806 | Ga0495674_0018073 | 3300047319 | Bacteria | 6564 |
| 807 | Ga0495674_0485452 | 3300047319 | Bacteria | 990 |
| 808 | Ga0495676_0059742 | 3300047321 | Bacteria | 2992 |
| 809 | Ga0495680_0075594 | 3300047322 | Bacteria | 2555 |
| 810 | Ga0495683_0278981 | 3300047323 | Bacteria | 724 |
| 811 | Ga0495687_002581 | 3300047443 | Bacteria | 14284 |
| 812 | Ga0495687_002812 | 3300047443 | Bacteria | 13428 |
| 813 | Ga0495687_003084 | 3300047443 | Bacteria | 12483 |
| 814 | Ga0495675_0409438 | 3300047444 | Bacteria | 789 |
| 815 | Ga0495675_0657236 | 3300047444 | Bacteria | 590 |
| 816 | Ga0495677_0174788 | 3300047445 | Bacteria | 832 |
| 817 | Ga0495677_0200358 | 3300047445 | Bacteria | 776 |
| 818 | Ga0495673_0054349 | 3300047469 | Bacteria | 1742 |
| 819 | Ga0495673_0100002 | 3300047469 | Bacteria | 1174 |
| 820 | Ga0495681_0137244 | 3300047470 | Bacteria | 1036 |
| 821 | Ga0495684_0005299 | 3300047471 | Bacteria | 10042 |
| 822 | Ga0495684_0181812 | 3300047471 | Bacteria | 1558 |
| 823 | Ga0495686_0002064 | 3300047472 | Bacteria | 19764 |
| 824 | Ga0495686_0082946 | 3300047472 | Bacteria | 1956 |
| 825 | Ga0495593_0006629 | 3300047673 | Bacteria | 6775 |
| 826 | Ga0495593_0024096 | 3300047673 | Bacteria | 3376 |
| 827 | Ga0495614_0222708 | 3300048089 | Bacteria | 858 |
| 828 | Ga0495626_0077277 | 3300048091 | Bacteria | 1484 |
| 829 | Ga0496106_0112626 | 3300048909 | Bacteria | 2120 |
| 830 | Ga0496108_0050302 | 3300048911 | Bacteria | 3488 |
| 831 | Ga0496108_0607566 | 3300048911 | Bacteria | 953 |
| 832 | Ga0496109_0084287 | 3300048912 | Bacteria | 2932 |
| 833 | Ga0496110_0298147 | 3300048913 | Bacteria | 1468 |
| 834 | Ga0496111_0539514 | 3300048914 | Bacteria | 857 |
| 835 | Ga0496113_0130349 | 3300048916 | Bacteria | 1973 |
| 836 | Ga0496113_0361350 | 3300048916 | Bacteria | 1165 |
| 837 | Ga0496114_0000832 | 3300048917 | Bacteria | 23157 |
| 838 | Ga0496114_0040638 | 3300048917 | Bacteria | 3851 |
| 839 | Ga0496115_0108657 | 3300048918 | Bacteria | 2277 |
| 840 | Ga0496117_0047473 | 3300048920 | Bacteria | 3078 |
| 841 | Ga0496121_0021499 | 3300048924 | Bacteria | 6316 |
| 842 | Ga0496124_0126090 | 3300048927 | Bacteria | 2039 |
| 843 | Ga0496124_0273030 | 3300048927 | Bacteria | 1237 |
| 844 | Ga0496125_0542280 | 3300048928 | Bacteria | 646 |
| 845 | Ga0496126_0040934 | 3300048929 | Bacteria | 4293 |
| 846 | Ga0495682_0072566 | 3300049460 | Bacteria | 1239 |
| 847 | Ga0495682_0131467 | 3300049460 | Bacteria | 895 |
| 848 | Ga0501047_0398470 | 3300049581 | Bacteria | 1209 |
| 849 | Ga0501067_0538504 | 3300049583 | Bacteria | 654 |
| 850 | Ga0501249_109039 | 3300049679 | Bacteria | 668 |
| 851 | Ga0501259_175117 | 3300049688 | Bacteria | 541 |
| 852 | nmdc:mga03683_20325_c1 | 3300050489 | Bacteria | 2547 |
| 853 | nmdc:mga03683_300970_c1 | 3300050489 | Bacteria | 752 |
| 854 | nmdc:mga03683_511647_c1 | 3300050489 | Bacteria | 582 |
| 855 | nmdc:mga03683_6668_c1 | 3300050489 | Bacteria | 3966 |
| 856 | nmdc:mga03n38_4787_c1 | 3300050490 | Bacteria | 4529 |
| 857 | nmdc:mga03n38_58059_c1 | 3300050490 | Bacteria | 1752 |
| 858 | nmdc:mga00v17_4622_c1 | 3300050491 | Bacteria | 7179 |
| 859 | nmdc:mga00v17_55469_c1 | 3300050491 | Bacteria | 2420 |
| 860 | nmdc:mga0yw44_11763_c1 | 3300050492 | Bacteria | 4535 |
| 861 | nmdc:mga0yw44_29766_c1 | 3300050492 | Bacteria | 3156 |
| 862 | nmdc:mga0yw44_44241_c1 | 3300050492 | Bacteria | 2662 |
| 863 | nmdc:mga0k408_20661_c1 | 3300050493 | Bacteria | 3692 |
| 864 | nmdc:mga0k408_2209_c1 | 3300050493 | Bacteria | 10430 |
| 865 | nmdc:mga0k408_257960_c1 | 3300050493 | Bacteria | 1041 |
| 866 | nmdc:mga0k408_37370_c1 | 3300050493 | Bacteria | 2788 |
| 867 | nmdc:mga0k408_447946_c1 | 3300050493 | Bacteria | 767 |
| 868 | nmdc:mga0k408_496228_c1 | 3300050493 | Bacteria | 724 |
| 869 | nmdc:mga0k408_67699_c1 | 3300050493 | Bacteria | 2081 |
| 870 | nmdc:mga0k408_83737_c1 | 3300050493 | Bacteria | 1870 |
| 871 | nmdc:mga0k408_87493_c1 | 3300050493 | Bacteria | 1830 |
| 872 | nmdc:mga0k408_985_c1 | 3300050493 | Bacteria | 15642 |
| 873 | nmdc:mga06z11_175711_c1 | 3300050494 | Bacteria | 1232 |
| 874 | nmdc:mga06z11_17881_c1 | 3300050494 | Bacteria | 3228 |
| 875 | nmdc:mga06z11_284694_c1 | 3300050494 | Bacteria | 980 |
| 876 | nmdc:mga06z11_57994_c1 | 3300050494 | Bacteria | 2007 |
| 877 | nmdc:mga06z11_6814_c1 | 3300050494 | Bacteria | 4670 |
| 878 | nmdc:mga04h51_30995_c1 | 3300050495 | Bacteria | 1687 |
| 879 | nmdc:mga04h51_6047_c1 | 3300050495 | Bacteria | 3117 |
| 880 | nmdc:mga07m45_106891_c1 | 3300050496 | Bacteria | 1610 |
| 881 | nmdc:mga07m45_107520_c1 | 3300050496 | Bacteria | 1605 |
| 882 | nmdc:mga07m45_11967_c1 | 3300050496 | Bacteria | 4572 |
| 883 | nmdc:mga07m45_17318_c1 | 3300050496 | Bacteria | 3868 |
| 884 | nmdc:mga07m45_1848_c1 | 3300050496 | Bacteria | 9781 |
| 885 | nmdc:mga07m45_50505_c1 | 3300050496 | Bacteria | 2344 |
| 886 | nmdc:mga07m45_59404_c1 | 3300050496 | Bacteria | 2164 |
| 887 | nmdc:mga05p37_2001070_c1 | 3300050507 | Bacteria | 548 |
| 888 | nmdc:mga05p37_3939_c1 | 3300050507 | Bacteria | 17392 |
| 889 | nmdc:mga05p37_534475_c1 | 3300050507 | Bacteria | 1338 |
| 890 | nmdc:mga09592_28393_c1 | 3300050508 | Bacteria | 4648 |
| 891 | nmdc:mga09592_496959_c1 | 3300050508 | Bacteria | 1050 |
| 892 | nmdc:mga09592_725890_c1 | 3300050508 | Bacteria | 844 |
| 893 | nmdc:mga0qj67_104673_c1 | 3300050509 | Bacteria | 890 |
| 894 | nmdc:mga0qj67_144969_c1 | 3300050509 | Bacteria | 1925 |
| 895 | nmdc:mga06r32_4044_c1 | 3300050510 | Bacteria | 13148 |
| 896 | nmdc:mga06r32_71366_c1 | 3300050510 | Bacteria | 3360 |
| 897 | nmdc:mga06r32_76546_c1 | 3300050510 | Bacteria | 3249 |
| 898 | nmdc:mga08y16_22844_c1 | 3300050511 | Bacteria | 6601 |
| 899 | nmdc:mga08y16_274643_c1 | 3300050511 | Bacteria | 1739 |
| 900 | nmdc:mga08y16_386921_c1 | 3300050511 | Bacteria | 1433 |
| 901 | nmdc:mga0sz30_116965_c1 | 3300050516 | Bacteria | 1170 |
| 902 | nmdc:mga0sz30_210323_c1 | 3300050516 | Bacteria | 864 |
| 903 | nmdc:mga0sz30_53753_c1 | 3300050516 | Bacteria | 1712 |
| 904 | Ga0495601_0031890 | 3300053077 | Bacteria | 3277 |
| 905 | Ga0495601_0122040 | 3300053077 | Bacteria | 1693 |
| 906 | Ga0495601_0195595 | 3300053077 | Bacteria | 1322 |
| 907 | Ga0495612_0008508 | 3300053078 | Bacteria | 4161 |
| 908 | Ga0495595_0008389 | 3300053084 | Bacteria | 4241 |
| 909 | Ga0495595_0086143 | 3300053084 | Bacteria | 1503 |
| 910 | Ga0495619_0011988 | 3300053085 | Bacteria | 5461 |
| 911 | Ga0495619_0290279 | 3300053085 | Bacteria | 1133 |
| 912 | Ga0500644_0036236 | 3300053088 | Bacteria | 1604 |
| 913 | Ga0500646_0150626 | 3300053090 | Bacteria | 770 |
| 914 | Ga0500583_0071453 | 3300053092 | Bacteria | 1660 |
| 915 | Ga0500583_0200296 | 3300053092 | Bacteria | 992 |
| 916 | Ga0500641_0006688 | 3300053096 | Bacteria | 4097 |
| 917 | Ga0500650_0164861 | 3300053098 | Bacteria | 1021 |
| 918 | Ga0500556_0000486 | 3300053104 | Bacteria | 27714 |
| 919 | Ga0500594_0040029 | 3300053118 | Bacteria | 1277 |
| 920 | Ga0500595_001646 | 3300053119 | Bacteria | 11737 |
| 921 | Ga0500595_195075 | 3300053119 | Bacteria | 560 |
| 922 | Ga0500607_139792 | 3300053121 | Bacteria | 1141 |
| 923 | Ga0500618_115570 | 3300053125 | Bacteria | 607 |
| 924 | Ga0500655_021221 | 3300053133 | Bacteria | 1217 |
| 925 | Ga0500559_0000126 | 3300053136 | Bacteria | 59577 |
| 926 | Ga0500559_0563093 | 3300053136 | Bacteria | 519 |
| 927 | Ga0500589_229657 | 3300053147 | Bacteria | 693 |
| 928 | Ga0500619_108190 | 3300053154 | Bacteria | 945 |
| 929 | Ga0500622_0005314 | 3300053156 | Bacteria | 7764 |
| 930 | Ga0500627_0392127 | 3300053158 | Bacteria | 593 |
| 931 | Ga0500645_008546 | 3300053730 | Bacteria | 3490 |
| 932 | Ga0500587_000588 | 3300053739 | Bacteria | 4525 |
| 933 | Ga0500587_009217 | 3300053739 | Bacteria | 1263 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019597564 | 8019601492 | 123 |
| 2 | 3300046471 | Ga0495650_0093757 | Ga0495650_0093757_60_440 | 126 |
| 3 | 3300046557 | Ga0495622_0082507 | Ga0495622_0082507_191_571 | 126 |
| 4 | 3300025972 | Ga0207668_10566690 | Ga0207668_105666902 | 128 |
| 5 | 3300035118 | Ga0373954_0006821 | Ga0373954_0006821_1515_1907 | 130 |
| 6 | 3300035172 | Ga0373955_0015611 | Ga0373955_0015611_2935_3327 | 130 |
| 7 | 3300036401 | Ga0373937_0074503 | Ga0373937_0074503_2634_3026 | 130 |
| 8 | 3300046463 | Ga0495653_0000973 | Ga0495653_0000973_15317_15709 | 130 |
| 9 | 3300046529 | Ga0495652_0049870 | Ga0495652_0049870_2830_3222 | 130 |
| 10 | 3300046543 | Ga0495645_0034733 | Ga0495645_0034733_2982_3374 | 130 |
| 11 | 3300046663 | Ga0495635_0001062 | Ga0495635_0001062_1549_1941 | 130 |
| 12 | 3300046680 | Ga0495646_0001205 | Ga0495646_0001205_11675_12067 | 130 |
| 13 | 3300046689 | Ga0495613_0122566 | Ga0495613_0122566_716_1108 | 130 |
| 14 | 3300046809 | Ga0495600_0162451 | Ga0495600_0162451_488_880 | 130 |
| 15 | 3300047319 | Ga0495674_0018073 | Ga0495674_0018073_3966_4358 | 130 |
| 16 | 3300047444 | Ga0495675_0409438 | Ga0495675_0409438_360_752 | 130 |
| 17 | 3300053084 | Ga0495595_0008389 | Ga0495595_0008389_2292_2684 | 130 |
| 18 | 3300017792 | Ga0163161_10596864 | Ga0163161_105968641 | 136 |
| 19 | 3300005335 | Ga0070666_10783492 | Ga0070666_107834922 | 137 |
| 20 | 3300005841 | Ga0068863_101516845 | Ga0068863_1015168452 | 137 |
| 21 | 3300006358 | Ga0068871_100240650 | Ga0068871_1002406503 | 137 |
| 22 | 3300009177 | Ga0105248_10146437 | Ga0105248_101464372 | 137 |
| 23 | 3300014969 | Ga0157376_10059288 | Ga0157376_100592883 | 137 |
| 24 | 3300026088 | Ga0207641_10556671 | Ga0207641_105566712 | 137 |
| 25 | 3300028800 | Ga0265338_10136903 | Ga0265338_101369032 | 137 |
| 26 | 3300035117 | Ga0373953_0578843 | Ga0373953_0578843_10_462 | 137 |
| 27 | 3300005355 | Ga0070671_100481259 | Ga0070671_1004812592 | 138 |
| 28 | 3300005841 | Ga0068863_101171557 | Ga0068863_1011715572 | 138 |
| 29 | 3300006237 | Ga0097621_101230784 | Ga0097621_1012307841 | 138 |
| 30 | 3300025931 | Ga0207644_10618399 | Ga0207644_106183992 | 138 |
| 31 | 3300035692 | Ga0373935_0030940 | Ga0373935_0030940_2552_3010 | 138 |
| 32 | 3300046616 | Ga0495668_0151358 | Ga0495668_0151358_645_1103 | 138 |
| 33 | 3300042439 | Ga0439464_0018357 | Ga0439464_0018357_1282_1734 | 139 |
| 34 | 3300042461 | Ga0439460_0020142 | Ga0439460_0020142_688_1140 | 139 |
| 35 | 3300046681 | Ga0495647_0489872 | Ga0495647_0489872_70_522 | 139 |
| 36 | 3300005293 | Ga0065715_10585454 | Ga0065715_105854542 | 140 |
| 37 | 3300005327 | Ga0070658_10124698 | Ga0070658_101246983 | 140 |
| 38 | 3300005331 | Ga0070670_100023097 | Ga0070670_1000230974 | 140 |
| 39 | 3300005338 | Ga0068868_100077111 | Ga0068868_1000771112 | 140 |
| 40 | 3300005353 | Ga0070669_101486088 | Ga0070669_1014860881 | 140 |
| 41 | 3300005364 | Ga0070673_100018256 | Ga0070673_1000182563 | 140 |
| 42 | 3300005366 | Ga0070659_100147324 | Ga0070659_1001473243 | 140 |
| 43 | 3300005367 | Ga0070667_100580586 | Ga0070667_1005805862 | 140 |
| 44 | 3300005456 | Ga0070678_100015805 | Ga0070678_1000158052 | 140 |
| 45 | 3300005457 | Ga0070662_100131601 | Ga0070662_1001316012 | 140 |
| 46 | 3300005467 | Ga0070706_100070158 | Ga0070706_1000701582 | 140 |
| 47 | 3300005564 | Ga0070664_101279357 | Ga0070664_1012793571 | 140 |
| 48 | 3300009177 | Ga0105248_10784767 | Ga0105248_107847671 | 140 |
| 49 | 3300014497 | Ga0182008_10158316 | Ga0182008_101583162 | 140 |
| 50 | 3300014745 | Ga0157377_10830713 | Ga0157377_108307131 | 140 |
| 51 | 3300025893 | Ga0207682_10018630 | Ga0207682_100186303 | 140 |
| 52 | 3300025901 | Ga0207688_10077825 | Ga0207688_100778252 | 140 |
| 53 | 3300025908 | Ga0207643_10375273 | Ga0207643_103752732 | 140 |
| 54 | 3300025910 | Ga0207684_10213189 | Ga0207684_102131892 | 140 |
| 55 | 3300025922 | Ga0207646_10742048 | Ga0207646_107420481 | 140 |
| 56 | 3300025925 | Ga0207650_10423975 | Ga0207650_104239752 | 140 |
| 57 | 3300025926 | Ga0207659_10165772 | Ga0207659_101657722 | 140 |
| 58 | 3300025931 | Ga0207644_10155868 | Ga0207644_101558682 | 140 |
| 59 | 3300025933 | Ga0207706_10159032 | Ga0207706_101590322 | 140 |
| 60 | 3300025936 | Ga0207670_11307063 | Ga0207670_113070631 | 140 |
| 61 | 3300025945 | Ga0207679_10192108 | Ga0207679_101921082 | 140 |
| 62 | 3300025960 | Ga0207651_10085627 | Ga0207651_100856273 | 140 |
| 63 | 3300025986 | Ga0207658_10101284 | Ga0207658_101012843 | 140 |
| 64 | 3300026075 | Ga0207708_10254625 | Ga0207708_102546252 | 140 |
| 65 | 3300026121 | Ga0207683_10153509 | Ga0207683_101535092 | 140 |
| 66 | 3300048927 | Ga0496124_0273030 | Ga0496124_0273030_251_703 | 140 |
| 67 | 3300031730 | Ga0307516_10981260 | Ga0307516_109812601 | 141 |
| 68 | 3300005563 | Ga0068855_100004988 | Ga0068855_1000049884 | 142 |
| 69 | 3300005937 | Ga0081455_10504311 | Ga0081455_105043112 | 142 |
| 70 | 3300007788 | Ga0099795_10000876 | Ga0099795_100008761 | 142 |
| 71 | 3300013105 | Ga0157369_10323014 | Ga0157369_103230143 | 142 |
| 72 | 3300013306 | Ga0163162_10414512 | Ga0163162_104145121 | 142 |
| 73 | 3300025909 | Ga0207705_10531408 | Ga0207705_105314082 | 142 |
| 74 | 3300025917 | Ga0207660_10625957 | Ga0207660_106259571 | 142 |
| 75 | 3300025919 | Ga0207657_10039408 | Ga0207657_100394084 | 142 |
| 76 | 3300025921 | Ga0207652_10096850 | Ga0207652_100968503 | 142 |
| 77 | 3300025929 | Ga0207664_10685375 | Ga0207664_106853751 | 142 |
| 78 | 3300025942 | Ga0207689_10249506 | Ga0207689_102495062 | 142 |
| 79 | 3300025981 | Ga0207640_10028863 | Ga0207640_100288633 | 142 |
| 80 | 3300037418 | Ga0395900_1784244 | Ga0395900_1784244_24_482 | 142 |
| 81 | 3300037466 | Ga0395898_0018925 | Ga0395898_0018925_301_759 | 142 |
| 82 | 3300037471 | Ga0395905_0048196 | Ga0395905_0048196_2711_3169 | 142 |
| 83 | 3300047323 | Ga0495683_0278981 | Ga0495683_0278981_33_491 | 142 |
| 84 | 3300003659 | JGI25404J52841_10054809 | JGI25404J52841_100548092 | 143 |
| 85 | 3300005353 | Ga0070669_100545138 | Ga0070669_1005451381 | 143 |
| 86 | 3300005983 | Ga0081540_1006280 | Ga0081540_10062806 | 143 |
| 87 | 3300014326 | Ga0157380_11619408 | Ga0157380_116194082 | 143 |
| 88 | 3300025908 | Ga0207643_10058333 | Ga0207643_100583333 | 143 |
| 89 | 3300025923 | Ga0207681_10058879 | Ga0207681_100588793 | 143 |
| 90 | 3300026075 | Ga0207708_11277283 | Ga0207708_112772832 | 143 |
| 91 | 3300037418 | Ga0395900_0009709 | Ga0395900_0009709_575_1033 | 143 |
| 92 | 3300037466 | Ga0395898_0088174 | Ga0395898_0088174_868_1326 | 143 |
| 93 | 3300038443 | Ga0395901_0243359 | Ga0395901_0243359_339_797 | 143 |
| 94 | 3300047469 | Ga0495673_0100002 | Ga0495673_0100002_71_529 | 143 |
| 95 | 3300050493 | nmdc:mga0k408_257960_c1 | nmdc:mga0k408_257960_c1_35_493 | 143 |
| 96 | 3300053096 | Ga0500641_0006688 | Ga0500641_0006688_2513_2971 | 143 |
| 97 | 3300053147 | Ga0500589_229657 | Ga0500589_229657_62_520 | 143 |
| 98 | 3300005455 | Ga0070663_100293745 | Ga0070663_1002937451 | 144 |
| 99 | 3300047445 | Ga0495677_0174788 | Ga0495677_0174788_208_666 | 144 |
| 100 | 3300005983 | Ga0081540_1000327 | Ga0081540_100032735 | 145 |
| 101 | 3300010159 | Ga0099796_10093126 | Ga0099796_100931261 | 145 |
| 102 | iso_pu_bacteria | 2643221644 | 2644245846 | 146 |
| 103 | iso_pu_bacteria | 2643221654 | 2644302775 | 146 |
| 104 | iso_pu_bacteria | 2545555834 | 2545678417 | 148 |
| 105 | iso_pu_bacteria | 2888419890 | 2888424104 | 148 |
| 106 | iso_pu_bacteria | 2904690495 | 2904694345 | 148 |
| 107 | iso_pu_bacteria | 2906635258 | 2906643067 | 148 |
| 108 | iso_pu_bacteria | 2906660503 | 2906661953 | 148 |
| 109 | 3300041443 | Ga0451789_0231164 | Ga0451789_0231164_38_487 | 149 |
| 110 | 3300003791 | Ga0055530_10004946 | Ga0055530_100049466 | 150 |
| 111 | 3300003791 | Ga0055530_10027959 | Ga0055530_100279592 | 150 |
| 112 | 3300003792 | Ga0055540_1000002 | Ga0055540_100000219 | 150 |
| 113 | 3300005328 | Ga0070676_10001571 | Ga0070676_1000157113 | 150 |
| 114 | 3300005328 | Ga0070676_10042317 | Ga0070676_100423172 | 150 |
| 115 | 3300005328 | Ga0070676_10068364 | Ga0070676_100683642 | 150 |
| 116 | 3300005328 | Ga0070676_10387222 | Ga0070676_103872222 | 150 |
| 117 | 3300005328 | Ga0070676_10546457 | Ga0070676_105464572 | 150 |
| 118 | 3300005330 | Ga0070690_100033930 | Ga0070690_1000339301 | 150 |
| 119 | 3300005331 | Ga0070670_100016337 | Ga0070670_1000163372 | 150 |
| 120 | 3300005331 | Ga0070670_100123241 | Ga0070670_1001232412 | 150 |
| 121 | 3300005331 | Ga0070670_100141375 | Ga0070670_1001413752 | 150 |
| 122 | 3300005331 | Ga0070670_100359317 | Ga0070670_1003593172 | 150 |
| 123 | 3300005331 | Ga0070670_100374642 | Ga0070670_1003746422 | 150 |
| 124 | 3300005331 | Ga0070670_100417055 | Ga0070670_1004170551 | 150 |
| 125 | 3300005331 | Ga0070670_100954434 | Ga0070670_1009544342 | 150 |
| 126 | 3300005333 | Ga0070677_10082838 | Ga0070677_100828382 | 150 |
| 127 | 3300005333 | Ga0070677_10136908 | Ga0070677_101369082 | 150 |
| 128 | 3300005334 | Ga0068869_100239701 | Ga0068869_1002397012 | 150 |
| 129 | 3300005334 | Ga0068869_100351437 | Ga0068869_1003514372 | 150 |
| 130 | 3300005334 | Ga0068869_101320958 | Ga0068869_1013209581 | 150 |
| 131 | 3300005334 | Ga0068869_101787187 | Ga0068869_1017871871 | 150 |
| 132 | 3300005335 | Ga0070666_10003543 | Ga0070666_100035437 | 150 |
| 133 | 3300005335 | Ga0070666_10420505 | Ga0070666_104205052 | 150 |
| 134 | 3300005335 | Ga0070666_10445832 | Ga0070666_104458322 | 150 |
| 135 | 3300005335 | Ga0070666_10775274 | Ga0070666_107752741 | 150 |
| 136 | 3300005337 | Ga0070682_100280917 | Ga0070682_1002809172 | 150 |
| 137 | 3300005338 | Ga0068868_100028329 | Ga0068868_1000283292 | 150 |
| 138 | 3300005338 | Ga0068868_100034873 | Ga0068868_1000348734 | 150 |
| 139 | 3300005338 | Ga0068868_100034996 | Ga0068868_1000349962 | 150 |
| 140 | 3300005338 | Ga0068868_100057236 | Ga0068868_1000572364 | 150 |
| 141 | 3300005338 | Ga0068868_100302618 | Ga0068868_1003026182 | 150 |
| 142 | 3300005339 | Ga0070660_100169936 | Ga0070660_1001699362 | 150 |
| 143 | 3300005340 | Ga0070689_100584904 | Ga0070689_1005849041 | 150 |
| 144 | 3300005340 | Ga0070689_100929303 | Ga0070689_1009293032 | 150 |
| 145 | 3300005341 | Ga0070691_10284518 | Ga0070691_102845181 | 150 |
| 146 | 3300005343 | Ga0070687_100364528 | Ga0070687_1003645282 | 150 |
| 147 | 3300005344 | Ga0070661_100094009 | Ga0070661_1000940092 | 150 |
| 148 | 3300005344 | Ga0070661_100484173 | Ga0070661_1004841732 | 150 |
| 149 | 3300005344 | Ga0070661_100511186 | Ga0070661_1005111862 | 150 |
| 150 | 3300005345 | Ga0070692_10303525 | Ga0070692_103035252 | 150 |
| 151 | 3300005347 | Ga0070668_100045003 | Ga0070668_1000450033 | 150 |
| 152 | 3300005347 | Ga0070668_100642543 | Ga0070668_1006425432 | 150 |
| 153 | 3300005347 | Ga0070668_100821385 | Ga0070668_1008213851 | 150 |
| 154 | 3300005353 | Ga0070669_100165601 | Ga0070669_1001656013 | 150 |
| 155 | 3300005353 | Ga0070669_100373046 | Ga0070669_1003730462 | 150 |
| 156 | 3300005354 | Ga0070675_100063197 | Ga0070675_1000631973 | 150 |
| 157 | 3300005354 | Ga0070675_100090116 | Ga0070675_1000901164 | 150 |
| 158 | 3300005354 | Ga0070675_100154040 | Ga0070675_1001540404 | 150 |
| 159 | 3300005354 | Ga0070675_100254286 | Ga0070675_1002542862 | 150 |
| 160 | 3300005355 | Ga0070671_100002227 | Ga0070671_1000022279 | 150 |
| 161 | 3300005355 | Ga0070671_100045288 | Ga0070671_1000452883 | 150 |
| 162 | 3300005355 | Ga0070671_100050018 | Ga0070671_1000500183 | 150 |
| 163 | 3300005355 | Ga0070671_100167435 | Ga0070671_1001674352 | 150 |
| 164 | 3300005355 | Ga0070671_100499381 | Ga0070671_1004993812 | 150 |
| 165 | 3300005355 | Ga0070671_101256382 | Ga0070671_1012563822 | 150 |
| 166 | 3300005356 | Ga0070674_100032527 | Ga0070674_1000325273 | 150 |
| 167 | 3300005356 | Ga0070674_100033008 | Ga0070674_1000330081 | 150 |
| 168 | 3300005356 | Ga0070674_100176767 | Ga0070674_1001767672 | 150 |
| 169 | 3300005356 | Ga0070674_100284726 | Ga0070674_1002847262 | 150 |
| 170 | 3300005356 | Ga0070674_100309447 | Ga0070674_1003094472 | 150 |
| 171 | 3300005364 | Ga0070673_100053712 | Ga0070673_1000537123 | 150 |
| 172 | 3300005364 | Ga0070673_100069128 | Ga0070673_1000691284 | 150 |
| 173 | 3300005364 | Ga0070673_100256307 | Ga0070673_1002563072 | 150 |
| 174 | 3300005364 | Ga0070673_100332974 | Ga0070673_1003329742 | 150 |
| 175 | 3300005364 | Ga0070673_100527740 | Ga0070673_1005277402 | 150 |
| 176 | 3300005364 | Ga0070673_100639520 | Ga0070673_1006395201 | 150 |
| 177 | 3300005366 | Ga0070659_100395090 | Ga0070659_1003950902 | 150 |
| 178 | 3300005366 | Ga0070659_100537561 | Ga0070659_1005375612 | 150 |
| 179 | 3300005367 | Ga0070667_100000702 | Ga0070667_10000070217 | 150 |
| 180 | 3300005367 | Ga0070667_100003128 | Ga0070667_10000312811 | 150 |
| 181 | 3300005367 | Ga0070667_100108277 | Ga0070667_1001082772 | 150 |
| 182 | 3300005367 | Ga0070667_100175632 | Ga0070667_1001756323 | 150 |
| 183 | 3300005367 | Ga0070667_100400269 | Ga0070667_1004002692 | 150 |
| 184 | 3300005441 | Ga0070700_100024707 | Ga0070700_1000247073 | 150 |
| 185 | 3300005445 | Ga0070708_100651983 | Ga0070708_1006519831 | 150 |
| 186 | 3300005455 | Ga0070663_100022607 | Ga0070663_1000226074 | 150 |
| 187 | 3300005455 | Ga0070663_100040976 | Ga0070663_1000409763 | 150 |
| 188 | 3300005455 | Ga0070663_100273542 | Ga0070663_1002735422 | 150 |
| 189 | 3300005455 | Ga0070663_100736600 | Ga0070663_1007366001 | 150 |
| 190 | 3300005456 | Ga0070678_100033253 | Ga0070678_1000332534 | 150 |
| 191 | 3300005456 | Ga0070678_100117756 | Ga0070678_1001177561 | 150 |
| 192 | 3300005456 | Ga0070678_100340408 | Ga0070678_1003404082 | 150 |
| 193 | 3300005456 | Ga0070678_100776117 | Ga0070678_1007761172 | 150 |
| 194 | 3300005456 | Ga0070678_101122836 | Ga0070678_1011228361 | 150 |
| 195 | 3300005456 | Ga0070678_101827763 | Ga0070678_1018277631 | 150 |
| 196 | 3300005457 | Ga0070662_100010591 | Ga0070662_1000105913 | 150 |
| 197 | 3300005457 | Ga0070662_100057619 | Ga0070662_1000576192 | 150 |
| 198 | 3300005457 | Ga0070662_100117017 | Ga0070662_1001170173 | 150 |
| 199 | 3300005457 | Ga0070662_100393068 | Ga0070662_1003930681 | 150 |
| 200 | 3300005459 | Ga0068867_100002735 | Ga0068867_1000027355 | 150 |
| 201 | 3300005459 | Ga0068867_100061849 | Ga0068867_1000618491 | 150 |
| 202 | 3300005459 | Ga0068867_100068826 | Ga0068867_1000688262 | 150 |
| 203 | 3300005459 | Ga0068867_100135893 | Ga0068867_1001358932 | 150 |
| 204 | 3300005459 | Ga0068867_100166447 | Ga0068867_1001664472 | 150 |
| 205 | 3300005466 | Ga0070685_10333550 | Ga0070685_103335502 | 150 |
| 206 | 3300005466 | Ga0070685_10746709 | Ga0070685_107467092 | 150 |
| 207 | 3300005467 | Ga0070706_100000671 | Ga0070706_1000006719 | 150 |
| 208 | 3300005468 | Ga0070707_100009411 | Ga0070707_1000094113 | 150 |
| 209 | 3300005530 | Ga0070679_100547700 | Ga0070679_1005477002 | 150 |
| 210 | 3300005539 | Ga0068853_100433149 | Ga0068853_1004331492 | 150 |
| 211 | 3300005543 | Ga0070672_100002315 | Ga0070672_10000231511 | 150 |
| 212 | 3300005543 | Ga0070672_100028972 | Ga0070672_1000289722 | 150 |
| 213 | 3300005543 | Ga0070672_100038652 | Ga0070672_1000386521 | 150 |
| 214 | 3300005543 | Ga0070672_100084456 | Ga0070672_1000844563 | 150 |
| 215 | 3300005543 | Ga0070672_100090945 | Ga0070672_1000909452 | 150 |
| 216 | 3300005543 | Ga0070672_100136490 | Ga0070672_1001364902 | 150 |
| 217 | 3300005543 | Ga0070672_100171686 | Ga0070672_1001716862 | 150 |
| 218 | 3300005543 | Ga0070672_100224675 | Ga0070672_1002246753 | 150 |
| 219 | 3300005543 | Ga0070672_100259699 | Ga0070672_1002596991 | 150 |
| 220 | 3300005543 | Ga0070672_100410615 | Ga0070672_1004106152 | 150 |
| 221 | 3300005547 | Ga0070693_100071429 | Ga0070693_1000714293 | 150 |
| 222 | 3300005548 | Ga0070665_100233384 | Ga0070665_1002333842 | 150 |
| 223 | 3300005549 | Ga0070704_100545621 | Ga0070704_1005456212 | 150 |
| 224 | 3300005564 | Ga0070664_100033760 | Ga0070664_1000337602 | 150 |
| 225 | 3300005564 | Ga0070664_100182376 | Ga0070664_1001823762 | 150 |
| 226 | 3300005564 | Ga0070664_100871420 | Ga0070664_1008714202 | 150 |
| 227 | 3300005577 | Ga0068857_100013080 | Ga0068857_1000130807 | 150 |
| 228 | 3300005577 | Ga0068857_100089872 | Ga0068857_1000898722 | 150 |
| 229 | 3300005578 | Ga0068854_100045777 | Ga0068854_1000457773 | 150 |
| 230 | 3300005578 | Ga0068854_100530591 | Ga0068854_1005305912 | 150 |
| 231 | 3300005578 | Ga0068854_100543221 | Ga0068854_1005432212 | 150 |
| 232 | 3300005578 | Ga0068854_100678904 | Ga0068854_1006789042 | 150 |
| 233 | 3300005615 | Ga0070702_100150142 | Ga0070702_1001501422 | 150 |
| 234 | 3300005616 | Ga0068852_100192879 | Ga0068852_1001928792 | 150 |
| 235 | 3300005616 | Ga0068852_100264517 | Ga0068852_1002645172 | 150 |
| 236 | 3300005616 | Ga0068852_100273340 | Ga0068852_1002733403 | 150 |
| 237 | 3300005616 | Ga0068852_100409503 | Ga0068852_1004095032 | 150 |
| 238 | 3300005616 | Ga0068852_100585553 | Ga0068852_1005855532 | 150 |
| 239 | 3300005616 | Ga0068852_100871834 | Ga0068852_1008718342 | 150 |
| 240 | 3300005616 | Ga0068852_101784896 | Ga0068852_1017848961 | 150 |
| 241 | 3300005617 | Ga0068859_100055119 | Ga0068859_1000551192 | 150 |
| 242 | 3300005617 | Ga0068859_100351485 | Ga0068859_1003514852 | 150 |
| 243 | 3300005617 | Ga0068859_101416460 | Ga0068859_1014164601 | 150 |
| 244 | 3300005618 | Ga0068864_100043014 | Ga0068864_1000430143 | 150 |
| 245 | 3300005618 | Ga0068864_100048474 | Ga0068864_1000484741 | 150 |
| 246 | 3300005618 | Ga0068864_100181312 | Ga0068864_1001813123 | 150 |
| 247 | 3300005718 | Ga0068866_10027930 | Ga0068866_100279301 | 150 |
| 248 | 3300005718 | Ga0068866_10412886 | Ga0068866_104128862 | 150 |
| 249 | 3300005719 | Ga0068861_100004858 | Ga0068861_1000048589 | 150 |
| 250 | 3300005719 | Ga0068861_100374752 | Ga0068861_1003747522 | 150 |
| 251 | 3300005834 | Ga0068851_10041380 | Ga0068851_100413803 | 150 |
| 252 | 3300005841 | Ga0068863_100018157 | Ga0068863_1000181574 | 150 |
| 253 | 3300005841 | Ga0068863_100023761 | Ga0068863_1000237617 | 150 |
| 254 | 3300005841 | Ga0068863_100052850 | Ga0068863_1000528502 | 150 |
| 255 | 3300005841 | Ga0068863_100059049 | Ga0068863_1000590494 | 150 |
| 256 | 3300005841 | Ga0068863_100237760 | Ga0068863_1002377602 | 150 |
| 257 | 3300005841 | Ga0068863_100971013 | Ga0068863_1009710132 | 150 |
| 258 | 3300005842 | Ga0068858_100051286 | Ga0068858_1000512864 | 150 |
| 259 | 3300005843 | Ga0068860_100055844 | Ga0068860_1000558443 | 150 |
| 260 | 3300005843 | Ga0068860_100064811 | Ga0068860_1000648113 | 150 |
| 261 | 3300005843 | Ga0068860_100359658 | Ga0068860_1003596582 | 150 |
| 262 | 3300005844 | Ga0068862_100124433 | Ga0068862_1001244332 | 150 |
| 263 | 3300005844 | Ga0068862_101071626 | Ga0068862_1010716262 | 150 |
| 264 | 3300006038 | Ga0075365_10105522 | Ga0075365_101055222 | 150 |
| 265 | 3300006042 | Ga0075368_10018388 | Ga0075368_100183883 | 150 |
| 266 | 3300006048 | Ga0075363_100006739 | Ga0075363_1000067393 | 150 |
| 267 | 3300006048 | Ga0075363_100180366 | Ga0075363_1001803662 | 150 |
| 268 | 3300006048 | Ga0075363_100722228 | Ga0075363_1007222282 | 150 |
| 269 | 3300006173 | Ga0070716_100198683 | Ga0070716_1001986832 | 150 |
| 270 | 3300006177 | Ga0075362_10009819 | Ga0075362_100098194 | 150 |
| 271 | 3300006177 | Ga0075362_10030180 | Ga0075362_100301804 | 150 |
| 272 | 3300006177 | Ga0075362_10073657 | Ga0075362_100736571 | 150 |
| 273 | 3300006178 | Ga0075367_10000286 | Ga0075367_100002862 | 150 |
| 274 | 3300006178 | Ga0075367_10010668 | Ga0075367_100106685 | 150 |
| 275 | 3300006178 | Ga0075367_10066306 | Ga0075367_100663063 | 150 |
| 276 | 3300006186 | Ga0075369_10001735 | Ga0075369_100017357 | 150 |
| 277 | 3300006195 | Ga0075366_10001659 | Ga0075366_1000165911 | 150 |
| 278 | 3300006195 | Ga0075366_10141490 | Ga0075366_101414902 | 150 |
| 279 | 3300006195 | Ga0075366_10188777 | Ga0075366_101887772 | 150 |
| 280 | 3300006237 | Ga0097621_100027899 | Ga0097621_1000278996 | 150 |
| 281 | 3300006237 | Ga0097621_100267567 | Ga0097621_1002675671 | 150 |
| 282 | 3300006237 | Ga0097621_100282822 | Ga0097621_1002828222 | 150 |
| 283 | 3300006237 | Ga0097621_100513610 | Ga0097621_1005136102 | 150 |
| 284 | 3300006237 | Ga0097621_100822595 | Ga0097621_1008225951 | 150 |
| 285 | 3300006237 | Ga0097621_101136710 | Ga0097621_1011367102 | 150 |
| 286 | 3300006237 | Ga0097621_101385036 | Ga0097621_1013850362 | 150 |
| 287 | 3300006353 | Ga0075370_10003013 | Ga0075370_100030137 | 150 |
| 288 | 3300006353 | Ga0075370_10008160 | Ga0075370_100081602 | 150 |
| 289 | 3300006353 | Ga0075370_10031485 | Ga0075370_100314852 | 150 |
| 290 | 3300006353 | Ga0075370_10040724 | Ga0075370_100407243 | 150 |
| 291 | 3300006353 | Ga0075370_10091911 | Ga0075370_100919112 | 150 |
| 292 | 3300006353 | Ga0075370_10298113 | Ga0075370_102981132 | 150 |
| 293 | 3300006353 | Ga0075370_10345216 | Ga0075370_103452162 | 150 |
| 294 | 3300006353 | Ga0075370_10582564 | Ga0075370_105825642 | 150 |
| 295 | 3300006358 | Ga0068871_100048558 | Ga0068871_1000485582 | 150 |
| 296 | 3300006358 | Ga0068871_100094270 | Ga0068871_1000942704 | 150 |
| 297 | 3300006358 | Ga0068871_100120272 | Ga0068871_1001202722 | 150 |
| 298 | 3300006358 | Ga0068871_100213010 | Ga0068871_1002130102 | 150 |
| 299 | 3300006358 | Ga0068871_100608077 | Ga0068871_1006080772 | 150 |
| 300 | 3300006844 | Ga0075428_101874561 | Ga0075428_1018745612 | 150 |
| 301 | 3300006881 | Ga0068865_100004931 | Ga0068865_1000049313 | 150 |
| 302 | 3300006881 | Ga0068865_100008008 | Ga0068865_1000080082 | 150 |
| 303 | 3300006881 | Ga0068865_100111196 | Ga0068865_1001111963 | 150 |
| 304 | 3300006881 | Ga0068865_100282035 | Ga0068865_1002820352 | 150 |
| 305 | 3300006881 | Ga0068865_100478896 | Ga0068865_1004788962 | 150 |
| 306 | 3300006881 | Ga0068865_100676425 | Ga0068865_1006764252 | 150 |
| 307 | 3300006931 | Ga0097620_100055123 | Ga0097620_1000551232 | 150 |
| 308 | 3300006931 | Ga0097620_100351509 | Ga0097620_1003515092 | 150 |
| 309 | 3300006931 | Ga0097620_101416543 | Ga0097620_1014165431 | 150 |
| 310 | 3300006946 | Ga0079104_1000839 | Ga0079104_100083912 | 150 |
| 311 | 3300009093 | Ga0105240_10156460 | Ga0105240_101564604 | 150 |
| 312 | 3300009094 | Ga0111539_10483084 | Ga0111539_104830842 | 150 |
| 313 | 3300009098 | Ga0105245_10189019 | Ga0105245_101890193 | 150 |
| 314 | 3300009098 | Ga0105245_10472989 | Ga0105245_104729892 | 150 |
| 315 | 3300009098 | Ga0105245_10568449 | Ga0105245_105684492 | 150 |
| 316 | 3300009098 | Ga0105245_10606543 | Ga0105245_106065432 | 150 |
| 317 | 3300009098 | Ga0105245_10875070 | Ga0105245_108750702 | 150 |
| 318 | 3300009101 | Ga0105247_10354331 | Ga0105247_103543312 | 150 |
| 319 | 3300009147 | Ga0114129_13056944 | Ga0114129_130569441 | 150 |
| 320 | 3300009148 | Ga0105243_10262108 | Ga0105243_102621082 | 150 |
| 321 | 3300009148 | Ga0105243_10418367 | Ga0105243_104183672 | 150 |
| 322 | 3300009148 | Ga0105243_10690076 | Ga0105243_106900762 | 150 |
| 323 | 3300009148 | Ga0105243_11475344 | Ga0105243_114753442 | 150 |
| 324 | 3300009174 | Ga0105241_10331738 | Ga0105241_103317382 | 150 |
| 325 | 3300009176 | Ga0105242_10057880 | Ga0105242_100578803 | 150 |
| 326 | 3300009176 | Ga0105242_10541384 | Ga0105242_105413842 | 150 |
| 327 | 3300009176 | Ga0105242_10704468 | Ga0105242_107044682 | 150 |
| 328 | 3300009177 | Ga0105248_10015932 | Ga0105248_100159325 | 150 |
| 329 | 3300009177 | Ga0105248_10044985 | Ga0105248_100449852 | 150 |
| 330 | 3300009177 | Ga0105248_10059293 | Ga0105248_100592935 | 150 |
| 331 | 3300009177 | Ga0105248_10584820 | Ga0105248_105848202 | 150 |
| 332 | 3300009177 | Ga0105248_10648769 | Ga0105248_106487691 | 150 |
| 333 | 3300009177 | Ga0105248_10712936 | Ga0105248_107129362 | 150 |
| 334 | 3300009177 | Ga0105248_10746295 | Ga0105248_107462952 | 150 |
| 335 | 3300009177 | Ga0105248_11176691 | Ga0105248_111766912 | 150 |
| 336 | 3300009177 | Ga0105248_12203579 | Ga0105248_122035791 | 150 |
| 337 | 3300009545 | Ga0105237_10121851 | Ga0105237_101218512 | 150 |
| 338 | 3300009545 | Ga0105237_10298827 | Ga0105237_102988272 | 150 |
| 339 | 3300009551 | Ga0105238_11562495 | Ga0105238_115624951 | 150 |
| 340 | 3300009553 | Ga0105249_10006344 | Ga0105249_1000634411 | 150 |
| 341 | 3300009553 | Ga0105249_10010010 | Ga0105249_1001001010 | 150 |
| 342 | 3300010375 | Ga0105239_10071838 | Ga0105239_100718383 | 150 |
| 343 | 3300011119 | Ga0105246_10311415 | Ga0105246_103114152 | 150 |
| 344 | 3300011119 | Ga0105246_10613197 | Ga0105246_106131972 | 150 |
| 345 | 3300013296 | Ga0157374_10040378 | Ga0157374_100403782 | 150 |
| 346 | 3300013296 | Ga0157374_10218393 | Ga0157374_102183932 | 150 |
| 347 | 3300013296 | Ga0157374_10516831 | Ga0157374_105168311 | 150 |
| 348 | 3300013296 | Ga0157374_10638186 | Ga0157374_106381862 | 150 |
| 349 | 3300013296 | Ga0157374_10716923 | Ga0157374_107169232 | 150 |
| 350 | 3300013297 | Ga0157378_10129320 | Ga0157378_101293202 | 150 |
| 351 | 3300013297 | Ga0157378_10743273 | Ga0157378_107432732 | 150 |
| 352 | 3300013306 | Ga0163162_10005745 | Ga0163162_100057454 | 150 |
| 353 | 3300013306 | Ga0163162_10131671 | Ga0163162_101316712 | 150 |
| 354 | 3300013306 | Ga0163162_10169211 | Ga0163162_101692112 | 150 |
| 355 | 3300013306 | Ga0163162_10957664 | Ga0163162_109576642 | 150 |
| 356 | 3300013306 | Ga0163162_11900402 | Ga0163162_119004021 | 150 |
| 357 | 3300013307 | Ga0157372_11888685 | Ga0157372_118886852 | 150 |
| 358 | 3300013308 | Ga0157375_10015577 | Ga0157375_100155772 | 150 |
| 359 | 3300013308 | Ga0157375_10040729 | Ga0157375_100407294 | 150 |
| 360 | 3300013308 | Ga0157375_10087592 | Ga0157375_100875922 | 150 |
| 361 | 3300013308 | Ga0157375_10132947 | Ga0157375_101329472 | 150 |
| 362 | 3300013308 | Ga0157375_10194002 | Ga0157375_101940023 | 150 |
| 363 | 3300013308 | Ga0157375_10593668 | Ga0157375_105936682 | 150 |
| 364 | 3300013308 | Ga0157375_10807015 | Ga0157375_108070152 | 150 |
| 365 | 3300014325 | Ga0163163_10958237 | Ga0163163_109582371 | 150 |
| 366 | 3300014326 | Ga0157380_10009952 | Ga0157380_100099528 | 150 |
| 367 | 3300014968 | Ga0157379_10008063 | Ga0157379_100080634 | 150 |
| 368 | 3300014968 | Ga0157379_10160745 | Ga0157379_101607454 | 150 |
| 369 | 3300014968 | Ga0157379_10387042 | Ga0157379_103870422 | 150 |
| 370 | 3300014969 | Ga0157376_10221927 | Ga0157376_102219272 | 150 |
| 371 | 3300014969 | Ga0157376_10673285 | Ga0157376_106732852 | 150 |
| 372 | 3300014969 | Ga0157376_10893854 | Ga0157376_108938542 | 150 |
| 373 | 3300014969 | Ga0157376_11337024 | Ga0157376_113370241 | 150 |
| 374 | 3300014969 | Ga0157376_12112069 | Ga0157376_121120692 | 150 |
| 375 | 3300017792 | Ga0163161_10107886 | Ga0163161_101078863 | 150 |
| 376 | 3300017792 | Ga0163161_10403012 | Ga0163161_104030121 | 150 |
| 377 | 3300025291 | Ga0209675_1015366 | Ga0209675_10153661 | 150 |
| 378 | 3300025298 | Ga0209050_1001035 | Ga0209050_100103518 | 150 |
| 379 | 3300025298 | Ga0209050_1007995 | Ga0209050_10079955 | 150 |
| 380 | 3300025299 | Ga0209256_1000143 | Ga0209256_100014388 | 150 |
| 381 | 3300025303 | Ga0209051_1000024 | Ga0209051_100002419 | 150 |
| 382 | 3300025304 | Ga0209257_1000079 | Ga0209257_100007919 | 150 |
| 383 | 3300025304 | Ga0209257_1040119 | Ga0209257_10401192 | 150 |
| 384 | 3300025315 | Ga0207697_10011942 | Ga0207697_100119422 | 150 |
| 385 | 3300025315 | Ga0207697_10036965 | Ga0207697_100369652 | 150 |
| 386 | 3300025321 | Ga0207656_10084860 | Ga0207656_100848602 | 150 |
| 387 | 3300025321 | Ga0207656_10341297 | Ga0207656_103412972 | 150 |
| 388 | 3300025893 | Ga0207682_10009193 | Ga0207682_100091934 | 150 |
| 389 | 3300025893 | Ga0207682_10088909 | Ga0207682_100889092 | 150 |
| 390 | 3300025899 | Ga0207642_10004867 | Ga0207642_100048673 | 150 |
| 391 | 3300025899 | Ga0207642_10168536 | Ga0207642_101685362 | 150 |
| 392 | 3300025901 | Ga0207688_10335936 | Ga0207688_103359362 | 150 |
| 393 | 3300025903 | Ga0207680_10014466 | Ga0207680_100144664 | 150 |
| 394 | 3300025903 | Ga0207680_10379220 | Ga0207680_103792202 | 150 |
| 395 | 3300025903 | Ga0207680_10388298 | Ga0207680_103882982 | 150 |
| 396 | 3300025905 | Ga0207685_10145266 | Ga0207685_101452661 | 150 |
| 397 | 3300025907 | Ga0207645_10001208 | Ga0207645_1000120813 | 150 |
| 398 | 3300025907 | Ga0207645_10063363 | Ga0207645_100633634 | 150 |
| 399 | 3300025907 | Ga0207645_10221700 | Ga0207645_102217002 | 150 |
| 400 | 3300025907 | Ga0207645_10230742 | Ga0207645_102307422 | 150 |
| 401 | 3300025907 | Ga0207645_10235704 | Ga0207645_102357042 | 150 |
| 402 | 3300025907 | Ga0207645_10276870 | Ga0207645_102768702 | 150 |
| 403 | 3300025907 | Ga0207645_10448855 | Ga0207645_104488552 | 150 |
| 404 | 3300025908 | Ga0207643_10141221 | Ga0207643_101412212 | 150 |
| 405 | 3300025909 | Ga0207705_10100307 | Ga0207705_101003073 | 150 |
| 406 | 3300025910 | Ga0207684_10000939 | Ga0207684_1000093912 | 150 |
| 407 | 3300025911 | Ga0207654_10150347 | Ga0207654_101503472 | 150 |
| 408 | 3300025913 | Ga0207695_10139621 | Ga0207695_101396213 | 150 |
| 409 | 3300025914 | Ga0207671_10113189 | Ga0207671_101131892 | 150 |
| 410 | 3300025914 | Ga0207671_10320783 | Ga0207671_103207832 | 150 |
| 411 | 3300025918 | Ga0207662_10025459 | Ga0207662_100254592 | 150 |
| 412 | 3300025919 | Ga0207657_10288215 | Ga0207657_102882151 | 150 |
| 413 | 3300025919 | Ga0207657_10544963 | Ga0207657_105449632 | 150 |
| 414 | 3300025919 | Ga0207657_10739657 | Ga0207657_107396572 | 150 |
| 415 | 3300025921 | Ga0207652_10433227 | Ga0207652_104332272 | 150 |
| 416 | 3300025922 | Ga0207646_10163030 | Ga0207646_101630302 | 150 |
| 417 | 3300025923 | Ga0207681_10004559 | Ga0207681_100045598 | 150 |
| 418 | 3300025924 | Ga0207694_10168524 | Ga0207694_101685242 | 150 |
| 419 | 3300025925 | Ga0207650_10002985 | Ga0207650_100029859 | 150 |
| 420 | 3300025925 | Ga0207650_10005604 | Ga0207650_100056044 | 150 |
| 421 | 3300025925 | Ga0207650_10074941 | Ga0207650_100749414 | 150 |
| 422 | 3300025925 | Ga0207650_10101123 | Ga0207650_101011231 | 150 |
| 423 | 3300025925 | Ga0207650_10292567 | Ga0207650_102925672 | 150 |
| 424 | 3300025925 | Ga0207650_10453781 | Ga0207650_104537813 | 150 |
| 425 | 3300025925 | Ga0207650_10713305 | Ga0207650_107133052 | 150 |
| 426 | 3300025926 | Ga0207659_10069997 | Ga0207659_100699972 | 150 |
| 427 | 3300025926 | Ga0207659_10095714 | Ga0207659_100957142 | 150 |
| 428 | 3300025926 | Ga0207659_10261958 | Ga0207659_102619581 | 150 |
| 429 | 3300025926 | Ga0207659_10298933 | Ga0207659_102989332 | 150 |
| 430 | 3300025926 | Ga0207659_10319657 | Ga0207659_103196572 | 150 |
| 431 | 3300025926 | Ga0207659_10335299 | Ga0207659_103352992 | 150 |
| 432 | 3300025926 | Ga0207659_10580741 | Ga0207659_105807412 | 150 |
| 433 | 3300025927 | Ga0207687_10075351 | Ga0207687_100753513 | 150 |
| 434 | 3300025927 | Ga0207687_10082961 | Ga0207687_100829614 | 150 |
| 435 | 3300025927 | Ga0207687_10118635 | Ga0207687_101186352 | 150 |
| 436 | 3300025931 | Ga0207644_10008221 | Ga0207644_100082213 | 150 |
| 437 | 3300025931 | Ga0207644_10086886 | Ga0207644_100868863 | 150 |
| 438 | 3300025931 | Ga0207644_10127733 | Ga0207644_101277332 | 150 |
| 439 | 3300025931 | Ga0207644_10153745 | Ga0207644_101537452 | 150 |
| 440 | 3300025931 | Ga0207644_10304472 | Ga0207644_103044722 | 150 |
| 441 | 3300025932 | Ga0207690_11545370 | Ga0207690_115453701 | 150 |
| 442 | 3300025933 | Ga0207706_10013363 | Ga0207706_100133639 | 150 |
| 443 | 3300025933 | Ga0207706_10102439 | Ga0207706_101024392 | 150 |
| 444 | 3300025933 | Ga0207706_10172280 | Ga0207706_101722803 | 150 |
| 445 | 3300025933 | Ga0207706_10355061 | Ga0207706_103550611 | 150 |
| 446 | 3300025933 | Ga0207706_10395302 | Ga0207706_103953022 | 150 |
| 447 | 3300025933 | Ga0207706_10709514 | Ga0207706_107095142 | 150 |
| 448 | 3300025933 | Ga0207706_11265749 | Ga0207706_112657491 | 150 |
| 449 | 3300025934 | Ga0207686_10012711 | Ga0207686_100127112 | 150 |
| 450 | 3300025934 | Ga0207686_10236380 | Ga0207686_102363802 | 150 |
| 451 | 3300025934 | Ga0207686_11108665 | Ga0207686_111086651 | 150 |
| 452 | 3300025935 | Ga0207709_10010252 | Ga0207709_100102522 | 150 |
| 453 | 3300025935 | Ga0207709_10102813 | Ga0207709_101028133 | 150 |
| 454 | 3300025935 | Ga0207709_10131907 | Ga0207709_101319073 | 150 |
| 455 | 3300025935 | Ga0207709_10314345 | Ga0207709_103143452 | 150 |
| 456 | 3300025936 | Ga0207670_10664012 | Ga0207670_106640122 | 150 |
| 457 | 3300025937 | Ga0207669_10003010 | Ga0207669_100030109 | 150 |
| 458 | 3300025937 | Ga0207669_10025177 | Ga0207669_100251772 | 150 |
| 459 | 3300025937 | Ga0207669_10174143 | Ga0207669_101741433 | 150 |
| 460 | 3300025937 | Ga0207669_10655080 | Ga0207669_106550801 | 150 |
| 461 | 3300025938 | Ga0207704_10090498 | Ga0207704_100904982 | 150 |
| 462 | 3300025938 | Ga0207704_10127219 | Ga0207704_101272192 | 150 |
| 463 | 3300025938 | Ga0207704_10415419 | Ga0207704_104154192 | 150 |
| 464 | 3300025938 | Ga0207704_10571005 | Ga0207704_105710051 | 150 |
| 465 | 3300025938 | Ga0207704_10896347 | Ga0207704_108963472 | 150 |
| 466 | 3300025940 | Ga0207691_10001739 | Ga0207691_100017393 | 150 |
| 467 | 3300025940 | Ga0207691_10004984 | Ga0207691_100049845 | 150 |
| 468 | 3300025940 | Ga0207691_10005163 | Ga0207691_100051633 | 150 |
| 469 | 3300025940 | Ga0207691_10075981 | Ga0207691_100759812 | 150 |
| 470 | 3300025940 | Ga0207691_10195709 | Ga0207691_101957092 | 150 |
| 471 | 3300025940 | Ga0207691_10215824 | Ga0207691_102158243 | 150 |
| 472 | 3300025940 | Ga0207691_10267612 | Ga0207691_102676122 | 150 |
| 473 | 3300025940 | Ga0207691_10369720 | Ga0207691_103697202 | 150 |
| 474 | 3300025940 | Ga0207691_10371320 | Ga0207691_103713202 | 150 |
| 475 | 3300025941 | Ga0207711_10006629 | Ga0207711_100066292 | 150 |
| 476 | 3300025941 | Ga0207711_10011087 | Ga0207711_100110879 | 150 |
| 477 | 3300025941 | Ga0207711_10121741 | Ga0207711_101217411 | 150 |
| 478 | 3300025941 | Ga0207711_10307864 | Ga0207711_103078642 | 150 |
| 479 | 3300025941 | Ga0207711_10474460 | Ga0207711_104744601 | 150 |
| 480 | 3300025942 | Ga0207689_10043632 | Ga0207689_100436324 | 150 |
| 481 | 3300025942 | Ga0207689_10178173 | Ga0207689_101781732 | 150 |
| 482 | 3300025942 | Ga0207689_10184318 | Ga0207689_101843182 | 150 |
| 483 | 3300025942 | Ga0207689_10310633 | Ga0207689_103106332 | 150 |
| 484 | 3300025942 | Ga0207689_11000290 | Ga0207689_110002901 | 150 |
| 485 | 3300025945 | Ga0207679_11274601 | Ga0207679_112746012 | 150 |
| 486 | 3300025945 | Ga0207679_11685404 | Ga0207679_116854041 | 150 |
| 487 | 3300025960 | Ga0207651_10017871 | Ga0207651_100178713 | 150 |
| 488 | 3300025960 | Ga0207651_10051418 | Ga0207651_100514183 | 150 |
| 489 | 3300025960 | Ga0207651_10055941 | Ga0207651_100559413 | 150 |
| 490 | 3300025960 | Ga0207651_10153823 | Ga0207651_101538233 | 150 |
| 491 | 3300025960 | Ga0207651_10218471 | Ga0207651_102184712 | 150 |
| 492 | 3300025960 | Ga0207651_10758327 | Ga0207651_107583272 | 150 |
| 493 | 3300025960 | Ga0207651_11344336 | Ga0207651_113443362 | 150 |
| 494 | 3300025961 | Ga0207712_10024976 | Ga0207712_100249765 | 150 |
| 495 | 3300025972 | Ga0207668_10001265 | Ga0207668_1000126510 | 150 |
| 496 | 3300025972 | Ga0207668_10457355 | Ga0207668_104573552 | 150 |
| 497 | 3300025981 | Ga0207640_10029852 | Ga0207640_100298524 | 150 |
| 498 | 3300025981 | Ga0207640_10086364 | Ga0207640_100863642 | 150 |
| 499 | 3300025981 | Ga0207640_10849834 | Ga0207640_108498342 | 150 |
| 500 | 3300025981 | Ga0207640_11077226 | Ga0207640_110772261 | 150 |
| 501 | 3300025986 | Ga0207658_10001317 | Ga0207658_100013174 | 150 |
| 502 | 3300025986 | Ga0207658_10001833 | Ga0207658_1000183315 | 150 |
| 503 | 3300025986 | Ga0207658_10233773 | Ga0207658_102337734 | 150 |
| 504 | 3300025986 | Ga0207658_10971784 | Ga0207658_109717842 | 150 |
| 505 | 3300026023 | Ga0207677_10042848 | Ga0207677_100428482 | 150 |
| 506 | 3300026023 | Ga0207677_10069882 | Ga0207677_100698823 | 150 |
| 507 | 3300026023 | Ga0207677_10072814 | Ga0207677_100728142 | 150 |
| 508 | 3300026023 | Ga0207677_10113911 | Ga0207677_101139112 | 150 |
| 509 | 3300026023 | Ga0207677_10316112 | Ga0207677_103161122 | 150 |
| 510 | 3300026023 | Ga0207677_10502920 | Ga0207677_105029202 | 150 |
| 511 | 3300026023 | Ga0207677_11191401 | Ga0207677_111914012 | 150 |
| 512 | 3300026035 | Ga0207703_10010751 | Ga0207703_100107513 | 150 |
| 513 | 3300026035 | Ga0207703_10772824 | Ga0207703_107728243 | 150 |
| 514 | 3300026041 | Ga0207639_10417404 | Ga0207639_104174042 | 150 |
| 515 | 3300026041 | Ga0207639_10451271 | Ga0207639_104512712 | 150 |
| 516 | 3300026067 | Ga0207678_10139706 | Ga0207678_101397063 | 150 |
| 517 | 3300026067 | Ga0207678_10164477 | Ga0207678_101644772 | 150 |
| 518 | 3300026067 | Ga0207678_10169289 | Ga0207678_101692893 | 150 |
| 519 | 3300026067 | Ga0207678_10189384 | Ga0207678_101893842 | 150 |
| 520 | 3300026067 | Ga0207678_11067837 | Ga0207678_110678372 | 150 |
| 521 | 3300026075 | Ga0207708_10004053 | Ga0207708_100040537 | 150 |
| 522 | 3300026078 | Ga0207702_10260894 | Ga0207702_102608942 | 150 |
| 523 | 3300026088 | Ga0207641_10004293 | Ga0207641_100042936 | 150 |
| 524 | 3300026088 | Ga0207641_10009403 | Ga0207641_100094033 | 150 |
| 525 | 3300026088 | Ga0207641_10044969 | Ga0207641_100449694 | 150 |
| 526 | 3300026088 | Ga0207641_10180189 | Ga0207641_101801892 | 150 |
| 527 | 3300026089 | Ga0207648_10002159 | Ga0207648_100021592 | 150 |
| 528 | 3300026089 | Ga0207648_10023940 | Ga0207648_100239402 | 150 |
| 529 | 3300026089 | Ga0207648_10035287 | Ga0207648_100352874 | 150 |
| 530 | 3300026089 | Ga0207648_10048342 | Ga0207648_100483422 | 150 |
| 531 | 3300026089 | Ga0207648_10156235 | Ga0207648_101562352 | 150 |
| 532 | 3300026089 | Ga0207648_10328313 | Ga0207648_103283132 | 150 |
| 533 | 3300026089 | Ga0207648_10429984 | Ga0207648_104299842 | 150 |
| 534 | 3300026095 | Ga0207676_10017462 | Ga0207676_100174626 | 150 |
| 535 | 3300026095 | Ga0207676_10032829 | Ga0207676_100328293 | 150 |
| 536 | 3300026095 | Ga0207676_10073828 | Ga0207676_100738284 | 150 |
| 537 | 3300026095 | Ga0207676_10429247 | Ga0207676_104292472 | 150 |
| 538 | 3300026095 | Ga0207676_10786405 | Ga0207676_107864052 | 150 |
| 539 | 3300026116 | Ga0207674_10029584 | Ga0207674_100295847 | 150 |
| 540 | 3300026116 | Ga0207674_11771012 | Ga0207674_117710121 | 150 |
| 541 | 3300026118 | Ga0207675_100003876 | Ga0207675_1000038762 | 150 |
| 542 | 3300026118 | Ga0207675_100290182 | Ga0207675_1002901822 | 150 |
| 543 | 3300026121 | Ga0207683_10045327 | Ga0207683_100453272 | 150 |
| 544 | 3300026121 | Ga0207683_10075715 | Ga0207683_100757152 | 150 |
| 545 | 3300026121 | Ga0207683_10076066 | Ga0207683_100760664 | 150 |
| 546 | 3300026121 | Ga0207683_10164948 | Ga0207683_101649483 | 150 |
| 547 | 3300026121 | Ga0207683_10274998 | Ga0207683_102749982 | 150 |
| 548 | 3300026142 | Ga0207698_10095185 | Ga0207698_100951852 | 150 |
| 549 | 3300026142 | Ga0207698_10154618 | Ga0207698_101546182 | 150 |
| 550 | 3300026142 | Ga0207698_10160940 | Ga0207698_101609403 | 150 |
| 551 | 3300026142 | Ga0207698_10197965 | Ga0207698_101979652 | 150 |
| 552 | 3300026142 | Ga0207698_10240499 | Ga0207698_102404992 | 150 |
| 553 | 3300027111 | Ga0209281_1000307 | Ga0209281_100030776 | 150 |
| 554 | 3300027866 | Ga0209813_10001234 | Ga0209813_100012342 | 150 |
| 555 | 3300027866 | Ga0209813_10089852 | Ga0209813_100898522 | 150 |
| 556 | 3300028379 | Ga0268266_10187818 | Ga0268266_101878182 | 150 |
| 557 | 3300028379 | Ga0268266_10197401 | Ga0268266_101974012 | 150 |
| 558 | 3300028379 | Ga0268266_10617744 | Ga0268266_106177442 | 150 |
| 559 | 3300028380 | Ga0268265_10006093 | Ga0268265_100060935 | 150 |
| 560 | 3300028380 | Ga0268265_11781884 | Ga0268265_117818842 | 150 |
| 561 | 3300028381 | Ga0268264_10001228 | Ga0268264_1000122820 | 150 |
| 562 | 3300028381 | Ga0268264_10426928 | Ga0268264_104269282 | 150 |
| 563 | 3300028786 | Ga0307517_10001591 | Ga0307517_1000159127 | 150 |
| 564 | 3300028786 | Ga0307517_10088858 | Ga0307517_100888582 | 150 |
| 565 | 3300028786 | Ga0307517_10138346 | Ga0307517_101383462 | 150 |
| 566 | 3300028794 | Ga0307515_10058252 | Ga0307515_100582522 | 150 |
| 567 | 3300028794 | Ga0307515_10092799 | Ga0307515_100927994 | 150 |
| 568 | 3300028794 | Ga0307515_10311869 | Ga0307515_103118692 | 150 |
| 569 | 3300028794 | Ga0307515_10543742 | Ga0307515_105437422 | 150 |
| 570 | 3300030521 | Ga0307511_10000025 | Ga0307511_1000002519 | 150 |
| 571 | 3300030522 | Ga0307512_10022579 | Ga0307512_100225794 | 150 |
| 572 | 3300030522 | Ga0307512_10135032 | Ga0307512_101350323 | 150 |
| 573 | 3300030522 | Ga0307512_10137616 | Ga0307512_101376162 | 150 |
| 574 | 3300031456 | Ga0307513_10016408 | Ga0307513_100164085 | 150 |
| 575 | 3300031456 | Ga0307513_10512147 | Ga0307513_105121472 | 150 |
| 576 | 3300031507 | Ga0307509_10002193 | Ga0307509_1000219317 | 150 |
| 577 | 3300031507 | Ga0307509_10004459 | Ga0307509_100044594 | 150 |
| 578 | 3300031507 | Ga0307509_10050222 | Ga0307509_100502224 | 150 |
| 579 | 3300031507 | Ga0307509_10117181 | Ga0307509_101171814 | 150 |
| 580 | 3300031507 | Ga0307509_10137647 | Ga0307509_101376472 | 150 |
| 581 | 3300031507 | Ga0307509_10159898 | Ga0307509_101598982 | 150 |
| 582 | 3300031507 | Ga0307509_10271111 | Ga0307509_102711112 | 150 |
| 583 | 3300031507 | Ga0307509_10276381 | Ga0307509_102763812 | 150 |
| 584 | 3300031507 | Ga0307509_10417158 | Ga0307509_104171581 | 150 |
| 585 | 3300031548 | Ga0307408_100075405 | Ga0307408_1000754052 | 150 |
| 586 | 3300031616 | Ga0307508_10002730 | Ga0307508_100027302 | 150 |
| 587 | 3300031616 | Ga0307508_10036341 | Ga0307508_100363412 | 150 |
| 588 | 3300031616 | Ga0307508_10129465 | Ga0307508_101294653 | 150 |
| 589 | 3300031616 | Ga0307508_10468456 | Ga0307508_104684561 | 150 |
| 590 | 3300031649 | Ga0307514_10158267 | Ga0307514_101582673 | 150 |
| 591 | 3300031649 | Ga0307514_10288771 | Ga0307514_102887712 | 150 |
| 592 | 3300031730 | Ga0307516_10047244 | Ga0307516_100472443 | 150 |
| 593 | 3300031730 | Ga0307516_10112068 | Ga0307516_101120683 | 150 |
| 594 | 3300031730 | Ga0307516_10382196 | Ga0307516_103821961 | 150 |
| 595 | 3300031730 | Ga0307516_10539309 | Ga0307516_105393091 | 150 |
| 596 | 3300031731 | Ga0307405_10012488 | Ga0307405_100124882 | 150 |
| 597 | 3300031731 | Ga0307405_10656239 | Ga0307405_106562392 | 150 |
| 598 | 3300031731 | Ga0307405_12071108 | Ga0307405_120711081 | 150 |
| 599 | 3300031824 | Ga0307413_10267905 | Ga0307413_102679052 | 150 |
| 600 | 3300031852 | Ga0307410_10116241 | Ga0307410_101162412 | 150 |
| 601 | 3300031852 | Ga0307410_10203428 | Ga0307410_102034282 | 150 |
| 602 | 3300031852 | Ga0307410_10953155 | Ga0307410_109531551 | 150 |
| 603 | 3300031901 | Ga0307406_10010094 | Ga0307406_100100944 | 150 |
| 604 | 3300031901 | Ga0307406_10029558 | Ga0307406_100295582 | 150 |
| 605 | 3300031901 | Ga0307406_10704297 | Ga0307406_107042972 | 150 |
| 606 | 3300031901 | Ga0307406_11041100 | Ga0307406_110411002 | 150 |
| 607 | 3300031903 | Ga0307407_10145162 | Ga0307407_101451622 | 150 |
| 608 | 3300031903 | Ga0307407_10219073 | Ga0307407_102190732 | 150 |
| 609 | 3300031995 | Ga0307409_100003397 | Ga0307409_10000339711 | 150 |
| 610 | 3300031995 | Ga0307409_100036260 | Ga0307409_1000362603 | 150 |
| 611 | 3300032002 | Ga0307416_100019017 | Ga0307416_1000190174 | 150 |
| 612 | 3300032002 | Ga0307416_100082465 | Ga0307416_1000824652 | 150 |
| 613 | 3300032004 | Ga0307414_10028282 | Ga0307414_100282822 | 150 |
| 614 | 3300032005 | Ga0307411_10009952 | Ga0307411_100099522 | 150 |
| 615 | 3300032005 | Ga0307411_10070966 | Ga0307411_100709663 | 150 |
| 616 | 3300032005 | Ga0307411_10075739 | Ga0307411_100757392 | 150 |
| 617 | 3300032126 | Ga0307415_100152118 | Ga0307415_1001521183 | 150 |
| 618 | 3300032126 | Ga0307415_100332020 | Ga0307415_1003320202 | 150 |
| 619 | 3300032126 | Ga0307415_100407844 | Ga0307415_1004078441 | 150 |
| 620 | 3300033179 | Ga0307507_10273752 | Ga0307507_102737521 | 150 |
| 621 | 3300033180 | Ga0307510_10000290 | Ga0307510_1000029029 | 150 |
| 622 | 3300033180 | Ga0307510_10106360 | Ga0307510_101063604 | 150 |
| 623 | 3300033180 | Ga0307510_10170824 | Ga0307510_101708242 | 150 |
| 624 | 3300035089 | Ga0373944_0049245 | Ga0373944_0049245_386_838 | 150 |
| 625 | 3300035114 | Ga0373939_0140269 | Ga0373939_0140269_22_474 | 150 |
| 626 | 3300035117 | Ga0373953_0050953 | Ga0373953_0050953_501_953 | 150 |
| 627 | 3300035119 | Ga0373956_0229057 | Ga0373956_0229057_164_616 | 150 |
| 628 | 3300035172 | Ga0373955_0039413 | Ga0373955_0039413_1836_2288 | 150 |
| 629 | 3300035410 | Ga0373924_0021284 | Ga0373924_0021284_891_1343 | 150 |
| 630 | 3300035691 | Ga0373931_0054081 | Ga0373931_0054081_329_781 | 150 |
| 631 | 3300035692 | Ga0373935_0110270 | Ga0373935_0110270_643_1095 | 150 |
| 632 | 3300035692 | Ga0373935_0613644 | Ga0373935_0613644_276_728 | 150 |
| 633 | 3300035695 | Ga0373927_0416894 | Ga0373927_0416894_321_773 | 150 |
| 634 | 3300035724 | Ga0373933_0227461 | Ga0373933_0227461_691_1143 | 150 |
| 635 | 3300035725 | Ga0373947_0741903 | Ga0373947_0741903_166_618 | 150 |
| 636 | 3300036401 | Ga0373937_0054971 | Ga0373937_0054971_447_899 | 150 |
| 637 | 3300037068 | Ga0373925_0350985 | Ga0373925_0350985_239_691 | 150 |
| 638 | 3300037068 | Ga0373925_0476659 | Ga0373925_0476659_78_530 | 150 |
| 639 | 3300037068 | Ga0373925_0827938 | Ga0373925_0827938_219_671 | 150 |
| 640 | 3300037471 | Ga0395905_0038456 | Ga0395905_0038456_443_895 | 150 |
| 641 | 3300041443 | Ga0451789_0060154 | Ga0451789_0060154_849_1301 | 150 |
| 642 | 3300041443 | Ga0451789_1057507 | Ga0451789_1057507_68_520 | 150 |
| 643 | 3300041459 | Ga0451800_1025911 | Ga0451800_1025911_301_753 | 150 |
| 644 | 3300041460 | Ga0451802_1266583 | Ga0451802_1266583_239_691 | 150 |
| 645 | 3300041491 | Ga0451833_0913082 | Ga0451833_0913082_274_729 | 150 |
| 646 | 3300041492 | Ga0451835_0713309 | Ga0451835_0713309_283_741 | 150 |
| 647 | 3300041501 | Ga0451845_0412393 | Ga0451845_0412393_170_622 | 150 |
| 648 | 3300041505 | Ga0451849_0639518 | Ga0451849_0639518_19_471 | 150 |
| 649 | 3300041507 | Ga0451851_0957251 | Ga0451851_0957251_245_697 | 150 |
| 650 | 3300041509 | Ga0451843_0227149 | Ga0451843_0227149_212_664 | 150 |
| 651 | 3300041512 | Ga0451853_1441017 | Ga0451853_1441017_1312_1776 | 150 |
| 652 | 3300041512 | Ga0451853_1589172 | Ga0451853_1589172_21_473 | 150 |
| 653 | 3300041512 | Ga0451853_3936543 | Ga0451853_3936543_140_592 | 150 |
| 654 | 3300042004 | Ga0439445_0100753 | Ga0439445_0100753_211_693 | 150 |
| 655 | 3300042007 | Ga0439449_0130857 | Ga0439449_0130857_300_782 | 150 |
| 656 | 3300044658 | Ga0466972_0184829 | Ga0466972_0184829_313_765 | 150 |
| 657 | 3300044712 | Ga0453684_0006446 | Ga0453684_0006446_9905_10357 | 150 |
| 658 | 3300044901 | Ga0466960_0304251 | Ga0466960_0304251_31_513 | 150 |
| 659 | 3300046454 | Ga0495592_0000758 | Ga0495592_0000758_2669_3121 | 150 |
| 660 | 3300046454 | Ga0495592_0003273 | Ga0495592_0003273_1081_1539 | 150 |
| 661 | 3300046459 | Ga0495629_0070696 | Ga0495629_0070696_549_1001 | 150 |
| 662 | 3300046459 | Ga0495629_0215131 | Ga0495629_0215131_294_746 | 150 |
| 663 | 3300046460 | Ga0495638_0148189 | Ga0495638_0148189_459_911 | 150 |
| 664 | 3300046461 | Ga0495641_0147210 | Ga0495641_0147210_509_961 | 150 |
| 665 | 3300046461 | Ga0495641_0214107 | Ga0495641_0214107_64_516 | 150 |
| 666 | 3300046462 | Ga0495651_0771196 | Ga0495651_0771196_89_541 | 150 |
| 667 | 3300046471 | Ga0495650_0140279 | Ga0495650_0140279_206_658 | 150 |
| 668 | 3300046472 | Ga0495580_0346800 | Ga0495580_0346800_176_628 | 150 |
| 669 | 3300046475 | Ga0495639_0403009 | Ga0495639_0403009_45_497 | 150 |
| 670 | 3300046491 | Ga0495584_0287920 | Ga0495584_0287920_214_666 | 150 |
| 671 | 3300046507 | Ga0495606_0114523 | Ga0495606_0114523_326_778 | 150 |
| 672 | 3300046507 | Ga0495606_0194859 | Ga0495606_0194859_47_499 | 150 |
| 673 | 3300046507 | Ga0495606_0404241 | Ga0495606_0404241_230_682 | 150 |
| 674 | 3300046511 | Ga0495608_0415652 | Ga0495608_0415652_206_658 | 150 |
| 675 | 3300046512 | Ga0495610_0015791 | Ga0495610_0015791_3337_3789 | 150 |
| 676 | 3300046513 | Ga0495616_0287770 | Ga0495616_0287770_227_679 | 150 |
| 677 | 3300046515 | Ga0495620_0051533 | Ga0495620_0051533_21_473 | 150 |
| 678 | 3300046515 | Ga0495620_0069357 | Ga0495620_0069357_224_676 | 150 |
| 679 | 3300046516 | Ga0495628_0000483 | Ga0495628_0000483_4852_5310 | 150 |
| 680 | 3300046516 | Ga0495628_0253578 | Ga0495628_0253578_41_493 | 150 |
| 681 | 3300046518 | Ga0495631_0187702 | Ga0495631_0187702_282_734 | 150 |
| 682 | 3300046519 | Ga0495632_0012805 | Ga0495632_0012805_2881_3333 | 150 |
| 683 | 3300046519 | Ga0495632_0113327 | Ga0495632_0113327_736_1188 | 150 |
| 684 | 3300046522 | Ga0495643_0086659 | Ga0495643_0086659_265_717 | 150 |
| 685 | 3300046522 | Ga0495643_0262358 | Ga0495643_0262358_220_672 | 150 |
| 686 | 3300046526 | Ga0495666_0070603 | Ga0495666_0070603_766_1218 | 150 |
| 687 | 3300046529 | Ga0495652_0002769 | Ga0495652_0002769_15698_16156 | 150 |
| 688 | 3300046537 | Ga0495598_0038578 | Ga0495598_0038578_314_766 | 150 |
| 689 | 3300046542 | Ga0495597_0029318 | Ga0495597_0029318_1423_1875 | 150 |
| 690 | 3300046543 | Ga0495645_0000423 | Ga0495645_0000423_10121_10579 | 150 |
| 691 | 3300046543 | Ga0495645_0011453 | Ga0495645_0011453_3802_4254 | 150 |
| 692 | 3300046543 | Ga0495645_0018798 | Ga0495645_0018798_3049_3501 | 150 |
| 693 | 3300046557 | Ga0495622_0274280 | Ga0495622_0274280_70_522 | 150 |
| 694 | 3300046616 | Ga0495668_0086724 | Ga0495668_0086724_752_1204 | 150 |
| 695 | 3300046648 | Ga0495611_0091661 | Ga0495611_0091661_34_486 | 150 |
| 696 | 3300046648 | Ga0495611_0454406 | Ga0495611_0454406_107_559 | 150 |
| 697 | 3300046660 | Ga0495625_0012637 | Ga0495625_0012637_4588_5058 | 150 |
| 698 | 3300046660 | Ga0495625_0366343 | Ga0495625_0366343_128_580 | 150 |
| 699 | 3300046660 | Ga0495625_0730573 | Ga0495625_0730573_32_484 | 150 |
| 700 | 3300046663 | Ga0495635_0406090 | Ga0495635_0406090_417_869 | 150 |
| 701 | 3300046678 | Ga0495599_0000508 | Ga0495599_0000508_3098_3556 | 150 |
| 702 | 3300046678 | Ga0495599_0665069 | Ga0495599_0665069_57_509 | 150 |
| 703 | 3300046680 | Ga0495646_0135299 | Ga0495646_0135299_493_945 | 150 |
| 704 | 3300046681 | Ga0495647_0216257 | Ga0495647_0216257_236_688 | 150 |
| 705 | 3300046683 | Ga0495658_0041005 | Ga0495658_0041005_888_1340 | 150 |
| 706 | 3300046683 | Ga0495658_0125129 | Ga0495658_0125129_209_661 | 150 |
| 707 | 3300046683 | Ga0495658_0361455 | Ga0495658_0361455_130_582 | 150 |
| 708 | 3300046689 | Ga0495613_0213878 | Ga0495613_0213878_725_1177 | 150 |
| 709 | 3300046690 | Ga0495624_0013479 | Ga0495624_0013479_3928_4380 | 150 |
| 710 | 3300046692 | Ga0495671_0067505 | Ga0495671_0067505_400_852 | 150 |
| 711 | 3300046692 | Ga0495671_0427783 | Ga0495671_0427783_67_519 | 150 |
| 712 | 3300046694 | Ga0495649_0003846 | Ga0495649_0003846_2671_3123 | 150 |
| 713 | 3300046694 | Ga0495649_0659494 | Ga0495649_0659494_16_468 | 150 |
| 714 | 3300046809 | Ga0495600_0129650 | Ga0495600_0129650_1068_1520 | 150 |
| 715 | 3300046810 | Ga0495660_0016913 | Ga0495660_0016913_438_890 | 150 |
| 716 | 3300047315 | Ga0495581_0485219 | Ga0495581_0485219_77_529 | 150 |
| 717 | 3300047319 | Ga0495674_0485452 | Ga0495674_0485452_196_648 | 150 |
| 718 | 3300047321 | Ga0495676_0059742 | Ga0495676_0059742_1483_1935 | 150 |
| 719 | 3300047443 | Ga0495687_002581 | Ga0495687_002581_3698_4150 | 150 |
| 720 | 3300047443 | Ga0495687_002812 | Ga0495687_002812_2962_3414 | 150 |
| 721 | 3300047443 | Ga0495687_003084 | Ga0495687_003084_9075_9527 | 150 |
| 722 | 3300047444 | Ga0495675_0657236 | Ga0495675_0657236_83_535 | 150 |
| 723 | 3300047445 | Ga0495677_0200358 | Ga0495677_0200358_303_755 | 150 |
| 724 | 3300047469 | Ga0495673_0054349 | Ga0495673_0054349_11_463 | 150 |
| 725 | 3300047470 | Ga0495681_0137244 | Ga0495681_0137244_384_872 | 150 |
| 726 | 3300047471 | Ga0495684_0181812 | Ga0495684_0181812_384_836 | 150 |
| 727 | 3300047472 | Ga0495686_0002064 | Ga0495686_0002064_14200_14652 | 150 |
| 728 | 3300047472 | Ga0495686_0082946 | Ga0495686_0082946_112_564 | 150 |
| 729 | 3300047673 | Ga0495593_0006629 | Ga0495593_0006629_3409_3861 | 150 |
| 730 | 3300048089 | Ga0495614_0222708 | Ga0495614_0222708_222_674 | 150 |
| 731 | 3300048091 | Ga0495626_0077277 | Ga0495626_0077277_190_642 | 150 |
| 732 | 3300048909 | Ga0496106_0112626 | Ga0496106_0112626_1622_2074 | 150 |
| 733 | 3300048911 | Ga0496108_0050302 | Ga0496108_0050302_849_1301 | 150 |
| 734 | 3300048911 | Ga0496108_0607566 | Ga0496108_0607566_127_579 | 150 |
| 735 | 3300048912 | Ga0496109_0084287 | Ga0496109_0084287_734_1186 | 150 |
| 736 | 3300048913 | Ga0496110_0298147 | Ga0496110_0298147_560_1012 | 150 |
| 737 | 3300048914 | Ga0496111_0539514 | Ga0496111_0539514_347_799 | 150 |
| 738 | 3300048916 | Ga0496113_0130349 | Ga0496113_0130349_766_1218 | 150 |
| 739 | 3300048916 | Ga0496113_0361350 | Ga0496113_0361350_208_699 | 150 |
| 740 | 3300048917 | Ga0496114_0000832 | Ga0496114_0000832_15074_15526 | 150 |
| 741 | 3300048917 | Ga0496114_0040638 | Ga0496114_0040638_299_751 | 150 |
| 742 | 3300049460 | Ga0495682_0131467 | Ga0495682_0131467_104_556 | 150 |
| 743 | 3300049581 | Ga0501047_0398470 | Ga0501047_0398470_606_1058 | 150 |
| 744 | 3300049583 | Ga0501067_0538504 | Ga0501067_0538504_44_496 | 150 |
| 745 | 3300049679 | Ga0501249_109039 | Ga0501249_109039_190_642 | 150 |
| 746 | 3300049688 | Ga0501259_175117 | Ga0501259_175117_29_481 | 150 |
| 747 | 3300050489 | nmdc:mga03683_20325_c1 | nmdc:mga03683_20325_c1_153_605 | 150 |
| 748 | 3300050489 | nmdc:mga03683_300970_c1 | nmdc:mga03683_300970_c1_290_742 | 150 |
| 749 | 3300050490 | nmdc:mga03n38_4787_c1 | nmdc:mga03n38_4787_c1_2532_2984 | 150 |
| 750 | 3300050490 | nmdc:mga03n38_58059_c1 | nmdc:mga03n38_58059_c1_943_1395 | 150 |
| 751 | 3300050491 | nmdc:mga00v17_55469_c1 | nmdc:mga00v17_55469_c1_1665_2117 | 150 |
| 752 | 3300050493 | nmdc:mga0k408_20661_c1 | nmdc:mga0k408_20661_c1_3069_3521 | 150 |
| 753 | 3300050493 | nmdc:mga0k408_2209_c1 | nmdc:mga0k408_2209_c1_180_632 | 150 |
| 754 | 3300050493 | nmdc:mga0k408_37370_c1 | nmdc:mga0k408_37370_c1_786_1238 | 150 |
| 755 | 3300050493 | nmdc:mga0k408_447946_c1 | nmdc:mga0k408_447946_c1_26_478 | 150 |
| 756 | 3300050493 | nmdc:mga0k408_496228_c1 | nmdc:mga0k408_496228_c1_147_599 | 150 |
| 757 | 3300050493 | nmdc:mga0k408_67699_c1 | nmdc:mga0k408_67699_c1_1067_1519 | 150 |
| 758 | 3300050493 | nmdc:mga0k408_87493_c1 | nmdc:mga0k408_87493_c1_720_1172 | 150 |
| 759 | 3300050493 | nmdc:mga0k408_985_c1 | nmdc:mga0k408_985_c1_10094_10546 | 150 |
| 760 | 3300050494 | nmdc:mga06z11_175711_c1 | nmdc:mga06z11_175711_c1_131_583 | 150 |
| 761 | 3300050494 | nmdc:mga06z11_17881_c1 | nmdc:mga06z11_17881_c1_501_953 | 150 |
| 762 | 3300050494 | nmdc:mga06z11_57994_c1 | nmdc:mga06z11_57994_c1_16_468 | 150 |
| 763 | 3300050494 | nmdc:mga06z11_6814_c1 | nmdc:mga06z11_6814_c1_3026_3478 | 150 |
| 764 | 3300050495 | nmdc:mga04h51_30995_c1 | nmdc:mga04h51_30995_c1_151_603 | 150 |
| 765 | 3300050495 | nmdc:mga04h51_6047_c1 | nmdc:mga04h51_6047_c1_1586_2038 | 150 |
| 766 | 3300050496 | nmdc:mga07m45_106891_c1 | nmdc:mga07m45_106891_c1_288_740 | 150 |
| 767 | 3300050496 | nmdc:mga07m45_107520_c1 | nmdc:mga07m45_107520_c1_467_919 | 150 |
| 768 | 3300050496 | nmdc:mga07m45_11967_c1 | nmdc:mga07m45_11967_c1_1828_2301 | 150 |
| 769 | 3300050496 | nmdc:mga07m45_17318_c1 | nmdc:mga07m45_17318_c1_3321_3773 | 150 |
| 770 | 3300050496 | nmdc:mga07m45_1848_c1 | nmdc:mga07m45_1848_c1_7914_8366 | 150 |
| 771 | 3300050496 | nmdc:mga07m45_50505_c1 | nmdc:mga07m45_50505_c1_786_1238 | 150 |
| 772 | 3300050496 | nmdc:mga07m45_59404_c1 | nmdc:mga07m45_59404_c1_1040_1492 | 150 |
| 773 | 3300050507 | nmdc:mga05p37_2001070_c1 | nmdc:mga05p37_2001070_c1_68_520 | 150 |
| 774 | 3300050508 | nmdc:mga09592_725890_c1 | nmdc:mga09592_725890_c1_322_774 | 150 |
| 775 | 3300050511 | nmdc:mga08y16_274643_c1 | nmdc:mga08y16_274643_c1_581_1033 | 150 |
| 776 | 3300050511 | nmdc:mga08y16_386921_c1 | nmdc:mga08y16_386921_c1_584_1036 | 150 |
| 777 | 3300050516 | nmdc:mga0sz30_210323_c1 | nmdc:mga0sz30_210323_c1_125_577 | 150 |
| 778 | 3300050516 | nmdc:mga0sz30_53753_c1 | nmdc:mga0sz30_53753_c1_1169_1621 | 150 |
| 779 | 3300053077 | Ga0495601_0031890 | Ga0495601_0031890_1149_1607 | 150 |
| 780 | 3300053077 | Ga0495601_0122040 | Ga0495601_0122040_1194_1646 | 150 |
| 781 | 3300053084 | Ga0495595_0086143 | Ga0495595_0086143_969_1421 | 150 |
| 782 | 3300053085 | Ga0495619_0290279 | Ga0495619_0290279_94_546 | 150 |
| 783 | 3300053088 | Ga0500644_0036236 | Ga0500644_0036236_282_734 | 150 |
| 784 | 3300053090 | Ga0500646_0150626 | Ga0500646_0150626_66_518 | 150 |
| 785 | 3300053092 | Ga0500583_0071453 | Ga0500583_0071453_1090_1542 | 150 |
| 786 | 3300053098 | Ga0500650_0164861 | Ga0500650_0164861_301_753 | 150 |
| 787 | 3300053104 | Ga0500556_0000486 | Ga0500556_0000486_1246_1698 | 150 |
| 788 | 3300053118 | Ga0500594_0040029 | Ga0500594_0040029_666_1118 | 150 |
| 789 | 3300053121 | Ga0500607_139792 | Ga0500607_139792_271_723 | 150 |
| 790 | 3300053125 | Ga0500618_115570 | Ga0500618_115570_66_524 | 150 |
| 791 | 3300053133 | Ga0500655_021221 | Ga0500655_021221_42_500 | 150 |
| 792 | 3300053136 | Ga0500559_0000126 | Ga0500559_0000126_54977_55429 | 150 |
| 793 | 3300053136 | Ga0500559_0563093 | Ga0500559_0563093_35_487 | 150 |
| 794 | 3300053154 | Ga0500619_108190 | Ga0500619_108190_441_893 | 150 |
| 795 | 3300053156 | Ga0500622_0005314 | Ga0500622_0005314_3946_4398 | 150 |
| 796 | 3300053158 | Ga0500627_0392127 | Ga0500627_0392127_88_540 | 150 |
| 797 | 3300053730 | Ga0500645_008546 | Ga0500645_008546_1407_1859 | 150 |
| 798 | 3300053739 | Ga0500587_000588 | Ga0500587_000588_74_526 | 150 |
| 799 | 3300053739 | Ga0500587_009217 | Ga0500587_009217_495_947 | 150 |
| 800 | iso_pu_bacteria | 2643221576 | 2643892645 | 150 |
| 801 | iso_pu_bacteria | 2643221590 | 2643962094 | 150 |
| 802 | 3300005327 | Ga0070658_10314389 | Ga0070658_103143892 | 151 |
| 803 | 3300005336 | Ga0070680_100091888 | Ga0070680_1000918882 | 151 |
| 804 | 3300005338 | Ga0068868_100106500 | Ga0068868_1001065004 | 151 |
| 805 | 3300005339 | Ga0070660_100047371 | Ga0070660_1000473713 | 151 |
| 806 | 3300005341 | Ga0070691_10117972 | Ga0070691_101179722 | 151 |
| 807 | 3300005458 | Ga0070681_10273319 | Ga0070681_102733193 | 151 |
| 808 | 3300005530 | Ga0070679_100026370 | Ga0070679_1000263703 | 151 |
| 809 | 3300006038 | Ga0075365_10001258 | Ga0075365_100012586 | 151 |
| 810 | 3300006038 | Ga0075365_10013219 | Ga0075365_100132196 | 151 |
| 811 | 3300006051 | Ga0075364_10004205 | Ga0075364_100042058 | 151 |
| 812 | 3300006177 | Ga0075362_10017212 | Ga0075362_100172122 | 151 |
| 813 | 3300006178 | Ga0075367_10015646 | Ga0075367_100156462 | 151 |
| 814 | 3300006186 | Ga0075369_10066707 | Ga0075369_100667072 | 151 |
| 815 | 3300006195 | Ga0075366_10510727 | Ga0075366_105107271 | 151 |
| 816 | 3300009093 | Ga0105240_10156411 | Ga0105240_101564112 | 151 |
| 817 | 3300009147 | Ga0114129_10360430 | Ga0114129_103604301 | 151 |
| 818 | 3300009551 | Ga0105238_10063203 | Ga0105238_100632034 | 151 |
| 819 | 3300014969 | Ga0157376_10016653 | Ga0157376_100166532 | 151 |
| 820 | 3300025942 | Ga0207689_10241921 | Ga0207689_102419212 | 151 |
| 821 | 3300026023 | Ga0207677_10039410 | Ga0207677_100394104 | 151 |
| 822 | 3300037471 | Ga0395905_1468561 | Ga0395905_1468561_112_567 | 151 |
| 823 | 3300050489 | nmdc:mga03683_6668_c1 | nmdc:mga03683_6668_c1_760_1215 | 151 |
| 824 | 3300050491 | nmdc:mga00v17_4622_c1 | nmdc:mga00v17_4622_c1_3330_3785 | 151 |
| 825 | 3300050492 | nmdc:mga0yw44_11763_c1 | nmdc:mga0yw44_11763_c1_3939_4394 | 151 |
| 826 | 3300050492 | nmdc:mga0yw44_29766_c1 | nmdc:mga0yw44_29766_c1_2499_2954 | 151 |
| 827 | 3300050494 | nmdc:mga06z11_284694_c1 | nmdc:mga06z11_284694_c1_493_948 | 151 |
| 828 | 3300050507 | nmdc:mga05p37_534475_c1 | nmdc:mga05p37_534475_c1_677_1132 | 151 |
| 829 | 3300050516 | nmdc:mga0sz30_116965_c1 | nmdc:mga0sz30_116965_c1_289_744 | 151 |
| 830 | 3300003320 | rootH2_10037517 | rootH2_100375172 | 152 |
| 831 | 3300003659 | JGI25404J52841_10016749 | JGI25404J52841_100167492 | 152 |
| 832 | 3300005353 | Ga0070669_100176804 | Ga0070669_1001768042 | 152 |
| 833 | 3300005354 | Ga0070675_100289345 | Ga0070675_1002893452 | 152 |
| 834 | 3300005455 | Ga0070663_100037279 | Ga0070663_1000372793 | 152 |
| 835 | 3300005457 | Ga0070662_100833994 | Ga0070662_1008339941 | 152 |
| 836 | 3300005535 | Ga0070684_101140537 | Ga0070684_1011405372 | 152 |
| 837 | 3300005539 | Ga0068853_100108400 | Ga0068853_1001084002 | 152 |
| 838 | 3300005543 | Ga0070672_100397711 | Ga0070672_1003977112 | 152 |
| 839 | 3300005543 | Ga0070672_100665794 | Ga0070672_1006657942 | 152 |
| 840 | 3300005563 | Ga0068855_100729089 | Ga0068855_1007290892 | 152 |
| 841 | 3300005983 | Ga0081540_1000011 | Ga0081540_100001170 | 152 |
| 842 | 3300005983 | Ga0081540_1019580 | Ga0081540_10195802 | 152 |
| 843 | 3300006038 | Ga0075365_10311037 | Ga0075365_103110372 | 152 |
| 844 | 3300006048 | Ga0075363_100370142 | Ga0075363_1003701422 | 152 |
| 845 | 3300006178 | Ga0075367_10186438 | Ga0075367_101864382 | 152 |
| 846 | 3300006195 | Ga0075366_10140627 | Ga0075366_101406272 | 152 |
| 847 | 3300006844 | Ga0075428_100041134 | Ga0075428_1000411341 | 152 |
| 848 | 3300006844 | Ga0075428_101223213 | Ga0075428_1012232132 | 152 |
| 849 | 3300006846 | Ga0075430_100146389 | Ga0075430_1001463892 | 152 |
| 850 | 3300006846 | Ga0075430_100317471 | Ga0075430_1003174712 | 152 |
| 851 | 3300006847 | Ga0075431_100016231 | Ga0075431_1000162317 | 152 |
| 852 | 3300006847 | Ga0075431_100086702 | Ga0075431_1000867024 | 152 |
| 853 | 3300006847 | Ga0075431_100274045 | Ga0075431_1002740453 | 152 |
| 854 | 3300006880 | Ga0075429_100047414 | Ga0075429_1000474142 | 152 |
| 855 | 3300006880 | Ga0075429_100511611 | Ga0075429_1005116111 | 152 |
| 856 | 3300006880 | Ga0075429_100693419 | Ga0075429_1006934192 | 152 |
| 857 | 3300006914 | Ga0075436_101000948 | Ga0075436_1010009482 | 152 |
| 858 | 3300007788 | Ga0099795_10011399 | Ga0099795_100113992 | 152 |
| 859 | 3300009094 | Ga0111539_10022520 | Ga0111539_100225206 | 152 |
| 860 | 3300009094 | Ga0111539_10030368 | Ga0111539_100303683 | 152 |
| 861 | 3300009094 | Ga0111539_11104195 | Ga0111539_111041952 | 152 |
| 862 | 3300009101 | Ga0105247_10287505 | Ga0105247_102875052 | 152 |
| 863 | 3300009147 | Ga0114129_10025035 | Ga0114129_100250352 | 152 |
| 864 | 3300009545 | Ga0105237_10015172 | Ga0105237_1001517211 | 152 |
| 865 | 3300009551 | Ga0105238_10005340 | Ga0105238_1000534012 | 152 |
| 866 | 3300009553 | Ga0105249_10393485 | Ga0105249_103934852 | 152 |
| 867 | 3300009553 | Ga0105249_11885151 | Ga0105249_118851512 | 152 |
| 868 | 3300010375 | Ga0105239_10079663 | Ga0105239_100796632 | 152 |
| 869 | 3300013296 | Ga0157374_10003619 | Ga0157374_100036192 | 152 |
| 870 | 3300013306 | Ga0163162_10346750 | Ga0163162_103467503 | 152 |
| 871 | 3300013306 | Ga0163162_11105783 | Ga0163162_111057831 | 152 |
| 872 | 3300013306 | Ga0163162_11152829 | Ga0163162_111528291 | 152 |
| 873 | 3300014326 | Ga0157380_10044486 | Ga0157380_100444862 | 152 |
| 874 | 3300021388 | Ga0213875_10136673 | Ga0213875_101366732 | 152 |
| 875 | 3300025914 | Ga0207671_10026777 | Ga0207671_100267772 | 152 |
| 876 | 3300025924 | Ga0207694_10067262 | Ga0207694_100672622 | 152 |
| 877 | 3300025926 | Ga0207659_10116718 | Ga0207659_101167182 | 152 |
| 878 | 3300025940 | Ga0207691_10654788 | Ga0207691_106547882 | 152 |
| 879 | 3300025949 | Ga0207667_10126181 | Ga0207667_101261812 | 152 |
| 880 | 3300025949 | Ga0207667_10589870 | Ga0207667_105898702 | 152 |
| 881 | 3300025972 | Ga0207668_10177563 | Ga0207668_101775632 | 152 |
| 882 | 3300026041 | Ga0207639_10611751 | Ga0207639_106117511 | 152 |
| 883 | 3300026067 | Ga0207678_10041283 | Ga0207678_100412834 | 152 |
| 884 | 3300026089 | Ga0207648_10389766 | Ga0207648_103897662 | 152 |
| 885 | 3300027907 | Ga0207428_10018366 | Ga0207428_100183664 | 152 |
| 886 | 3300031344 | Ga0265316_10286091 | Ga0265316_102860911 | 152 |
| 887 | 3300031731 | Ga0307405_11600751 | Ga0307405_116007511 | 152 |
| 888 | 3300031995 | Ga0307409_101023067 | Ga0307409_1010230672 | 152 |
| 889 | 3300032002 | Ga0307416_101101464 | Ga0307416_1011014641 | 152 |
| 890 | 3300035083 | Ga0373926_0003365 | Ga0373926_0003365_4111_4578 | 152 |
| 891 | 3300035086 | Ga0373934_0072616 | Ga0373934_0072616_421_879 | 152 |
| 892 | 3300035089 | Ga0373944_0201187 | Ga0373944_0201187_167_625 | 152 |
| 893 | 3300035111 | Ga0373923_0008893 | Ga0373923_0008893_676_1134 | 152 |
| 894 | 3300035117 | Ga0373953_0000591 | Ga0373953_0000591_1147_1605 | 152 |
| 895 | 3300035119 | Ga0373956_0006342 | Ga0373956_0006342_2785_3243 | 152 |
| 896 | 3300035120 | Ga0373957_0015885 | Ga0373957_0015885_931_1389 | 152 |
| 897 | 3300035724 | Ga0373933_0022323 | Ga0373933_0022323_2727_3185 | 152 |
| 898 | 3300037312 | Ga0395899_0272876 | Ga0395899_0272876_388_846 | 152 |
| 899 | 3300041509 | Ga0451843_0336977 | Ga0451843_0336977_785_1249 | 152 |
| 900 | 3300046454 | Ga0495592_0000815 | Ga0495592_0000815_4348_4806 | 152 |
| 901 | 3300046459 | Ga0495629_0001921 | Ga0495629_0001921_12980_13438 | 152 |
| 902 | 3300046459 | Ga0495629_0032728 | Ga0495629_0032728_2210_2677 | 152 |
| 903 | 3300046462 | Ga0495651_0016519 | Ga0495651_0016519_4742_5200 | 152 |
| 904 | 3300046462 | Ga0495651_0091103 | Ga0495651_0091103_1249_1707 | 152 |
| 905 | 3300046491 | Ga0495584_0339190 | Ga0495584_0339190_104_562 | 152 |
| 906 | 3300046511 | Ga0495608_0031249 | Ga0495608_0031249_1191_1649 | 152 |
| 907 | 3300046514 | Ga0495618_0034797 | Ga0495618_0034797_2095_2553 | 152 |
| 908 | 3300046516 | Ga0495628_0017699 | Ga0495628_0017699_4950_5408 | 152 |
| 909 | 3300046533 | Ga0495640_0001223 | Ga0495640_0001223_16967_17425 | 152 |
| 910 | 3300046536 | Ga0495587_0010373 | Ga0495587_0010373_2824_3282 | 152 |
| 911 | 3300046559 | Ga0495667_0021548 | Ga0495667_0021548_2652_3110 | 152 |
| 912 | 3300046642 | Ga0495634_0006090 | Ga0495634_0006090_7614_8072 | 152 |
| 913 | 3300046675 | Ga0495657_0069620 | Ga0495657_0069620_1484_1942 | 152 |
| 914 | 3300046678 | Ga0495599_0015764 | Ga0495599_0015764_1368_1826 | 152 |
| 915 | 3300046680 | Ga0495646_0145124 | Ga0495646_0145124_807_1265 | 152 |
| 916 | 3300047322 | Ga0495680_0075594 | Ga0495680_0075594_390_848 | 152 |
| 917 | 3300047471 | Ga0495684_0005299 | Ga0495684_0005299_8084_8542 | 152 |
| 918 | 3300047673 | Ga0495593_0024096 | Ga0495593_0024096_804_1262 | 152 |
| 919 | 3300048918 | Ga0496115_0108657 | Ga0496115_0108657_840_1298 | 152 |
| 920 | 3300048920 | Ga0496117_0047473 | Ga0496117_0047473_1868_2347 | 152 |
| 921 | 3300048924 | Ga0496121_0021499 | Ga0496121_0021499_2034_2492 | 152 |
| 922 | 3300048927 | Ga0496124_0126090 | Ga0496124_0126090_604_1062 | 152 |
| 923 | 3300048928 | Ga0496125_0542280 | Ga0496125_0542280_83_541 | 152 |
| 924 | 3300048929 | Ga0496126_0040934 | Ga0496126_0040934_1889_2347 | 152 |
| 925 | 3300049460 | Ga0495682_0072566 | Ga0495682_0072566_288_746 | 152 |
| 926 | 3300050489 | nmdc:mga03683_511647_c1 | nmdc:mga03683_511647_c1_114_572 | 152 |
| 927 | 3300050492 | nmdc:mga0yw44_44241_c1 | nmdc:mga0yw44_44241_c1_1782_2240 | 152 |
| 928 | 3300050493 | nmdc:mga0k408_83737_c1 | nmdc:mga0k408_83737_c1_739_1197 | 152 |
| 929 | 3300050507 | nmdc:mga05p37_3939_c1 | nmdc:mga05p37_3939_c1_10770_11228 | 152 |
| 930 | 3300050508 | nmdc:mga09592_28393_c1 | nmdc:mga09592_28393_c1_2360_2818 | 152 |
| 931 | 3300050508 | nmdc:mga09592_496959_c1 | nmdc:mga09592_496959_c1_438_896 | 152 |
| 932 | 3300050509 | nmdc:mga0qj67_104673_c1 | nmdc:mga0qj67_104673_c1_214_672 | 152 |
| 933 | 3300050509 | nmdc:mga0qj67_144969_c1 | nmdc:mga0qj67_144969_c1_1112_1570 | 152 |
| 934 | 3300050510 | nmdc:mga06r32_4044_c1 | nmdc:mga06r32_4044_c1_428_886 | 152 |
| 935 | 3300050510 | nmdc:mga06r32_71366_c1 | nmdc:mga06r32_71366_c1_630_1088 | 152 |
| 936 | 3300050510 | nmdc:mga06r32_76546_c1 | nmdc:mga06r32_76546_c1_2439_2897 | 152 |
| 937 | 3300050511 | nmdc:mga08y16_22844_c1 | nmdc:mga08y16_22844_c1_19_477 | 152 |
| 938 | 3300053077 | Ga0495601_0195595 | Ga0495601_0195595_152_610 | 152 |
| 939 | 3300053078 | Ga0495612_0008508 | Ga0495612_0008508_709_1167 | 152 |
| 940 | 3300053085 | Ga0495619_0011988 | Ga0495619_0011988_1307_1765 | 152 |
| 941 | 3300053092 | Ga0500583_0200296 | Ga0500583_0200296_59_517 | 152 |
| 942 | 3300053119 | Ga0500595_001646 | Ga0500595_001646_7900_8358 | 152 |
| 943 | 3300053119 | Ga0500595_195075 | Ga0500595_195075_59_517 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c2i-assembly1.cif.gz_B | structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis | 0.9436 | 2 | 152 |
| 2c2i-assembly1.cif.gz_B | structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis | 0.9375 | 2 | 152 |
| 1iq6-assembly1.cif.gz_A | (r)-hydratase from a. caviae involved in pha biosynthesis | 0.837 | 14 | 148 |
| 4ffu-assembly2.cif.gz_K | crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 | 0.8195 | 19 | 152 |
| 2bhm-assembly2.cif.gz_D | crystal structure of virb8 from brucella suis | 0.8025 | 107 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c2iB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9425 | 2 | 152 | 3.10.129.10 |
| af_B0G197_51_201_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9417 | 1 | 151 | 3.10.129.10 |
| 2c2iB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9364 | 2 | 152 | 3.10.129.10 |
| af_B0G197_51_201_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9357 | 1 | 151 | 3.10.129.10 |
| 1iq6A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.837 | 14 | 148 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6RXT6-F1-model_v4 | Putative enoyl-CoA hydratase 1 (EC 4.2.1.17) | 0.9839 | 1 | 152 |
GO:0004300
|
| AF-A0A2D9XR98-F1-model_v4 | deleted | 0.9791 | 1 | 152 |
|
| AF-A9BSV1-F1-model_v4 | MaoC domain protein dehydratase | 0.9788 | 1 | 151 |
|
| AF-A0A6N7A1J6-F1-model_v4 | deleted | 0.9784 | 2 | 151 |
|
| AF-A0A1B3PGS9-F1-model_v4 | Putative enoyl-CoA hydratase 1 | 0.9776 | 1 | 151 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar