F486368

General Info

Members Datasets Scaffolds Average Seq Length
942 321 905 348

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0004429|Ga0495650_0004429_3548_4762
Length 404
Sequence MLPVIIATELLQGYFLILYRSLVHYKKNAHQRGASGNYFIMRADPLNRLTMTSSPSRFGAISEAAVDLAARNLRDTLAIAIEHRAPQAALIVYDTQTDLNRALTEAYRRAAPDAQFIDFDATTPELILATFERMQAGDLVVLVQSTSFRMDAYRIRIELFKRGLKVIEHVHLSRMPDEQGLHYIDSLAYDPAYYRGVGHALKARIDSAQRGVVDSGDGAQLVFASPFESAKLNIGDYSGMNNIGGQFPLGEVFTEARDLEAVSGRARIFVFGDTKFLVNRPETPITIIVDKGRVVGTENSTPEFENMLSIIREHEGEVWLRELGFGMNRAFSRERMVDDIGTYERMCGIHLSLGAKHGVYTKPQLKRKDARYHIDVFAVTEGVYLDEQRVYRNGAWEIDNLPRI

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
5 2643221556 Massilia sp. Root1485 Isolate Unclassified
6 2643221638 Duganella sp. Root336D2 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541297 Duganella sp. GV083 Isolate Unclassified
11 2738541300 Massilia sp. GV016 Isolate Unclassified
12 2738541357 Duganella sp. GV053 Isolate Unclassified
13 2738543003 Duganella sp. GV066 Isolate Unclassified
14 2738543018 Massilia sp. GV045 Isolate Unclassified
15 2738543026 Duganella sp. GV089 Isolate Unclassified
16 2738543029 Duganella sp. GV039 Isolate Unclassified
17 2738543030 Massilia sp. GV097 Isolate Unclassified
18 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
19 2818991436 Collimonas arenae 515 Isolate Unclassified
20 2821131069 Duganella sp. 1224 Isolate Unclassified
21 2842711865 Duganella sp. R-73148 Isolate Unclassified
22 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
23 2857553236 Duganella sp. R-74557 Isolate Unclassified
24 2857558681 Duganella sp. R-74565 Isolate Unclassified
25 2857564685 Duganella sp. R-74599 Isolate Unclassified
26 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
27 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
28 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
29 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
30 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
31 2904424332 Duganella sp. 1411 Isolate Rhizosphere
32 2919476304 Duganella sp. 3397 Isolate Unclassified
33 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
34 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
35 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
36 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
37 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
38 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
39 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
40 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
50 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
51 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
52 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
53 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
63 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
99 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
176 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
297 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
301 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
302 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
312 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
316 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
317 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
318 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
319 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 0
Isolates 3.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.53
Nodule 0.42
Rhizoplane 2.87
Rhizosphere 75.16
Stem 0
Stem Tuber 0
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000076 3300002704 Bacteria 59158
2 JGI25155J39150_1000101 3300002704 Bacteria 45881
3 JGI25156J39149_1000032 3300002705 Bacteria 118609
4 JGI25162J39368_1000025 3300002737 Bacteria 228879
5 JGI25162J39368_1000263 3300002737 Bacteria 50433
6 JGI25162J39368_1004561 3300002737 Bacteria 3153
7 JGI25154J39366_1000095 3300002738 Bacteria 79187
8 JGI25154J39366_1000123 3300002738 Bacteria 61878
9 JGI25158J39367_1000321 3300002739 Bacteria 10616
10 JGI25158J39367_1000929 3300002739 Bacteria 5435
11 JGI25157J39369_1000388 3300002741 Bacteria 30373
12 JGI25152J39213_1000031 3300002773 Bacteria 96812
13 JGI25152J39213_1008059 3300002773 Bacteria 2654
14 JGI25150J39212_1000470 3300002774 Bacteria 17597
15 JGI25150J39212_1001102 3300002774 Bacteria 8144
16 JGI25159J45721_1000552 3300002987 Bacteria 16976
17 JGI25165J46597_1000054 3300003214 Bacteria 228891
18 rootL2_10010806 3300003322 Bacteria 12609
19 rootL2_10022331 3300003322 Bacteria 8575
20 rootL2_10120913 3300003322 Bacteria 3506
21 rootH1_10216592 3300003323 Bacteria 11634
22 JGI25160J50197_1001448 3300003354 Bacteria 11859
23 JGI25161J50226_1000465 3300003374 Bacteria 18592
24 JGI25161J50226_1002791 3300003374 Bacteria 4297
25 Ga0055538_1000026 3300003751 Bacteria 228891
26 Ga0055539_1000033 3300003752 Bacteria 228891
27 Ga0055533_1000044 3300003756 Bacteria 228891
28 Ga0055532_1000083 3300003758 Bacteria 118609
29 Ga0055525_1000009 3300003759 Bacteria 596899
30 Ga0055525_1000052 3300003759 Bacteria 228891
31 Ga0055529_1000545 3300003763 Bacteria 32103
32 Ga0055526_1000020 3300003771 Bacteria 188230
33 Ga0055526_1000031 3300003771 Bacteria 143136
34 Ga0055526_1000908 3300003771 Bacteria 22003
35 Ga0055526_1004472 3300003771 Bacteria 8383
36 Ga0055537_1000071 3300003773 Bacteria 73402
37 Ga0055537_1004385 3300003773 Bacteria 4044
38 Ga0055537_1007058 3300003773 Bacteria 2762
39 Ga0055537_1008471 3300003773 Bacteria 2371
40 Ga0055524_1000015 3300003775 Bacteria 246493
41 Ga0055524_1000560 3300003775 Bacteria 27934
42 Ga0055524_1001529 3300003775 Bacteria 13077
43 Ga0055524_1005186 3300003775 Bacteria 5868
44 Ga0055534_1000452 3300003784 Bacteria 23968
45 Ga0055534_1000864 3300003784 Bacteria 13883
46 Ga0055534_1004846 3300003784 Bacteria 3766
47 Ga0055528_1000537 3300003790 Bacteria 29135
48 Ga0055528_1017213 3300003790 Bacteria 2516
49 Ga0055530_10001313 3300003791 Bacteria 18696
50 Ga0055530_10001696 3300003791 Bacteria 15599
51 Ga0055530_10004892 3300003791 Bacteria 6661
52 Ga0055531_10003437 3300003794 Bacteria 10103
53 Ga0055541_1000069 3300003841 Bacteria 94648
54 Ga0055543_1000222 3300004625 Bacteria 45583
55 Ga0065165_1000710 3300005262 Bacteria 47150
56 Ga0065165_1000754 3300005262 Bacteria 44059
57 Ga0065165_1002020 3300005262 Bacteria 18897
58 Ga0065165_1015133 3300005262 Bacteria 2957
59 Ga0070658_10006027 3300005327 Bacteria 9838
60 Ga0070666_10001066 3300005335 Bacteria 16749
61 Ga0070680_100418778 3300005336 Bacteria 1143
62 Ga0070682_100055362 3300005337 Bacteria 2491
63 Ga0070689_100000042 3300005340 Bacteria 79383
64 Ga0070688_100007002 3300005365 Bacteria 6061
65 Ga0070672_100003675 3300005543 Bacteria 9971
66 Ga0068855_100000016 3300005563 Bacteria 222591
67 Ga0068855_100015153 3300005563 Bacteria 9284
68 Ga0068855_100056433 3300005563 Bacteria 4608
69 Ga0068855_100121150 3300005563 Bacteria 2994
70 Ga0068855_100217134 3300005563 Bacteria 2146
71 Ga0070664_100133740 3300005564 Bacteria 2179
72 Ga0068857_100113744 3300005577 Bacteria 2434
73 Ga0068854_100245784 3300005578 Bacteria 1427
74 Ga0068856_100197863 3300005614 Bacteria 2024
75 Ga0075365_10073780 3300006038 Bacteria 2300
76 Ga0075362_10061128 3300006177 Bacteria 1704
77 Ga0075434_100421232 3300006871 Bacteria 1356
78 Ga0099826_10000003 3300006948 Bacteria 1067817
79 Ga0105244_10004609 3300009036 Bacteria 9436
80 Ga0105240_10000952 3300009093 Bacteria 51588
81 Ga0105240_10001988 3300009093 Bacteria 33782
82 Ga0105240_10008537 3300009093 Bacteria 14639
83 Ga0105245_10000332 3300009098 Bacteria 44503
84 Ga0105243_10010095 3300009148 Bacteria 7182
85 Ga0105241_10033948 3300009174 Bacteria 3832
86 Ga0105248_10612817 3300009177 Bacteria 1228
87 Ga0105237_10000050 3300009545 Bacteria 160580
88 Ga0105237_10234803 3300009545 Bacteria 1835
89 Ga0105238_10011438 3300009551 Bacteria 8938
90 Ga0105238_10026479 3300009551 Bacteria 5913
91 Ga0105239_10014685 3300010375 Bacteria 8685
92 Ga0157373_10025853 3300013100 Bacteria 4243
93 Ga0157373_10041267 3300013100 Bacteria 3301
94 Ga0157371_10000001 3300013102 Bacteria 1162285
95 Ga0157376_10098876 3300014969 Bacteria 2544
96 Ga0157376_10128880 3300014969 Bacteria 2255
97 Ga0182006_1000014 3300015261 Bacteria 340159
98 Ga0182006_1000044 3300015261 Bacteria 197442
99 Ga0182006_1003369 3300015261 Bacteria 8209
100 Ga0182007_10000011 3300015262 Bacteria 264045
101 Ga0182007_10001225 3300015262 Bacteria 13942
102 Ga0182005_1000014 3300015265 Bacteria 389763
103 Ga0182005_1000018 3300015265 Bacteria 324307
104 Ga0182005_1000540 3300015265 Bacteria 19079
105 Ga0213872_10000002 3300021361 Bacteria 554092
106 Ga0213872_10000269 3300021361 Bacteria 44994
107 Ga0213872_10000485 3300021361 Bacteria 31868
108 Ga0213875_10070975 3300021388 Bacteria 1626
109 Ga0209435_100013 3300025206 Bacteria 366789
110 Ga0209435_100072 3300025206 Bacteria 60184
111 Ga0209436_100375 3300025208 Bacteria 20163
112 Ga0209436_101106 3300025208 Bacteria 10036
113 Ga0209436_111218 3300025208 Bacteria 1588
114 Ga0209784_100020 3300025224 Bacteria 412353
115 Ga0209566_100020 3300025225 Bacteria 412353
116 Ga0209674_100035 3300025226 Bacteria 412353
117 Ga0209147_100030 3300025229 Bacteria 366789
118 Ga0209563_100015 3300025230 Bacteria 879901
119 Ga0209563_100038 3300025230 Bacteria 412353
120 Ga0207427_100721 3300025231 Bacteria 15423
121 Ga0209437_100066 3300025233 Bacteria 327883
122 Ga0209437_100317 3300025233 Bacteria 63136
123 Ga0209437_105114 3300025233 Bacteria 2252
124 Ga0209258_100542 3300025242 Bacteria 34693
125 Ga0207425_1000001 3300025245 Bacteria 2525432
126 Ga0207425_1000060 3300025245 Bacteria 139031
127 Ga0207425_1000587 3300025245 Bacteria 21270
128 Ga0207425_1000620 3300025245 Bacteria 20287
129 Ga0209646_1000021 3300025246 Bacteria 461083
130 Ga0209646_1000034 3300025246 Bacteria 366789
131 Ga0209646_1000117 3300025246 Bacteria 150025
132 Ga0209026_1000022 3300025250 Bacteria 366789
133 Ga0209026_1001718 3300025250 Bacteria 9125
134 Ga0209677_100031 3300025253 Bacteria 329719
135 Ga0209148_1001432 3300025254 Bacteria 12171
136 Ga0209759_1000018 3300025256 Bacteria 366789
137 Ga0209759_1000324 3300025256 Bacteria 63074
138 Ga0209129_1000093 3300025258 Bacteria 173163
139 Ga0209129_1004595 3300025258 Bacteria 5300
140 Ga0209233_1000060 3300025261 Bacteria 412379
141 Ga0209565_1000006 3300025263 Bacteria 897294
142 Ga0209565_1001517 3300025263 Bacteria 10059
143 Ga0209565_1001525 3300025263 Bacteria 9991
144 Ga0209565_1001608 3300025263 Bacteria 9549
145 Ga0209565_1002784 3300025263 Bacteria 6056
146 Ga0209565_1004583 3300025263 Bacteria 4172
147 Ga0209455_1000049 3300025272 Bacteria 374414
148 Ga0209673_1000004 3300025273 Bacteria 896155
149 Ga0209130_1000044 3300025284 Bacteria 241110
150 Ga0209130_1000474 3300025284 Bacteria 41406
151 Ga0209130_1002300 3300025284 Bacteria 9802
152 Ga0209675_1000006 3300025291 Bacteria 732267
153 Ga0209675_1013731 3300025291 Bacteria 2510
154 Ga0209025_1003213 3300025294 Bacteria 15832
155 Ga0209564_1000006 3300025295 Bacteria 1100927
156 Ga0209564_1000064 3300025295 Bacteria 316431
157 Ga0209564_1000134 3300025295 Bacteria 188346
158 Ga0209564_1003660 3300025295 Bacteria 10166
159 Ga0209564_1022596 3300025295 Bacteria 2216
160 Ga0209758_1000055 3300025297 Bacteria 336183
161 Ga0209050_1000085 3300025298 Bacteria 263219
162 Ga0209050_1000092 3300025298 Bacteria 252702
163 Ga0209050_1000465 3300025298 Bacteria 71894
164 Ga0209050_1000552 3300025298 Bacteria 61721
165 Ga0209256_1000005 3300025299 Bacteria 1315082
166 Ga0209256_1000080 3300025299 Bacteria 224592
167 Ga0209256_1002537 3300025299 Bacteria 14619
168 Ga0207426_1002592 3300025302 Bacteria 11226
169 Ga0207426_1036384 3300025302 Bacteria 1565
170 Ga0209051_1024832 3300025303 Bacteria 2455
171 Ga0209257_1000010 3300025304 Bacteria 1158682
172 Ga0209257_1002123 3300025304 Bacteria 20708
173 Ga0207680_10015242 3300025903 Bacteria 4006
174 Ga0207705_10005294 3300025909 Bacteria 9653
175 Ga0207705_10012419 3300025909 Bacteria 6154
176 Ga0207705_10292566 3300025909 Bacteria 1248
177 Ga0207695_10000896 3300025913 Bacteria 53929
178 Ga0207695_10007805 3300025913 Bacteria 13543
179 Ga0207695_10009905 3300025913 Bacteria 11712
180 Ga0207671_10000498 3300025914 Bacteria 53330
181 Ga0207657_10020139 3300025919 Bacteria 6312
182 Ga0207652_10001329 3300025921 Bacteria 21947
183 Ga0207652_10063648 3300025921 Bacteria 3190
184 Ga0207694_10170095 3300025924 Bacteria 1764
185 Ga0207687_10001406 3300025927 Bacteria 16426
186 Ga0207670_10000058 3300025936 Bacteria 79241
187 Ga0207691_10001913 3300025940 Bacteria 20336
188 Ga0207667_10000206 3300025949 Bacteria 83657
189 Ga0207667_10014671 3300025949 Bacteria 8921
190 Ga0207667_10131487 3300025949 Bacteria 2578
191 Ga0207678_10125945 3300026067 Bacteria 2185
192 Ga0207702_10262766 3300026078 Bacteria 1626
193 Ga0207648_10261934 3300026089 Bacteria 1543
194 Ga0207674_10060727 3300026116 Bacteria 3822
195 Ga0209282_1000002 3300027666 Bacteria 1067825
196 Ga0265334_10012951 3300028573 Bacteria 3499
197 Ga0265334_10074724 3300028573 Bacteria 1257
198 Ga0265318_10000068 3300028577 Bacteria 101168
199 Ga0265318_10000128 3300028577 Bacteria 69731
200 Ga0265318_10011384 3300028577 Bacteria 3832
201 Ga0265338_10000560 3300028800 Bacteria 65231
202 Ga0265324_10037833 3300029957 Bacteria 1676
203 Ga0316177_1137694 3300030731 Bacteria 6716
204 Ga0316182_1150583 3300030745 Bacteria 2108
205 Ga0265330_10000031 3300031235 Bacteria 132487
206 Ga0265330_10000064 3300031235 Bacteria 93262
207 Ga0265332_10000135 3300031238 Bacteria 60723
208 Ga0265332_10004292 3300031238 Bacteria 6726
209 Ga0265328_10002328 3300031239 Bacteria 8567
210 Ga0265328_10021506 3300031239 Bacteria 2460
211 Ga0265328_10043212 3300031239 Unclassified 1658
212 Ga0265320_10000028 3300031240 Bacteria 160699
213 Ga0265320_10005243 3300031240 Bacteria 8355
214 Ga0265329_10005947 3300031242 Bacteria 4886
215 Ga0265339_10069269 3300031249 Bacteria 1883
216 Ga0265331_10000023 3300031250 Bacteria 236483
217 Ga0265331_10001382 3300031250 Bacteria 17843
218 Ga0265331_10004725 3300031250 Bacteria 8428
219 Ga0265327_10000077 3300031251 Bacteria 211850
220 Ga0265327_10022547 3300031251 Bacteria 3758
221 Ga0265316_10000898 3300031344 Bacteria 32585
222 Ga0307408_100000094 3300031548 Bacteria 97519
223 Ga0307408_100001672 3300031548 Bacteria 16328
224 Ga0307408_100002920 3300031548 Bacteria 11845
225 Ga0265313_10000126 3300031595 Bacteria 76903
226 Ga0265313_10014039 3300031595 Bacteria 4767
227 Ga0265313_10018286 3300031595 Bacteria 3942
228 Ga0265314_10000176 3300031711 Bacteria 94482
229 Ga0265314_10001620 3300031711 Bacteria 24671
230 Ga0265342_10002741 3300031712 Bacteria 14988
231 Ga0265342_10020905 3300031712 Bacteria 4186
232 Ga0307518_10012873 3300031838 Bacteria 5972
233 Ga0307414_10064118 3300032004 Bacteria 2614
234 Ga0395899_0000141 3300037312 Bacteria 109773
235 Ga0395899_0005393 3300037312 Bacteria 9936
236 Ga0395899_0011729 3300037312 Bacteria 6708
237 Ga0395899_0025446 3300037312 Bacteria 4468
238 Ga0395899_0042408 3300037312 Bacteria 3396
239 Ga0395900_0012739 3300037418 Bacteria 8594
240 Ga0395900_0020227 3300037418 Bacteria 6792
241 Ga0395900_0021953 3300037418 Bacteria 6526
242 Ga0395900_0035468 3300037418 Bacteria 5137
243 Ga0395900_0047375 3300037418 Bacteria 4425
244 Ga0395900_0098175 3300037418 Bacteria 3009
245 Ga0395900_0104040 3300037418 Bacteria 2916
246 Ga0395900_0173691 3300037418 Bacteria 2192
247 Ga0395900_0420440 3300037418 Bacteria 1297
248 Ga0395898_0038830 3300037466 Bacteria 4715
249 Ga0395898_0097514 3300037466 Bacteria 2823
250 Ga0395898_0289478 3300037466 Bacteria 1562
251 Ga0395905_0050893 3300037471 Bacteria 3880
252 Ga0395905_0071359 3300037471 Bacteria 3256
253 Ga0395905_0107996 3300037471 Bacteria 2612
254 Ga0395905_0116577 3300037471 Bacteria 2510
255 Ga0395905_0117288 3300037471 Bacteria 2501
256 Ga0395905_0121927 3300037471 Bacteria 2451
257 Ga0436364_1136587 3300037853 Bacteria 7948
258 Ga0395901_0000331 3300038443 Bacteria 58263
259 Ga0395901_0000963 3300038443 Bacteria 31334
260 Ga0395901_0110024 3300038443 Bacteria 2892
261 Ga0395901_0179634 3300038443 Bacteria 2219
262 Ga0436361_0152693 3300039447 Bacteria 2901
263 Ga0436361_0325950 3300039447 Bacteria 85005
264 Ga0436361_0390486 3300039447 Bacteria 18264
265 Ga0436361_0462569 3300039447 Bacteria 5834
266 Ga0436361_0495861 3300039447 Bacteria 3183
267 Ga0436361_0875769 3300039447 Bacteria 32444
268 Ga0451807_2471212 3300041486 Bacteria 1824
269 Ga0451843_1196518 3300041509 Bacteria 2109
270 Ga0439450_008783 3300042008 Bacteria 1895
271 Ga0450904_000388 3300042139 Bacteria 9121
272 Ga0451577_0013684 3300042876 Bacteria 7582
273 Ga0451577_0227430 3300042876 Bacteria 1686
274 Ga0466972_0004731 3300044658 Bacteria 6815
275 Ga0466972_0065196 3300044658 Bacteria 1743
276 Ga0466965_0010919 3300044683 Bacteria 4247
277 Ga0466965_0110601 3300044683 Bacteria 1411
278 Ga0466966_0002083 3300044684 Bacteria 12980
279 Ga0466966_0022529 3300044684 Bacteria 4132
280 Ga0466966_0059914 3300044684 Bacteria 2403
281 Ga0466961_0077714 3300044693 Bacteria 2102
282 Ga0466963_0046763 3300044694 Bacteria 2854
283 Ga0466964_0000224 3300044706 Bacteria 16209
284 Ga0466964_0000583 3300044706 Bacteria 11528
285 Ga0453684_0011532 3300044712 Bacteria 14786
286 Ga0466970_0031031 3300044765 Bacteria 2821
287 Ga0466957_0007577 3300044842 Bacteria 6134
288 Ga0466957_0015010 3300044842 Bacteria 4518
289 Ga0466957_0017385 3300044842 Bacteria 4210
290 Ga0451576_0001926 3300045051 Bacteria 33249
291 Ga0451576_0004769 3300045051 Bacteria 17384
292 Ga0466958_0004216 3300045836 Bacteria 7560
293 Ga0466958_0140263 3300045836 Bacteria 1521
294 Ga0466967_0023470 3300045976 Bacteria 5055
295 Ga0466967_0069170 3300045976 Bacteria 3154
296 Ga0466967_0522966 3300045976 Bacteria 1166
297 Ga0495617_000002 3300046452 Bacteria 710121
298 Ga0495617_000007 3300046452 Bacteria 369986
299 Ga0495617_000396 3300046452 Bacteria 24153
300 Ga0495617_000529 3300046452 Bacteria 19810
301 Ga0495617_007951 3300046452 Bacteria 3665
302 Ga0495617_017772 3300046452 Bacteria 2403
303 Ga0495627_000006 3300046453 Bacteria 581750
304 Ga0495627_000111 3300046453 Bacteria 101652
305 Ga0495603_0014816 3300046455 Bacteria 4715
306 Ga0495590_0000004 3300046457 Bacteria 402091
307 Ga0495590_0000007 3300046457 Bacteria 331108
308 Ga0495590_0000352 3300046457 Bacteria 23781
309 Ga0495590_0007832 3300046457 Bacteria 4098
310 Ga0495590_0028580 3300046457 Bacteria 1955
311 Ga0495590_0043940 3300046457 Bacteria 1558
312 Ga0495591_000062 3300046458 Bacteria 124615
313 Ga0495629_0011465 3300046459 Bacteria 6440
314 Ga0495629_0023319 3300046459 Bacteria 4410
315 Ga0495638_0000023 3300046460 Bacteria 363063
316 Ga0495638_0002863 3300046460 Bacteria 13812
317 Ga0495638_0003777 3300046460 Bacteria 11768
318 Ga0495638_0004044 3300046460 Bacteria 11250
319 Ga0495638_0122770 3300046460 Bacteria 1533
320 Ga0495651_0162472 3300046462 Bacteria 1598
321 Ga0495653_0000073 3300046463 Bacteria 84617
322 Ga0495653_0018376 3300046463 Bacteria 5679
323 Ga0495653_0056866 3300046463 Bacteria 2980
324 Ga0495650_0000015 3300046471 Bacteria 557595
325 Ga0495650_0000124 3300046471 Bacteria 180310
326 Ga0495650_0000169 3300046471 Bacteria 145238
327 Ga0495650_0000177 3300046471 Bacteria 139376
328 Ga0495650_0000538 3300046471 Bacteria 54090
329 Ga0495650_0001900 3300046471 Bacteria 18530
330 Ga0495650_0002395 3300046471 Bacteria 15319
331 Ga0495650_0004429 3300046471 Bacteria 9620
332 Ga0495650_0005538 3300046471 Bacteria 8156
333 Ga0495650_0016593 3300046471 Bacteria 3724
334 Ga0495580_0027622 3300046472 Bacteria 4127
335 Ga0495605_0000063 3300046474 Bacteria 140789
336 Ga0495605_0000092 3300046474 Bacteria 115315
337 Ga0495605_0000174 3300046474 Bacteria 81340
338 Ga0495605_0001450 3300046474 Bacteria 15527
339 Ga0495605_0004480 3300046474 Bacteria 8188
340 Ga0495605_0004907 3300046474 Bacteria 7817
341 Ga0495605_0021101 3300046474 Bacteria 3454
342 Ga0495605_0024848 3300046474 Bacteria 3129
343 Ga0495605_0025747 3300046474 Bacteria 3063
344 Ga0495605_0080571 3300046474 Bacteria 1524
345 Ga0495605_0105521 3300046474 Bacteria 1290
346 Ga0495584_0000010 3300046491 Bacteria 225095
347 Ga0495584_0000211 3300046491 Bacteria 41947
348 Ga0495584_0000456 3300046491 Bacteria 28211
349 Ga0495584_0000756 3300046491 Bacteria 21379
350 Ga0495584_0000788 3300046491 Bacteria 20907
351 Ga0495584_0002654 3300046491 Bacteria 10065
352 Ga0495584_0008327 3300046491 Bacteria 5369
353 Ga0495584_0021307 3300046491 Bacteria 3293
354 Ga0495584_0034256 3300046491 Bacteria 2569
355 Ga0495584_0042915 3300046491 Bacteria 2283
356 Ga0495584_0092040 3300046491 Bacteria 1529
357 Ga0495585_0000006 3300046492 Bacteria 320556
358 Ga0495585_0000190 3300046492 Bacteria 65291
359 Ga0495585_0000196 3300046492 Bacteria 62748
360 Ga0495585_0000336 3300046492 Bacteria 45683
361 Ga0495585_0000564 3300046492 Bacteria 35032
362 Ga0495585_0002186 3300046492 Bacteria 14199
363 Ga0495585_0004665 3300046492 Bacteria 8839
364 Ga0495585_0004904 3300046492 Bacteria 8571
365 Ga0495585_0009103 3300046492 Bacteria 5980
366 Ga0495585_0043150 3300046492 Bacteria 2523
367 Ga0495585_0043206 3300046492 Bacteria 2521
368 Ga0495585_0046506 3300046492 Bacteria 2420
369 Ga0495585_0059966 3300046492 Bacteria 2095
370 Ga0495585_0066836 3300046492 Bacteria 1967
371 Ga0495585_0068283 3300046492 Bacteria 1942
372 Ga0495585_0088561 3300046492 Bacteria 1669
373 Ga0495585_0098985 3300046492 Bacteria 1561
374 Ga0495585_0099507 3300046492 Bacteria 1556
375 Ga0495585_0127585 3300046492 Bacteria 1341
376 Ga0495585_0163771 3300046492 Bacteria 1152
377 Ga0495594_0001314 3300046499 Bacteria 12942
378 Ga0495594_0003923 3300046499 Bacteria 7649
379 Ga0495594_0013780 3300046499 Bacteria 4225
380 Ga0495594_0040131 3300046499 Bacteria 2560
381 Ga0495594_0053204 3300046499 Bacteria 2229
382 Ga0495596_0000130 3300046500 Bacteria 51970
383 Ga0495596_0000217 3300046500 Bacteria 39881
384 Ga0495596_0000867 3300046500 Bacteria 18208
385 Ga0495596_0001456 3300046500 Bacteria 13558
386 Ga0495596_0001704 3300046500 Bacteria 12372
387 Ga0495596_0002425 3300046500 Bacteria 10051
388 Ga0495596_0004552 3300046500 Bacteria 6739
389 Ga0495596_0007723 3300046500 Bacteria 4833
390 Ga0495596_0011882 3300046500 Bacteria 3739
391 Ga0495596_0017520 3300046500 Bacteria 2963
392 Ga0495596_0021422 3300046500 Bacteria 2638
393 Ga0495596_0023080 3300046500 Bacteria 2526
394 Ga0495596_0024209 3300046500 Bacteria 2460
395 Ga0495607_0000380 3300046501 Bacteria 45619
396 Ga0495607_0000692 3300046501 Bacteria 32509
397 Ga0495607_0000740 3300046501 Bacteria 31315
398 Ga0495607_0000852 3300046501 Bacteria 28754
399 Ga0495607_0002892 3300046501 Bacteria 13562
400 Ga0495607_0003619 3300046501 Bacteria 11732
401 Ga0495607_0009387 3300046501 Bacteria 6624
402 Ga0495607_0015473 3300046501 Bacteria 4943
403 Ga0495607_0023548 3300046501 Bacteria 3853
404 Ga0495607_0026552 3300046501 Bacteria 3592
405 Ga0495607_0036460 3300046501 Bacteria 2962
406 Ga0495607_0091085 3300046501 Bacteria 1652
407 Ga0495607_0141846 3300046501 Bacteria 1238
408 Ga0495583_0000056 3300046506 Bacteria 200858
409 Ga0495583_0000084 3300046506 Bacteria 165375
410 Ga0495583_0000088 3300046506 Bacteria 164073
411 Ga0495583_0000299 3300046506 Bacteria 78832
412 Ga0495583_0000404 3300046506 Bacteria 65523
413 Ga0495583_0001506 3300046506 Bacteria 23173
414 Ga0495583_0001938 3300046506 Bacteria 19127
415 Ga0495583_0002237 3300046506 Bacteria 17042
416 Ga0495583_0003192 3300046506 Bacteria 12858
417 Ga0495583_0005086 3300046506 Bacteria 9072
418 Ga0495583_0006758 3300046506 Bacteria 7415
419 Ga0495583_0007931 3300046506 Bacteria 6573
420 Ga0495583_0023098 3300046506 Bacteria 3153
421 Ga0495583_0039154 3300046506 Bacteria 2235
422 Ga0495606_0000043 3300046507 Bacteria 214367
423 Ga0495606_0000146 3300046507 Bacteria 122515
424 Ga0495606_0000184 3300046507 Bacteria 110347
425 Ga0495606_0000291 3300046507 Bacteria 86832
426 Ga0495606_0002377 3300046507 Bacteria 22071
427 Ga0495606_0002573 3300046507 Bacteria 20774
428 Ga0495606_0011650 3300046507 Bacteria 7144
429 Ga0495606_0017285 3300046507 Bacteria 5461
430 Ga0495606_0018541 3300046507 Bacteria 5213
431 Ga0495606_0027053 3300046507 Bacteria 4073
432 Ga0495606_0034750 3300046507 Bacteria 3456
433 Ga0495606_0075850 3300046507 Bacteria 2103
434 Ga0495610_0000004 3300046512 Bacteria 1006135
435 Ga0495610_0000423 3300046512 Bacteria 43492
436 Ga0495610_0011356 3300046512 Bacteria 5453
437 Ga0495610_0022485 3300046512 Bacteria 3448
438 Ga0495610_0022621 3300046512 Bacteria 3434
439 Ga0495610_0033555 3300046512 Bacteria 2652
440 Ga0495616_0000081 3300046513 Bacteria 80720
441 Ga0495616_0000111 3300046513 Bacteria 71395
442 Ga0495616_0000419 3300046513 Bacteria 32725
443 Ga0495616_0001731 3300046513 Bacteria 14869
444 Ga0495616_0004007 3300046513 Bacteria 9364
445 Ga0495616_0008370 3300046513 Bacteria 6134
446 Ga0495616_0016401 3300046513 Bacteria 4101
447 Ga0495616_0018067 3300046513 Bacteria 3880
448 Ga0495616_0040790 3300046513 Bacteria 2370
449 Ga0495616_0062010 3300046513 Bacteria 1832
450 Ga0495616_0062332 3300046513 Bacteria 1826
451 Ga0495620_0011666 3300046515 Bacteria 4574
452 Ga0495628_0003636 3300046516 Bacteria 13766
453 Ga0495631_0000226 3300046518 Bacteria 38540
454 Ga0495631_0003086 3300046518 Bacteria 9183
455 Ga0495631_0005356 3300046518 Bacteria 6729
456 Ga0495631_0006563 3300046518 Bacteria 5992
457 Ga0495631_0014389 3300046518 Bacteria 3819
458 Ga0495631_0020636 3300046518 Bacteria 3076
459 Ga0495631_0023008 3300046518 Bacteria 2893
460 Ga0495631_0035430 3300046518 Bacteria 2232
461 Ga0495631_0061083 3300046518 Bacteria 1635
462 Ga0495631_0089976 3300046518 Bacteria 1321
463 Ga0495632_0000068 3300046519 Bacteria 108872
464 Ga0495632_0000154 3300046519 Bacteria 70836
465 Ga0495632_0001164 3300046519 Bacteria 22365
466 Ga0495632_0002784 3300046519 Bacteria 12967
467 Ga0495632_0007068 3300046519 Bacteria 7112
468 Ga0495632_0017573 3300046519 Bacteria 3943
469 Ga0495632_0039196 3300046519 Bacteria 2393
470 Ga0495637_0000019 3300046520 Bacteria 185953
471 Ga0495637_0000498 3300046520 Bacteria 28461
472 Ga0495637_0004630 3300046520 Bacteria 7103
473 Ga0495637_0008473 3300046520 Bacteria 5047
474 Ga0495643_0000196 3300046522 Bacteria 95989
475 Ga0495643_0000211 3300046522 Bacteria 89358
476 Ga0495643_0000213 3300046522 Bacteria 89236
477 Ga0495643_0000227 3300046522 Bacteria 85333
478 Ga0495643_0005455 3300046522 Bacteria 8601
479 Ga0495643_0011286 3300046522 Bacteria 5452
480 Ga0495643_0015987 3300046522 Bacteria 4418
481 Ga0495643_0020435 3300046522 Bacteria 3816
482 Ga0495643_0023710 3300046522 Bacteria 3485
483 Ga0495643_0030220 3300046522 Bacteria 3027
484 Ga0495643_0041735 3300046522 Bacteria 2501
485 Ga0495643_0041937 3300046522 Bacteria 2494
486 Ga0495643_0062653 3300046522 Bacteria 1968
487 Ga0495644_0003468 3300046523 Bacteria 6237
488 Ga0495644_0006241 3300046523 Bacteria 4629
489 Ga0495644_0007236 3300046523 Bacteria 4291
490 Ga0495644_0007335 3300046523 Bacteria 4259
491 Ga0495644_0008045 3300046523 Bacteria 4056
492 Ga0495644_0013446 3300046523 Bacteria 3139
493 Ga0495644_0017425 3300046523 Bacteria 2746
494 Ga0495644_0019045 3300046523 Bacteria 2619
495 Ga0495644_0039470 3300046523 Bacteria 1780
496 Ga0495648_0000007 3300046524 Bacteria 347305
497 Ga0495648_0000084 3300046524 Bacteria 120611
498 Ga0495648_0000367 3300046524 Bacteria 49778
499 Ga0495648_0000497 3300046524 Bacteria 42400
500 Ga0495648_0003856 3300046524 Bacteria 13004
501 Ga0495648_0005495 3300046524 Bacteria 10512
502 Ga0495648_0006062 3300046524 Bacteria 9921
503 Ga0495648_0007441 3300046524 Bacteria 8760
504 Ga0495648_0009255 3300046524 Bacteria 7657
505 Ga0495648_0010304 3300046524 Bacteria 7131
506 Ga0495648_0039206 3300046524 Bacteria 3017
507 Ga0495648_0042819 3300046524 Bacteria 2845
508 Ga0495648_0076078 3300046524 Bacteria 1928
509 Ga0495663_0002462 3300046525 Bacteria 5566
510 Ga0495663_0007538 3300046525 Bacteria 3010
511 Ga0495666_0001962 3300046526 Bacteria 10142
512 Ga0495666_0007127 3300046526 Bacteria 5617
513 Ga0495666_0025001 3300046526 Bacteria 2950
514 Ga0495642_0000133 3300046528 Bacteria 42946
515 Ga0495642_0000535 3300046528 Bacteria 19288
516 Ga0495642_0000635 3300046528 Bacteria 17592
517 Ga0495642_0002841 3300046528 Bacteria 6911
518 Ga0495642_0007136 3300046528 Bacteria 4287
519 Ga0495642_0011435 3300046528 Bacteria 3410
520 Ga0495642_0013023 3300046528 Bacteria 3211
521 Ga0495642_0013331 3300046528 Bacteria 3178
522 Ga0495642_0015740 3300046528 Bacteria 2944
523 Ga0495642_0015935 3300046528 Bacteria 2926
524 Ga0495642_0019968 3300046528 Bacteria 2628
525 Ga0495642_0028281 3300046528 Bacteria 2233
526 Ga0495642_0034113 3300046528 Bacteria 2048
527 Ga0495642_0073602 3300046528 Bacteria 1431
528 Ga0495652_0003589 3300046529 Bacteria 15219
529 Ga0495652_0005611 3300046529 Bacteria 11771
530 Ga0495652_0013202 3300046529 Bacteria 7436
531 Ga0495652_0051204 3300046529 Bacteria 3528
532 Ga0495654_0000004 3300046530 Bacteria 515304
533 Ga0495654_0002324 3300046530 Bacteria 12288
534 Ga0495654_0005959 3300046530 Bacteria 7004
535 Ga0495654_0015326 3300046530 Bacteria 4072
536 Ga0495654_0024513 3300046530 Bacteria 3115
537 Ga0495654_0026219 3300046530 Bacteria 2999
538 Ga0495665_0039174 3300046531 Bacteria 2524
539 Ga0495665_0061154 3300046531 Bacteria 1988
540 Ga0495665_0158407 3300046531 Bacteria 1180
541 Ga0495586_0021137 3300046535 Bacteria 3467
542 Ga0495586_0026641 3300046535 Bacteria 3093
543 Ga0495609_0000002 3300046538 Bacteria 739816
544 Ga0495609_0000363 3300046538 Bacteria 38970
545 Ga0495609_0000518 3300046538 Bacteria 31072
546 Ga0495609_0001137 3300046538 Bacteria 18406
547 Ga0495609_0001775 3300046538 Bacteria 13852
548 Ga0495609_0002348 3300046538 Bacteria 11678
549 Ga0495609_0002975 3300046538 Bacteria 10007
550 Ga0495609_0005685 3300046538 Bacteria 6492
551 Ga0495609_0008340 3300046538 Bacteria 5077
552 Ga0495609_0010339 3300046538 Bacteria 4480
553 Ga0495609_0010893 3300046538 Bacteria 4343
554 Ga0495609_0029535 3300046538 Bacteria 2496
555 Ga0495609_0032758 3300046538 Bacteria 2360
556 Ga0495609_0054690 3300046538 Bacteria 1772
557 Ga0495609_0065662 3300046538 Bacteria 1599
558 Ga0495597_0000022 3300046542 Bacteria 150986
559 Ga0495597_0000063 3300046542 Bacteria 91471
560 Ga0495597_0001267 3300046542 Bacteria 18621
561 Ga0495597_0001274 3300046542 Bacteria 18578
562 Ga0495597_0001432 3300046542 Bacteria 17158
563 Ga0495597_0002036 3300046542 Bacteria 13530
564 Ga0495597_0002456 3300046542 Bacteria 11723
565 Ga0495597_0002765 3300046542 Bacteria 10806
566 Ga0495597_0002948 3300046542 Bacteria 10326
567 Ga0495597_0022799 3300046542 Bacteria 2900
568 Ga0495597_0028854 3300046542 Bacteria 2536
569 Ga0495597_0072189 3300046542 Bacteria 1485
570 Ga0495645_0002586 3300046543 Bacteria 12301
571 Ga0495622_0000003 3300046557 Bacteria 268681
572 Ga0495622_0000074 3300046557 Bacteria 87846
573 Ga0495622_0013694 3300046557 Bacteria 3760
574 Ga0495622_0029272 3300046557 Bacteria 2573
575 Ga0495622_0048462 3300046557 Bacteria 1974
576 Ga0495633_0000113 3300046558 Bacteria 109307
577 Ga0495633_0000421 3300046558 Bacteria 44029
578 Ga0495633_0001242 3300046558 Bacteria 20380
579 Ga0495633_0001263 3300046558 Bacteria 20159
580 Ga0495633_0001832 3300046558 Bacteria 15619
581 Ga0495633_0002519 3300046558 Bacteria 12882
582 Ga0495633_0003469 3300046558 Bacteria 10482
583 Ga0495633_0007240 3300046558 Bacteria 6420
584 Ga0495633_0015981 3300046558 Bacteria 3882
585 Ga0495633_0022590 3300046558 Bacteria 3127
586 Ga0495633_0028353 3300046558 Bacteria 2729
587 Ga0495633_0031970 3300046558 Bacteria 2545
588 Ga0495656_0012612 3300046615 Bacteria 3124
589 Ga0495656_0062731 3300046615 Bacteria 1626
590 Ga0495668_0000051 3300046616 Bacteria 214532
591 Ga0495668_0000139 3300046616 Bacteria 109589
592 Ga0495668_0000589 3300046616 Bacteria 44174
593 Ga0495668_0000617 3300046616 Bacteria 43027
594 Ga0495668_0001450 3300046616 Bacteria 22883
595 Ga0495668_0002601 3300046616 Bacteria 14626
596 Ga0495668_0002799 3300046616 Bacteria 13882
597 Ga0495668_0003830 3300046616 Bacteria 11013
598 Ga0495668_0004085 3300046616 Bacteria 10578
599 Ga0495668_0005502 3300046616 Bacteria 8548
600 Ga0495668_0008922 3300046616 Bacteria 6201
601 Ga0495668_0017919 3300046616 Bacteria 4101
602 Ga0495668_0029948 3300046616 Bacteria 3074
603 Ga0495668_0094424 3300046616 Bacteria 1637
604 Ga0495668_0096414 3300046616 Bacteria 1618
605 Ga0495634_0001242 3300046642 Bacteria 23453
606 Ga0495611_0000227 3300046648 Bacteria 39262
607 Ga0495611_0000625 3300046648 Bacteria 20376
608 Ga0495611_0001871 3300046648 Bacteria 10034
609 Ga0495611_0002481 3300046648 Bacteria 8411
610 Ga0495611_0006810 3300046648 Bacteria 4855
611 Ga0495611_0011083 3300046648 Bacteria 3818
612 Ga0495611_0031061 3300046648 Bacteria 2349
613 Ga0495611_0050875 3300046648 Bacteria 1866
614 Ga0495611_0072071 3300046648 Bacteria 1580
615 Ga0495625_0000073 3300046660 Bacteria 165197
616 Ga0495625_0000176 3300046660 Bacteria 99062
617 Ga0495625_0002486 3300046660 Bacteria 19870
618 Ga0495625_0005549 3300046660 Bacteria 11455
619 Ga0495625_0016330 3300046660 Bacteria 5846
620 Ga0495625_0036211 3300046660 Bacteria 3629
621 Ga0495625_0123871 3300046660 Bacteria 1756
622 Ga0495625_0178238 3300046660 Bacteria 1415
623 Ga0495625_0237649 3300046660 Bacteria 1187
624 Ga0495635_0024837 3300046663 Bacteria 4175
625 Ga0495635_0188722 3300046663 Bacteria 1400
626 Ga0495635_0280017 3300046663 Bacteria 1120
627 Ga0495659_0000004 3300046664 Bacteria 143914
628 Ga0495659_0001570 3300046664 Bacteria 7682
629 Ga0495659_0002496 3300046664 Bacteria 5937
630 Ga0495659_0016971 3300046664 Bacteria 2407
631 Ga0495659_0105855 3300046664 Bacteria 1094
632 Ga0495661_0000183 3300046665 Bacteria 72020
633 Ga0495661_0000377 3300046665 Bacteria 48123
634 Ga0495661_0001998 3300046665 Bacteria 16090
635 Ga0495661_0003109 3300046665 Bacteria 12453
636 Ga0495661_0003914 3300046665 Bacteria 10872
637 Ga0495661_0007957 3300046665 Bacteria 7361
638 Ga0495661_0009209 3300046665 Bacteria 6785
639 Ga0495661_0012052 3300046665 Bacteria 5849
640 Ga0495661_0016410 3300046665 Bacteria 4908
641 Ga0495661_0017343 3300046665 Bacteria 4756
642 Ga0495661_0020699 3300046665 Bacteria 4291
643 Ga0495661_0024828 3300046665 Bacteria 3878
644 Ga0495661_0050921 3300046665 Bacteria 2503
645 Ga0495661_0069543 3300046665 Bacteria 2062
646 Ga0495661_0083973 3300046665 Bacteria 1829
647 Ga0495661_0087602 3300046665 Bacteria 1779
648 Ga0495588_0000127 3300046674 Bacteria 125854
649 Ga0495588_0002680 3300046674 Bacteria 7624
650 Ga0495588_0009512 3300046674 Bacteria 4495
651 Ga0495588_0022869 3300046674 Bacteria 3091
652 Ga0495588_0024895 3300046674 Bacteria 2977
653 Ga0495588_0028437 3300046674 Bacteria 2797
654 Ga0495657_0137111 3300046675 Bacteria 1528
655 Ga0495599_0065791 3300046678 Bacteria 2264
656 Ga0495623_0008074 3300046679 Bacteria 6841
657 Ga0495623_0008515 3300046679 Bacteria 6662
658 Ga0495623_0056344 3300046679 Bacteria 2475
659 Ga0495646_0054272 3300046680 Bacteria 2411
660 Ga0495646_0102857 3300046680 Bacteria 1635
661 Ga0495669_0000036 3300046684 Bacteria 95830
662 Ga0495669_0000544 3300046684 Bacteria 16875
663 Ga0495669_0000786 3300046684 Bacteria 13553
664 Ga0495669_0002017 3300046684 Bacteria 8325
665 Ga0495613_0023563 3300046689 Bacteria 4587
666 Ga0495624_0025298 3300046690 Bacteria 3898
667 Ga0495624_0028123 3300046690 Bacteria 3676
668 Ga0495624_0076557 3300046690 Bacteria 2076
669 Ga0495670_0000490 3300046691 Bacteria 18748
670 Ga0495670_0001576 3300046691 Bacteria 11137
671 Ga0495670_0038493 3300046691 Bacteria 2384
672 Ga0495670_0041618 3300046691 Bacteria 2292
673 Ga0495671_0000067 3300046692 Bacteria 103441
674 Ga0495671_0000213 3300046692 Bacteria 50627
675 Ga0495671_0004992 3300046692 Bacteria 7818
676 Ga0495671_0009872 3300046692 Bacteria 5310
677 Ga0495671_0020398 3300046692 Bacteria 3493
678 Ga0495671_0021118 3300046692 Bacteria 3424
679 Ga0495671_0059770 3300046692 Bacteria 1883
680 Ga0495649_0000281 3300046694 Bacteria 44878
681 Ga0495649_0000597 3300046694 Bacteria 30098
682 Ga0495649_0005172 3300046694 Bacteria 8362
683 Ga0495649_0006243 3300046694 Bacteria 7430
684 Ga0495649_0012961 3300046694 Bacteria 4826
685 Ga0495649_0060689 3300046694 Bacteria 2034
686 Ga0495589_0000079 3300046794 Bacteria 89713
687 Ga0495589_0000083 3300046794 Bacteria 87058
688 Ga0495589_0001488 3300046794 Bacteria 13479
689 Ga0495589_0009391 3300046794 Bacteria 5087
690 Ga0495589_0013735 3300046794 Bacteria 4176
691 Ga0495589_0020895 3300046794 Bacteria 3346
692 Ga0495600_0039199 3300046809 Bacteria 3085
693 Ga0495600_0065389 3300046809 Bacteria 2377
694 Ga0495660_0000081 3300046810 Bacteria 101754
695 Ga0495660_0000264 3300046810 Bacteria 49401
696 Ga0495660_0000625 3300046810 Bacteria 27722
697 Ga0495660_0000784 3300046810 Bacteria 23793
698 Ga0495660_0002107 3300046810 Bacteria 12875
699 Ga0495660_0004430 3300046810 Bacteria 8494
700 Ga0495660_0039769 3300046810 Bacteria 2610
701 Ga0495660_0058308 3300046810 Bacteria 2080
702 Ga0495581_0020353 3300047315 Bacteria 3851
703 Ga0495581_0051260 3300047315 Bacteria 2383
704 Ga0495604_0010541 3300047317 Bacteria 7328
705 Ga0495604_0012089 3300047317 Bacteria 6864
706 Ga0495604_0031295 3300047317 Bacteria 4221
707 Ga0495604_0039134 3300047317 Bacteria 3728
708 Ga0495636_0003707 3300047318 Bacteria 5942
709 Ga0495636_0005753 3300047318 Bacteria 4859
710 Ga0495636_0010723 3300047318 Bacteria 3622
711 Ga0495636_0020142 3300047318 Bacteria 2686
712 Ga0495674_0004551 3300047319 Bacteria 13341
713 Ga0495672_0000041 3300047320 Bacteria 267545
714 Ga0495672_0000045 3300047320 Bacteria 255145
715 Ga0495672_0000132 3300047320 Bacteria 111537
716 Ga0495672_0000168 3300047320 Bacteria 95544
717 Ga0495672_0000182 3300047320 Bacteria 91245
718 Ga0495672_0000705 3300047320 Bacteria 36728
719 Ga0495672_0002916 3300047320 Bacteria 15128
720 Ga0495672_0003713 3300047320 Bacteria 12874
721 Ga0495672_0005367 3300047320 Bacteria 10192
722 Ga0495672_0013932 3300047320 Bacteria 5527
723 Ga0495672_0023172 3300047320 Bacteria 4024
724 Ga0495672_0028266 3300047320 Bacteria 3550
725 Ga0495672_0084352 3300047320 Bacteria 1762
726 Ga0495676_0000014 3300047321 Bacteria 203356
727 Ga0495676_0014944 3300047321 Bacteria 6931
728 Ga0495676_0019137 3300047321 Bacteria 6027
729 Ga0495676_0027281 3300047321 Bacteria 4899
730 Ga0495680_0115458 3300047322 Bacteria 1986
731 Ga0495683_0000159 3300047323 Bacteria 66298
732 Ga0495683_0002317 3300047323 Bacteria 11579
733 Ga0495683_0003896 3300047323 Bacteria 8585
734 Ga0495683_0004758 3300047323 Bacteria 7627
735 Ga0495683_0008042 3300047323 Bacteria 5661
736 Ga0495683_0016126 3300047323 Bacteria 3880
737 Ga0495683_0042916 3300047323 Bacteria 2279
738 Ga0495683_0061811 3300047323 Bacteria 1854
739 Ga0495683_0071040 3300047323 Bacteria 1708
740 Ga0495687_000049 3300047443 Bacteria 205432
741 Ga0495687_000075 3300047443 Bacteria 152218
742 Ga0495687_000133 3300047443 Bacteria 113757
743 Ga0495687_000197 3300047443 Bacteria 86694
744 Ga0495687_000199 3300047443 Bacteria 86090
745 Ga0495687_000701 3300047443 Bacteria 37406
746 Ga0495687_001964 3300047443 Bacteria 17562
747 Ga0495687_002227 3300047443 Bacteria 16014
748 Ga0495687_003980 3300047443 Bacteria 10297
749 Ga0495675_0002901 3300047444 Bacteria 10296
750 Ga0495675_0007616 3300047444 Bacteria 6675
751 Ga0495677_0000030 3300047445 Bacteria 87817
752 Ga0495677_0000138 3300047445 Bacteria 34784
753 Ga0495677_0004097 3300047445 Bacteria 5629
754 Ga0495677_0007122 3300047445 Bacteria 4187
755 Ga0495677_0008702 3300047445 Bacteria 3765
756 Ga0495677_0012319 3300047445 Bacteria 3119
757 Ga0495677_0012818 3300047445 Bacteria 3056
758 Ga0495677_0041321 3300047445 Bacteria 1687
759 Ga0495677_0063404 3300047445 Bacteria 1372
760 Ga0495679_001504 3300047446 Bacteria 13174
761 Ga0495679_003064 3300047446 Bacteria 8209
762 Ga0495679_004802 3300047446 Bacteria 6117
763 Ga0495679_018850 3300047446 Bacteria 2439
764 Ga0495679_032568 3300047446 Bacteria 1670
765 Ga0495679_032594 3300047446 Bacteria 1669
766 Ga0495685_000010 3300047447 Bacteria 84950
767 Ga0495685_002335 3300047447 Bacteria 5927
768 Ga0495685_011659 3300047447 Bacteria 2970
769 Ga0495685_016354 3300047447 Bacteria 2533
770 Ga0495685_031599 3300047447 Bacteria 1819
771 Ga0495685_033199 3300047447 Bacteria 1773
772 Ga0495673_0000006 3300047469 Bacteria 908691
773 Ga0495673_0000017 3300047469 Bacteria 574970
774 Ga0495673_0015116 3300047469 Bacteria 3988
775 Ga0495681_0000057 3300047470 Bacteria 103340
776 Ga0495681_0001545 3300047470 Bacteria 17177
777 Ga0495681_0004162 3300047470 Bacteria 9942
778 Ga0495681_0008290 3300047470 Bacteria 6526
779 Ga0495681_0008796 3300047470 Bacteria 6287
780 Ga0495681_0010749 3300047470 Bacteria 5515
781 Ga0495681_0049560 3300047470 Bacteria 1984
782 Ga0495686_0000400 3300047472 Bacteria 68842
783 Ga0495686_0000455 3300047472 Bacteria 61537
784 Ga0495686_0004730 3300047472 Bacteria 11022
785 Ga0495686_0013129 3300047472 Bacteria 5765
786 Ga0495686_0020754 3300047472 Bacteria 4378
787 Ga0495686_0048916 3300047472 Bacteria 2663
788 Ga0495686_0080210 3300047472 Bacteria 1995
789 Ga0495593_0019789 3300047673 Bacteria 3771
790 Ga0495593_0035580 3300047673 Bacteria 2703
791 Ga0495602_0001440 3300048088 Bacteria 23620
792 Ga0495602_0025548 3300048088 Bacteria 5715
793 Ga0495614_0011463 3300048089 Bacteria 3901
794 Ga0495615_0001527 3300048090 Bacteria 3473
795 Ga0495626_0000102 3300048091 Bacteria 110315
796 Ga0495626_0000111 3300048091 Bacteria 105401
797 Ga0495626_0001501 3300048091 Bacteria 18401
798 Ga0495626_0001547 3300048091 Bacteria 18065
799 Ga0495626_0002427 3300048091 Bacteria 12938
800 Ga0495626_0005287 3300048091 Bacteria 7621
801 Ga0495626_0013969 3300048091 Bacteria 4156
802 Ga0495626_0016819 3300048091 Bacteria 3707
803 Ga0495626_0016980 3300048091 Bacteria 3685
804 Ga0495626_0016999 3300048091 Bacteria 3681
805 Ga0495626_0040021 3300048091 Bacteria 2215
806 Ga0495626_0061097 3300048091 Bacteria 1715
807 Ga0496100_0109550 3300048903 Bacteria 1916
808 Ga0496101_0067851 3300048904 Bacteria 2605
809 Ga0496102_0000088 3300048905 Bacteria 129762
810 Ga0496102_0000159 3300048905 Bacteria 91043
811 Ga0496102_0020050 3300048905 Bacteria 5901
812 Ga0496102_0022714 3300048905 Bacteria 5559
813 Ga0496102_0093907 3300048905 Bacteria 2779
814 Ga0496102_0134780 3300048905 Bacteria 2313
815 Ga0496103_0000904 3300048906 Bacteria 21298
816 Ga0496103_0050564 3300048906 Bacteria 2571
817 Ga0496103_0116139 3300048906 Bacteria 1702
818 Ga0496104_0330407 3300048907 Bacteria 1438
819 Ga0496105_0186607 3300048908 Bacteria 1697
820 Ga0496106_0002714 3300048909 Bacteria 13113
821 Ga0496107_0043352 3300048910 Bacteria 3232
822 Ga0496109_0006947 3300048912 Bacteria 9555
823 Ga0496111_0030066 3300048914 Bacteria 3862
824 Ga0496113_0000552 3300048916 Bacteria 18562
825 Ga0496113_0038592 3300048916 Bacteria 3512
826 Ga0496113_0114812 3300048916 Bacteria 2100
827 Ga0496114_0022332 3300048917 Bacteria 5156
828 Ga0496114_0079916 3300048917 Bacteria 2761
829 Ga0496115_0015844 3300048918 Bacteria 5725
830 Ga0496115_0036967 3300048918 Bacteria 3868
831 Ga0496115_0041646 3300048918 Bacteria 3656
832 Ga0496116_0000005 3300048919 Bacteria 827804
833 Ga0496116_0005797 3300048919 Bacteria 11347
834 Ga0496116_0015162 3300048919 Bacteria 6110
835 Ga0496116_0065845 3300048919 Bacteria 2322
836 Ga0496117_0000001 3300048920 Bacteria 2526244
837 Ga0496118_0000008 3300048921 Bacteria 644537
838 Ga0496121_0000029 3300048924 Bacteria 430303
839 Ga0496121_0003166 3300048924 Bacteria 23725
840 Ga0496121_0032323 3300048924 Bacteria 4759
841 Ga0496121_0037463 3300048924 Bacteria 4307
842 Ga0496121_0104595 3300048924 Bacteria 2175
843 Ga0496122_0000134 3300048925 Bacteria 171080
844 Ga0496122_0000169 3300048925 Bacteria 155380
845 Ga0496122_0001178 3300048925 Bacteria 44704
846 Ga0496122_0002235 3300048925 Bacteria 28137
847 Ga0496123_0000198 3300048926 Bacteria 122508
848 Ga0496123_0000583 3300048926 Bacteria 62248
849 Ga0496123_0008917 3300048926 Bacteria 9118
850 Ga0496123_0027069 3300048926 Bacteria 4279
851 Ga0496123_0117539 3300048926 Bacteria 1503
852 Ga0496124_0002261 3300048927 Bacteria 25562
853 Ga0496124_0025174 3300048927 Bacteria 5395
854 Ga0496124_0028866 3300048927 Bacteria 4954
855 Ga0496124_0043903 3300048927 Bacteria 3839
856 Ga0496124_0046734 3300048927 Bacteria 3705
857 Ga0496124_0070676 3300048927 Bacteria 2895
858 Ga0496124_0089330 3300048927 Bacteria 2516
859 Ga0496124_0159023 3300048927 Bacteria 1763
860 Ga0496125_0000433 3300048928 Bacteria 76686
861 Ga0496125_0000605 3300048928 Bacteria 61001
862 Ga0496125_0008347 3300048928 Bacteria 10864
863 Ga0496125_0037113 3300048928 Bacteria 4241
864 Ga0496125_0040188 3300048928 Bacteria 4015
865 Ga0496125_0188030 3300048928 Bacteria 1367
866 Ga0496126_0262316 3300048929 Bacteria 1436
867 Ga0495678_000042 3300049459 Bacteria 174125
868 Ga0495678_000070 3300049459 Bacteria 131437
869 Ga0495678_000105 3300049459 Bacteria 103599
870 Ga0495678_000147 3300049459 Bacteria 85326
871 Ga0495678_000363 3300049459 Bacteria 46320
872 Ga0495678_001845 3300049459 Bacteria 15498
873 Ga0495678_002051 3300049459 Bacteria 14409
874 Ga0495678_006491 3300049459 Bacteria 6219
875 Ga0495678_007503 3300049459 Bacteria 5639
876 Ga0495682_0000116 3300049460 Bacteria 69250
877 Ga0495682_0000126 3300049460 Bacteria 66245
878 Ga0495682_0002583 3300049460 Bacteria 8507
879 Ga0495682_0007570 3300049460 Bacteria 4311
880 Ga0495682_0013718 3300049460 Bacteria 3080
881 Ga0501034_0142807 3300049571 Bacteria 2373
882 Ga0501046_0000027 3300049580 Bacteria 197037
883 Ga0501227_005620 3300049665 Bacteria 2683
884 Ga0501269_000295 3300049766 Bacteria 13600
885 Ga0501279_002231 3300049775 Bacteria 2552
886 Ga0501279_002611 3300049775 Bacteria 2356
887 Ga0501035_0001519 3300049822 Bacteria 23703
888 Ga0501044_0162943 3300049823 Bacteria 2205
889 nmdc:mga0yw44_68789_c1 3300050492 Bacteria 2191
890 nmdc:mga07m45_99065_c1 3300050496 Bacteria 1673
891 nmdc:mga0n895_407618_c1 3300050512 Bacteria 1375
892 Ga0495601_0037386 3300053077 Bacteria 3035
893 Ga0495601_0044660 3300053077 Bacteria 2785
894 Ga0500643_001239 3300053087 Bacteria 15130
895 Ga0500594_0010822 3300053118 Bacteria 2122
896 Ga0500595_008866 3300053119 Bacteria 4087
897 Ga0500618_000498 3300053125 Bacteria 25216
898 Ga0500559_0101026 3300053136 Bacteria 1329
899 Ga0500568_0011042 3300053139 Bacteria 4207
900 Ga0500573_0107549 3300053140 Bacteria 1564
901 Ga0500586_001055 3300053145 Bacteria 5679
902 Ga0500636_0003995 3300053177 Bacteria 8315
903 Ga0500637_0025663 3300053178 Bacteria 3240
904 Ga0500625_005841 3300053729 Bacteria 5185
905 Ga0466962_0015926 3300061719 Bacteria 3628

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003773 Ga0055537_1007058 Ga0055537_10070584 276
2 3300009098 Ga0105245_10000332 Ga0105245_100003329 294
3 3300014969 Ga0157376_10098876 Ga0157376_100988763 294
4 3300025927 Ga0207687_10001406 Ga0207687_100014064 294
5 3300003790 Ga0055528_1017213 Ga0055528_10172132 296
6 3300037312 Ga0395899_0005393 Ga0395899_0005393_8686_9723 304
7 3300037418 Ga0395900_0021953 Ga0395900_0021953_3807_4844 304
8 3300046513 Ga0495616_0040790 Ga0495616_0040790_818_1792 304
9 3300048927 Ga0496124_0002261 Ga0496124_0002261_2045_3082 307
10 3300049822 Ga0501035_0001519 Ga0501035_0001519_14185_15222 308
11 3300046528 Ga0495642_0000535 Ga0495642_0000535_12127_13164 309
12 3300046513 Ga0495616_0062332 Ga0495616_0062332_254_1291 311
13 3300049775 Ga0501279_002231 Ga0501279_002231_782_1810 312
14 3300006871 Ga0075434_100421232 Ga0075434_1004212321 314
15 3300049571 Ga0501034_0142807 Ga0501034_0142807_333_1370 314
16 3300050512 nmdc:mga0n895_407618_c1 nmdc:mga0n895_407618_c1_77_1135 314
17 3300005262 Ga0065165_1000754 Ga0065165_100075411 317
18 3300025208 Ga0209436_111218 Ga0209436_1112182 317
19 3300025284 Ga0209130_1000044 Ga0209130_100004422 317
20 3300025302 Ga0207426_1036384 Ga0207426_10363842 317
21 3300046520 Ga0495637_0000498 Ga0495637_0000498_18239_19453 317
22 3300046530 Ga0495654_0000004 Ga0495654_0000004_241720_242934 317
23 3300048927 Ga0496124_0070676 Ga0496124_0070676_1756_2814 318
24 3300046679 Ga0495623_0008074 Ga0495623_0008074_3128_4228 319
25 3300048088 Ga0495602_0025548 Ga0495602_0025548_1981_3081 319
26 3300048926 Ga0496123_0008917 Ga0496123_0008917_3264_4379 319
27 3300046524 Ga0495648_0003856 Ga0495648_0003856_11358_12530 320
28 3300046810 Ga0495660_0058308 Ga0495660_0058308_761_1798 320
29 3300013100 Ga0157373_10041267 Ga0157373_100412673 321
30 3300031548 Ga0307408_100000094 Ga0307408_10000009413 321
31 3300046474 Ga0495605_0004907 Ga0495605_0004907_2310_3365 321
32 3300047320 Ga0495672_0084352 Ga0495672_0084352_272_1324 321
33 3300049459 Ga0495678_006491 Ga0495678_006491_3466_4500 321
34 3300003791 Ga0055530_10001696 Ga0055530_1000169618 322
35 3300025298 Ga0209050_1000092 Ga0209050_100009272 322
36 3300037312 Ga0395899_0025446 Ga0395899_0025446_1366_2409 322
37 3300037418 Ga0395900_0012739 Ga0395900_0012739_7172_8209 322
38 3300037418 Ga0395900_0020227 Ga0395900_0020227_2057_3100 322
39 3300037466 Ga0395898_0038830 Ga0395898_0038830_2151_3194 322
40 3300037471 Ga0395905_0050893 Ga0395905_0050893_1766_2809 322
41 3300038443 Ga0395901_0000963 Ga0395901_0000963_28203_29246 322
42 3300046452 Ga0495617_000007 Ga0495617_000007_91185_92246 322
43 3300046471 Ga0495650_0000538 Ga0495650_0000538_140_1201 322
44 3300046491 Ga0495584_0000788 Ga0495584_0000788_10712_11749 322
45 3300046507 Ga0495606_0002377 Ga0495606_0002377_7802_8839 322
46 3300046524 Ga0495648_0006062 Ga0495648_0006062_5648_6709 322
47 3300046674 Ga0495588_0000127 Ga0495588_0000127_27946_28995 322
48 3300046810 Ga0495660_0004430 Ga0495660_0004430_4687_5748 322
49 3300047323 Ga0495683_0004758 Ga0495683_0004758_5573_6634 322
50 3300047443 Ga0495687_000075 Ga0495687_000075_60959_61996 322
51 3300047446 Ga0495679_004802 Ga0495679_004802_4999_6060 322
52 3300047469 Ga0495673_0000017 Ga0495673_0000017_190014_191075 322
53 3300003759 Ga0055525_1000009 Ga0055525_1000009116 323
54 3300025230 Ga0209563_100015 Ga0209563_100015230 323
55 3300044684 Ga0466966_0022529 Ga0466966_0022529_930_1967 323
56 3300046492 Ga0495585_0000564 Ga0495585_0000564_14094_15155 323
57 3300046530 Ga0495654_0002324 Ga0495654_0002324_3673_4734 323
58 3300048916 Ga0496113_0038592 Ga0496113_0038592_2161_3198 323
59 3300048925 Ga0496122_0002235 Ga0496122_0002235_17685_18722 323
60 3300048926 Ga0496123_0027069 Ga0496123_0027069_2869_3906 323
61 3300048928 Ga0496125_0188030 Ga0496125_0188030_319_1356 323
62 3300026067 Ga0207678_10125945 Ga0207678_101259453 324
63 3300003771 Ga0055526_1000908 Ga0055526_100090814 325
64 3300003775 Ga0055524_1005186 Ga0055524_10051863 325
65 3300025263 Ga0209565_1001608 Ga0209565_10016089 325
66 3300025295 Ga0209564_1000134 Ga0209564_100013472 325
67 3300046507 Ga0495606_0000146 Ga0495606_0000146_47126_48205 325
68 3300046684 Ga0495669_0002017 Ga0495669_0002017_7326_8306 325
69 3300049823 Ga0501044_0162943 Ga0501044_0162943_784_1821 325
70 3300003322 rootL2_10120913 rootL2_101209132 326
71 3300003784 Ga0055534_1004846 Ga0055534_10048462 326
72 3300028573 Ga0265334_10074724 Ga0265334_100747242 326
73 3300028577 Ga0265318_10000068 Ga0265318_1000006873 326
74 3300029957 Ga0265324_10037833 Ga0265324_100378332 326
75 3300031235 Ga0265330_10000031 Ga0265330_10000031106 326
76 3300031238 Ga0265332_10000135 Ga0265332_1000013543 326
77 3300031239 Ga0265328_10021506 Ga0265328_100215063 326
78 3300031240 Ga0265320_10000028 Ga0265320_1000002814 326
79 3300031242 Ga0265329_10005947 Ga0265329_100059473 326
80 3300031250 Ga0265331_10000023 Ga0265331_10000023124 326
81 3300031344 Ga0265316_10000898 Ga0265316_1000089820 326
82 3300031595 Ga0265313_10000126 Ga0265313_100001263 326
83 3300031711 Ga0265314_10000176 Ga0265314_1000017647 326
84 3300031712 Ga0265342_10020905 Ga0265342_100209053 326
85 3300045976 Ga0466967_0522966 Ga0466967_0522966_54_1115 326
86 3300002739 JGI25158J39367_1000321 JGI25158J39367_10003211 327
87 3300002773 JGI25152J39213_1008059 JGI25152J39213_10080592 327
88 3300002774 JGI25150J39212_1001102 JGI25150J39212_10011028 327
89 3300003354 JGI25160J50197_1001448 JGI25160J50197_10014481 327
90 3300003374 JGI25161J50226_1002791 JGI25161J50226_10027917 327
91 3300003771 Ga0055526_1004472 Ga0055526_10044726 327
92 3300003773 Ga0055537_1004385 Ga0055537_10043852 327
93 3300003775 Ga0055524_1001529 Ga0055524_10015293 327
94 3300003784 Ga0055534_1000864 Ga0055534_10008641 327
95 3300003791 Ga0055530_10004892 Ga0055530_100048924 327
96 3300003794 Ga0055531_10003437 Ga0055531_100034376 327
97 3300025208 Ga0209436_101106 Ga0209436_10110610 327
98 3300025245 Ga0207425_1000060 Ga0207425_100006077 327
99 3300025245 Ga0207425_1000587 Ga0207425_10005879 327
100 3300025258 Ga0209129_1004595 Ga0209129_10045954 327
101 3300025263 Ga0209565_1001517 Ga0209565_100151710 327
102 3300025284 Ga0209130_1002300 Ga0209130_100230010 327
103 3300025291 Ga0209675_1013731 Ga0209675_10137312 327
104 3300025295 Ga0209564_1003660 Ga0209564_100366010 327
105 3300025298 Ga0209050_1000085 Ga0209050_1000085167 327
106 3300025298 Ga0209050_1000465 Ga0209050_100046545 327
107 3300025299 Ga0209256_1002537 Ga0209256_100253711 327
108 3300025302 Ga0207426_1002592 Ga0207426_10025924 327
109 3300025303 Ga0209051_1024832 Ga0209051_10248322 327
110 3300025304 Ga0209257_1000010 Ga0209257_1000010890 327
111 3300042876 Ga0451577_0227430 Ga0451577_0227430_46_1089 327
112 3300044694 Ga0466963_0046763 Ga0466963_0046763_405_1514 328
113 3300045976 Ga0466967_0023470 Ga0466967_0023470_802_1911 328
114 3300037471 Ga0395905_0117288 Ga0395905_0117288_109_1146 329
115 3300044706 Ga0466964_0000224 Ga0466964_0000224_2146_3183 329
116 3300045976 Ga0466967_0069170 Ga0466967_0069170_804_1841 329
117 3300046452 Ga0495617_000396 Ga0495617_000396_8029_9084 329
118 3300046492 Ga0495585_0000190 Ga0495585_0000190_6623_7678 329
119 3300046513 Ga0495616_0001731 Ga0495616_0001731_7660_8715 329
120 3300046524 Ga0495648_0000007 Ga0495648_0000007_144011_145066 329
121 3300046558 Ga0495633_0022590 Ga0495633_0022590_847_1902 329
122 3300047323 Ga0495683_0003896 Ga0495683_0003896_4219_5274 329
123 3300009545 Ga0105237_10234803 Ga0105237_102348032 331
124 3300037418 Ga0395900_0047375 Ga0395900_0047375_1815_2852 331
125 3300037418 Ga0395900_0173691 Ga0395900_0173691_963_2000 331
126 3300037471 Ga0395905_0116577 Ga0395905_0116577_333_1370 331
127 3300038443 Ga0395901_0179634 Ga0395901_0179634_990_2027 331
128 3300042008 Ga0439450_008783 Ga0439450_008783_629_1666 331
129 3300047472 Ga0495686_0000455 Ga0495686_0000455_30287_31348 331
130 3300037312 Ga0395899_0042408 Ga0395899_0042408_184_1221 332
131 3300037418 Ga0395900_0104040 Ga0395900_0104040_184_1221 332
132 3300037466 Ga0395898_0289478 Ga0395898_0289478_300_1337 332
133 3300038443 Ga0395901_0110024 Ga0395901_0110024_1672_2709 332
134 3300047472 Ga0495686_0020754 Ga0495686_0020754_1597_2685 332
135 3300049580 Ga0501046_0000027 Ga0501046_0000027_101669_102673 332
136 3300028573 Ga0265334_10012951 Ga0265334_100129513 333
137 3300028577 Ga0265318_10000128 Ga0265318_1000012814 333
138 3300031235 Ga0265330_10000064 Ga0265330_1000006466 333
139 3300031238 Ga0265332_10004292 Ga0265332_100042926 333
140 3300031239 Ga0265328_10002328 Ga0265328_100023284 333
141 3300031240 Ga0265320_10005243 Ga0265320_100052436 333
142 3300031249 Ga0265339_10069269 Ga0265339_100692692 333
143 3300031250 Ga0265331_10001382 Ga0265331_100013829 333
144 3300031595 Ga0265313_10018286 Ga0265313_100182864 333
145 3300031711 Ga0265314_10001620 Ga0265314_1000162012 333
146 3300031712 Ga0265342_10002741 Ga0265342_1000274114 333
147 3300037418 Ga0395900_0098175 Ga0395900_0098175_1649_2692 333
148 3300005327 Ga0070658_10006027 Ga0070658_100060272 334
149 3300009551 Ga0105238_10011438 Ga0105238_100114382 334
150 3300025909 Ga0207705_10012419 Ga0207705_100124192 334
151 3300025921 Ga0207652_10063648 Ga0207652_100636482 334
152 3300025924 Ga0207694_10170095 Ga0207694_101700952 334
153 3300031595 Ga0265313_10014039 Ga0265313_100140393 334
154 3300048905 Ga0496102_0093907 Ga0496102_0093907_1025_2062 334
155 3300048909 Ga0496106_0002714 Ga0496106_0002714_2883_3920 334
156 3300005335 Ga0070666_10001066 Ga0070666_100010662 335
157 3300005340 Ga0070689_100000042 Ga0070689_10000004229 335
158 3300025903 Ga0207680_10015242 Ga0207680_100152422 335
159 3300025936 Ga0207670_10000058 Ga0207670_1000005840 335
160 3300026116 Ga0207674_10060727 Ga0207674_100607274 335
161 3300047320 Ga0495672_0000132 Ga0495672_0000132_98062_99144 335
162 3300047472 Ga0495686_0080210 Ga0495686_0080210_446_1576 335
163 3300053087 Ga0500643_001239 Ga0500643_001239_8450_9484 335
164 3300053139 Ga0500568_0011042 Ga0500568_0011042_1615_2649 335
165 iso_pu_bacteria 2643221554 2643787532 336
166 iso_pu_bacteria 2643221638 2644213599 336
167 3300005577 Ga0068857_100113744 Ga0068857_1001137442 337
168 3300006038 Ga0075365_10073780 Ga0075365_100737802 337
169 3300009545 Ga0105237_10000050 Ga0105237_1000005096 337
170 3300025914 Ga0207671_10000498 Ga0207671_1000049848 337
171 3300047443 Ga0495687_003980 Ga0495687_003980_427_1503 337
172 3300050492 nmdc:mga0yw44_68789_c1 nmdc:mga0yw44_68789_c1_643_1665 337
173 iso_pu_bacteria 2919476304 2919481092 337
174 3300002739 JGI25158J39367_1000929 JGI25158J39367_10009296 338
175 3300002773 JGI25152J39213_1000031 JGI25152J39213_100003145 338
176 3300002774 JGI25150J39212_1000470 JGI25150J39212_100047011 338
177 3300002987 JGI25159J45721_1000552 JGI25159J45721_100055220 338
178 3300003374 JGI25161J50226_1000465 JGI25161J50226_10004656 338
179 3300003771 Ga0055526_1000031 Ga0055526_100003171 338
180 3300003773 Ga0055537_1000071 Ga0055537_10000714 338
181 3300003773 Ga0055537_1008471 Ga0055537_10084712 338
182 3300003775 Ga0055524_1000015 Ga0055524_100001573 338
183 3300003775 Ga0055524_1000560 Ga0055524_100056018 338
184 3300003784 Ga0055534_1000452 Ga0055534_10004524 338
185 3300003790 Ga0055528_1000537 Ga0055528_10005373 338
186 3300003791 Ga0055530_10001313 Ga0055530_1000131323 338
187 3300004625 Ga0055543_1000222 Ga0055543_100022212 338
188 3300005262 Ga0065165_1000710 Ga0065165_100071037 338
189 3300005262 Ga0065165_1015133 Ga0065165_10151331 338
190 3300006948 Ga0099826_10000003 Ga0099826_10000003342 338
191 3300009036 Ga0105244_10004609 Ga0105244_100046096 338
192 3300009177 Ga0105248_10612817 Ga0105248_106128171 338
193 3300025208 Ga0209436_100375 Ga0209436_10037522 338
194 3300025245 Ga0207425_1000001 Ga0207425_10000012308 338
195 3300025245 Ga0207425_1000620 Ga0207425_10006207 338
196 3300025258 Ga0209129_1000093 Ga0209129_100009344 338
197 3300025263 Ga0209565_1000006 Ga0209565_100000650 338
198 3300025263 Ga0209565_1001525 Ga0209565_10015254 338
199 3300025263 Ga0209565_1002784 Ga0209565_10027844 338
200 3300025263 Ga0209565_1004583 Ga0209565_10045835 338
201 3300025273 Ga0209673_1000004 Ga0209673_1000004779 338
202 3300025284 Ga0209130_1000474 Ga0209130_100047438 338
203 3300025291 Ga0209675_1000006 Ga0209675_100000649 338
204 3300025294 Ga0209025_1003213 Ga0209025_10032134 338
205 3300025295 Ga0209564_1000064 Ga0209564_1000064228 338
206 3300025295 Ga0209564_1022596 Ga0209564_10225962 338
207 3300025297 Ga0209758_1000055 Ga0209758_100005544 338
208 3300025298 Ga0209050_1000552 Ga0209050_100055240 338
209 3300025299 Ga0209256_1000005 Ga0209256_100000574 338
210 3300025299 Ga0209256_1000080 Ga0209256_100008045 338
211 3300025304 Ga0209257_1002123 Ga0209257_100212324 338
212 3300025921 Ga0207652_10001329 Ga0207652_1000132910 338
213 3300027666 Ga0209282_1000002 Ga0209282_1000002655 338
214 3300031548 Ga0307408_100001672 Ga0307408_1000016725 338
215 3300031838 Ga0307518_10012873 Ga0307518_100128732 338
216 3300037471 Ga0395905_0071359 Ga0395905_0071359_1181_2212 338
217 3300044765 Ga0466970_0031031 Ga0466970_0031031_1754_2779 338
218 3300046460 Ga0495638_0002863 Ga0495638_0002863_7063_8085 338
219 3300046471 Ga0495650_0000177 Ga0495650_0000177_59250_60278 338
220 3300046474 Ga0495605_0000174 Ga0495605_0000174_6863_7894 338
221 3300046474 Ga0495605_0080571 Ga0495605_0080571_67_1089 338
222 3300046491 Ga0495584_0008327 Ga0495584_0008327_4143_5165 338
223 3300046500 Ga0495596_0017520 Ga0495596_0017520_1769_2845 338
224 3300046501 Ga0495607_0002892 Ga0495607_0002892_8485_9507 338
225 3300046506 Ga0495583_0005086 Ga0495583_0005086_5372_6394 338
226 3300046506 Ga0495583_0007931 Ga0495583_0007931_5326_6402 338
227 3300046518 Ga0495631_0003086 Ga0495631_0003086_3203_4279 338
228 3300046522 Ga0495643_0041937 Ga0495643_0041937_209_1234 338
229 3300046528 Ga0495642_0007136 Ga0495642_0007136_1727_2749 338
230 3300046538 Ga0495609_0005685 Ga0495609_0005685_4692_5714 338
231 3300046616 Ga0495668_0000051 Ga0495668_0000051_63016_64047 338
232 3300046616 Ga0495668_0000617 Ga0495668_0000617_10324_11385 338
233 3300046616 Ga0495668_0003830 Ga0495668_0003830_1246_2274 338
234 3300046616 Ga0495668_0008922 Ga0495668_0008922_1885_2907 338
235 3300046660 Ga0495625_0005549 Ga0495625_0005549_65_1087 338
236 3300046664 Ga0495659_0001570 Ga0495659_0001570_4168_5190 338
237 3300046665 Ga0495661_0007957 Ga0495661_0007957_5198_6220 338
238 3300046694 Ga0495649_0012961 Ga0495649_0012961_3740_4762 338
239 3300047318 Ga0495636_0010723 Ga0495636_0010723_1298_2320 338
240 3300047322 Ga0495680_0115458 Ga0495680_0115458_510_1589 338
241 3300047446 Ga0495679_003064 Ga0495679_003064_4424_5446 338
242 3300047447 Ga0495685_016354 Ga0495685_016354_956_1978 338
243 3300047470 Ga0495681_0004162 Ga0495681_0004162_4692_5714 338
244 3300047472 Ga0495686_0004730 Ga0495686_0004730_6941_7972 338
245 3300048927 Ga0496124_0046734 Ga0496124_0046734_1644_2672 338
246 3300048927 Ga0496124_0089330 Ga0496124_0089330_1434_2492 338
247 3300048928 Ga0496125_0040188 Ga0496125_0040188_1525_2583 338
248 3300049459 Ga0495678_000363 Ga0495678_000363_16035_17111 338
249 3300049460 Ga0495682_0000116 Ga0495682_0000116_32294_33370 338
250 3300049665 Ga0501227_005620 Ga0501227_005620_1593_2624 338
251 3300053136 Ga0500559_0101026 Ga0500559_0101026_209_1231 338
252 3300053177 Ga0500636_0003995 Ga0500636_0003995_6380_7402 338
253 3300053178 Ga0500637_0025663 Ga0500637_0025663_621_1643 338
254 3300053729 Ga0500625_005841 Ga0500625_005841_3549_4571 338
255 3300005365 Ga0070688_100007002 Ga0070688_1000070027 339
256 3300046452 Ga0495617_000002 Ga0495617_000002_501060_502115 339
257 3300046453 Ga0495627_000111 Ga0495627_000111_31291_32346 339
258 3300046471 Ga0495650_0016593 Ga0495650_0016593_969_2012 339
259 3300046474 Ga0495605_0000092 Ga0495605_0000092_42306_43361 339
260 3300046492 Ga0495585_0002186 Ga0495585_0002186_8991_10037 339
261 3300046492 Ga0495585_0088561 Ga0495585_0088561_47_1102 339
262 3300046499 Ga0495594_0003923 Ga0495594_0003923_6493_7536 339
263 3300046499 Ga0495594_0013780 Ga0495594_0013780_2166_3212 339
264 3300046500 Ga0495596_0002425 Ga0495596_0002425_6249_7304 339
265 3300046501 Ga0495607_0000740 Ga0495607_0000740_18018_19073 339
266 3300046506 Ga0495583_0039154 Ga0495583_0039154_842_1891 339
267 3300046513 Ga0495616_0000419 Ga0495616_0000419_12078_13133 339
268 3300046518 Ga0495631_0005356 Ga0495631_0005356_2190_3236 339
269 3300046518 Ga0495631_0035430 Ga0495631_0035430_479_1534 339
270 3300046518 Ga0495631_0061083 Ga0495631_0061083_304_1359 339
271 3300046519 Ga0495632_0000068 Ga0495632_0000068_88868_90070 339
272 3300046519 Ga0495632_0000154 Ga0495632_0000154_30996_32042 339
273 3300046519 Ga0495632_0001164 Ga0495632_0001164_9265_10308 339
274 3300046522 Ga0495643_0015987 Ga0495643_0015987_2398_3453 339
275 3300046523 Ga0495644_0003468 Ga0495644_0003468_4879_5934 339
276 3300046524 Ga0495648_0000367 Ga0495648_0000367_6816_7871 339
277 3300046526 Ga0495666_0001962 Ga0495666_0001962_3032_4078 339
278 3300046528 Ga0495642_0000133 Ga0495642_0000133_29199_30254 339
279 3300046528 Ga0495642_0000635 Ga0495642_0000635_14605_15648 339
280 3300046528 Ga0495642_0011435 Ga0495642_0011435_605_1651 339
281 3300046530 Ga0495654_0005959 Ga0495654_0005959_3407_4450 339
282 3300046542 Ga0495597_0001274 Ga0495597_0001274_12416_13471 339
283 3300046558 Ga0495633_0003469 Ga0495633_0003469_1534_2580 339
284 3300046616 Ga0495668_0001450 Ga0495668_0001450_14806_15861 339
285 3300046663 Ga0495635_0024837 Ga0495635_0024837_2735_3787 339
286 3300046665 Ga0495661_0001998 Ga0495661_0001998_11547_12593 339
287 3300046665 Ga0495661_0003914 Ga0495661_0003914_6424_7479 339
288 3300046665 Ga0495661_0020699 Ga0495661_0020699_2870_3916 339
289 3300046674 Ga0495588_0024895 Ga0495588_0024895_1217_2260 339
290 3300046684 Ga0495669_0000544 Ga0495669_0000544_10818_11861 339
291 3300046690 Ga0495624_0076557 Ga0495624_0076557_965_2008 339
292 3300046691 Ga0495670_0001576 Ga0495670_0001576_2215_3261 339
293 3300046691 Ga0495670_0041618 Ga0495670_0041618_379_1422 339
294 3300046692 Ga0495671_0000067 Ga0495671_0000067_31183_32238 339
295 3300046810 Ga0495660_0002107 Ga0495660_0002107_592_1794 339
296 3300047317 Ga0495604_0012089 Ga0495604_0012089_523_1575 339
297 3300047320 Ga0495672_0000168 Ga0495672_0000168_24554_25612 339
298 3300047321 Ga0495676_0000014 Ga0495676_0000014_16959_18002 339
299 3300047444 Ga0495675_0007616 Ga0495675_0007616_3301_4353 339
300 3300047445 Ga0495677_0004097 Ga0495677_0004097_240_1295 339
301 3300047470 Ga0495681_0008796 Ga0495681_0008796_1945_2991 339
302 3300047673 Ga0495593_0035580 Ga0495593_0035580_145_1197 339
303 3300048089 Ga0495614_0011463 Ga0495614_0011463_1153_2205 339
304 3300048905 Ga0496102_0000159 Ga0496102_0000159_67534_68589 339
305 3300048906 Ga0496103_0116139 Ga0496103_0116139_419_1462 339
306 3300048929 Ga0496126_0262316 Ga0496126_0262316_99_1274 339
307 3300049459 Ga0495678_007503 Ga0495678_007503_1718_2920 339
308 iso_pu_bacteria 2643221556 2643797988 339
309 iso_pu_bacteria 2643221684 2644473166 339
310 iso_pu_bacteria 2884811622 2884816785 339
311 iso_pu_bacteria 2884836552 2884837667 339
312 iso_pu_bacteria 2884852848 2884853959 339
313 iso_pu_bacteria 2896154374 2896154924 339
314 iso_pu_bacteria 8047673197 8047677991 339
315 3300002737 JGI25162J39368_1000025 JGI25162J39368_100002546 340
316 3300002737 JGI25162J39368_1000263 JGI25162J39368_100026346 340
317 3300003214 JGI25165J46597_1000054 JGI25165J46597_100005446 340
318 3300003323 rootH1_10216592 rootH1_1021659210 340
319 3300003751 Ga0055538_1000026 Ga0055538_1000026181 340
320 3300003752 Ga0055539_1000033 Ga0055539_1000033181 340
321 3300003756 Ga0055533_1000044 Ga0055533_1000044181 340
322 3300003759 Ga0055525_1000052 Ga0055525_1000052181 340
323 3300003841 Ga0055541_1000069 Ga0055541_100006946 340
324 3300005336 Ga0070680_100418778 Ga0070680_1004187781 340
325 3300005337 Ga0070682_100055362 Ga0070682_1000553623 340
326 3300005543 Ga0070672_100003675 Ga0070672_1000036754 340
327 3300005563 Ga0068855_100000016 Ga0068855_10000001673 340
328 3300005563 Ga0068855_100217134 Ga0068855_1002171342 340
329 3300005564 Ga0070664_100133740 Ga0070664_1001337403 340
330 3300005578 Ga0068854_100245784 Ga0068854_1002457842 340
331 3300009148 Ga0105243_10010095 Ga0105243_100100955 340
332 3300009174 Ga0105241_10033948 Ga0105241_100339483 340
333 3300014969 Ga0157376_10128880 Ga0157376_101288802 340
334 3300021388 Ga0213875_10070975 Ga0213875_100709752 340
335 3300025224 Ga0209784_100020 Ga0209784_100020111 340
336 3300025225 Ga0209566_100020 Ga0209566_100020111 340
337 3300025226 Ga0209674_100035 Ga0209674_100035111 340
338 3300025230 Ga0209563_100038 Ga0209563_100038111 340
339 3300025231 Ga0207427_100721 Ga0207427_1007213 340
340 3300025233 Ga0209437_100066 Ga0209437_100066270 340
341 3300025253 Ga0209677_100031 Ga0209677_10003151 340
342 3300025254 Ga0209148_1001432 Ga0209148_10014327 340
343 3300025261 Ga0209233_1000060 Ga0209233_1000060111 340
344 3300025909 Ga0207705_10005294 Ga0207705_100052946 340
345 3300025909 Ga0207705_10292566 Ga0207705_102925662 340
346 3300025919 Ga0207657_10020139 Ga0207657_100201396 340
347 3300025940 Ga0207691_10001913 Ga0207691_1000191319 340
348 3300025949 Ga0207667_10000206 Ga0207667_1000020672 340
349 3300026089 Ga0207648_10261934 Ga0207648_102619342 340
350 3300031239 Ga0265328_10043212 Ga0265328_100432121 340
351 3300031250 Ga0265331_10004725 Ga0265331_100047254 340
352 3300031251 Ga0265327_10000077 Ga0265327_10000077103 340
353 3300031251 Ga0265327_10022547 Ga0265327_100225476 340
354 3300037312 Ga0395899_0011729 Ga0395899_0011729_3755_4792 340
355 3300037418 Ga0395900_0035468 Ga0395900_0035468_958_1995 340
356 3300037418 Ga0395900_0420440 Ga0395900_0420440_79_1116 340
357 3300037466 Ga0395898_0097514 Ga0395898_0097514_356_1393 340
358 3300037471 Ga0395905_0107996 Ga0395905_0107996_1356_2393 340
359 3300037853 Ga0436364_1136587 Ga0436364_1136587_1987_3015 340
360 3300038443 Ga0395901_0000331 Ga0395901_0000331_36985_38022 340
361 3300041486 Ga0451807_2471212 Ga0451807_2471212_450_1478 340
362 3300041509 Ga0451843_1196518 Ga0451843_1196518_308_1336 340
363 3300042876 Ga0451577_0013684 Ga0451577_0013684_813_1841 340
364 3300044658 Ga0466972_0004731 Ga0466972_0004731_312_1349 340
365 3300044658 Ga0466972_0065196 Ga0466972_0065196_320_1357 340
366 3300044683 Ga0466965_0010919 Ga0466965_0010919_2754_3791 340
367 3300044683 Ga0466965_0110601 Ga0466965_0110601_20_1057 340
368 3300044684 Ga0466966_0002083 Ga0466966_0002083_11462_12499 340
369 3300044684 Ga0466966_0059914 Ga0466966_0059914_211_1248 340
370 3300044693 Ga0466961_0077714 Ga0466961_0077714_682_1719 340
371 3300044706 Ga0466964_0000583 Ga0466964_0000583_10325_11362 340
372 3300044712 Ga0453684_0011532 Ga0453684_0011532_6702_7730 340
373 3300044842 Ga0466957_0007577 Ga0466957_0007577_620_1657 340
374 3300044842 Ga0466957_0015010 Ga0466957_0015010_722_1759 340
375 3300045051 Ga0451576_0001926 Ga0451576_0001926_24928_25968 340
376 3300045051 Ga0451576_0004769 Ga0451576_0004769_9259_10299 340
377 3300045836 Ga0466958_0004216 Ga0466958_0004216_5037_6074 340
378 3300045836 Ga0466958_0140263 Ga0466958_0140263_285_1322 340
379 3300046457 Ga0495590_0043940 Ga0495590_0043940_365_1402 340
380 3300046474 Ga0495605_0000063 Ga0495605_0000063_68988_70025 340
381 3300046474 Ga0495605_0021101 Ga0495605_0021101_2029_3063 340
382 3300046500 Ga0495596_0023080 Ga0495596_0023080_1033_2079 340
383 3300046501 Ga0495607_0000380 Ga0495607_0000380_44400_45434 340
384 3300046501 Ga0495607_0009387 Ga0495607_0009387_5171_6208 340
385 3300046501 Ga0495607_0026552 Ga0495607_0026552_417_1454 340
386 3300046513 Ga0495616_0000111 Ga0495616_0000111_48856_49890 340
387 3300046522 Ga0495643_0005455 Ga0495643_0005455_4239_5276 340
388 3300046524 Ga0495648_0039206 Ga0495648_0039206_697_1734 340
389 3300046531 Ga0495665_0061154 Ga0495665_0061154_338_1372 340
390 3300046538 Ga0495609_0000002 Ga0495609_0000002_269711_270745 340
391 3300046542 Ga0495597_0072189 Ga0495597_0072189_61_1098 340
392 3300046665 Ga0495661_0000183 Ga0495661_0000183_61863_62897 340
393 3300046665 Ga0495661_0012052 Ga0495661_0012052_1885_2922 340
394 3300046674 Ga0495588_0028437 Ga0495588_0028437_151_1185 340
395 3300046694 Ga0495649_0006243 Ga0495649_0006243_2822_3871 340
396 3300046794 Ga0495589_0000083 Ga0495589_0000083_9124_10158 340
397 3300046794 Ga0495589_0001488 Ga0495589_0001488_8987_10024 340
398 3300046810 Ga0495660_0000625 Ga0495660_0000625_15873_16910 340
399 3300047315 Ga0495581_0020353 Ga0495581_0020353_181_1215 340
400 3300047320 Ga0495672_0002916 Ga0495672_0002916_6342_7379 340
401 3300047323 Ga0495683_0008042 Ga0495683_0008042_317_1354 340
402 3300047443 Ga0495687_000197 Ga0495687_000197_76537_77571 340
403 3300047443 Ga0495687_000701 Ga0495687_000701_27398_28435 340
404 3300047445 Ga0495677_0000030 Ga0495677_0000030_9124_10158 340
405 3300047445 Ga0495677_0012319 Ga0495677_0012319_116_1147 340
406 3300047472 Ga0495686_0000400 Ga0495686_0000400_25752_26801 340
407 3300048091 Ga0495626_0000111 Ga0495626_0000111_34445_35482 340
408 3300048091 Ga0495626_0001501 Ga0495626_0001501_9614_10648 340
409 3300048091 Ga0495626_0061097 Ga0495626_0061097_572_1621 340
410 3300048903 Ga0496100_0109550 Ga0496100_0109550_811_1872 340
411 3300048907 Ga0496104_0330407 Ga0496104_0330407_87_1121 340
412 3300048910 Ga0496107_0043352 Ga0496107_0043352_2162_3199 340
413 3300048916 Ga0496113_0114812 Ga0496113_0114812_649_1710 340
414 3300048927 Ga0496124_0028866 Ga0496124_0028866_1396_2433 340
415 3300049460 Ga0495682_0002583 Ga0495682_0002583_7084_8133 340
416 3300049775 Ga0501279_002611 Ga0501279_002611_377_1423 340
417 3300061719 Ga0466962_0015926 Ga0466962_0015926_2104_3141 340
418 iso_pu_bacteria 2808606418 2809144465 340
419 iso_pu_bacteria 2904424332 2904429292 340
420 3300005262 Ga0065165_1002020 Ga0065165_10020203 341
421 3300005563 Ga0068855_100056433 Ga0068855_1000564333 341
422 3300006177 Ga0075362_10061128 Ga0075362_100611282 341
423 3300009093 Ga0105240_10000952 Ga0105240_100009527 341
424 3300025913 Ga0207695_10009905 Ga0207695_100099057 341
425 3300037471 Ga0395905_0121927 Ga0395905_0121927_278_1345 341
426 3300046452 Ga0495617_017772 Ga0495617_017772_997_2052 341
427 3300046457 Ga0495590_0000007 Ga0495590_0000007_261187_262239 341
428 3300046457 Ga0495590_0000352 Ga0495590_0000352_17394_18443 341
429 3300046458 Ga0495591_000062 Ga0495591_000062_80239_81291 341
430 3300046459 Ga0495629_0023319 Ga0495629_0023319_2427_3479 341
431 3300046463 Ga0495653_0018376 Ga0495653_0018376_3859_4908 341
432 3300046463 Ga0495653_0056866 Ga0495653_0056866_257_1309 341
433 3300046471 Ga0495650_0000015 Ga0495650_0000015_398009_399034 341
434 3300046471 Ga0495650_0002395 Ga0495650_0002395_12353_13387 341
435 3300046472 Ga0495580_0027622 Ga0495580_0027622_917_1966 341
436 3300046474 Ga0495605_0025747 Ga0495605_0025747_290_1348 341
437 3300046491 Ga0495584_0000211 Ga0495584_0000211_32974_34026 341
438 3300046491 Ga0495584_0021307 Ga0495584_0021307_78_1148 341
439 3300046492 Ga0495585_0000336 Ga0495585_0000336_28892_29935 341
440 3300046492 Ga0495585_0009103 Ga0495585_0009103_2348_3397 341
441 3300046492 Ga0495585_0043150 Ga0495585_0043150_193_1245 341
442 3300046492 Ga0495585_0066836 Ga0495585_0066836_73_1143 341
443 3300046492 Ga0495585_0068283 Ga0495585_0068283_656_1711 341
444 3300046492 Ga0495585_0098985 Ga0495585_0098985_201_1253 341
445 3300046499 Ga0495594_0040131 Ga0495594_0040131_1141_2190 341
446 3300046499 Ga0495594_0053204 Ga0495594_0053204_449_1501 341
447 3300046500 Ga0495596_0001456 Ga0495596_0001456_2040_3095 341
448 3300046500 Ga0495596_0021422 Ga0495596_0021422_245_1297 341
449 3300046500 Ga0495596_0024209 Ga0495596_0024209_539_1591 341
450 3300046501 Ga0495607_0000852 Ga0495607_0000852_2958_4013 341
451 3300046501 Ga0495607_0003619 Ga0495607_0003619_6647_7699 341
452 3300046501 Ga0495607_0036460 Ga0495607_0036460_1728_2798 341
453 3300046506 Ga0495583_0000404 Ga0495583_0000404_16441_17490 341
454 3300046506 Ga0495583_0002237 Ga0495583_0002237_4262_5314 341
455 3300046507 Ga0495606_0034750 Ga0495606_0034750_2181_3230 341
456 3300046512 Ga0495610_0000423 Ga0495610_0000423_8016_9068 341
457 3300046512 Ga0495610_0011356 Ga0495610_0011356_3103_4176 341
458 3300046513 Ga0495616_0016401 Ga0495616_0016401_328_1383 341
459 3300046513 Ga0495616_0062010 Ga0495616_0062010_637_1689 341
460 3300046516 Ga0495628_0003636 Ga0495628_0003636_12508_13560 341
461 3300046518 Ga0495631_0014389 Ga0495631_0014389_2217_3269 341
462 3300046518 Ga0495631_0023008 Ga0495631_0023008_1790_2839 341
463 3300046518 Ga0495631_0089976 Ga0495631_0089976_167_1219 341
464 3300046519 Ga0495632_0002784 Ga0495632_0002784_11334_12383 341
465 3300046519 Ga0495632_0017573 Ga0495632_0017573_2119_3174 341
466 3300046519 Ga0495632_0039196 Ga0495632_0039196_827_1882 341
467 3300046520 Ga0495637_0000019 Ga0495637_0000019_146988_148040 341
468 3300046520 Ga0495637_0008473 Ga0495637_0008473_865_1935 341
469 3300046522 Ga0495643_0000196 Ga0495643_0000196_6825_7880 341
470 3300046522 Ga0495643_0023710 Ga0495643_0023710_600_1649 341
471 3300046522 Ga0495643_0030220 Ga0495643_0030220_770_1825 341
472 3300046522 Ga0495643_0041735 Ga0495643_0041735_1272_2324 341
473 3300046523 Ga0495644_0007335 Ga0495644_0007335_3052_4101 341
474 3300046523 Ga0495644_0013446 Ga0495644_0013446_237_1280 341
475 3300046523 Ga0495644_0017425 Ga0495644_0017425_1576_2646 341
476 3300046524 Ga0495648_0042819 Ga0495648_0042819_257_1327 341
477 3300046526 Ga0495666_0007127 Ga0495666_0007127_2136_3185 341
478 3300046528 Ga0495642_0028281 Ga0495642_0028281_470_1513 341
479 3300046528 Ga0495642_0034113 Ga0495642_0034113_89_1144 341
480 3300046528 Ga0495642_0073602 Ga0495642_0073602_117_1169 341
481 3300046529 Ga0495652_0005611 Ga0495652_0005611_5724_6773 341
482 3300046535 Ga0495586_0026641 Ga0495586_0026641_1188_2237 341
483 3300046538 Ga0495609_0001775 Ga0495609_0001775_2868_3926 341
484 3300046538 Ga0495609_0010893 Ga0495609_0010893_825_1895 341
485 3300046542 Ga0495597_0001432 Ga0495597_0001432_6195_7253 341
486 3300046557 Ga0495622_0029272 Ga0495622_0029272_1061_2113 341
487 3300046558 Ga0495633_0002519 Ga0495633_0002519_1180_2232 341
488 3300046558 Ga0495633_0028353 Ga0495633_0028353_279_1328 341
489 3300046616 Ga0495668_0000139 Ga0495668_0000139_68887_69945 341
490 3300046616 Ga0495668_0017919 Ga0495668_0017919_532_1581 341
491 3300046616 Ga0495668_0094424 Ga0495668_0094424_481_1551 341
492 3300046616 Ga0495668_0096414 Ga0495668_0096414_380_1432 341
493 3300046642 Ga0495634_0001242 Ga0495634_0001242_8160_9209 341
494 3300046648 Ga0495611_0000227 Ga0495611_0000227_7954_9006 341
495 3300046648 Ga0495611_0000625 Ga0495611_0000625_4151_5194 341
496 3300046648 Ga0495611_0031061 Ga0495611_0031061_1207_2277 341
497 3300046648 Ga0495611_0072071 Ga0495611_0072071_458_1510 341
498 3300046664 Ga0495659_0105855 Ga0495659_0105855_24_1076 341
499 3300046665 Ga0495661_0000377 Ga0495661_0000377_24165_25208 341
500 3300046665 Ga0495661_0016410 Ga0495661_0016410_1718_2767 341
501 3300046665 Ga0495661_0069543 Ga0495661_0069543_328_1380 341
502 3300046674 Ga0495588_0022869 Ga0495588_0022869_449_1507 341
503 3300046678 Ga0495599_0065791 Ga0495599_0065791_295_1347 341
504 3300046679 Ga0495623_0008515 Ga0495623_0008515_1380_2429 341
505 3300046684 Ga0495669_0000036 Ga0495669_0000036_38496_39551 341
506 3300046684 Ga0495669_0000786 Ga0495669_0000786_9275_10318 341
507 3300046689 Ga0495613_0023563 Ga0495613_0023563_1060_2112 341
508 3300046690 Ga0495624_0025298 Ga0495624_0025298_241_1293 341
509 3300046694 Ga0495649_0000281 Ga0495649_0000281_18009_19058 341
510 3300046694 Ga0495649_0000597 Ga0495649_0000597_20380_21435 341
511 3300046794 Ga0495589_0013735 Ga0495589_0013735_448_1497 341
512 3300046794 Ga0495589_0020895 Ga0495589_0020895_1511_2563 341
513 3300046809 Ga0495600_0039199 Ga0495600_0039199_584_1633 341
514 3300047320 Ga0495672_0000041 Ga0495672_0000041_41517_42569 341
515 3300047320 Ga0495672_0028266 Ga0495672_0028266_2006_3064 341
516 3300047323 Ga0495683_0002317 Ga0495683_0002317_6595_7647 341
517 3300047323 Ga0495683_0016126 Ga0495683_0016126_2686_3711 341
518 3300047323 Ga0495683_0061811 Ga0495683_0061811_316_1365 341
519 3300047444 Ga0495675_0002901 Ga0495675_0002901_5431_6480 341
520 3300047445 Ga0495677_0000138 Ga0495677_0000138_18101_19153 341
521 3300047445 Ga0495677_0007122 Ga0495677_0007122_2377_3429 341
522 3300047446 Ga0495679_001504 Ga0495679_001504_11410_12459 341
523 3300047446 Ga0495679_018850 Ga0495679_018850_331_1383 341
524 3300047446 Ga0495679_032568 Ga0495679_032568_556_1608 341
525 3300047446 Ga0495679_032594 Ga0495679_032594_555_1607 341
526 3300047447 Ga0495685_002335 Ga0495685_002335_4494_5564 341
527 3300047447 Ga0495685_033199 Ga0495685_033199_389_1441 341
528 3300047470 Ga0495681_0000057 Ga0495681_0000057_74164_75231 341
529 3300047470 Ga0495681_0008290 Ga0495681_0008290_4375_5427 341
530 3300047472 Ga0495686_0048916 Ga0495686_0048916_1326_2378 341
531 3300048088 Ga0495602_0001440 Ga0495602_0001440_3440_4492 341
532 3300048091 Ga0495626_0000102 Ga0495626_0000102_85340_86404 341
533 3300048091 Ga0495626_0013969 Ga0495626_0013969_1001_2056 341
534 3300048091 Ga0495626_0016980 Ga0495626_0016980_256_1326 341
535 3300048091 Ga0495626_0016999 Ga0495626_0016999_459_1502 341
536 3300048091 Ga0495626_0040021 Ga0495626_0040021_621_1676 341
537 3300048904 Ga0496101_0067851 Ga0496101_0067851_1200_2243 341
538 3300048906 Ga0496103_0000904 Ga0496103_0000904_11998_13038 341
539 3300048908 Ga0496105_0186607 Ga0496105_0186607_214_1266 341
540 3300048912 Ga0496109_0006947 Ga0496109_0006947_4149_5192 341
541 3300048916 Ga0496113_0000552 Ga0496113_0000552_5493_6536 341
542 3300048917 Ga0496114_0079916 Ga0496114_0079916_89_1135 341
543 3300048925 Ga0496122_0000169 Ga0496122_0000169_137241_138284 341
544 3300048926 Ga0496123_0000198 Ga0496123_0000198_89854_90897 341
545 3300048927 Ga0496124_0025174 Ga0496124_0025174_3739_4791 341
546 3300048927 Ga0496124_0159023 Ga0496124_0159023_219_1283 341
547 3300048928 Ga0496125_0000605 Ga0496125_0000605_52410_53453 341
548 3300049459 Ga0495678_000070 Ga0495678_000070_100749_101798 341
549 3300049459 Ga0495678_001845 Ga0495678_001845_4412_5446 341
550 3300049766 Ga0501269_000295 Ga0501269_000295_785_1858 341
551 3300053077 Ga0495601_0044660 Ga0495601_0044660_62_1114 341
552 iso_pu_bacteria 2857564685 2857565646 341
553 3300044842 Ga0466957_0017385 Ga0466957_0017385_587_1663 342
554 3300046457 Ga0495590_0007832 Ga0495590_0007832_2442_3506 342
555 3300046459 Ga0495629_0011465 Ga0495629_0011465_2275_3333 342
556 3300046474 Ga0495605_0105521 Ga0495605_0105521_170_1234 342
557 3300046491 Ga0495584_0042915 Ga0495584_0042915_457_1509 342
558 3300046500 Ga0495596_0011882 Ga0495596_0011882_2225_3286 342
559 3300046506 Ga0495583_0001506 Ga0495583_0001506_2587_3651 342
560 3300046506 Ga0495583_0003192 Ga0495583_0003192_9963_11024 342
561 3300046506 Ga0495583_0006758 Ga0495583_0006758_503_1579 342
562 3300046518 Ga0495631_0000226 Ga0495631_0000226_23330_24394 342
563 3300046522 Ga0495643_0020435 Ga0495643_0020435_508_1569 342
564 3300046522 Ga0495643_0062653 Ga0495643_0062653_894_1958 342
565 3300046524 Ga0495648_0007441 Ga0495648_0007441_7101_8165 342
566 3300046526 Ga0495666_0025001 Ga0495666_0025001_1838_2887 342
567 3300046529 Ga0495652_0051204 Ga0495652_0051204_2451_3500 342
568 3300046531 Ga0495665_0039174 Ga0495665_0039174_1297_2346 342
569 3300046531 Ga0495665_0158407 Ga0495665_0158407_17_1066 342
570 3300046538 Ga0495609_0002975 Ga0495609_0002975_6320_7381 342
571 3300046542 Ga0495597_0000063 Ga0495597_0000063_49726_50787 342
572 3300046542 Ga0495597_0002456 Ga0495597_0002456_7910_8959 342
573 3300046557 Ga0495622_0013694 Ga0495622_0013694_1955_3004 342
574 3300046616 Ga0495668_0002799 Ga0495668_0002799_3403_4467 342
575 3300046660 Ga0495625_0123871 Ga0495625_0123871_158_1207 342
576 3300046663 Ga0495635_0280017 Ga0495635_0280017_58_1107 342
577 3300046665 Ga0495661_0009209 Ga0495661_0009209_2540_3601 342
578 3300046665 Ga0495661_0024828 Ga0495661_0024828_832_1887 342
579 3300046665 Ga0495661_0087602 Ga0495661_0087602_92_1156 342
580 3300046674 Ga0495588_0009512 Ga0495588_0009512_1608_2657 342
581 3300046679 Ga0495623_0056344 Ga0495623_0056344_778_1836 342
582 3300046680 Ga0495646_0054272 Ga0495646_0054272_507_1556 342
583 3300046690 Ga0495624_0028123 Ga0495624_0028123_1558_2607 342
584 3300046692 Ga0495671_0004992 Ga0495671_0004992_6013_7074 342
585 3300046692 Ga0495671_0009872 Ga0495671_0009872_3371_4432 342
586 3300046794 Ga0495589_0000079 Ga0495589_0000079_10789_11850 342
587 3300046809 Ga0495600_0065389 Ga0495600_0065389_997_2046 342
588 3300047315 Ga0495581_0051260 Ga0495581_0051260_1104_2153 342
589 3300047317 Ga0495604_0010541 Ga0495604_0010541_428_1486 342
590 3300047317 Ga0495604_0039134 Ga0495604_0039134_1051_2100 342
591 3300047321 Ga0495676_0027281 Ga0495676_0027281_1154_2203 342
592 3300047443 Ga0495687_000049 Ga0495687_000049_43630_44691 342
593 3300047443 Ga0495687_000133 Ga0495687_000133_85208_86269 342
594 3300047447 Ga0495685_011659 Ga0495685_011659_749_1813 342
595 3300047470 Ga0495681_0001545 Ga0495681_0001545_3664_4725 342
596 3300047673 Ga0495593_0019789 Ga0495593_0019789_342_1391 342
597 3300048091 Ga0495626_0002427 Ga0495626_0002427_3459_4502 342
598 3300048905 Ga0496102_0022714 Ga0496102_0022714_3571_4617 342
599 3300048927 Ga0496124_0043903 Ga0496124_0043903_1947_2987 342
600 3300049459 Ga0495678_000105 Ga0495678_000105_71399_72463 342
601 iso_pu_bacteria 2643221664 2644356499 342
602 iso_pu_bacteria 2821131069 2821133856 342
603 iso_pu_bacteria 2857558681 2857560240 342
604 3300003322 rootL2_10010806 rootL2_100108063 343
605 3300003322 rootL2_10022331 rootL2_100223311 343
606 3300003763 Ga0055529_1000545 Ga0055529_10005454 343
607 3300010375 Ga0105239_10014685 Ga0105239_1001468511 343
608 3300013102 Ga0157371_10000001 Ga0157371_10000001718 343
609 3300015261 Ga0182006_1000014 Ga0182006_1000014176 343
610 3300015262 Ga0182007_10000011 Ga0182007_10000011201 343
611 3300015265 Ga0182005_1000014 Ga0182005_1000014184 343
612 3300021361 Ga0213872_10000002 Ga0213872_10000002329 343
613 3300021361 Ga0213872_10000269 Ga0213872_1000026923 343
614 3300025233 Ga0209437_105114 Ga0209437_1051141 343
615 3300025272 Ga0209455_1000049 Ga0209455_1000049301 343
616 3300031548 Ga0307408_100002920 Ga0307408_10000292010 343
617 3300032004 Ga0307414_10064118 Ga0307414_100641182 343
618 3300039447 Ga0436361_0152693 Ga0436361_0152693_1575_2621 343
619 3300039447 Ga0436361_0325950 Ga0436361_0325950_36382_37428 343
620 3300039447 Ga0436361_0390486 Ga0436361_0390486_8495_9541 343
621 3300039447 Ga0436361_0462569 Ga0436361_0462569_972_2018 343
622 3300039447 Ga0436361_0495861 Ga0436361_0495861_563_1609 343
623 3300046455 Ga0495603_0014816 Ga0495603_0014816_115_1200 343
624 3300046460 Ga0495638_0122770 Ga0495638_0122770_300_1367 343
625 3300046463 Ga0495653_0000073 Ga0495653_0000073_76661_77710 343
626 3300046471 Ga0495650_0004429 Ga0495650_0004429_3548_4762 343
627 3300046471 Ga0495650_0005538 Ga0495650_0005538_6964_8013 343
628 3300046474 Ga0495605_0004480 Ga0495605_0004480_5008_6084 343
629 3300046491 Ga0495584_0002654 Ga0495584_0002654_6634_7710 343
630 3300046499 Ga0495594_0001314 Ga0495594_0001314_7146_8225 343
631 3300046507 Ga0495606_0000043 Ga0495606_0000043_152040_153083 343
632 3300046507 Ga0495606_0011650 Ga0495606_0011650_4496_5548 343
633 3300046512 Ga0495610_0000004 Ga0495610_0000004_520038_521117 343
634 3300046512 Ga0495610_0033555 Ga0495610_0033555_1294_2343 343
635 3300046518 Ga0495631_0020636 Ga0495631_0020636_393_1445 343
636 3300046528 Ga0495642_0013023 Ga0495642_0013023_1257_2309 343
637 3300046528 Ga0495642_0015740 Ga0495642_0015740_496_1548 343
638 3300046530 Ga0495654_0015326 Ga0495654_0015326_2151_3227 343
639 3300046530 Ga0495654_0024513 Ga0495654_0024513_2025_3095 343
640 3300046535 Ga0495586_0021137 Ga0495586_0021137_939_1994 343
641 3300046538 Ga0495609_0032758 Ga0495609_0032758_40_1146 343
642 3300046538 Ga0495609_0065662 Ga0495609_0065662_366_1442 343
643 3300046542 Ga0495597_0001267 Ga0495597_0001267_1588_2634 343
644 3300046542 Ga0495597_0002036 Ga0495597_0002036_9420_10526 343
645 3300046542 Ga0495597_0002948 Ga0495597_0002948_7107_8183 343
646 3300046557 Ga0495622_0048462 Ga0495622_0048462_836_1915 343
647 3300046558 Ga0495633_0000113 Ga0495633_0000113_51307_52353 343
648 3300046558 Ga0495633_0001242 Ga0495633_0001242_6326_7396 343
649 3300046558 Ga0495633_0001263 Ga0495633_0001263_13516_14565 343
650 3300046616 Ga0495668_0005502 Ga0495668_0005502_5307_6383 343
651 3300046648 Ga0495611_0050875 Ga0495611_0050875_101_1147 343
652 3300046660 Ga0495625_0000176 Ga0495625_0000176_30965_32014 343
653 3300046663 Ga0495635_0188722 Ga0495635_0188722_238_1293 343
654 3300046665 Ga0495661_0050921 Ga0495661_0050921_258_1310 343
655 3300046674 Ga0495588_0002680 Ga0495588_0002680_3667_4728 343
656 3300046692 Ga0495671_0021118 Ga0495671_0021118_1862_2914 343
657 3300047317 Ga0495604_0031295 Ga0495604_0031295_2081_3133 343
658 3300047318 Ga0495636_0003707 Ga0495636_0003707_1422_2468 343
659 3300047320 Ga0495672_0003713 Ga0495672_0003713_9641_10717 343
660 3300047321 Ga0495676_0014944 Ga0495676_0014944_499_1578 343
661 3300047469 Ga0495673_0000006 Ga0495673_0000006_2814_3893 343
662 3300048091 Ga0495626_0005287 Ga0495626_0005287_3809_4915 343
663 3300048914 Ga0496111_0030066 Ga0496111_0030066_1323_2393 343
664 3300048918 Ga0496115_0015844 Ga0496115_0015844_3956_5008 343
665 3300048918 Ga0496115_0036967 Ga0496115_0036967_1647_2726 343
666 3300048918 Ga0496115_0041646 Ga0496115_0041646_1450_2589 343
667 3300048919 Ga0496116_0065845 Ga0496116_0065845_992_2062 343
668 3300048920 Ga0496117_0000001 Ga0496117_0000001_2344070_2345140 343
669 3300048921 Ga0496118_0000008 Ga0496118_0000008_462363_463433 343
670 3300048924 Ga0496121_0003166 Ga0496121_0003166_14456_15526 343
671 3300048924 Ga0496121_0032323 Ga0496121_0032323_305_1375 343
672 3300048925 Ga0496122_0001178 Ga0496122_0001178_19200_20270 343
673 3300048926 Ga0496123_0117539 Ga0496123_0117539_192_1262 343
674 3300049460 Ga0495682_0013718 Ga0495682_0013718_919_2025 343
675 3300053125 Ga0500618_000498 Ga0500618_000498_8779_9828 343
676 3300053145 Ga0500586_001055 Ga0500586_001055_3266_4315 343
677 iso_pu_bacteria 2600255292 2601671089 343
678 iso_pu_bacteria 2842711865 2842716687 343
679 iso_pu_bacteria 2857547612 2857547860 343
680 iso_pu_bacteria 2857553236 2857553952 343
681 iso_pu_bacteria 2885080285 2885081511 343
682 iso_pu_bacteria 2932410948 2932412460 343
683 iso_pu_bacteria 2932416698 2932419975 343
684 3300021361 Ga0213872_10000485 Ga0213872_1000048523 344
685 3300028577 Ga0265318_10011384 Ga0265318_100113844 344
686 3300030745 Ga0316182_1150583 Ga0316182_11505832 344
687 3300037312 Ga0395899_0000141 Ga0395899_0000141_100201_101298 344
688 3300039447 Ga0436361_0875769 Ga0436361_0875769_9265_10317 344
689 3300042139 Ga0450904_000388 Ga0450904_000388_3792_4883 344
690 3300046452 Ga0495617_007951 Ga0495617_007951_2251_3345 344
691 3300046453 Ga0495627_000006 Ga0495627_000006_147320_148387 344
692 3300046457 Ga0495590_0028580 Ga0495590_0028580_682_1737 344
693 3300046460 Ga0495638_0003777 Ga0495638_0003777_4556_5614 344
694 3300046460 Ga0495638_0004044 Ga0495638_0004044_10096_11190 344
695 3300046474 Ga0495605_0001450 Ga0495605_0001450_14385_15479 344
696 3300046491 Ga0495584_0000010 Ga0495584_0000010_41659_42720 344
697 3300046491 Ga0495584_0000456 Ga0495584_0000456_9688_10743 344
698 3300046491 Ga0495584_0000756 Ga0495584_0000756_20219_21313 344
699 3300046491 Ga0495584_0034256 Ga0495584_0034256_952_2046 344
700 3300046491 Ga0495584_0092040 Ga0495584_0092040_300_1394 344
701 3300046492 Ga0495585_0000006 Ga0495585_0000006_130726_131787 344
702 3300046492 Ga0495585_0000196 Ga0495585_0000196_25436_26491 344
703 3300046492 Ga0495585_0004665 Ga0495585_0004665_6223_7278 344
704 3300046492 Ga0495585_0004904 Ga0495585_0004904_4789_5850 344
705 3300046492 Ga0495585_0043206 Ga0495585_0043206_201_1295 344
706 3300046492 Ga0495585_0046506 Ga0495585_0046506_1269_2330 344
707 3300046492 Ga0495585_0059966 Ga0495585_0059966_631_1725 344
708 3300046492 Ga0495585_0099507 Ga0495585_0099507_307_1362 344
709 3300046492 Ga0495585_0127585 Ga0495585_0127585_234_1289 344
710 3300046492 Ga0495585_0163771 Ga0495585_0163771_44_1099 344
711 3300046500 Ga0495596_0000130 Ga0495596_0000130_16142_17203 344
712 3300046500 Ga0495596_0000867 Ga0495596_0000867_4657_5712 344
713 3300046500 Ga0495596_0004552 Ga0495596_0004552_883_1959 344
714 3300046500 Ga0495596_0007723 Ga0495596_0007723_974_2035 344
715 3300046501 Ga0495607_0015473 Ga0495607_0015473_3139_4233 344
716 3300046501 Ga0495607_0023548 Ga0495607_0023548_2624_3718 344
717 3300046501 Ga0495607_0091085 Ga0495607_0091085_377_1471 344
718 3300046501 Ga0495607_0141846 Ga0495607_0141846_108_1202 344
719 3300046506 Ga0495583_0000056 Ga0495583_0000056_7481_8575 344
720 3300046506 Ga0495583_0000084 Ga0495583_0000084_155452_156507 344
721 3300046506 Ga0495583_0001938 Ga0495583_0001938_2566_3624 344
722 3300046506 Ga0495583_0023098 Ga0495583_0023098_847_1908 344
723 3300046507 Ga0495606_0075850 Ga0495606_0075850_692_1753 344
724 3300046513 Ga0495616_0000081 Ga0495616_0000081_8991_10049 344
725 3300046513 Ga0495616_0004007 Ga0495616_0004007_1191_2246 344
726 3300046513 Ga0495616_0008370 Ga0495616_0008370_4227_5321 344
727 3300046513 Ga0495616_0018067 Ga0495616_0018067_1907_3001 344
728 3300046515 Ga0495620_0011666 Ga0495620_0011666_2316_3377 344
729 3300046518 Ga0495631_0006563 Ga0495631_0006563_4041_5135 344
730 3300046519 Ga0495632_0007068 Ga0495632_0007068_5662_6756 344
731 3300046520 Ga0495637_0004630 Ga0495637_0004630_4612_5670 344
732 3300046522 Ga0495643_0000213 Ga0495643_0000213_2613_3671 344
733 3300046523 Ga0495644_0006241 Ga0495644_0006241_463_1557 344
734 3300046523 Ga0495644_0007236 Ga0495644_0007236_2404_3498 344
735 3300046523 Ga0495644_0008045 Ga0495644_0008045_1888_2937 344
736 3300046523 Ga0495644_0019045 Ga0495644_0019045_813_1868 344
737 3300046523 Ga0495644_0039470 Ga0495644_0039470_702_1757 344
738 3300046524 Ga0495648_0010304 Ga0495648_0010304_774_1868 344
739 3300046525 Ga0495663_0007538 Ga0495663_0007538_760_1854 344
740 3300046528 Ga0495642_0002841 Ga0495642_0002841_1320_2381 344
741 3300046528 Ga0495642_0013331 Ga0495642_0013331_610_1704 344
742 3300046528 Ga0495642_0015935 Ga0495642_0015935_1411_2505 344
743 3300046530 Ga0495654_0026219 Ga0495654_0026219_1115_2179 344
744 3300046538 Ga0495609_0000518 Ga0495609_0000518_21096_22163 344
745 3300046538 Ga0495609_0001137 Ga0495609_0001137_4387_5481 344
746 3300046538 Ga0495609_0008340 Ga0495609_0008340_3505_4599 344
747 3300046538 Ga0495609_0054690 Ga0495609_0054690_473_1597 344
748 3300046542 Ga0495597_0002765 Ga0495597_0002765_7381_8475 344
749 3300046542 Ga0495597_0022799 Ga0495597_0022799_1551_2612 344
750 3300046558 Ga0495633_0001832 Ga0495633_0001832_12729_13790 344
751 3300046558 Ga0495633_0007240 Ga0495633_0007240_3711_4766 344
752 3300046558 Ga0495633_0015981 Ga0495633_0015981_2494_3588 344
753 3300046558 Ga0495633_0031970 Ga0495633_0031970_622_1716 344
754 3300046615 Ga0495656_0062731 Ga0495656_0062731_152_1246 344
755 3300046616 Ga0495668_0002601 Ga0495668_0002601_11834_12958 344
756 3300046616 Ga0495668_0004085 Ga0495668_0004085_7276_8370 344
757 3300046616 Ga0495668_0029948 Ga0495668_0029948_250_1311 344
758 3300046648 Ga0495611_0001871 Ga0495611_0001871_2714_3784 344
759 3300046648 Ga0495611_0002481 Ga0495611_0002481_60_1154 344
760 3300046648 Ga0495611_0006810 Ga0495611_0006810_3165_4259 344
761 3300046648 Ga0495611_0011083 Ga0495611_0011083_148_1203 344
762 3300046660 Ga0495625_0036211 Ga0495625_0036211_206_1300 344
763 3300046660 Ga0495625_0237649 Ga0495625_0237649_53_1108 344
764 3300046664 Ga0495659_0002496 Ga0495659_0002496_3374_4468 344
765 3300046665 Ga0495661_0003109 Ga0495661_0003109_9106_10167 344
766 3300046665 Ga0495661_0017343 Ga0495661_0017343_1227_2321 344
767 3300046665 Ga0495661_0083973 Ga0495661_0083973_559_1653 344
768 3300046691 Ga0495670_0000490 Ga0495670_0000490_10664_11719 344
769 3300046691 Ga0495670_0038493 Ga0495670_0038493_226_1281 344
770 3300046692 Ga0495671_0059770 Ga0495671_0059770_731_1825 344
771 3300046794 Ga0495589_0009391 Ga0495589_0009391_1770_2864 344
772 3300046810 Ga0495660_0000081 Ga0495660_0000081_69614_70669 344
773 3300046810 Ga0495660_0000264 Ga0495660_0000264_21415_22482 344
774 3300047318 Ga0495636_0020142 Ga0495636_0020142_1547_2641 344
775 3300047319 Ga0495674_0004551 Ga0495674_0004551_3091_4152 344
776 3300047320 Ga0495672_0005367 Ga0495672_0005367_4714_5808 344
777 3300047320 Ga0495672_0023172 Ga0495672_0023172_2211_3305 344
778 3300047323 Ga0495683_0000159 Ga0495683_0000159_23178_24233 344
779 3300047323 Ga0495683_0071040 Ga0495683_0071040_559_1653 344
780 3300047443 Ga0495687_000199 Ga0495687_000199_55312_56406 344
781 3300047445 Ga0495677_0008702 Ga0495677_0008702_1940_3034 344
782 3300047445 Ga0495677_0063404 Ga0495677_0063404_289_1344 344
783 3300047447 Ga0495685_000010 Ga0495685_000010_63952_65046 344
784 3300047469 Ga0495673_0015116 Ga0495673_0015116_57_1151 344
785 3300047470 Ga0495681_0010749 Ga0495681_0010749_972_2033 344
786 3300047470 Ga0495681_0049560 Ga0495681_0049560_822_1883 344
787 3300048091 Ga0495626_0001547 Ga0495626_0001547_2912_3970 344
788 3300048091 Ga0495626_0016819 Ga0495626_0016819_999_2093 344
789 3300048919 Ga0496116_0015162 Ga0496116_0015162_1314_2381 344
790 3300049459 Ga0495678_000042 Ga0495678_000042_39149_40204 344
791 3300049459 Ga0495678_002051 Ga0495678_002051_67_1161 344
792 3300049460 Ga0495682_0000126 Ga0495682_0000126_4441_5535 344
793 3300049460 Ga0495682_0007570 Ga0495682_0007570_195_1289 344
794 3300050496 nmdc:mga07m45_99065_c1 nmdc:mga07m45_99065_c1_548_1594 344
795 3300028800 Ga0265338_10000560 Ga0265338_1000056028 345
796 3300046452 Ga0495617_000529 Ga0495617_000529_8823_9875 345
797 3300046457 Ga0495590_0000004 Ga0495590_0000004_252220_253281 345
798 3300046460 Ga0495638_0000023 Ga0495638_0000023_307076_308164 345
799 3300046471 Ga0495650_0000124 Ga0495650_0000124_29290_30363 345
800 3300046471 Ga0495650_0001900 Ga0495650_0001900_11085_12173 345
801 3300046474 Ga0495605_0024848 Ga0495605_0024848_270_1337 345
802 3300046500 Ga0495596_0000217 Ga0495596_0000217_35195_36262 345
803 3300046500 Ga0495596_0001704 Ga0495596_0001704_3738_4811 345
804 3300046501 Ga0495607_0000692 Ga0495607_0000692_19815_20909 345
805 3300046506 Ga0495583_0000299 Ga0495583_0000299_73546_74634 345
806 3300046507 Ga0495606_0000184 Ga0495606_0000184_24608_25702 345
807 3300046507 Ga0495606_0002573 Ga0495606_0002573_10997_12055 345
808 3300046507 Ga0495606_0018541 Ga0495606_0018541_2325_3377 345
809 3300046512 Ga0495610_0022485 Ga0495610_0022485_1450_2502 345
810 3300046522 Ga0495643_0000211 Ga0495643_0000211_84243_85304 345
811 3300046522 Ga0495643_0011286 Ga0495643_0011286_1150_2217 345
812 3300046524 Ga0495648_0000084 Ga0495648_0000084_64614_65702 345
813 3300046524 Ga0495648_0000497 Ga0495648_0000497_7362_8435 345
814 3300046538 Ga0495609_0000363 Ga0495609_0000363_30542_31615 345
815 3300046538 Ga0495609_0002348 Ga0495609_0002348_5537_6604 345
816 3300046542 Ga0495597_0000022 Ga0495597_0000022_93934_94995 345
817 3300046557 Ga0495622_0000074 Ga0495622_0000074_82560_83648 345
818 3300046558 Ga0495633_0000421 Ga0495633_0000421_32547_33635 345
819 3300046616 Ga0495668_0000589 Ga0495668_0000589_8623_9684 345
820 3300046660 Ga0495625_0000073 Ga0495625_0000073_54841_55929 345
821 3300046660 Ga0495625_0178238 Ga0495625_0178238_326_1384 345
822 3300047320 Ga0495672_0000705 Ga0495672_0000705_26540_27613 345
823 3300047320 Ga0495672_0013932 Ga0495672_0013932_4092_5159 345
824 3300047321 Ga0495676_0019137 Ga0495676_0019137_2451_3518 345
825 3300047323 Ga0495683_0042916 Ga0495683_0042916_1206_2258 345
826 3300047443 Ga0495687_001964 Ga0495687_001964_124_1185 345
827 3300047443 Ga0495687_002227 Ga0495687_002227_123_1184 345
828 3300047445 Ga0495677_0012818 Ga0495677_0012818_1178_2245 345
829 iso_pu_bacteria 2738541297 2738825265 345
830 iso_pu_bacteria 2738541357 2739149062 345
831 iso_pu_bacteria 2738543003 2739190981 345
832 iso_pu_bacteria 2738543026 2739317458 345
833 iso_pu_bacteria 2738543029 2739335699 345
834 3300015261 Ga0182006_1003369 Ga0182006_10033697 346
835 3300015262 Ga0182007_10001225 Ga0182007_1000122515 346
836 3300015265 Ga0182005_1000540 Ga0182005_10005407 346
837 3300046462 Ga0495651_0162472 Ga0495651_0162472_270_1322 346
838 3300046507 Ga0495606_0017285 Ga0495606_0017285_1586_2647 346
839 3300046524 Ga0495648_0005495 Ga0495648_0005495_3267_4343 346
840 3300046538 Ga0495609_0010339 Ga0495609_0010339_2452_3513 346
841 3300046675 Ga0495657_0137111 Ga0495657_0137111_65_1117 346
842 3300046694 Ga0495649_0005172 Ga0495649_0005172_6247_7302 346
843 3300046810 Ga0495660_0000784 Ga0495660_0000784_9291_10352 346
844 3300047472 Ga0495686_0013129 Ga0495686_0013129_483_1544 346
845 3300048917 Ga0496114_0022332 Ga0496114_0022332_3762_4814 346
846 3300048919 Ga0496116_0000005 Ga0496116_0000005_447382_448434 346
847 3300048919 Ga0496116_0000005 Ga0496116_0000005_709494_710546 346
848 3300048924 Ga0496121_0000029 Ga0496121_0000029_122470_123522 346
849 3300048924 Ga0496121_0000029 Ga0496121_0000029_385569_386621 346
850 3300048928 Ga0496125_0008347 Ga0496125_0008347_4501_5556 346
851 3300053119 Ga0500595_008866 Ga0500595_008866_2663_3715 346
852 3300053140 Ga0500573_0107549 Ga0500573_0107549_286_1338 346
853 iso_pu_bacteria 2818991436 2819543090 346
854 3300025246 Ga0209646_1000117 Ga0209646_1000117117 347
855 3300046506 Ga0495583_0000088 Ga0495583_0000088_87303_88358 347
856 3300046512 Ga0495610_0022621 Ga0495610_0022621_805_1863 347
857 3300046522 Ga0495643_0000227 Ga0495643_0000227_82691_83749 347
858 3300046524 Ga0495648_0009255 Ga0495648_0009255_2624_3679 347
859 3300046524 Ga0495648_0076078 Ga0495648_0076078_432_1490 347
860 3300046525 Ga0495663_0002462 Ga0495663_0002462_2132_3187 347
861 3300046538 Ga0495609_0029535 Ga0495609_0029535_1317_2375 347
862 3300046542 Ga0495597_0028854 Ga0495597_0028854_1121_2176 347
863 3300046615 Ga0495656_0012612 Ga0495656_0012612_1360_2415 347
864 3300046660 Ga0495625_0016330 Ga0495625_0016330_2249_3343 347
865 3300046664 Ga0495659_0000004 Ga0495659_0000004_69120_70214 347
866 3300046664 Ga0495659_0016971 Ga0495659_0016971_694_1749 347
867 3300046692 Ga0495671_0000213 Ga0495671_0000213_19121_20215 347
868 3300046692 Ga0495671_0020398 Ga0495671_0020398_1677_2735 347
869 3300046694 Ga0495649_0060689 Ga0495649_0060689_249_1307 347
870 3300046810 Ga0495660_0039769 Ga0495660_0039769_1050_2144 347
871 3300047318 Ga0495636_0005753 Ga0495636_0005753_573_1628 347
872 3300047320 Ga0495672_0000045 Ga0495672_0000045_95644_96738 347
873 3300047320 Ga0495672_0000182 Ga0495672_0000182_82687_83745 347
874 3300047445 Ga0495677_0041321 Ga0495677_0041321_351_1409 347
875 3300047447 Ga0495685_031599 Ga0495685_031599_668_1723 347
876 3300048090 Ga0495615_0001527 Ga0495615_0001527_1680_2735 347
877 3300048905 Ga0496102_0000088 Ga0496102_0000088_39742_40797 347
878 3300048905 Ga0496102_0020050 Ga0496102_0020050_2975_4030 347
879 3300048906 Ga0496103_0050564 Ga0496103_0050564_1044_2099 347
880 3300049459 Ga0495678_000147 Ga0495678_000147_1588_2646 347
881 3300053118 Ga0500594_0010822 Ga0500594_0010822_122_1180 347
882 iso_pu_bacteria 2738541280 2738738865 347
883 iso_pu_bacteria 2738541300 2738844765 347
884 iso_pu_bacteria 2738543018 2739276290 347
885 iso_pu_bacteria 2738543030 2739345186 347
886 3300003771 Ga0055526_1000020 Ga0055526_100002076 348
887 3300015261 Ga0182006_1000044 Ga0182006_10000448 348
888 3300015265 Ga0182005_1000018 Ga0182005_1000018143 348
889 3300025295 Ga0209564_1000006 Ga0209564_1000006206 348
890 3300046471 Ga0495650_0000169 Ga0495650_0000169_44356_45426 348
891 3300046507 Ga0495606_0000291 Ga0495606_0000291_79525_80598 348
892 3300046507 Ga0495606_0027053 Ga0495606_0027053_2181_3251 348
893 3300046528 Ga0495642_0019968 Ga0495642_0019968_1376_2458 348
894 3300046557 Ga0495622_0000003 Ga0495622_0000003_77121_78194 348
895 3300030731 Ga0316177_1137694 Ga0316177_11376943 349
896 iso_pu_bacteria 2511231003 2511247818 349
897 iso_pu_bacteria 2548876994 2550694068 349
898 3300002704 JGI25155J39150_1000076 JGI25155J39150_100007632 350
899 3300002704 JGI25155J39150_1000101 JGI25155J39150_100010124 350
900 3300002705 JGI25156J39149_1000032 JGI25156J39149_100003244 350
901 3300002737 JGI25162J39368_1004561 JGI25162J39368_10045614 350
902 3300002738 JGI25154J39366_1000095 JGI25154J39366_100009532 350
903 3300002738 JGI25154J39366_1000123 JGI25154J39366_100012311 350
904 3300002741 JGI25157J39369_1000388 JGI25157J39369_10003888 350
905 3300003758 Ga0055532_1000083 Ga0055532_100008369 350
906 3300005563 Ga0068855_100015153 Ga0068855_1000151536 350
907 3300005563 Ga0068855_100121150 Ga0068855_1001211503 350
908 3300005614 Ga0068856_100197863 Ga0068856_1001978632 350
909 3300009093 Ga0105240_10001988 Ga0105240_100019886 350
910 3300009093 Ga0105240_10008537 Ga0105240_100085373 350
911 3300009551 Ga0105238_10026479 Ga0105238_100264793 350
912 3300013100 Ga0157373_10025853 Ga0157373_100258532 350
913 3300025206 Ga0209435_100013 Ga0209435_10001344 350
914 3300025206 Ga0209435_100072 Ga0209435_10007246 350
915 3300025229 Ga0209147_100030 Ga0209147_100030310 350
916 3300025233 Ga0209437_100317 Ga0209437_10031756 350
917 3300025242 Ga0209258_100542 Ga0209258_10054223 350
918 3300025246 Ga0209646_1000021 Ga0209646_100002188 350
919 3300025246 Ga0209646_1000034 Ga0209646_100003444 350
920 3300025250 Ga0209026_1000022 Ga0209026_100002244 350
921 3300025250 Ga0209026_1001718 Ga0209026_10017183 350
922 3300025256 Ga0209759_1000018 Ga0209759_100001844 350
923 3300025256 Ga0209759_1000324 Ga0209759_100032441 350
924 3300025913 Ga0207695_10000896 Ga0207695_1000089625 350
925 3300025913 Ga0207695_10007805 Ga0207695_1000780510 350
926 3300025949 Ga0207667_10014671 Ga0207667_100146712 350
927 3300025949 Ga0207667_10131487 Ga0207667_101314873 350
928 3300026078 Ga0207702_10262766 Ga0207702_102627662 350
929 3300046529 Ga0495652_0003589 Ga0495652_0003589_13460_14524 350
930 3300046529 Ga0495652_0013202 Ga0495652_0013202_3460_4527 350
931 3300046543 Ga0495645_0002586 Ga0495645_0002586_3675_4739 350
932 3300046660 Ga0495625_0002486 Ga0495625_0002486_1061_2122 350
933 3300046680 Ga0495646_0102857 Ga0495646_0102857_446_1510 350
934 3300048905 Ga0496102_0134780 Ga0496102_0134780_809_1891 350
935 3300048919 Ga0496116_0005797 Ga0496116_0005797_9546_10610 350
936 3300048924 Ga0496121_0037463 Ga0496121_0037463_1542_2603 350
937 3300048924 Ga0496121_0104595 Ga0496121_0104595_616_1680 350
938 3300048925 Ga0496122_0000134 Ga0496122_0000134_57770_58834 350
939 3300048926 Ga0496123_0000583 Ga0496123_0000583_4289_5353 350
940 3300048928 Ga0496125_0000433 Ga0496125_0000433_70994_72055 350
941 3300048928 Ga0496125_0037113 Ga0496125_0037113_1564_2628 350
942 3300053077 Ga0495601_0037386 Ga0495601_0037386_35_1102 350

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ehn-assembly1.cif.gz_A human mthfd2 in complex with compound 21 and 9 0.7103 21 123
4pzp-assembly1.cif.gz_A substrate-free structure of d-alanine carrier protein ligase dlta from bacillus cereus 0.7028 9 126
3dhv-assembly1.cif.gz_A crystal structure of dlta protein in complex with d-alanine adenylate 0.6909 9 126
7xbv-assembly1.cif.gz_A crystal structure of the adenylation domain of cmng in complex with ampcpp 0.6834 17 85
3fce-assembly1.cif.gz_A crystal structure of bacillus cereus d-alanyl carrier protein ligase dlta in complex with atp: implications for adenylation mechanism 0.6677 9 126
ID Description Score Start End Superfamily
4pzpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.7028 9 126 3.40.50.12780
af_B7EBJ6_9_283_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.6971 9 121 3.40.50.12780
af_Q9VDN3_1_370_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6666 14 121 3.40.50.2300
af_A0A1D6HRG6_59_454_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.6589 10 95 3.40.50.12780
5u95C02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6577 17 122 3.40.50.980
ID Description Score Start End GO Terms
AF-A0A7W2ET23-F1-model_v4 Leucyl aminopeptidase (Aminopeptidase T) 0.9962 20 350
AF-A0A0Q5CN67-F1-model_v4 Leucyl aminopeptidase 0.9957 15 350
AF-A0A2U2I6Y5-F1-model_v4 Leucyl aminopeptidase 0.9947 12 350 GO:0046872
AF-A0A6I3SZG3-F1-model_v4 Leucyl aminopeptidase 0.993 13 350
AF-A0A4Q3HSP6-F1-model_v4 deleted 0.9921 218 350

Feature Viewer

pLDDT pTM Quality
93.46 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map