F486321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 940 | 416 | 937 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0454926|Ga0501040_0454926_47_574 |
| Length | 175 |
| Sequence | MAPSLWRPSSIVLIGCIRKGESMNEASGTVDAVGIATILKSLPHRYPFLMVDRVVNIRGEEFGMGIKNVTINEPQFLGHFPDNPIFPGVLLIEGMAQTAGVLCVLAWPKGSPPPYVYFMTIDEAKFRKPVVPGDTVEFHMTMVRRRKNMWWYRGEAKVDGELVAEATLSAMMGER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 253 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 254 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 255 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 256 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 257 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 258 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 259 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 260 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 390 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 391 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 409 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 410 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 416 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.47 |
| Metatranscriptomes | 0.21 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.79 |
| Nodule | 0 |
| Rhizoplane | 5.43 |
| Rhizosphere | 87.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10010240 | 3300001991 | Bacteria | 1671 |
| 2 | JGI24750J21931_1005052 | 3300002070 | Bacteria | 1615 |
| 3 | JGI24744J21845_10000313 | 3300002077 | Bacteria | 8167 |
| 4 | JGI24034J26672_10002721 | 3300002239 | Bacteria | 2439 |
| 5 | JGI24742J22300_10003208 | 3300002244 | Bacteria | 2647 |
| 6 | JGI24751J29686_10033142 | 3300002459 | Bacteria | 1071 |
| 7 | rootH1_10126579 | 3300003316 | Bacteria | 2940 |
| 8 | rootH2_10349800 | 3300003320 | Bacteria | 1169 |
| 9 | rootL2_10111746 | 3300003322 | Bacteria | 7827 |
| 10 | Ga0055536_1028189 | 3300003781 | Bacteria | 1535 |
| 11 | JGI25405J52794_10006356 | 3300003911 | Bacteria | 2158 |
| 12 | JGI25405J52794_10010918 | 3300003911 | Bacteria | 1734 |
| 13 | Ga0058860_11801317 | 3300004801 | Bacteria | 536 |
| 14 | Ga0065704_10471892 | 3300005289 | Bacteria | 683 |
| 15 | Ga0070658_10176257 | 3300005327 | Bacteria | 1798 |
| 16 | Ga0070676_10150439 | 3300005328 | Bacteria | 1489 |
| 17 | Ga0070683_100039407 | 3300005329 | Bacteria | 4337 |
| 18 | Ga0070670_100016106 | 3300005331 | Bacteria | 6416 |
| 19 | Ga0070670_100084996 | 3300005331 | Bacteria | 2719 |
| 20 | Ga0068869_100772394 | 3300005334 | Bacteria | 824 |
| 21 | Ga0070666_10003883 | 3300005335 | Bacteria | 9078 |
| 22 | Ga0070666_10192017 | 3300005335 | Bacteria | 1435 |
| 23 | Ga0070680_100311056 | 3300005336 | Bacteria | 1337 |
| 24 | Ga0070680_101087240 | 3300005336 | Bacteria | 691 |
| 25 | Ga0068868_100121320 | 3300005338 | Bacteria | 2132 |
| 26 | Ga0068868_100585545 | 3300005338 | Bacteria | 987 |
| 27 | Ga0070660_100041561 | 3300005339 | Bacteria | 3505 |
| 28 | Ga0070687_101036976 | 3300005343 | Bacteria | 596 |
| 29 | Ga0070661_100013819 | 3300005344 | Bacteria | 5674 |
| 30 | Ga0070692_10583006 | 3300005345 | Bacteria | 737 |
| 31 | Ga0070668_100046181 | 3300005347 | Bacteria | 3343 |
| 32 | Ga0070668_100999569 | 3300005347 | Bacteria | 752 |
| 33 | Ga0070669_100054968 | 3300005353 | Bacteria | 2917 |
| 34 | Ga0070675_100097445 | 3300005354 | Bacteria | 2472 |
| 35 | Ga0070675_101089942 | 3300005354 | Bacteria | 734 |
| 36 | Ga0070671_100003576 | 3300005355 | Bacteria | 12156 |
| 37 | Ga0070674_100094227 | 3300005356 | Bacteria | 2168 |
| 38 | Ga0070674_100370433 | 3300005356 | Bacteria | 1162 |
| 39 | Ga0070674_100595920 | 3300005356 | Bacteria | 933 |
| 40 | Ga0070673_100015590 | 3300005364 | Bacteria | 5345 |
| 41 | Ga0070673_101196151 | 3300005364 | Bacteria | 712 |
| 42 | Ga0070688_100026564 | 3300005365 | Bacteria | 3441 |
| 43 | Ga0070688_101035173 | 3300005365 | Bacteria | 654 |
| 44 | Ga0070659_100058332 | 3300005366 | Bacteria | 3046 |
| 45 | Ga0070659_101039357 | 3300005366 | Bacteria | 720 |
| 46 | Ga0070667_100029202 | 3300005367 | Bacteria | 4593 |
| 47 | Ga0070709_10008529 | 3300005434 | Bacteria | 5632 |
| 48 | Ga0070709_10032134 | 3300005434 | Bacteria | 3163 |
| 49 | Ga0070709_10155738 | 3300005434 | Bacteria | 1584 |
| 50 | Ga0070709_10816516 | 3300005434 | Bacteria | 733 |
| 51 | Ga0070709_10883600 | 3300005434 | Bacteria | 706 |
| 52 | Ga0070714_100002895 | 3300005435 | Bacteria | 12704 |
| 53 | Ga0070714_100206652 | 3300005435 | Bacteria | 1798 |
| 54 | Ga0070714_100359938 | 3300005435 | Bacteria | 1368 |
| 55 | Ga0070714_100475997 | 3300005435 | Bacteria | 1189 |
| 56 | Ga0070714_101345751 | 3300005435 | Bacteria | 697 |
| 57 | Ga0070713_100000522 | 3300005436 | Bacteria | 24346 |
| 58 | Ga0070713_100011440 | 3300005436 | Bacteria | 6463 |
| 59 | Ga0070713_100103130 | 3300005436 | Bacteria | 2475 |
| 60 | Ga0070713_101544619 | 3300005436 | Bacteria | 644 |
| 61 | Ga0070710_10007403 | 3300005437 | Bacteria | 5314 |
| 62 | Ga0070710_10011480 | 3300005437 | Bacteria | 4376 |
| 63 | Ga0070701_10077299 | 3300005438 | Bacteria | 1793 |
| 64 | Ga0070711_100015376 | 3300005439 | Bacteria | 4843 |
| 65 | Ga0070711_100139364 | 3300005439 | Bacteria | 1816 |
| 66 | Ga0070711_100355271 | 3300005439 | Bacteria | 1179 |
| 67 | Ga0070711_100425696 | 3300005439 | Bacteria | 1082 |
| 68 | Ga0070705_100012203 | 3300005440 | Bacteria | 4362 |
| 69 | Ga0070700_100046983 | 3300005441 | Bacteria | 2669 |
| 70 | Ga0070694_100141017 | 3300005444 | Bacteria | 1751 |
| 71 | Ga0070708_100045800 | 3300005445 | Bacteria | 3856 |
| 72 | Ga0070708_100512822 | 3300005445 | Bacteria | 1131 |
| 73 | Ga0070663_100153321 | 3300005455 | Bacteria | 1768 |
| 74 | Ga0070662_100045218 | 3300005457 | Bacteria | 3157 |
| 75 | Ga0070662_100747252 | 3300005457 | Bacteria | 829 |
| 76 | Ga0070681_10279122 | 3300005458 | Bacteria | 1581 |
| 77 | Ga0068867_100011501 | 3300005459 | Bacteria | 6247 |
| 78 | Ga0070685_10003961 | 3300005466 | Bacteria | 7483 |
| 79 | Ga0070707_100340290 | 3300005468 | Bacteria | 1457 |
| 80 | Ga0070698_100132969 | 3300005471 | Bacteria | 2442 |
| 81 | Ga0070698_100298832 | 3300005471 | Bacteria | 1541 |
| 82 | Ga0070698_100939994 | 3300005471 | Bacteria | 811 |
| 83 | Ga0070699_100027933 | 3300005518 | Bacteria | 4867 |
| 84 | Ga0070699_100090652 | 3300005518 | Bacteria | 2672 |
| 85 | Ga0070679_100110386 | 3300005530 | Bacteria | 2736 |
| 86 | Ga0070684_100009679 | 3300005535 | Bacteria | 7603 |
| 87 | Ga0070684_100081079 | 3300005535 | Bacteria | 2871 |
| 88 | Ga0068853_100162531 | 3300005539 | Bacteria | 2016 |
| 89 | Ga0068853_100347238 | 3300005539 | Bacteria | 1380 |
| 90 | Ga0070672_100704898 | 3300005543 | Bacteria | 884 |
| 91 | Ga0070686_100007896 | 3300005544 | Bacteria | 5949 |
| 92 | Ga0070686_100898859 | 3300005544 | Bacteria | 720 |
| 93 | Ga0070693_100272157 | 3300005547 | Bacteria | 1131 |
| 94 | Ga0070665_100145699 | 3300005548 | Bacteria | 2371 |
| 95 | Ga0070704_101768070 | 3300005549 | Bacteria | 572 |
| 96 | Ga0068855_100510734 | 3300005563 | Bacteria | 1305 |
| 97 | Ga0068854_100039606 | 3300005578 | Bacteria | 3321 |
| 98 | Ga0068854_100281684 | 3300005578 | Bacteria | 1339 |
| 99 | Ga0068856_100194447 | 3300005614 | Bacteria | 2042 |
| 100 | Ga0068856_100236265 | 3300005614 | Bacteria | 1843 |
| 101 | Ga0070702_100002486 | 3300005615 | Bacteria | 7976 |
| 102 | Ga0068852_100007204 | 3300005616 | Bacteria | 8107 |
| 103 | Ga0068859_100102927 | 3300005617 | Bacteria | 2913 |
| 104 | Ga0068864_100025576 | 3300005618 | Bacteria | 4973 |
| 105 | Ga0068866_10077946 | 3300005718 | Bacteria | 1771 |
| 106 | Ga0068861_100032968 | 3300005719 | Bacteria | 3818 |
| 107 | Ga0068870_10002509 | 3300005840 | Bacteria | 7660 |
| 108 | Ga0068858_100001353 | 3300005842 | Bacteria | 25256 |
| 109 | Ga0068858_102156578 | 3300005842 | Bacteria | 551 |
| 110 | Ga0068860_101235203 | 3300005843 | Bacteria | 768 |
| 111 | Ga0081455_10000853 | 3300005937 | Bacteria | 39265 |
| 112 | Ga0081455_10003196 | 3300005937 | Bacteria | 18983 |
| 113 | Ga0081455_10005182 | 3300005937 | Bacteria | 14347 |
| 114 | Ga0081455_10017568 | 3300005937 | Bacteria | 6850 |
| 115 | Ga0081455_10018403 | 3300005937 | Bacteria | 6658 |
| 116 | Ga0081455_10075759 | 3300005937 | Bacteria | 2774 |
| 117 | Ga0081455_10307322 | 3300005937 | Bacteria | 1135 |
| 118 | Ga0081455_10343728 | 3300005937 | Bacteria | 1055 |
| 119 | Ga0081538_10061297 | 3300005981 | Bacteria | 2154 |
| 120 | Ga0081540_1001438 | 3300005983 | Bacteria | 20573 |
| 121 | Ga0081540_1016305 | 3300005983 | Bacteria | 4655 |
| 122 | Ga0081540_1040839 | 3300005983 | Bacteria | 2413 |
| 123 | Ga0081540_1049164 | 3300005983 | Bacteria | 2106 |
| 124 | Ga0081539_10144285 | 3300005985 | Bacteria | 1153 |
| 125 | Ga0070717_10000447 | 3300006028 | Bacteria | 26109 |
| 126 | Ga0070717_10026215 | 3300006028 | Bacteria | 4648 |
| 127 | Ga0070717_10327619 | 3300006028 | Bacteria | 1366 |
| 128 | Ga0070717_10621699 | 3300006028 | Bacteria | 980 |
| 129 | Ga0075365_10026205 | 3300006038 | Bacteria | 3699 |
| 130 | Ga0075365_10105076 | 3300006038 | Bacteria | 1937 |
| 131 | Ga0075365_10126740 | 3300006038 | Bacteria | 1764 |
| 132 | Ga0075365_10262379 | 3300006038 | Bacteria | 1215 |
| 133 | Ga0075365_10521466 | 3300006038 | Bacteria | 840 |
| 134 | Ga0075368_10028207 | 3300006042 | Bacteria | 2168 |
| 135 | Ga0075368_10259479 | 3300006042 | Bacteria | 744 |
| 136 | Ga0075363_100013666 | 3300006048 | Bacteria | 3945 |
| 137 | Ga0075363_100112409 | 3300006048 | Bacteria | 1515 |
| 138 | Ga0075363_100855048 | 3300006048 | Bacteria | 555 |
| 139 | Ga0075364_10186859 | 3300006051 | Bacteria | 1403 |
| 140 | Ga0075364_10250201 | 3300006051 | Bacteria | 1204 |
| 141 | Ga0075364_10275628 | 3300006051 | Bacteria | 1144 |
| 142 | Ga0070715_10005522 | 3300006163 | Bacteria | 4223 |
| 143 | Ga0070716_100012986 | 3300006173 | Bacteria | 4233 |
| 144 | Ga0070716_100140853 | 3300006173 | Bacteria | 1538 |
| 145 | Ga0070716_100373168 | 3300006173 | Bacteria | 1017 |
| 146 | Ga0070716_101438023 | 3300006173 | Bacteria | 562 |
| 147 | Ga0070712_100002337 | 3300006175 | Bacteria | 11684 |
| 148 | Ga0070712_100020236 | 3300006175 | Bacteria | 4353 |
| 149 | Ga0070712_100024652 | 3300006175 | Bacteria | 3989 |
| 150 | Ga0070712_100178157 | 3300006175 | Bacteria | 1654 |
| 151 | Ga0070712_100372892 | 3300006175 | Bacteria | 1173 |
| 152 | Ga0070712_101236825 | 3300006175 | Bacteria | 650 |
| 153 | Ga0075367_10206246 | 3300006178 | Bacteria | 1228 |
| 154 | Ga0075367_10233502 | 3300006178 | Bacteria | 1152 |
| 155 | Ga0075369_10398190 | 3300006186 | Bacteria | 649 |
| 156 | Ga0075366_10118105 | 3300006195 | Bacteria | 1598 |
| 157 | Ga0097621_100054866 | 3300006237 | Bacteria | 3252 |
| 158 | Ga0075370_10061293 | 3300006353 | Bacteria | 2143 |
| 159 | Ga0075370_10236984 | 3300006353 | Bacteria | 1080 |
| 160 | Ga0075428_100032651 | 3300006844 | Bacteria | 5749 |
| 161 | Ga0075428_100616526 | 3300006844 | Bacteria | 1158 |
| 162 | Ga0075428_102250835 | 3300006844 | Bacteria | 562 |
| 163 | Ga0075430_100130875 | 3300006846 | Bacteria | 2091 |
| 164 | Ga0075430_100977995 | 3300006846 | Bacteria | 697 |
| 165 | Ga0075431_100094711 | 3300006847 | Bacteria | 3082 |
| 166 | Ga0075431_100123790 | 3300006847 | Bacteria | 2668 |
| 167 | Ga0075431_100165818 | 3300006847 | Bacteria | 2271 |
| 168 | Ga0075431_100319383 | 3300006847 | Bacteria | 1566 |
| 169 | Ga0075434_100082619 | 3300006871 | Bacteria | 3210 |
| 170 | Ga0075434_100129902 | 3300006871 | Bacteria | 2538 |
| 171 | Ga0075434_100223693 | 3300006871 | Bacteria | 1902 |
| 172 | Ga0075434_102000193 | 3300006871 | Bacteria | 585 |
| 173 | Ga0075429_100595149 | 3300006880 | Bacteria | 969 |
| 174 | Ga0068865_100003113 | 3300006881 | Bacteria | 9921 |
| 175 | Ga0075436_100062940 | 3300006914 | Bacteria | 2565 |
| 176 | Ga0075436_100102789 | 3300006914 | Bacteria | 1991 |
| 177 | Ga0097620_100102923 | 3300006931 | Bacteria | 2913 |
| 178 | Ga0075435_100098114 | 3300007076 | Bacteria | 2425 |
| 179 | Ga0075435_100114282 | 3300007076 | Bacteria | 2247 |
| 180 | Ga0075435_100269692 | 3300007076 | Bacteria | 1451 |
| 181 | Ga0099794_10412353 | 3300007265 | Bacteria | 706 |
| 182 | Ga0099795_10000471 | 3300007788 | Bacteria | 7485 |
| 183 | Ga0099795_10287614 | 3300007788 | Bacteria | 719 |
| 184 | Ga0105251_10064962 | 3300009011 | Bacteria | 1709 |
| 185 | Ga0105240_10459193 | 3300009093 | Bacteria | 1424 |
| 186 | Ga0111539_10038873 | 3300009094 | Bacteria | 5740 |
| 187 | Ga0111539_10054141 | 3300009094 | Bacteria | 4775 |
| 188 | Ga0111539_10863925 | 3300009094 | Bacteria | 1052 |
| 189 | Ga0105245_10084772 | 3300009098 | Bacteria | 2903 |
| 190 | Ga0105247_10013158 | 3300009101 | Bacteria | 4964 |
| 191 | Ga0105247_10494935 | 3300009101 | Bacteria | 890 |
| 192 | Ga0114129_10070412 | 3300009147 | Bacteria | 4877 |
| 193 | Ga0114129_10126224 | 3300009147 | Bacteria | 3517 |
| 194 | Ga0114129_10162344 | 3300009147 | Bacteria | 3051 |
| 195 | Ga0114129_10163069 | 3300009147 | Bacteria | 3043 |
| 196 | Ga0114129_11822507 | 3300009147 | Bacteria | 739 |
| 197 | Ga0105243_10005394 | 3300009148 | Bacteria | 9976 |
| 198 | Ga0105243_10410580 | 3300009148 | Bacteria | 1260 |
| 199 | Ga0105241_10044871 | 3300009174 | Bacteria | 3351 |
| 200 | Ga0105241_10094656 | 3300009174 | Bacteria | 2363 |
| 201 | Ga0105241_10205172 | 3300009174 | Bacteria | 1649 |
| 202 | Ga0105242_10056726 | 3300009176 | Bacteria | 3205 |
| 203 | Ga0105242_10612562 | 3300009176 | Bacteria | 1053 |
| 204 | Ga0105248_10008040 | 3300009177 | Bacteria | 11580 |
| 205 | Ga0105248_10114652 | 3300009177 | Bacteria | 3040 |
| 206 | Ga0105237_10041440 | 3300009545 | Bacteria | 4643 |
| 207 | Ga0105237_11166238 | 3300009545 | Bacteria | 777 |
| 208 | Ga0105238_10048324 | 3300009551 | Bacteria | 4289 |
| 209 | Ga0105238_10059259 | 3300009551 | Bacteria | 3835 |
| 210 | Ga0099796_10020829 | 3300010159 | Bacteria | 2010 |
| 211 | Ga0099796_10090127 | 3300010159 | Bacteria | 1139 |
| 212 | Ga0105239_10165897 | 3300010375 | Bacteria | 2469 |
| 213 | Ga0105239_10551872 | 3300010375 | Bacteria | 1312 |
| 214 | Ga0105239_11477827 | 3300010375 | Bacteria | 785 |
| 215 | Ga0157373_10225828 | 3300013100 | Bacteria | 1322 |
| 216 | Ga0157373_10801518 | 3300013100 | Bacteria | 695 |
| 217 | Ga0157370_10196828 | 3300013104 | Bacteria | 1870 |
| 218 | Ga0157369_10484673 | 3300013105 | Bacteria | 1280 |
| 219 | Ga0157374_10010277 | 3300013296 | Bacteria | 8047 |
| 220 | Ga0157378_10042417 | 3300013297 | Bacteria | 4038 |
| 221 | Ga0157378_10195208 | 3300013297 | Bacteria | 1912 |
| 222 | Ga0157378_11261457 | 3300013297 | Bacteria | 779 |
| 223 | Ga0163162_11035397 | 3300013306 | Bacteria | 929 |
| 224 | Ga0163162_11633588 | 3300013306 | Bacteria | 735 |
| 225 | Ga0157372_10176313 | 3300013307 | Bacteria | 2474 |
| 226 | Ga0157375_13558122 | 3300013308 | Bacteria | 518 |
| 227 | Ga0157375_13756222 | 3300013308 | Bacteria | 504 |
| 228 | Ga0163163_10091049 | 3300014325 | Bacteria | 3064 |
| 229 | Ga0157380_10273023 | 3300014326 | Bacteria | 1542 |
| 230 | Ga0157380_12527946 | 3300014326 | Bacteria | 579 |
| 231 | Ga0182008_10428574 | 3300014497 | Bacteria | 715 |
| 232 | Ga0157377_10056931 | 3300014745 | Bacteria | 2221 |
| 233 | Ga0157379_10023158 | 3300014968 | Bacteria | 5508 |
| 234 | Ga0157379_11904597 | 3300014968 | Bacteria | 586 |
| 235 | Ga0157376_10077982 | 3300014969 | Bacteria | 2835 |
| 236 | Ga0157376_11486705 | 3300014969 | Bacteria | 710 |
| 237 | Ga0157376_12740371 | 3300014969 | Bacteria | 533 |
| 238 | Ga0163161_11284526 | 3300017792 | Bacteria | 636 |
| 239 | Ga0154015_1598321 | 3300020610 | Bacteria | 738 |
| 240 | Ga0213872_10238494 | 3300021361 | Bacteria | 769 |
| 241 | Ga0213876_10009505 | 3300021384 | Bacteria | 5231 |
| 242 | Ga0213876_10133043 | 3300021384 | Bacteria | 1322 |
| 243 | Ga0213876_10156730 | 3300021384 | Bacteria | 1211 |
| 244 | Ga0213875_10044777 | 3300021388 | Bacteria | 2078 |
| 245 | Ga0213875_10140922 | 3300021388 | Bacteria | 1128 |
| 246 | Ga0209676_1000159 | 3300025292 | Bacteria | 161731 |
| 247 | Ga0207697_10150676 | 3300025315 | Bacteria | 1012 |
| 248 | Ga0207656_10066026 | 3300025321 | Bacteria | 1598 |
| 249 | Ga0207692_10007792 | 3300025898 | Bacteria | 4403 |
| 250 | Ga0207692_10039102 | 3300025898 | Bacteria | 2331 |
| 251 | Ga0207642_10668345 | 3300025899 | Bacteria | 652 |
| 252 | Ga0207710_10602385 | 3300025900 | Bacteria | 574 |
| 253 | Ga0207688_10000371 | 3300025901 | Bacteria | 20925 |
| 254 | Ga0207680_10024833 | 3300025903 | Unclassified | 3296 |
| 255 | Ga0207680_10150487 | 3300025903 | Bacteria | 1551 |
| 256 | Ga0207647_10017077 | 3300025904 | Bacteria | 4940 |
| 257 | Ga0207685_10009849 | 3300025905 | Bacteria | 2793 |
| 258 | Ga0207685_10491006 | 3300025905 | Bacteria | 645 |
| 259 | Ga0207699_10002470 | 3300025906 | Bacteria | 8722 |
| 260 | Ga0207699_10114748 | 3300025906 | Bacteria | 1732 |
| 261 | Ga0207699_10850225 | 3300025906 | Bacteria | 672 |
| 262 | Ga0207645_10008321 | 3300025907 | Bacteria | 7245 |
| 263 | Ga0207643_10000431 | 3300025908 | Bacteria | 27730 |
| 264 | Ga0207684_10006975 | 3300025910 | Bacteria | 10220 |
| 265 | Ga0207654_10158291 | 3300025911 | Bacteria | 1461 |
| 266 | Ga0207654_10158395 | 3300025911 | Bacteria | 1460 |
| 267 | Ga0207654_10159056 | 3300025911 | Bacteria | 1457 |
| 268 | Ga0207707_10390987 | 3300025912 | Bacteria | 1195 |
| 269 | Ga0207695_10332160 | 3300025913 | Bacteria | 1408 |
| 270 | Ga0207695_10352336 | 3300025913 | Bacteria | 1359 |
| 271 | Ga0207671_10804905 | 3300025914 | Bacteria | 745 |
| 272 | Ga0207693_10001524 | 3300025915 | Bacteria | 20450 |
| 273 | Ga0207693_10032576 | 3300025915 | Bacteria | 4112 |
| 274 | Ga0207693_10032964 | 3300025915 | Bacteria | 4088 |
| 275 | Ga0207693_10046830 | 3300025915 | Bacteria | 3397 |
| 276 | Ga0207693_10187803 | 3300025915 | Bacteria | 1626 |
| 277 | Ga0207693_10332682 | 3300025915 | Bacteria | 1189 |
| 278 | Ga0207693_11161978 | 3300025915 | Bacteria | 584 |
| 279 | Ga0207663_10003084 | 3300025916 | Bacteria | 8079 |
| 280 | Ga0207663_10036466 | 3300025916 | Bacteria | 2959 |
| 281 | Ga0207663_10078702 | 3300025916 | Bacteria | 2150 |
| 282 | Ga0207663_10089727 | 3300025916 | Bacteria | 2036 |
| 283 | Ga0207663_10529093 | 3300025916 | Bacteria | 919 |
| 284 | Ga0207662_10002627 | 3300025918 | Bacteria | 9061 |
| 285 | Ga0207657_10029403 | 3300025919 | Bacteria | 5002 |
| 286 | Ga0207694_10145615 | 3300025924 | Bacteria | 1907 |
| 287 | Ga0207694_10298741 | 3300025924 | Bacteria | 1325 |
| 288 | Ga0207650_10011186 | 3300025925 | Bacteria | 6172 |
| 289 | Ga0207650_10035669 | 3300025925 | Bacteria | 3614 |
| 290 | Ga0207659_10015818 | 3300025926 | Bacteria | 4900 |
| 291 | Ga0207687_10660979 | 3300025927 | Bacteria | 885 |
| 292 | Ga0207700_10005352 | 3300025928 | Bacteria | 7660 |
| 293 | Ga0207700_10041070 | 3300025928 | Bacteria | 3382 |
| 294 | Ga0207700_10220746 | 3300025928 | Bacteria | 1607 |
| 295 | Ga0207700_10276936 | 3300025928 | Bacteria | 1442 |
| 296 | Ga0207700_10370966 | 3300025928 | Bacteria | 1250 |
| 297 | Ga0207664_10049629 | 3300025929 | Bacteria | 3305 |
| 298 | Ga0207664_10466482 | 3300025929 | Bacteria | 1128 |
| 299 | Ga0207664_10711390 | 3300025929 | Bacteria | 903 |
| 300 | Ga0207644_10079804 | 3300025931 | Bacteria | 2415 |
| 301 | Ga0207690_10093662 | 3300025932 | Bacteria | 2129 |
| 302 | Ga0207690_10552054 | 3300025932 | Bacteria | 937 |
| 303 | Ga0207690_11344030 | 3300025932 | Bacteria | 597 |
| 304 | Ga0207706_10008492 | 3300025933 | Bacteria | 9474 |
| 305 | Ga0207686_10096107 | 3300025934 | Bacteria | 1967 |
| 306 | Ga0207709_10235941 | 3300025935 | Bacteria | 1328 |
| 307 | Ga0207709_10371001 | 3300025935 | Bacteria | 1086 |
| 308 | Ga0207669_10018462 | 3300025937 | Bacteria | 3606 |
| 309 | Ga0207669_10539696 | 3300025937 | Bacteria | 939 |
| 310 | Ga0207704_10218884 | 3300025938 | Bacteria | 1407 |
| 311 | Ga0207665_10003612 | 3300025939 | Bacteria | 10333 |
| 312 | Ga0207665_10109700 | 3300025939 | Bacteria | 1937 |
| 313 | Ga0207665_10264003 | 3300025939 | Bacteria | 1276 |
| 314 | Ga0207665_10831986 | 3300025939 | Bacteria | 730 |
| 315 | Ga0207691_10000542 | 3300025940 | Bacteria | 37831 |
| 316 | Ga0207711_10102115 | 3300025941 | Bacteria | 2538 |
| 317 | Ga0207711_10105870 | 3300025941 | Bacteria | 2495 |
| 318 | Ga0207689_10027542 | 3300025942 | Bacteria | 4755 |
| 319 | Ga0207661_10085889 | 3300025944 | Bacteria | 2610 |
| 320 | Ga0207661_10116859 | 3300025944 | Bacteria | 2265 |
| 321 | Ga0207679_11369121 | 3300025945 | Bacteria | 649 |
| 322 | Ga0207667_10079146 | 3300025949 | Bacteria | 3407 |
| 323 | Ga0207667_10240297 | 3300025949 | Bacteria | 1854 |
| 324 | Ga0207651_10254305 | 3300025960 | Bacteria | 1439 |
| 325 | Ga0207712_11063342 | 3300025961 | Bacteria | 719 |
| 326 | Ga0207640_11327486 | 3300025981 | Unclassified | 643 |
| 327 | Ga0207703_10025601 | 3300026035 | Bacteria | 4641 |
| 328 | Ga0207678_10016045 | 3300026067 | Bacteria | 6578 |
| 329 | Ga0207708_10000532 | 3300026075 | Bacteria | 29369 |
| 330 | Ga0207702_10308755 | 3300026078 | Bacteria | 1503 |
| 331 | Ga0207702_11798893 | 3300026078 | Bacteria | 605 |
| 332 | Ga0207641_10024795 | 3300026088 | Bacteria | 4944 |
| 333 | Ga0207648_10000825 | 3300026089 | Bacteria | 34995 |
| 334 | Ga0207676_10007032 | 3300026095 | Bacteria | 7972 |
| 335 | Ga0207674_11031328 | 3300026116 | Bacteria | 792 |
| 336 | Ga0207675_100007077 | 3300026118 | Bacteria | 10601 |
| 337 | Ga0207683_10004559 | 3300026121 | Bacteria | 11934 |
| 338 | Ga0207698_10105288 | 3300026142 | Bacteria | 2350 |
| 339 | Ga0209179_1016308 | 3300027512 | Bacteria | 1392 |
| 340 | Ga0209179_1063980 | 3300027512 | Bacteria | 801 |
| 341 | Ga0209588_1090760 | 3300027671 | Bacteria | 984 |
| 342 | Ga0209813_10260963 | 3300027866 | Bacteria | 661 |
| 343 | Ga0207428_10245798 | 3300027907 | Bacteria | 1335 |
| 344 | Ga0268266_10145977 | 3300028379 | Bacteria | 2127 |
| 345 | Ga0268266_10749129 | 3300028379 | Bacteria | 943 |
| 346 | Ga0268264_10022950 | 3300028381 | Bacteria | 5091 |
| 347 | Ga0265337_1004133 | 3300028556 | Bacteria | 6096 |
| 348 | Ga0265334_10027575 | 3300028573 | Bacteria | 2288 |
| 349 | Ga0265318_10011032 | 3300028577 | Bacteria | 3910 |
| 350 | Ga0265336_10087998 | 3300028666 | Bacteria | 926 |
| 351 | Ga0265338_10065318 | 3300028800 | Bacteria | 3157 |
| 352 | Ga0265338_10074105 | 3300028800 | Bacteria | 2898 |
| 353 | Ga0265330_10053545 | 3300031235 | Bacteria | 1765 |
| 354 | Ga0265330_10271205 | 3300031235 | Bacteria | 715 |
| 355 | Ga0265328_10117361 | 3300031239 | Bacteria | 991 |
| 356 | Ga0265320_10018286 | 3300031240 | Bacteria | 3864 |
| 357 | Ga0265325_10004432 | 3300031241 | Bacteria | 8874 |
| 358 | Ga0265325_10014870 | 3300031241 | Bacteria | 4388 |
| 359 | Ga0265325_10022005 | 3300031241 | Bacteria | 3496 |
| 360 | Ga0265325_10035421 | 3300031241 | Bacteria | 2651 |
| 361 | Ga0265325_10090686 | 3300031241 | Bacteria | 1508 |
| 362 | Ga0265329_10008172 | 3300031242 | Bacteria | 3989 |
| 363 | Ga0265329_10111677 | 3300031242 | Bacteria | 874 |
| 364 | Ga0265340_10010895 | 3300031247 | Bacteria | 4849 |
| 365 | Ga0265340_10035432 | 3300031247 | Bacteria | 2478 |
| 366 | Ga0265340_10048589 | 3300031247 | Bacteria | 2062 |
| 367 | Ga0265340_10052416 | 3300031247 | Bacteria | 1973 |
| 368 | Ga0265340_10153195 | 3300031247 | Bacteria | 1049 |
| 369 | Ga0265339_10004315 | 3300031249 | Bacteria | 9721 |
| 370 | Ga0265339_10059257 | 3300031249 | Bacteria | 2065 |
| 371 | Ga0265339_10112600 | 3300031249 | Bacteria | 1406 |
| 372 | Ga0265331_10150366 | 3300031250 | Bacteria | 1057 |
| 373 | Ga0265331_10233196 | 3300031250 | Bacteria | 826 |
| 374 | Ga0265327_10001294 | 3300031251 | Bacteria | 32796 |
| 375 | Ga0265316_10011100 | 3300031344 | Bacteria | 8160 |
| 376 | Ga0265316_10030377 | 3300031344 | Bacteria | 4431 |
| 377 | Ga0265316_10092294 | 3300031344 | Bacteria | 2308 |
| 378 | Ga0307408_100841761 | 3300031548 | Bacteria | 836 |
| 379 | Ga0265313_10001120 | 3300031595 | Bacteria | 25611 |
| 380 | Ga0265313_10067965 | 3300031595 | Bacteria | 1647 |
| 381 | Ga0265313_10140178 | 3300031595 | Bacteria | 1040 |
| 382 | Ga0265313_10163575 | 3300031595 | Bacteria | 944 |
| 383 | Ga0316575_10039180 | 3300031665 | Bacteria | 1870 |
| 384 | Ga0265314_10006793 | 3300031711 | Bacteria | 10032 |
| 385 | Ga0265314_10019360 | 3300031711 | Bacteria | 5275 |
| 386 | Ga0265314_10041851 | 3300031711 | Bacteria | 3274 |
| 387 | Ga0265314_10069302 | 3300031711 | Bacteria | 2368 |
| 388 | Ga0265314_10162338 | 3300031711 | Bacteria | 1358 |
| 389 | Ga0265342_10000233 | 3300031712 | Bacteria | 62514 |
| 390 | Ga0265342_10012942 | 3300031712 | Bacteria | 5624 |
| 391 | Ga0265342_10016663 | 3300031712 | Bacteria | 4796 |
| 392 | Ga0265342_10026466 | 3300031712 | Bacteria | 3634 |
| 393 | Ga0307413_10433359 | 3300031824 | Bacteria | 1039 |
| 394 | Ga0307413_11097757 | 3300031824 | Bacteria | 687 |
| 395 | Ga0373950_0064100 | 3300034818 | Bacteria | 742 |
| 396 | Ga0373926_0045113 | 3300035083 | Bacteria | 1580 |
| 397 | Ga0373926_0103277 | 3300035083 | Bacteria | 1067 |
| 398 | Ga0373926_0276031 | 3300035083 | Bacteria | 654 |
| 399 | Ga0373926_0416027 | 3300035083 | Bacteria | 532 |
| 400 | Ga0373934_0263862 | 3300035086 | Bacteria | 713 |
| 401 | Ga0373944_0008559 | 3300035089 | Bacteria | 2765 |
| 402 | Ga0373944_0041535 | 3300035089 | Bacteria | 1423 |
| 403 | Ga0373949_0108854 | 3300035090 | Bacteria | 767 |
| 404 | Ga0373949_0134638 | 3300035090 | Bacteria | 704 |
| 405 | Ga0373951_0038271 | 3300035091 | Bacteria | 1150 |
| 406 | Ga0373923_0000130 | 3300035111 | Bacteria | 13950 |
| 407 | Ga0373936_0002001 | 3300035113 | Bacteria | 7545 |
| 408 | Ga0373936_0009131 | 3300035113 | Bacteria | 3737 |
| 409 | Ga0373936_0304613 | 3300035113 | Bacteria | 720 |
| 410 | Ga0373939_0025484 | 3300035114 | Bacteria | 1658 |
| 411 | Ga0373941_0002860 | 3300035115 | Bacteria | 3850 |
| 412 | Ga0373941_0325938 | 3300035115 | Bacteria | 619 |
| 413 | Ga0373945_0006478 | 3300035116 | Bacteria | 3778 |
| 414 | Ga0373945_0055086 | 3300035116 | Bacteria | 1471 |
| 415 | Ga0373945_0062667 | 3300035116 | Bacteria | 1391 |
| 416 | Ga0373953_0001083 | 3300035117 | Bacteria | 7695 |
| 417 | Ga0373954_0003503 | 3300035118 | Bacteria | 6667 |
| 418 | Ga0373954_0006098 | 3300035118 | Bacteria | 5246 |
| 419 | Ga0373954_0036631 | 3300035118 | Bacteria | 2278 |
| 420 | Ga0373956_0079882 | 3300035119 | Bacteria | 1500 |
| 421 | Ga0373956_0441166 | 3300035119 | Bacteria | 621 |
| 422 | Ga0373957_0006799 | 3300035120 | Bacteria | 3623 |
| 423 | Ga0373957_0091339 | 3300035120 | Bacteria | 1210 |
| 424 | Ga0373960_0087607 | 3300035121 | Bacteria | 991 |
| 425 | Ga0373943_0006735 | 3300035170 | Bacteria | 5157 |
| 426 | Ga0373943_0010190 | 3300035170 | Bacteria | 4215 |
| 427 | Ga0373943_0018696 | 3300035170 | Bacteria | 3185 |
| 428 | Ga0373943_0120920 | 3300035170 | Bacteria | 1391 |
| 429 | Ga0373943_0162973 | 3300035170 | Bacteria | 1215 |
| 430 | Ga0373943_0326561 | 3300035170 | Unclassified | 875 |
| 431 | Ga0373946_0008089 | 3300035171 | Bacteria | 3860 |
| 432 | Ga0373946_0030547 | 3300035171 | Bacteria | 2151 |
| 433 | Ga0373946_0296563 | 3300035171 | Bacteria | 798 |
| 434 | Ga0373946_0508747 | 3300035171 | Bacteria | 618 |
| 435 | Ga0373955_0001349 | 3300035172 | Bacteria | 10428 |
| 436 | Ga0373955_0035612 | 3300035172 | Bacteria | 2637 |
| 437 | Ga0373955_0057076 | 3300035172 | Bacteria | 2144 |
| 438 | Ga0373924_0000822 | 3300035410 | Bacteria | 9703 |
| 439 | Ga0373924_0076424 | 3300035410 | Bacteria | 1419 |
| 440 | Ga0373931_0978720 | 3300035691 | Bacteria | 572 |
| 441 | Ga0373935_0000032 | 3300035692 | Bacteria | 54807 |
| 442 | Ga0373935_0012233 | 3300035692 | Bacteria | 5160 |
| 443 | Ga0373935_0106885 | 3300035692 | Bacteria | 1852 |
| 444 | Ga0373935_0298255 | 3300035692 | Bacteria | 1138 |
| 445 | Ga0373935_0434345 | 3300035692 | Bacteria | 946 |
| 446 | Ga0373927_0004218 | 3300035695 | Bacteria | 10090 |
| 447 | Ga0373927_0009160 | 3300035695 | Bacteria | 6645 |
| 448 | Ga0373927_0011509 | 3300035695 | Bacteria | 5894 |
| 449 | Ga0373927_0019283 | 3300035695 | Bacteria | 4473 |
| 450 | Ga0373927_0021733 | 3300035695 | Bacteria | 4205 |
| 451 | Ga0373927_0358530 | 3300035695 | Bacteria | 961 |
| 452 | Ga0373927_0377681 | 3300035695 | Bacteria | 934 |
| 453 | Ga0373927_0391480 | 3300035695 | Bacteria | 917 |
| 454 | Ga0373933_0002204 | 3300035724 | Bacteria | 11131 |
| 455 | Ga0373933_0680178 | 3300035724 | Bacteria | 676 |
| 456 | Ga0373947_0000298 | 3300035725 | Bacteria | 27892 |
| 457 | Ga0373947_0008510 | 3300035725 | Bacteria | 5908 |
| 458 | Ga0373947_0018711 | 3300035725 | Bacteria | 3988 |
| 459 | Ga0373947_0242557 | 3300035725 | Bacteria | 1189 |
| 460 | Ga0373937_0000326 | 3300036401 | Bacteria | 45214 |
| 461 | Ga0373937_0013503 | 3300036401 | Bacteria | 7194 |
| 462 | Ga0373937_0194055 | 3300036401 | Bacteria | 1908 |
| 463 | Ga0373925_0000012 | 3300037068 | Bacteria | 202139 |
| 464 | Ga0373925_0005229 | 3300037068 | Bacteria | 9702 |
| 465 | Ga0373925_0033074 | 3300037068 | Bacteria | 3810 |
| 466 | Ga0373925_0125891 | 3300037068 | Bacteria | 1993 |
| 467 | Ga0373925_0345542 | 3300037068 | Bacteria | 1207 |
| 468 | Ga0395900_0088706 | 3300037418 | Bacteria | 3180 |
| 469 | Ga0395900_0356599 | 3300037418 | Bacteria | 1435 |
| 470 | Ga0436364_0687434 | 3300037853 | Bacteria | 2596 |
| 471 | Ga0436364_0878561 | 3300037853 | Bacteria | 3735 |
| 472 | Ga0436364_0956945 | 3300037853 | Bacteria | 6276 |
| 473 | Ga0395901_0132208 | 3300038443 | Bacteria | 2622 |
| 474 | Ga0395901_0828402 | 3300038443 | Bacteria | 912 |
| 475 | Ga0436365_0204673 | 3300039437 | Bacteria | 13501 |
| 476 | Ga0436365_0381000 | 3300039437 | Bacteria | 1610 |
| 477 | Ga0436365_0849289 | 3300039437 | Bacteria | 1981 |
| 478 | Ga0436365_0988571 | 3300039437 | Bacteria | 6004 |
| 479 | Ga0436365_1793152 | 3300039437 | Bacteria | 856 |
| 480 | Ga0436360_0487319 | 3300039438 | Bacteria | 1077 |
| 481 | Ga0436360_0554890 | 3300039438 | Bacteria | 872 |
| 482 | Ga0436361_0203502 | 3300039447 | Bacteria | 9652 |
| 483 | Ga0436361_0224754 | 3300039447 | Bacteria | 2261 |
| 484 | Ga0436361_1089976 | 3300039447 | Bacteria | 1389 |
| 485 | Ga0436363_0525535 | 3300039450 | Bacteria | 2288 |
| 486 | Ga0436362_0207204 | 3300039453 | Bacteria | 1778 |
| 487 | Ga0436362_1296964 | 3300039453 | Bacteria | 1055 |
| 488 | Ga0439439_0107708 | 3300041406 | Bacteria | 770 |
| 489 | Ga0439453_0147701 | 3300041408 | Bacteria | 556 |
| 490 | Ga0451798_0720422 | 3300041458 | Bacteria | 1121 |
| 491 | Ga0439441_017757 | 3300042001 | Bacteria | 1281 |
| 492 | Ga0439441_031596 | 3300042001 | Bacteria | 1029 |
| 493 | Ga0439446_0043516 | 3300042156 | Bacteria | 1327 |
| 494 | Ga0439459_0144034 | 3300042438 | Bacteria | 618 |
| 495 | Ga0466965_0351988 | 3300044683 | Bacteria | 807 |
| 496 | Ga0466966_0259871 | 3300044684 | Bacteria | 1045 |
| 497 | Ga0466963_0018436 | 3300044694 | Bacteria | 4364 |
| 498 | Ga0466963_0142899 | 3300044694 | Bacteria | 1659 |
| 499 | Ga0466971_0072309 | 3300044719 | Bacteria | 1567 |
| 500 | Ga0466957_0081691 | 3300044842 | Bacteria | 2013 |
| 501 | Ga0466957_0160277 | 3300044842 | Bacteria | 1461 |
| 502 | Ga0466960_0559024 | 3300044901 | Bacteria | 676 |
| 503 | Ga0466958_0354192 | 3300045836 | Bacteria | 945 |
| 504 | Ga0466958_0765747 | 3300045836 | Bacteria | 629 |
| 505 | Ga0466958_0966986 | 3300045836 | Bacteria | 556 |
| 506 | Ga0466967_0005469 | 3300045976 | Bacteria | 8806 |
| 507 | Ga0466967_0364323 | 3300045976 | Bacteria | 1401 |
| 508 | Ga0466967_1928483 | 3300045976 | Bacteria | 587 |
| 509 | Ga0495617_084789 | 3300046452 | Bacteria | 1037 |
| 510 | Ga0495627_143729 | 3300046453 | Bacteria | 668 |
| 511 | Ga0495592_0000033 | 3300046454 | Bacteria | 127028 |
| 512 | Ga0495592_0447852 | 3300046454 | Bacteria | 809 |
| 513 | Ga0495603_0013141 | 3300046455 | Bacteria | 5004 |
| 514 | Ga0495603_0133783 | 3300046455 | Bacteria | 1443 |
| 515 | Ga0495603_0511071 | 3300046455 | Bacteria | 688 |
| 516 | Ga0495590_0109177 | 3300046457 | Bacteria | 987 |
| 517 | Ga0495629_0030342 | 3300046459 | Bacteria | 3834 |
| 518 | Ga0495629_0034630 | 3300046459 | Bacteria | 3570 |
| 519 | Ga0495629_0311781 | 3300046459 | Bacteria | 1076 |
| 520 | Ga0495638_0023057 | 3300046460 | Bacteria | 4077 |
| 521 | Ga0495641_0287445 | 3300046461 | Unclassified | 740 |
| 522 | Ga0495651_0000413 | 3300046462 | Bacteria | 33195 |
| 523 | Ga0495651_0062559 | 3300046462 | Bacteria | 2847 |
| 524 | Ga0495651_0353910 | 3300046462 | Bacteria | 970 |
| 525 | Ga0495651_0378400 | 3300046462 | Bacteria | 929 |
| 526 | Ga0495651_0507490 | 3300046462 | Bacteria | 771 |
| 527 | Ga0495653_0000240 | 3300046463 | Bacteria | 44123 |
| 528 | Ga0495653_0088025 | 3300046463 | Bacteria | 2279 |
| 529 | Ga0495580_0177062 | 3300046472 | Bacteria | 1473 |
| 530 | Ga0495580_0463712 | 3300046472 | Bacteria | 849 |
| 531 | Ga0495582_0073850 | 3300046473 | Bacteria | 1888 |
| 532 | Ga0495582_0417031 | 3300046473 | Bacteria | 774 |
| 533 | Ga0495639_0355456 | 3300046475 | Bacteria | 736 |
| 534 | Ga0495639_0444108 | 3300046475 | Bacteria | 658 |
| 535 | Ga0495639_0496539 | 3300046475 | Bacteria | 623 |
| 536 | Ga0495662_0001477 | 3300046476 | Bacteria | 11636 |
| 537 | Ga0495662_0003230 | 3300046476 | Bacteria | 8232 |
| 538 | Ga0495662_0014966 | 3300046476 | Bacteria | 3769 |
| 539 | Ga0495664_0000005 | 3300046477 | Bacteria | 439635 |
| 540 | Ga0495664_0001023 | 3300046477 | Bacteria | 14461 |
| 541 | Ga0495664_0455576 | 3300046477 | Bacteria | 766 |
| 542 | Ga0495664_0756466 | 3300046477 | Bacteria | 572 |
| 543 | Ga0495584_0005882 | 3300046491 | Bacteria | 6465 |
| 544 | Ga0495584_0245701 | 3300046491 | Bacteria | 910 |
| 545 | Ga0495585_0223475 | 3300046492 | Bacteria | 949 |
| 546 | Ga0495594_0194796 | 3300046499 | Bacteria | 1155 |
| 547 | Ga0495596_0096200 | 3300046500 | Bacteria | 1150 |
| 548 | Ga0495607_0358007 | 3300046501 | Bacteria | 672 |
| 549 | Ga0495583_0203406 | 3300046506 | Bacteria | 804 |
| 550 | Ga0495608_0000003 | 3300046511 | Bacteria | 369831 |
| 551 | Ga0495608_0004805 | 3300046511 | Bacteria | 9660 |
| 552 | Ga0495618_0000009 | 3300046514 | Bacteria | 200423 |
| 553 | Ga0495618_0001656 | 3300046514 | Bacteria | 14823 |
| 554 | Ga0495618_0175149 | 3300046514 | Bacteria | 1364 |
| 555 | Ga0495620_0219282 | 3300046515 | Bacteria | 728 |
| 556 | Ga0495628_0000010 | 3300046516 | Bacteria | 234932 |
| 557 | Ga0495628_0092408 | 3300046516 | Bacteria | 2341 |
| 558 | Ga0495628_0605948 | 3300046516 | Bacteria | 782 |
| 559 | Ga0495630_0005686 | 3300046517 | Bacteria | 8814 |
| 560 | Ga0495630_0033852 | 3300046517 | Bacteria | 3811 |
| 561 | Ga0495630_0094914 | 3300046517 | Bacteria | 2254 |
| 562 | Ga0495630_0449175 | 3300046517 | Bacteria | 988 |
| 563 | Ga0495630_0727812 | 3300046517 | Bacteria | 759 |
| 564 | Ga0495632_0143703 | 3300046519 | Bacteria | 1106 |
| 565 | Ga0495637_0132127 | 3300046520 | Bacteria | 953 |
| 566 | Ga0495644_0296305 | 3300046523 | Bacteria | 632 |
| 567 | Ga0495663_0303998 | 3300046525 | Bacteria | 575 |
| 568 | Ga0495666_0041406 | 3300046526 | Bacteria | 2231 |
| 569 | Ga0495666_0059152 | 3300046526 | Bacteria | 1833 |
| 570 | Ga0495666_0073000 | 3300046526 | Bacteria | 1629 |
| 571 | Ga0495652_0000016 | 3300046529 | Bacteria | 212723 |
| 572 | Ga0495652_0068272 | 3300046529 | Bacteria | 2978 |
| 573 | Ga0495665_0007508 | 3300046531 | Bacteria | 5902 |
| 574 | Ga0495665_0358252 | 3300046531 | Bacteria | 742 |
| 575 | Ga0495640_0000015 | 3300046533 | Bacteria | 160055 |
| 576 | Ga0495640_0003394 | 3300046533 | Bacteria | 12819 |
| 577 | Ga0495640_0063647 | 3300046533 | Bacteria | 2497 |
| 578 | Ga0495640_0282524 | 3300046533 | Bacteria | 1033 |
| 579 | Ga0495640_0591792 | 3300046533 | Bacteria | 670 |
| 580 | Ga0495586_0018556 | 3300046535 | Bacteria | 3704 |
| 581 | Ga0495586_0159461 | 3300046535 | Bacteria | 1272 |
| 582 | Ga0495587_0000009 | 3300046536 | Bacteria | 241480 |
| 583 | Ga0495587_0097972 | 3300046536 | Bacteria | 1690 |
| 584 | Ga0495587_0221576 | 3300046536 | Bacteria | 1067 |
| 585 | Ga0495609_0157891 | 3300046538 | Bacteria | 963 |
| 586 | Ga0495609_0267757 | 3300046538 | Bacteria | 701 |
| 587 | Ga0495621_0085070 | 3300046539 | Bacteria | 1185 |
| 588 | Ga0495621_0332225 | 3300046539 | Bacteria | 635 |
| 589 | Ga0495645_0000005 | 3300046543 | Bacteria | 443917 |
| 590 | Ga0495645_0002744 | 3300046543 | Bacteria | 11963 |
| 591 | Ga0495645_0141654 | 3300046543 | Bacteria | 1677 |
| 592 | Ga0495622_0016147 | 3300046557 | Bacteria | 3476 |
| 593 | Ga0495633_0034046 | 3300046558 | Bacteria | 2452 |
| 594 | Ga0495667_0000073 | 3300046559 | Bacteria | 74946 |
| 595 | Ga0495667_0106557 | 3300046559 | Bacteria | 1812 |
| 596 | Ga0495667_0347959 | 3300046559 | Bacteria | 936 |
| 597 | Ga0495656_0043198 | 3300046615 | Bacteria | 1891 |
| 598 | Ga0495656_0071219 | 3300046615 | Bacteria | 1545 |
| 599 | Ga0495656_0363345 | 3300046615 | Bacteria | 752 |
| 600 | Ga0495656_0467704 | 3300046615 | Bacteria | 666 |
| 601 | Ga0495668_0106233 | 3300046616 | Bacteria | 1536 |
| 602 | Ga0495668_0859657 | 3300046616 | Bacteria | 503 |
| 603 | Ga0495634_0000170 | 3300046642 | Bacteria | 60197 |
| 604 | Ga0495634_0010447 | 3300046642 | Bacteria | 6800 |
| 605 | Ga0495634_0024771 | 3300046642 | Bacteria | 4206 |
| 606 | Ga0495634_0173662 | 3300046642 | Bacteria | 1353 |
| 607 | Ga0495634_0178865 | 3300046642 | Bacteria | 1329 |
| 608 | Ga0495625_0160415 | 3300046660 | Bacteria | 1507 |
| 609 | Ga0495635_0000013 | 3300046663 | Bacteria | 221753 |
| 610 | Ga0495635_0004001 | 3300046663 | Bacteria | 10241 |
| 611 | Ga0495635_0281250 | 3300046663 | Bacteria | 1118 |
| 612 | Ga0495635_0301416 | 3300046663 | Bacteria | 1074 |
| 613 | Ga0495659_0051660 | 3300046664 | Bacteria | 1498 |
| 614 | Ga0495657_0000579 | 3300046675 | Bacteria | 33681 |
| 615 | Ga0495657_0138006 | 3300046675 | Bacteria | 1522 |
| 616 | Ga0495657_0233420 | 3300046675 | Bacteria | 1112 |
| 617 | Ga0495657_0480467 | 3300046675 | Bacteria | 726 |
| 618 | Ga0495599_0000011 | 3300046678 | Bacteria | 207639 |
| 619 | Ga0495599_0054487 | 3300046678 | Bacteria | 2505 |
| 620 | Ga0495599_0451881 | 3300046678 | Bacteria | 761 |
| 621 | Ga0495623_0000005 | 3300046679 | Bacteria | 140586 |
| 622 | Ga0495623_0561502 | 3300046679 | Bacteria | 596 |
| 623 | Ga0495646_0000011 | 3300046680 | Bacteria | 195220 |
| 624 | Ga0495646_0116965 | 3300046680 | Bacteria | 1512 |
| 625 | Ga0495646_0213745 | 3300046680 | Bacteria | 1045 |
| 626 | Ga0495647_0016516 | 3300046681 | Bacteria | 2599 |
| 627 | Ga0495658_0012827 | 3300046683 | Bacteria | 4256 |
| 628 | Ga0495658_0100152 | 3300046683 | Bacteria | 1729 |
| 629 | Ga0495658_0110900 | 3300046683 | Bacteria | 1649 |
| 630 | Ga0495658_0435550 | 3300046683 | Bacteria | 837 |
| 631 | Ga0495613_0065799 | 3300046689 | Bacteria | 2648 |
| 632 | Ga0495613_0431352 | 3300046689 | Bacteria | 895 |
| 633 | Ga0495624_0003168 | 3300046690 | Bacteria | 12254 |
| 634 | Ga0495624_0046775 | 3300046690 | Bacteria | 2751 |
| 635 | Ga0495624_0262050 | 3300046690 | Bacteria | 1044 |
| 636 | Ga0495624_0682456 | 3300046690 | Bacteria | 610 |
| 637 | Ga0495670_0055322 | 3300046691 | Bacteria | 1990 |
| 638 | Ga0495671_0085036 | 3300046692 | Bacteria | 1550 |
| 639 | Ga0495589_0235832 | 3300046794 | Bacteria | 857 |
| 640 | Ga0495600_0000004 | 3300046809 | Bacteria | 180417 |
| 641 | Ga0495600_0128268 | 3300046809 | Bacteria | 1649 |
| 642 | Ga0495600_0679605 | 3300046809 | Bacteria | 620 |
| 643 | Ga0495600_0732485 | 3300046809 | Bacteria | 593 |
| 644 | Ga0495581_0028659 | 3300047315 | Bacteria | 3228 |
| 645 | Ga0495581_0030029 | 3300047315 | Bacteria | 3151 |
| 646 | Ga0495581_0327074 | 3300047315 | Bacteria | 895 |
| 647 | Ga0495581_0327090 | 3300047315 | Bacteria | 895 |
| 648 | Ga0495581_0637726 | 3300047315 | Bacteria | 616 |
| 649 | Ga0495604_0000006 | 3300047317 | Bacteria | 420480 |
| 650 | Ga0495604_0089869 | 3300047317 | Bacteria | 2282 |
| 651 | Ga0495604_0117046 | 3300047317 | Bacteria | 1934 |
| 652 | Ga0495604_0248953 | 3300047317 | Bacteria | 1212 |
| 653 | Ga0495604_0406799 | 3300047317 | Bacteria | 895 |
| 654 | Ga0495674_0000005 | 3300047319 | Bacteria | 375129 |
| 655 | Ga0495674_0002588 | 3300047319 | Bacteria | 17615 |
| 656 | Ga0495674_0011651 | 3300047319 | Bacteria | 8292 |
| 657 | Ga0495674_0040438 | 3300047319 | Bacteria | 4170 |
| 658 | Ga0495674_0269677 | 3300047319 | Bacteria | 1397 |
| 659 | Ga0495674_0507245 | 3300047319 | Bacteria | 964 |
| 660 | Ga0495676_0019255 | 3300047321 | Bacteria | 6005 |
| 661 | Ga0495676_0030454 | 3300047321 | Bacteria | 4579 |
| 662 | Ga0495676_0123010 | 3300047321 | Bacteria | 1884 |
| 663 | Ga0495680_0000141 | 3300047322 | Bacteria | 72373 |
| 664 | Ga0495680_0043962 | 3300047322 | Bacteria | 3534 |
| 665 | Ga0495680_0191813 | 3300047322 | Bacteria | 1470 |
| 666 | Ga0495680_0271873 | 3300047322 | Bacteria | 1196 |
| 667 | Ga0495675_0000070 | 3300047444 | Bacteria | 71129 |
| 668 | Ga0495675_0024946 | 3300047444 | Bacteria | 3814 |
| 669 | Ga0495677_0217987 | 3300047445 | Bacteria | 743 |
| 670 | Ga0495679_031483 | 3300047446 | Bacteria | 1711 |
| 671 | Ga0495681_0092961 | 3300047470 | Bacteria | 1329 |
| 672 | Ga0495681_0192679 | 3300047470 | Bacteria | 831 |
| 673 | Ga0495684_0000001 | 3300047471 | Bacteria | 369809 |
| 674 | Ga0495684_0002341 | 3300047471 | Bacteria | 15138 |
| 675 | Ga0495684_0020709 | 3300047471 | Bacteria | 5067 |
| 676 | Ga0495684_0023444 | 3300047471 | Bacteria | 4744 |
| 677 | Ga0495684_0559776 | 3300047471 | Bacteria | 777 |
| 678 | Ga0495684_0753483 | 3300047471 | Bacteria | 640 |
| 679 | Ga0495684_0857308 | 3300047471 | Bacteria | 589 |
| 680 | Ga0495593_0000703 | 3300047673 | Bacteria | 19309 |
| 681 | Ga0495593_0234383 | 3300047673 | Bacteria | 920 |
| 682 | Ga0495593_0398182 | 3300047673 | Bacteria | 688 |
| 683 | Ga0495602_0000003 | 3300048088 | Bacteria | 357240 |
| 684 | Ga0495614_0135030 | 3300048089 | Bacteria | 1094 |
| 685 | Ga0495614_0476385 | 3300048089 | Bacteria | 592 |
| 686 | Ga0495626_0145235 | 3300048091 | Bacteria | 1004 |
| 687 | Ga0496100_0330649 | 3300048903 | Bacteria | 1147 |
| 688 | Ga0496100_0354701 | 3300048903 | Bacteria | 1108 |
| 689 | Ga0496100_0685608 | 3300048903 | Bacteria | 799 |
| 690 | Ga0496101_0065375 | 3300048904 | Bacteria | 2651 |
| 691 | Ga0496101_0674695 | 3300048904 | Bacteria | 816 |
| 692 | Ga0496102_0002538 | 3300048905 | Bacteria | 15566 |
| 693 | Ga0496102_0032009 | 3300048905 | Bacteria | 4722 |
| 694 | Ga0496102_0043973 | 3300048905 | Bacteria | 4051 |
| 695 | Ga0496102_0731811 | 3300048905 | Bacteria | 912 |
| 696 | Ga0496103_0008867 | 3300048906 | Bacteria | 5965 |
| 697 | Ga0496104_0003699 | 3300048907 | Bacteria | 13194 |
| 698 | Ga0496104_0005339 | 3300048907 | Bacteria | 11240 |
| 699 | Ga0496104_0005656 | 3300048907 | Bacteria | 10946 |
| 700 | Ga0496104_0042076 | 3300048907 | Bacteria | 4285 |
| 701 | Ga0496105_0006937 | 3300048908 | Bacteria | 8724 |
| 702 | Ga0496105_0035873 | 3300048908 | Bacteria | 4084 |
| 703 | Ga0496105_0214532 | 3300048908 | Bacteria | 1568 |
| 704 | Ga0496105_0453051 | 3300048908 | Bacteria | 1013 |
| 705 | Ga0496106_0012088 | 3300048909 | Bacteria | 6371 |
| 706 | Ga0496106_0031771 | 3300048909 | Bacteria | 3934 |
| 707 | Ga0496106_0052175 | 3300048909 | Bacteria | 3084 |
| 708 | Ga0496106_0229568 | 3300048909 | Bacteria | 1482 |
| 709 | Ga0496106_1050807 | 3300048909 | Bacteria | 639 |
| 710 | Ga0496107_0483632 | 3300048910 | Bacteria | 919 |
| 711 | Ga0496107_0987140 | 3300048910 | Bacteria | 611 |
| 712 | Ga0496108_0014122 | 3300048911 | Bacteria | 6514 |
| 713 | Ga0496108_0081845 | 3300048911 | Bacteria | 2736 |
| 714 | Ga0496109_0072699 | 3300048912 | Bacteria | 3159 |
| 715 | Ga0496109_0074841 | 3300048912 | Bacteria | 3113 |
| 716 | Ga0496109_0316108 | 3300048912 | Bacteria | 1473 |
| 717 | Ga0496109_1047195 | 3300048912 | Bacteria | 753 |
| 718 | Ga0496110_0020506 | 3300048913 | Bacteria | 5581 |
| 719 | Ga0496110_0074141 | 3300048913 | Bacteria | 3021 |
| 720 | Ga0496111_0000520 | 3300048914 | Bacteria | 19882 |
| 721 | Ga0496111_0034353 | 3300048914 | Bacteria | 3620 |
| 722 | Ga0496111_0060793 | 3300048914 | Bacteria | 2739 |
| 723 | Ga0496112_0032097 | 3300048915 | Bacteria | 5097 |
| 724 | Ga0496112_0082669 | 3300048915 | Bacteria | 3175 |
| 725 | Ga0496112_0928936 | 3300048915 | Bacteria | 791 |
| 726 | Ga0496113_0004173 | 3300048916 | Bacteria | 8825 |
| 727 | Ga0496113_0034836 | 3300048916 | Bacteria | 3677 |
| 728 | Ga0496113_0417091 | 3300048916 | Bacteria | 1078 |
| 729 | Ga0496113_0717908 | 3300048916 | Bacteria | 797 |
| 730 | Ga0496114_0021128 | 3300048917 | Bacteria | 5292 |
| 731 | Ga0496114_0117326 | 3300048917 | Bacteria | 2286 |
| 732 | Ga0496114_0524216 | 3300048917 | Bacteria | 1048 |
| 733 | Ga0496114_0527142 | 3300048917 | Bacteria | 1044 |
| 734 | Ga0496115_0009264 | 3300048918 | Bacteria | 7315 |
| 735 | Ga0496115_0025115 | 3300048918 | Bacteria | 4636 |
| 736 | Ga0496115_0086887 | 3300048918 | Bacteria | 2552 |
| 737 | Ga0501031_0030368 | 3300049568 | Bacteria | 3524 |
| 738 | Ga0501031_0053740 | 3300049568 | Bacteria | 2625 |
| 739 | Ga0501032_0011792 | 3300049569 | Bacteria | 6264 |
| 740 | Ga0501032_0022476 | 3300049569 | Bacteria | 4370 |
| 741 | Ga0501032_0026172 | 3300049569 | Bacteria | 4016 |
| 742 | Ga0501032_0891231 | 3300049569 | Bacteria | 560 |
| 743 | Ga0501033_0012022 | 3300049570 | Bacteria | 6611 |
| 744 | Ga0501033_0057569 | 3300049570 | Bacteria | 2872 |
| 745 | Ga0501033_0094697 | 3300049570 | Bacteria | 2183 |
| 746 | Ga0501033_0931933 | 3300049570 | Unclassified | 583 |
| 747 | Ga0501034_0000097 | 3300049571 | Bacteria | 161027 |
| 748 | Ga0501034_0003959 | 3300049571 | Bacteria | 16646 |
| 749 | Ga0501034_0006739 | 3300049571 | Bacteria | 12298 |
| 750 | Ga0501034_0031402 | 3300049571 | Bacteria | 5394 |
| 751 | Ga0501034_0087154 | 3300049571 | Bacteria | 3122 |
| 752 | Ga0501034_0105534 | 3300049571 | Bacteria | 2810 |
| 753 | Ga0501034_0108834 | 3300049571 | Bacteria | 2762 |
| 754 | Ga0501034_0110063 | 3300049571 | Bacteria | 2746 |
| 755 | Ga0501034_0477465 | 3300049571 | Bacteria | 1162 |
| 756 | Ga0501034_0595480 | 3300049571 | Bacteria | 1011 |
| 757 | Ga0501036_0002226 | 3300049572 | Bacteria | 15163 |
| 758 | Ga0501036_0003062 | 3300049572 | Bacteria | 13321 |
| 759 | Ga0501036_0586633 | 3300049572 | Bacteria | 925 |
| 760 | Ga0501037_0048015 | 3300049573 | Bacteria | 3128 |
| 761 | Ga0501037_0055716 | 3300049573 | Bacteria | 2891 |
| 762 | Ga0501037_0125438 | 3300049573 | Bacteria | 1844 |
| 763 | Ga0501037_0159662 | 3300049573 | Bacteria | 1607 |
| 764 | Ga0501037_0383636 | 3300049573 | Bacteria | 965 |
| 765 | Ga0501037_0793588 | 3300049573 | Bacteria | 625 |
| 766 | Ga0501038_0002646 | 3300049574 | Bacteria | 16747 |
| 767 | Ga0501038_0043193 | 3300049574 | Bacteria | 3920 |
| 768 | Ga0501038_0073137 | 3300049574 | Bacteria | 2903 |
| 769 | Ga0501038_0226098 | 3300049574 | Bacteria | 1491 |
| 770 | Ga0501038_0401393 | 3300049574 | Bacteria | 1061 |
| 771 | Ga0501038_0929008 | 3300049574 | Bacteria | 641 |
| 772 | Ga0501039_0032726 | 3300049575 | Bacteria | 4009 |
| 773 | Ga0501039_0116119 | 3300049575 | Bacteria | 2095 |
| 774 | Ga0501039_0274341 | 3300049575 | Bacteria | 1326 |
| 775 | Ga0501039_0492366 | 3300049575 | Bacteria | 963 |
| 776 | Ga0501040_0112491 | 3300049576 | Bacteria | 1905 |
| 777 | Ga0501040_0454926 | 3300049576 | Bacteria | 922 |
| 778 | Ga0501042_0195786 | 3300049578 | Bacteria | 1458 |
| 779 | Ga0501043_0003254 | 3300049579 | Bacteria | 13391 |
| 780 | Ga0501043_0059364 | 3300049579 | Bacteria | 3002 |
| 781 | Ga0501043_0312917 | 3300049579 | Bacteria | 1198 |
| 782 | Ga0501046_0048704 | 3300049580 | Bacteria | 3354 |
| 783 | Ga0501046_0152148 | 3300049580 | Bacteria | 1745 |
| 784 | Ga0501046_0342683 | 3300049580 | Bacteria | 1086 |
| 785 | Ga0501046_0552650 | 3300049580 | Bacteria | 821 |
| 786 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 787 | Ga0501047_0023364 | 3300049581 | Bacteria | 5937 |
| 788 | Ga0501047_0031269 | 3300049581 | Bacteria | 5134 |
| 789 | Ga0501047_0131177 | 3300049581 | Bacteria | 2387 |
| 790 | Ga0501047_0189545 | 3300049581 | Bacteria | 1920 |
| 791 | Ga0501048_0002496 | 3300049582 | Bacteria | 14045 |
| 792 | Ga0501048_0056670 | 3300049582 | Bacteria | 2780 |
| 793 | Ga0501067_0073636 | 3300049583 | Bacteria | 1892 |
| 794 | Ga0501068_0028385 | 3300049584 | Bacteria | 3309 |
| 795 | Ga0501068_0042380 | 3300049584 | Bacteria | 2737 |
| 796 | Ga0501068_0055856 | 3300049584 | Bacteria | 2392 |
| 797 | Ga0501068_0059611 | 3300049584 | Bacteria | 2317 |
| 798 | Ga0501068_0128273 | 3300049584 | Bacteria | 1585 |
| 799 | Ga0501069_0015441 | 3300049585 | Bacteria | 4093 |
| 800 | Ga0501069_0020409 | 3300049585 | Bacteria | 3590 |
| 801 | Ga0501069_0302408 | 3300049585 | Bacteria | 938 |
| 802 | Ga0501070_0017811 | 3300049586 | Bacteria | 5964 |
| 803 | Ga0501070_0038350 | 3300049586 | Bacteria | 3997 |
| 804 | Ga0501070_0046396 | 3300049586 | Bacteria | 3613 |
| 805 | Ga0501070_0065155 | 3300049586 | Bacteria | 3017 |
| 806 | Ga0501070_0186837 | 3300049586 | Bacteria | 1704 |
| 807 | Ga0501070_0189787 | 3300049586 | Bacteria | 1689 |
| 808 | Ga0501070_0491927 | 3300049586 | Bacteria | 986 |
| 809 | Ga0501071_0159645 | 3300049587 | Bacteria | 1684 |
| 810 | Ga0501071_0238219 | 3300049587 | Bacteria | 1372 |
| 811 | Ga0501071_0296665 | 3300049587 | Bacteria | 1225 |
| 812 | Ga0501071_0610133 | 3300049587 | Bacteria | 839 |
| 813 | Ga0501073_0069621 | 3300049589 | Bacteria | 2451 |
| 814 | Ga0501073_0099474 | 3300049589 | Bacteria | 2019 |
| 815 | Ga0501073_0108787 | 3300049589 | Bacteria | 1923 |
| 816 | Ga0501074_0008172 | 3300049590 | Bacteria | 7586 |
| 817 | Ga0501074_0193078 | 3300049590 | Bacteria | 1451 |
| 818 | Ga0501074_0238875 | 3300049590 | Bacteria | 1292 |
| 819 | Ga0501074_0334132 | 3300049590 | Bacteria | 1076 |
| 820 | Ga0501074_0833276 | 3300049590 | Bacteria | 650 |
| 821 | Ga0501074_1017274 | 3300049590 | Bacteria | 582 |
| 822 | Ga0501075_0449918 | 3300049591 | Bacteria | 982 |
| 823 | Ga0501075_0789823 | 3300049591 | Unclassified | 722 |
| 824 | Ga0501076_0127152 | 3300049592 | Bacteria | 2066 |
| 825 | Ga0501076_1485493 | 3300049592 | Bacteria | 556 |
| 826 | Ga0501077_0913701 | 3300049593 | Bacteria | 565 |
| 827 | Ga0501079_0359075 | 3300049741 | Bacteria | 1142 |
| 828 | Ga0501079_0407732 | 3300049741 | Bacteria | 1066 |
| 829 | Ga0501079_0619246 | 3300049741 | Bacteria | 852 |
| 830 | Ga0501080_0006002 | 3300049742 | Bacteria | 10888 |
| 831 | Ga0501080_0006165 | 3300049742 | Bacteria | 10759 |
| 832 | Ga0501080_0031760 | 3300049742 | Bacteria | 4920 |
| 833 | Ga0501080_0049363 | 3300049742 | Bacteria | 3917 |
| 834 | Ga0501080_0401778 | 3300049742 | Bacteria | 1232 |
| 835 | Ga0501080_0541182 | 3300049742 | Bacteria | 1038 |
| 836 | Ga0501080_0621352 | 3300049742 | Bacteria | 958 |
| 837 | Ga0501080_1031869 | 3300049742 | Bacteria | 712 |
| 838 | Ga0501080_1042089 | 3300049742 | Unclassified | 708 |
| 839 | Ga0501081_0279521 | 3300049743 | Bacteria | 1222 |
| 840 | Ga0501083_0000677 | 3300049744 | Bacteria | 22173 |
| 841 | Ga0501083_0024934 | 3300049744 | Bacteria | 4142 |
| 842 | Ga0501083_0057721 | 3300049744 | Bacteria | 2598 |
| 843 | Ga0501083_0218332 | 3300049744 | Bacteria | 1242 |
| 844 | Ga0501083_0230649 | 3300049744 | Bacteria | 1206 |
| 845 | Ga0501083_0783196 | 3300049744 | Unclassified | 620 |
| 846 | Ga0501035_0029489 | 3300049822 | Bacteria | 5003 |
| 847 | Ga0501035_0032444 | 3300049822 | Bacteria | 4751 |
| 848 | Ga0501035_0119190 | 3300049822 | Bacteria | 2308 |
| 849 | Ga0501035_0190491 | 3300049822 | Bacteria | 1763 |
| 850 | Ga0501035_0531694 | 3300049822 | Bacteria | 965 |
| 851 | Ga0501035_0651987 | 3300049822 | Bacteria | 853 |
| 852 | Ga0501044_0002568 | 3300049823 | Bacteria | 20676 |
| 853 | Ga0501044_0081657 | 3300049823 | Bacteria | 3271 |
| 854 | Ga0501044_0173859 | 3300049823 | Bacteria | 2124 |
| 855 | Ga0501044_0332973 | 3300049823 | Bacteria | 1440 |
| 856 | Ga0501044_0858025 | 3300049823 | Bacteria | 784 |
| 857 | Ga0501044_1018031 | 3300049823 | Bacteria | 700 |
| 858 | Ga0501045_0268657 | 3300049824 | Bacteria | 1270 |
| 859 | Ga0501045_0366055 | 3300049824 | Bacteria | 1073 |
| 860 | Ga0501045_0653646 | 3300049824 | Unclassified | 777 |
| 861 | nmdc:mga03n38_29764_c1 | 3300050490 | Bacteria | 2288 |
| 862 | nmdc:mga03n38_48607_c1 | 3300050490 | Bacteria | 1882 |
| 863 | nmdc:mga03n38_52258_c1 | 3300050490 | Bacteria | 1828 |
| 864 | nmdc:mga00v17_221042_c1 | 3300050491 | Bacteria | 1226 |
| 865 | nmdc:mga00v17_299995_c1 | 3300050491 | Bacteria | 1043 |
| 866 | nmdc:mga00v17_382140_c1 | 3300050491 | Bacteria | 915 |
| 867 | nmdc:mga0yw44_108417_c1 | 3300050492 | Bacteria | 1777 |
| 868 | nmdc:mga0yw44_13748_c1 | 3300050492 | Bacteria | 4274 |
| 869 | nmdc:mga0yw44_308540_c1 | 3300050492 | Bacteria | 1061 |
| 870 | nmdc:mga0yw44_452187_c1 | 3300050492 | Bacteria | 870 |
| 871 | nmdc:mga06z11_249044_c1 | 3300050494 | Bacteria | 1046 |
| 872 | nmdc:mga06z11_295462_c1 | 3300050494 | Bacteria | 962 |
| 873 | nmdc:mga06z11_373919_c1 | 3300050494 | Bacteria | 515 |
| 874 | nmdc:mga06z11_448821_c1 | 3300050494 | Bacteria | 779 |
| 875 | nmdc:mga04h51_138102_c1 | 3300050495 | Bacteria | 922 |
| 876 | nmdc:mga04h51_294673_c1 | 3300050495 | Bacteria | 660 |
| 877 | nmdc:mga07m45_184276_c1 | 3300050496 | Bacteria | 1214 |
| 878 | nmdc:mga07m45_40848_c2 | 3300050496 | Bacteria | 1648 |
| 879 | nmdc:mga05p37_111062_c1 | 3300050507 | Bacteria | 3371 |
| 880 | nmdc:mga05p37_461907_c1 | 3300050507 | Bacteria | 1467 |
| 881 | nmdc:mga05p37_535190_c1 | 3300050507 | Bacteria | 1337 |
| 882 | nmdc:mga05p37_62442_c1 | 3300050507 | Bacteria | 4585 |
| 883 | nmdc:mga05p37_70164_c1 | 3300050507 | Bacteria | 4310 |
| 884 | nmdc:mga0qj67_516077_c1 | 3300050509 | Bacteria | 960 |
| 885 | nmdc:mga06r32_338648_c1 | 3300050510 | Bacteria | 1489 |
| 886 | nmdc:mga06r32_922211_c1 | 3300050510 | Bacteria | 829 |
| 887 | nmdc:mga06r32_95751_c1 | 3300050510 | Bacteria | 2906 |
| 888 | nmdc:mga08y16_217314_c1 | 3300050511 | Bacteria | 1979 |
| 889 | nmdc:mga08y16_28718_c1 | 3300050511 | Bacteria | 5862 |
| 890 | nmdc:mga0n895_2142469_c1 | 3300050512 | Bacteria | 515 |
| 891 | nmdc:mga0n895_235211_c1 | 3300050512 | Bacteria | 1859 |
| 892 | nmdc:mga0n895_44768_c1 | 3300050512 | Bacteria | 4316 |
| 893 | nmdc:mga0rr50_130487_c1 | 3300050513 | Bacteria | 2012 |
| 894 | nmdc:mga0rr50_436217_c1 | 3300050513 | Bacteria | 1109 |
| 895 | nmdc:mga0rr50_579730_c1 | 3300050513 | Bacteria | 956 |
| 896 | nmdc:mga0rr50_910756_c1 | 3300050513 | Bacteria | 750 |
| 897 | nmdc:mga08x19_1184617_c1 | 3300050514 | Bacteria | 542 |
| 898 | nmdc:mga0a205_223853_c1 | 3300050515 | Bacteria | 1766 |
| 899 | Ga0495601_0000005 | 3300053077 | Bacteria | 387079 |
| 900 | Ga0495601_0000361 | 3300053077 | Bacteria | 23954 |
| 901 | Ga0495601_0009361 | 3300053077 | Bacteria | 5792 |
| 902 | Ga0495601_0009806 | 3300053077 | Bacteria | 5666 |
| 903 | Ga0495612_0000001 | 3300053078 | Bacteria | 418244 |
| 904 | Ga0495612_0000321 | 3300053078 | Bacteria | 19426 |
| 905 | Ga0495612_0261214 | 3300053078 | Bacteria | 771 |
| 906 | Ga0495595_0000070 | 3300053084 | Bacteria | 50736 |
| 907 | Ga0495595_0019093 | 3300053084 | Bacteria | 2970 |
| 908 | Ga0495595_0026039 | 3300053084 | Bacteria | 2596 |
| 909 | Ga0495595_0061510 | 3300053084 | Bacteria | 1759 |
| 910 | Ga0495595_0329323 | 3300053084 | Bacteria | 769 |
| 911 | Ga0495619_0000007 | 3300053085 | Bacteria | 369936 |
| 912 | Ga0495619_0003250 | 3300053085 | Bacteria | 10517 |
| 913 | Ga0495619_0004866 | 3300053085 | Bacteria | 8524 |
| 914 | Ga0495619_0028211 | 3300053085 | Bacteria | 3620 |
| 915 | Ga0495619_0042476 | 3300053085 | Bacteria | 2977 |
| 916 | Ga0495619_0045458 | 3300053085 | Bacteria | 2885 |
| 917 | Ga0495619_0124706 | 3300053085 | Bacteria | 1767 |
| 918 | Ga0495619_0314345 | 3300053085 | Bacteria | 1085 |
| 919 | Ga0500566_0235380 | 3300053094 | Bacteria | 901 |
| 920 | Ga0500650_0027389 | 3300053098 | Bacteria | 2565 |
| 921 | Ga0500562_063632 | 3300053108 | Bacteria | 992 |
| 922 | Ga0500559_0063075 | 3300053136 | Bacteria | 1656 |
| 923 | Ga0500616_0137945 | 3300053153 | Bacteria | 1143 |
| 924 | Ga0501084_0105761 | 3300054114 | Unclassified | 2364 |
| 925 | Ga0501084_0109726 | 3300054114 | Bacteria | 2318 |
| 926 | Ga0501084_0138605 | 3300054114 | Bacteria | 2048 |
| 927 | Ga0501084_0367418 | 3300054114 | Bacteria | 1216 |
| 928 | Ga0501084_0522989 | 3300054114 | Bacteria | 1003 |
| 929 | Ga0501084_0990049 | 3300054114 | Bacteria | 707 |
| 930 | Ga0501084_1419456 | 3300054114 | Bacteria | 581 |
| 931 | Ga0501082_0361599 | 3300060353 | Bacteria | 1266 |
| 932 | Ga0501082_0413055 | 3300060353 | Bacteria | 1178 |
| 933 | Ga0501082_0565055 | 3300060353 | Bacteria | 995 |
| 934 | Ga0466962_0142796 | 3300061719 | Bacteria | 1160 |
| 935 | Ga0530510_0052121 | 3300061734 | Unclassified | 2957 |
| 936 | Ga0530510_0069077 | 3300061734 | Bacteria | 2564 |
| 937 | Ga0530510_0649400 | 3300061734 | Bacteria | 803 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0401393 | Ga0501038_0401393_665_1042 | 123 |
| 2 | 3300046675 | Ga0495657_0480467 | Ga0495657_0480467_326_709 | 124 |
| 3 | 3300048089 | Ga0495614_0476385 | Ga0495614_0476385_170_553 | 124 |
| 4 | 3300045976 | Ga0466967_1928483 | Ga0466967_1928483_20_427 | 132 |
| 5 | 3300026116 | Ga0207674_11031328 | Ga0207674_110313282 | 137 |
| 6 | 3300005457 | Ga0070662_100747252 | Ga0070662_1007472522 | 138 |
| 7 | 3300009093 | Ga0105240_10459193 | Ga0105240_104591932 | 138 |
| 8 | 3300013297 | Ga0157378_10195208 | Ga0157378_101952082 | 138 |
| 9 | 3300025913 | Ga0207695_10332160 | Ga0207695_103321602 | 138 |
| 10 | 3300046660 | Ga0495625_0160415 | Ga0495625_0160415_734_1159 | 138 |
| 11 | 3300021384 | Ga0213876_10009505 | Ga0213876_100095055 | 140 |
| 12 | 3300039437 | Ga0436365_0204673 | Ga0436365_0204673_521_1015 | 140 |
| 13 | 3300035086 | Ga0373934_0263862 | Ga0373934_0263862_14_451 | 143 |
| 14 | 3300046809 | Ga0495600_0679605 | Ga0495600_0679605_14_451 | 143 |
| 15 | 3300003316 | rootH1_10126579 | rootH1_101265794 | 144 |
| 16 | 3300003322 | rootL2_10111746 | rootL2_101117465 | 144 |
| 17 | 3300003781 | Ga0055536_1028189 | Ga0055536_10281892 | 144 |
| 18 | 3300005335 | Ga0070666_10192017 | Ga0070666_101920171 | 144 |
| 19 | 3300009174 | Ga0105241_10205172 | Ga0105241_102051722 | 144 |
| 20 | 3300025292 | Ga0209676_1000159 | Ga0209676_1000159159 | 144 |
| 21 | 3300025903 | Ga0207680_10024833 | Ga0207680_100248332 | 144 |
| 22 | 3300025911 | Ga0207654_10159056 | Ga0207654_101590562 | 144 |
| 23 | 3300027907 | Ga0207428_10245798 | Ga0207428_102457982 | 144 |
| 24 | 3300049570 | Ga0501033_0931933 | Ga0501033_0931933_110_553 | 144 |
| 25 | 3300053136 | Ga0500559_0063075 | Ga0500559_0063075_184_660 | 144 |
| 26 | 3300005356 | Ga0070674_100595920 | Ga0070674_1005959201 | 145 |
| 27 | 3300006051 | Ga0075364_10186859 | Ga0075364_101868592 | 145 |
| 28 | 3300006195 | Ga0075366_10118105 | Ga0075366_101181052 | 145 |
| 29 | 3300046539 | Ga0495621_0332225 | Ga0495621_0332225_150_617 | 145 |
| 30 | 3300050491 | nmdc:mga00v17_221042_c1 | nmdc:mga00v17_221042_c1_348_815 | 145 |
| 31 | 3300050494 | nmdc:mga06z11_373919_c1 | nmdc:mga06z11_373919_c1_31_504 | 145 |
| 32 | 3300045836 | Ga0466958_0354192 | Ga0466958_0354192_227_682 | 146 |
| 33 | 3300005937 | Ga0081455_10003196 | Ga0081455_100031967 | 147 |
| 34 | 3300021384 | Ga0213876_10156730 | Ga0213876_101567302 | 147 |
| 35 | 3300039437 | Ga0436365_0381000 | Ga0436365_0381000_339_788 | 147 |
| 36 | 3300049568 | Ga0501031_0030368 | Ga0501031_0030368_394_843 | 147 |
| 37 | 3300049569 | Ga0501032_0022476 | Ga0501032_0022476_1053_1502 | 147 |
| 38 | 3300049570 | Ga0501033_0012022 | Ga0501033_0012022_28_477 | 147 |
| 39 | 3300049571 | Ga0501034_0108834 | Ga0501034_0108834_480_929 | 147 |
| 40 | 3300049571 | Ga0501034_0477465 | Ga0501034_0477465_560_1009 | 147 |
| 41 | 3300049573 | Ga0501037_0125438 | Ga0501037_0125438_1044_1493 | 147 |
| 42 | 3300049574 | Ga0501038_0043193 | Ga0501038_0043193_209_658 | 147 |
| 43 | 3300049579 | Ga0501043_0312917 | Ga0501043_0312917_568_1017 | 147 |
| 44 | 3300049580 | Ga0501046_0552650 | Ga0501046_0552650_190_639 | 147 |
| 45 | 3300049581 | Ga0501047_0031269 | Ga0501047_0031269_2935_3384 | 147 |
| 46 | 3300049581 | Ga0501047_0131177 | Ga0501047_0131177_1160_1609 | 147 |
| 47 | 3300049586 | Ga0501070_0186837 | Ga0501070_0186837_734_1183 | 147 |
| 48 | 3300049587 | Ga0501071_0238219 | Ga0501071_0238219_828_1277 | 147 |
| 49 | 3300049742 | Ga0501080_0541182 | Ga0501080_0541182_338_787 | 147 |
| 50 | 3300049822 | Ga0501035_0119190 | Ga0501035_0119190_1425_1874 | 147 |
| 51 | 3300049823 | Ga0501044_0081657 | Ga0501044_0081657_813_1262 | 147 |
| 52 | 3300005289 | Ga0065704_10471892 | Ga0065704_104718921 | 148 |
| 53 | 3300005343 | Ga0070687_101036976 | Ga0070687_1010369761 | 148 |
| 54 | 3300005436 | Ga0070713_101544619 | Ga0070713_1015446191 | 148 |
| 55 | 3300005439 | Ga0070711_100355271 | Ga0070711_1003552712 | 148 |
| 56 | 3300005544 | Ga0070686_100898859 | Ga0070686_1008988591 | 148 |
| 57 | 3300009094 | Ga0111539_10038873 | Ga0111539_100388733 | 148 |
| 58 | 3300009148 | Ga0105243_10410580 | Ga0105243_104105802 | 148 |
| 59 | 3300009177 | Ga0105248_10114652 | Ga0105248_101146523 | 148 |
| 60 | 3300014326 | Ga0157380_12527946 | Ga0157380_125279461 | 148 |
| 61 | 3300025915 | Ga0207693_11161978 | Ga0207693_111619782 | 148 |
| 62 | 3300025916 | Ga0207663_10529093 | Ga0207663_105290932 | 148 |
| 63 | 3300025935 | Ga0207709_10371001 | Ga0207709_103710011 | 148 |
| 64 | 3300025941 | Ga0207711_10102115 | Ga0207711_101021153 | 148 |
| 65 | 3300028577 | Ga0265318_10011032 | Ga0265318_100110325 | 148 |
| 66 | 3300031235 | Ga0265330_10271205 | Ga0265330_102712052 | 148 |
| 67 | 3300031239 | Ga0265328_10117361 | Ga0265328_101173611 | 148 |
| 68 | 3300031240 | Ga0265320_10018286 | Ga0265320_100182864 | 148 |
| 69 | 3300031241 | Ga0265325_10022005 | Ga0265325_100220053 | 148 |
| 70 | 3300031241 | Ga0265325_10035421 | Ga0265325_100354213 | 148 |
| 71 | 3300031242 | Ga0265329_10008172 | Ga0265329_100081722 | 148 |
| 72 | 3300031247 | Ga0265340_10048589 | Ga0265340_100485892 | 148 |
| 73 | 3300031247 | Ga0265340_10153195 | Ga0265340_101531952 | 148 |
| 74 | 3300031249 | Ga0265339_10059257 | Ga0265339_100592572 | 148 |
| 75 | 3300031249 | Ga0265339_10112600 | Ga0265339_101126002 | 148 |
| 76 | 3300031250 | Ga0265331_10233196 | Ga0265331_102331962 | 148 |
| 77 | 3300031251 | Ga0265327_10001294 | Ga0265327_1000129412 | 148 |
| 78 | 3300031344 | Ga0265316_10030377 | Ga0265316_100303773 | 148 |
| 79 | 3300031344 | Ga0265316_10092294 | Ga0265316_100922943 | 148 |
| 80 | 3300031595 | Ga0265313_10067965 | Ga0265313_100679652 | 148 |
| 81 | 3300031711 | Ga0265314_10041851 | Ga0265314_100418512 | 148 |
| 82 | 3300031711 | Ga0265314_10162338 | Ga0265314_101623382 | 148 |
| 83 | 3300031712 | Ga0265342_10012942 | Ga0265342_100129424 | 148 |
| 84 | 3300031712 | Ga0265342_10026466 | Ga0265342_100264662 | 148 |
| 85 | 3300035083 | Ga0373926_0276031 | Ga0373926_0276031_142_597 | 148 |
| 86 | 3300035115 | Ga0373941_0325938 | Ga0373941_0325938_38_490 | 148 |
| 87 | 3300035116 | Ga0373945_0062667 | Ga0373945_0062667_123_578 | 148 |
| 88 | 3300035118 | Ga0373954_0006098 | Ga0373954_0006098_4462_4917 | 148 |
| 89 | 3300035119 | Ga0373956_0441166 | Ga0373956_0441166_92_547 | 148 |
| 90 | 3300035170 | Ga0373943_0162973 | Ga0373943_0162973_71_526 | 148 |
| 91 | 3300035171 | Ga0373946_0296563 | Ga0373946_0296563_172_627 | 148 |
| 92 | 3300035172 | Ga0373955_0057076 | Ga0373955_0057076_1329_1784 | 148 |
| 93 | 3300035692 | Ga0373935_0434345 | Ga0373935_0434345_400_855 | 148 |
| 94 | 3300035695 | Ga0373927_0377681 | Ga0373927_0377681_199_654 | 148 |
| 95 | 3300035724 | Ga0373933_0680178 | Ga0373933_0680178_68_523 | 148 |
| 96 | 3300035725 | Ga0373947_0242557 | Ga0373947_0242557_37_492 | 148 |
| 97 | 3300036401 | Ga0373937_0194055 | Ga0373937_0194055_1270_1725 | 148 |
| 98 | 3300037068 | Ga0373925_0345542 | Ga0373925_0345542_114_569 | 148 |
| 99 | 3300041406 | Ga0439439_0107708 | Ga0439439_0107708_286_738 | 148 |
| 100 | 3300042001 | Ga0439441_017757 | Ga0439441_017757_523_975 | 148 |
| 101 | 3300042156 | Ga0439446_0043516 | Ga0439446_0043516_483_935 | 148 |
| 102 | 3300042438 | Ga0439459_0144034 | Ga0439459_0144034_134_586 | 148 |
| 103 | 3300044683 | Ga0466965_0351988 | Ga0466965_0351988_292_759 | 148 |
| 104 | 3300044684 | Ga0466966_0259871 | Ga0466966_0259871_44_538 | 148 |
| 105 | 3300044694 | Ga0466963_0018436 | Ga0466963_0018436_2940_3395 | 148 |
| 106 | 3300044694 | Ga0466963_0142899 | Ga0466963_0142899_328_783 | 148 |
| 107 | 3300044719 | Ga0466971_0072309 | Ga0466971_0072309_845_1300 | 148 |
| 108 | 3300044842 | Ga0466957_0081691 | Ga0466957_0081691_347_802 | 148 |
| 109 | 3300044842 | Ga0466957_0160277 | Ga0466957_0160277_663_1118 | 148 |
| 110 | 3300044901 | Ga0466960_0559024 | Ga0466960_0559024_86_541 | 148 |
| 111 | 3300045836 | Ga0466958_0765747 | Ga0466958_0765747_122_577 | 148 |
| 112 | 3300045836 | Ga0466958_0966986 | Ga0466958_0966986_14_469 | 148 |
| 113 | 3300045976 | Ga0466967_0005469 | Ga0466967_0005469_4253_4708 | 148 |
| 114 | 3300045976 | Ga0466967_0364323 | Ga0466967_0364323_540_1007 | 148 |
| 115 | 3300046454 | Ga0495592_0447852 | Ga0495592_0447852_302_757 | 148 |
| 116 | 3300046462 | Ga0495651_0062559 | Ga0495651_0062559_1924_2379 | 148 |
| 117 | 3300046462 | Ga0495651_0507490 | Ga0495651_0507490_52_510 | 148 |
| 118 | 3300046473 | Ga0495582_0417031 | Ga0495582_0417031_277_732 | 148 |
| 119 | 3300046475 | Ga0495639_0355456 | Ga0495639_0355456_213_668 | 148 |
| 120 | 3300046477 | Ga0495664_0756466 | Ga0495664_0756466_59_514 | 148 |
| 121 | 3300046499 | Ga0495594_0194796 | Ga0495594_0194796_176_631 | 148 |
| 122 | 3300046511 | Ga0495608_0004805 | Ga0495608_0004805_1221_1676 | 148 |
| 123 | 3300046514 | Ga0495618_0175149 | Ga0495618_0175149_77_532 | 148 |
| 124 | 3300046517 | Ga0495630_0449175 | Ga0495630_0449175_310_765 | 148 |
| 125 | 3300046526 | Ga0495666_0059152 | Ga0495666_0059152_1016_1471 | 148 |
| 126 | 3300046533 | Ga0495640_0282524 | Ga0495640_0282524_63_518 | 148 |
| 127 | 3300046536 | Ga0495587_0097972 | Ga0495587_0097972_695_1150 | 148 |
| 128 | 3300046543 | Ga0495645_0141654 | Ga0495645_0141654_604_1059 | 148 |
| 129 | 3300046559 | Ga0495667_0347959 | Ga0495667_0347959_82_537 | 148 |
| 130 | 3300046663 | Ga0495635_0301416 | Ga0495635_0301416_265_720 | 148 |
| 131 | 3300046675 | Ga0495657_0138006 | Ga0495657_0138006_247_702 | 148 |
| 132 | 3300046678 | Ga0495599_0054487 | Ga0495599_0054487_296_751 | 148 |
| 133 | 3300046679 | Ga0495623_0561502 | Ga0495623_0561502_13_468 | 148 |
| 134 | 3300046680 | Ga0495646_0213745 | Ga0495646_0213745_41_496 | 148 |
| 135 | 3300046683 | Ga0495658_0435550 | Ga0495658_0435550_19_474 | 148 |
| 136 | 3300046689 | Ga0495613_0431352 | Ga0495613_0431352_400_855 | 148 |
| 137 | 3300046690 | Ga0495624_0682456 | Ga0495624_0682456_41_496 | 148 |
| 138 | 3300046809 | Ga0495600_0128268 | Ga0495600_0128268_442_897 | 148 |
| 139 | 3300047315 | Ga0495581_0327074 | Ga0495581_0327074_155_610 | 148 |
| 140 | 3300047317 | Ga0495604_0089869 | Ga0495604_0089869_604_1059 | 148 |
| 141 | 3300047319 | Ga0495674_0040438 | Ga0495674_0040438_385_840 | 148 |
| 142 | 3300047322 | Ga0495680_0043962 | Ga0495680_0043962_2443_2898 | 148 |
| 143 | 3300047471 | Ga0495684_0753483 | Ga0495684_0753483_77_532 | 148 |
| 144 | 3300047673 | Ga0495593_0234383 | Ga0495593_0234383_372_827 | 148 |
| 145 | 3300048089 | Ga0495614_0135030 | Ga0495614_0135030_377_832 | 148 |
| 146 | 3300050511 | nmdc:mga08y16_217314_c1 | nmdc:mga08y16_217314_c1_651_1127 | 148 |
| 147 | 3300053078 | Ga0495612_0261214 | Ga0495612_0261214_130_585 | 148 |
| 148 | 3300053084 | Ga0495595_0329323 | Ga0495595_0329323_184_639 | 148 |
| 149 | 3300053085 | Ga0495619_0042476 | Ga0495619_0042476_1919_2374 | 148 |
| 150 | 3300053085 | Ga0495619_0045458 | Ga0495619_0045458_1364_1822 | 148 |
| 151 | 3300054114 | Ga0501084_1419456 | Ga0501084_1419456_55_510 | 148 |
| 152 | 3300061719 | Ga0466962_0142796 | Ga0466962_0142796_280_735 | 148 |
| 153 | 3300005354 | Ga0070675_101089942 | Ga0070675_1010899422 | 149 |
| 154 | 3300005356 | Ga0070674_100370433 | Ga0070674_1003704332 | 149 |
| 155 | 3300005364 | Ga0070673_101196151 | Ga0070673_1011961512 | 149 |
| 156 | 3300005434 | Ga0070709_10816516 | Ga0070709_108165162 | 149 |
| 157 | 3300005435 | Ga0070714_100359938 | Ga0070714_1003599382 | 149 |
| 158 | 3300005435 | Ga0070714_100475997 | Ga0070714_1004759972 | 149 |
| 159 | 3300005436 | Ga0070713_100103130 | Ga0070713_1001031303 | 149 |
| 160 | 3300005543 | Ga0070672_100704898 | Ga0070672_1007048982 | 149 |
| 161 | 3300006028 | Ga0070717_10621699 | Ga0070717_106216992 | 149 |
| 162 | 3300006038 | Ga0075365_10521466 | Ga0075365_105214662 | 149 |
| 163 | 3300006048 | Ga0075363_100013666 | Ga0075363_1000136663 | 149 |
| 164 | 3300006175 | Ga0070712_100002337 | Ga0070712_1000023374 | 149 |
| 165 | 3300006175 | Ga0070712_100024652 | Ga0070712_1000246523 | 149 |
| 166 | 3300006178 | Ga0075367_10233502 | Ga0075367_102335022 | 149 |
| 167 | 3300006186 | Ga0075369_10398190 | Ga0075369_103981902 | 149 |
| 168 | 3300006353 | Ga0075370_10236984 | Ga0075370_102369841 | 149 |
| 169 | 3300006844 | Ga0075428_100616526 | Ga0075428_1006165262 | 149 |
| 170 | 3300006847 | Ga0075431_100094711 | Ga0075431_1000947112 | 149 |
| 171 | 3300007265 | Ga0099794_10412353 | Ga0099794_104123531 | 149 |
| 172 | 3300007788 | Ga0099795_10000471 | Ga0099795_100004714 | 149 |
| 173 | 3300007788 | Ga0099795_10287614 | Ga0099795_102876141 | 149 |
| 174 | 3300009147 | Ga0114129_11822507 | Ga0114129_118225072 | 149 |
| 175 | 3300010159 | Ga0099796_10020829 | Ga0099796_100208292 | 149 |
| 176 | 3300010159 | Ga0099796_10090127 | Ga0099796_100901272 | 149 |
| 177 | 3300013308 | Ga0157375_13756222 | Ga0157375_137562221 | 149 |
| 178 | 3300025905 | Ga0207685_10491006 | Ga0207685_104910061 | 149 |
| 179 | 3300025915 | Ga0207693_10001524 | Ga0207693_100015242 | 149 |
| 180 | 3300025915 | Ga0207693_10032576 | Ga0207693_100325763 | 149 |
| 181 | 3300025916 | Ga0207663_10036466 | Ga0207663_100364663 | 149 |
| 182 | 3300025928 | Ga0207700_10220746 | Ga0207700_102207463 | 149 |
| 183 | 3300025929 | Ga0207664_10711390 | Ga0207664_107113902 | 149 |
| 184 | 3300025932 | Ga0207690_10552054 | Ga0207690_105520542 | 149 |
| 185 | 3300025937 | Ga0207669_10539696 | Ga0207669_105396962 | 149 |
| 186 | 3300025960 | Ga0207651_10254305 | Ga0207651_102543052 | 149 |
| 187 | 3300026078 | Ga0207702_11798893 | Ga0207702_117988932 | 149 |
| 188 | 3300027512 | Ga0209179_1016308 | Ga0209179_10163082 | 149 |
| 189 | 3300027512 | Ga0209179_1063980 | Ga0209179_10639801 | 149 |
| 190 | 3300028573 | Ga0265334_10027575 | Ga0265334_100275752 | 149 |
| 191 | 3300028666 | Ga0265336_10087998 | Ga0265336_100879982 | 149 |
| 192 | 3300028800 | Ga0265338_10065318 | Ga0265338_100653183 | 149 |
| 193 | 3300031235 | Ga0265330_10053545 | Ga0265330_100535452 | 149 |
| 194 | 3300031241 | Ga0265325_10014870 | Ga0265325_100148703 | 149 |
| 195 | 3300031247 | Ga0265340_10052416 | Ga0265340_100524162 | 149 |
| 196 | 3300031548 | Ga0307408_100841761 | Ga0307408_1008417612 | 149 |
| 197 | 3300031595 | Ga0265313_10163575 | Ga0265313_101635752 | 149 |
| 198 | 3300031711 | Ga0265314_10006793 | Ga0265314_100067936 | 149 |
| 199 | 3300031712 | Ga0265342_10016663 | Ga0265342_100166632 | 149 |
| 200 | 3300034818 | Ga0373950_0064100 | Ga0373950_0064100_276_731 | 149 |
| 201 | 3300035083 | Ga0373926_0045113 | Ga0373926_0045113_373_828 | 149 |
| 202 | 3300035083 | Ga0373926_0103277 | Ga0373926_0103277_178_636 | 149 |
| 203 | 3300035089 | Ga0373944_0041535 | Ga0373944_0041535_450_905 | 149 |
| 204 | 3300035090 | Ga0373949_0134638 | Ga0373949_0134638_13_465 | 149 |
| 205 | 3300035111 | Ga0373923_0000130 | Ga0373923_0000130_4690_5145 | 149 |
| 206 | 3300035113 | Ga0373936_0002001 | Ga0373936_0002001_3036_3491 | 149 |
| 207 | 3300035113 | Ga0373936_0009131 | Ga0373936_0009131_706_1164 | 149 |
| 208 | 3300035116 | Ga0373945_0006478 | Ga0373945_0006478_3236_3691 | 149 |
| 209 | 3300035116 | Ga0373945_0055086 | Ga0373945_0055086_655_1113 | 149 |
| 210 | 3300035117 | Ga0373953_0001083 | Ga0373953_0001083_5489_5944 | 149 |
| 211 | 3300035118 | Ga0373954_0003503 | Ga0373954_0003503_3621_4076 | 149 |
| 212 | 3300035120 | Ga0373957_0091339 | Ga0373957_0091339_421_876 | 149 |
| 213 | 3300035170 | Ga0373943_0010190 | Ga0373943_0010190_3610_4068 | 149 |
| 214 | 3300035170 | Ga0373943_0018696 | Ga0373943_0018696_2305_2760 | 149 |
| 215 | 3300035171 | Ga0373946_0030547 | Ga0373946_0030547_1258_1713 | 149 |
| 216 | 3300035172 | Ga0373955_0001349 | Ga0373955_0001349_585_1040 | 149 |
| 217 | 3300035410 | Ga0373924_0000822 | Ga0373924_0000822_4346_4801 | 149 |
| 218 | 3300035410 | Ga0373924_0076424 | Ga0373924_0076424_29_487 | 149 |
| 219 | 3300035692 | Ga0373935_0000032 | Ga0373935_0000032_38632_39087 | 149 |
| 220 | 3300035692 | Ga0373935_0012233 | Ga0373935_0012233_1960_2418 | 149 |
| 221 | 3300035692 | Ga0373935_0106885 | Ga0373935_0106885_1330_1788 | 149 |
| 222 | 3300035695 | Ga0373927_0004218 | Ga0373927_0004218_584_1042 | 149 |
| 223 | 3300035695 | Ga0373927_0009160 | Ga0373927_0009160_4143_4598 | 149 |
| 224 | 3300035695 | Ga0373927_0011509 | Ga0373927_0011509_5276_5734 | 149 |
| 225 | 3300035724 | Ga0373933_0002204 | Ga0373933_0002204_3342_3797 | 149 |
| 226 | 3300035725 | Ga0373947_0000298 | Ga0373947_0000298_14668_15123 | 149 |
| 227 | 3300035725 | Ga0373947_0008510 | Ga0373947_0008510_89_547 | 149 |
| 228 | 3300036401 | Ga0373937_0000326 | Ga0373937_0000326_20395_20850 | 149 |
| 229 | 3300037068 | Ga0373925_0000012 | Ga0373925_0000012_2883_3338 | 149 |
| 230 | 3300037068 | Ga0373925_0005229 | Ga0373925_0005229_4681_5139 | 149 |
| 231 | 3300037068 | Ga0373925_0125891 | Ga0373925_0125891_412_870 | 149 |
| 232 | 3300046454 | Ga0495592_0000033 | Ga0495592_0000033_123428_123883 | 149 |
| 233 | 3300046459 | Ga0495629_0030342 | Ga0495629_0030342_1194_1649 | 149 |
| 234 | 3300046459 | Ga0495629_0034630 | Ga0495629_0034630_370_828 | 149 |
| 235 | 3300046462 | Ga0495651_0000413 | Ga0495651_0000413_3334_3789 | 149 |
| 236 | 3300046462 | Ga0495651_0353910 | Ga0495651_0353910_439_897 | 149 |
| 237 | 3300046463 | Ga0495653_0000240 | Ga0495653_0000240_15675_16130 | 149 |
| 238 | 3300046463 | Ga0495653_0088025 | Ga0495653_0088025_1506_1964 | 149 |
| 239 | 3300046475 | Ga0495639_0444108 | Ga0495639_0444108_20_478 | 149 |
| 240 | 3300046476 | Ga0495662_0001477 | Ga0495662_0001477_9181_9639 | 149 |
| 241 | 3300046476 | Ga0495662_0003230 | Ga0495662_0003230_5769_6224 | 149 |
| 242 | 3300046477 | Ga0495664_0000005 | Ga0495664_0000005_423484_423939 | 149 |
| 243 | 3300046477 | Ga0495664_0001023 | Ga0495664_0001023_13460_13918 | 149 |
| 244 | 3300046511 | Ga0495608_0000003 | Ga0495608_0000003_15638_16093 | 149 |
| 245 | 3300046514 | Ga0495618_0000009 | Ga0495618_0000009_184342_184797 | 149 |
| 246 | 3300046514 | Ga0495618_0001656 | Ga0495618_0001656_4600_5058 | 149 |
| 247 | 3300046516 | Ga0495628_0000010 | Ga0495628_0000010_199434_199889 | 149 |
| 248 | 3300046516 | Ga0495628_0605948 | Ga0495628_0605948_155_613 | 149 |
| 249 | 3300046517 | Ga0495630_0005686 | Ga0495630_0005686_3203_3658 | 149 |
| 250 | 3300046517 | Ga0495630_0094914 | Ga0495630_0094914_1661_2119 | 149 |
| 251 | 3300046526 | Ga0495666_0073000 | Ga0495666_0073000_779_1237 | 149 |
| 252 | 3300046529 | Ga0495652_0000016 | Ga0495652_0000016_196537_196992 | 149 |
| 253 | 3300046529 | Ga0495652_0068272 | Ga0495652_0068272_1582_2040 | 149 |
| 254 | 3300046531 | Ga0495665_0007508 | Ga0495665_0007508_5126_5584 | 149 |
| 255 | 3300046531 | Ga0495665_0358252 | Ga0495665_0358252_77_535 | 149 |
| 256 | 3300046533 | Ga0495640_0000015 | Ga0495640_0000015_143883_144338 | 149 |
| 257 | 3300046533 | Ga0495640_0003394 | Ga0495640_0003394_7763_8221 | 149 |
| 258 | 3300046533 | Ga0495640_0063647 | Ga0495640_0063647_277_735 | 149 |
| 259 | 3300046535 | Ga0495586_0018556 | Ga0495586_0018556_3039_3497 | 149 |
| 260 | 3300046535 | Ga0495586_0159461 | Ga0495586_0159461_183_638 | 149 |
| 261 | 3300046536 | Ga0495587_0000009 | Ga0495587_0000009_35056_35511 | 149 |
| 262 | 3300046543 | Ga0495645_0000005 | Ga0495645_0000005_423455_423910 | 149 |
| 263 | 3300046543 | Ga0495645_0002744 | Ga0495645_0002744_7224_7682 | 149 |
| 264 | 3300046559 | Ga0495667_0000073 | Ga0495667_0000073_15721_16176 | 149 |
| 265 | 3300046559 | Ga0495667_0106557 | Ga0495667_0106557_533_991 | 149 |
| 266 | 3300046642 | Ga0495634_0000170 | Ga0495634_0000170_44020_44475 | 149 |
| 267 | 3300046642 | Ga0495634_0010447 | Ga0495634_0010447_2086_2544 | 149 |
| 268 | 3300046642 | Ga0495634_0024771 | Ga0495634_0024771_3168_3626 | 149 |
| 269 | 3300046663 | Ga0495635_0000013 | Ga0495635_0000013_15692_16147 | 149 |
| 270 | 3300046663 | Ga0495635_0004001 | Ga0495635_0004001_2661_3119 | 149 |
| 271 | 3300046675 | Ga0495657_0000579 | Ga0495657_0000579_17950_18405 | 149 |
| 272 | 3300046678 | Ga0495599_0000011 | Ga0495599_0000011_191538_191993 | 149 |
| 273 | 3300046679 | Ga0495623_0000005 | Ga0495623_0000005_127842_128297 | 149 |
| 274 | 3300046680 | Ga0495646_0000011 | Ga0495646_0000011_191433_191888 | 149 |
| 275 | 3300046680 | Ga0495646_0116965 | Ga0495646_0116965_173_631 | 149 |
| 276 | 3300046683 | Ga0495658_0012827 | Ga0495658_0012827_2404_2862 | 149 |
| 277 | 3300046683 | Ga0495658_0100152 | Ga0495658_0100152_511_966 | 149 |
| 278 | 3300046689 | Ga0495613_0065799 | Ga0495613_0065799_1594_2049 | 149 |
| 279 | 3300046690 | Ga0495624_0003168 | Ga0495624_0003168_9472_9930 | 149 |
| 280 | 3300046690 | Ga0495624_0046775 | Ga0495624_0046775_953_1408 | 149 |
| 281 | 3300046809 | Ga0495600_0000004 | Ga0495600_0000004_15656_16111 | 149 |
| 282 | 3300047315 | Ga0495581_0028659 | Ga0495581_0028659_1029_1484 | 149 |
| 283 | 3300047315 | Ga0495581_0030029 | Ga0495581_0030029_267_725 | 149 |
| 284 | 3300047317 | Ga0495604_0000006 | Ga0495604_0000006_184357_184812 | 149 |
| 285 | 3300047319 | Ga0495674_0000005 | Ga0495674_0000005_20933_21388 | 149 |
| 286 | 3300047319 | Ga0495674_0002588 | Ga0495674_0002588_10463_10921 | 149 |
| 287 | 3300047321 | Ga0495676_0123010 | Ga0495676_0123010_330_788 | 149 |
| 288 | 3300047322 | Ga0495680_0000141 | Ga0495680_0000141_15569_16024 | 149 |
| 289 | 3300047322 | Ga0495680_0191813 | Ga0495680_0191813_446_904 | 149 |
| 290 | 3300047444 | Ga0495675_0000070 | Ga0495675_0000070_55193_55648 | 149 |
| 291 | 3300047471 | Ga0495684_0000001 | Ga0495684_0000001_353718_354173 | 149 |
| 292 | 3300047471 | Ga0495684_0002341 | Ga0495684_0002341_10356_10814 | 149 |
| 293 | 3300047471 | Ga0495684_0020709 | Ga0495684_0020709_4451_4909 | 149 |
| 294 | 3300047471 | Ga0495684_0023444 | Ga0495684_0023444_3847_4305 | 149 |
| 295 | 3300047673 | Ga0495593_0000703 | Ga0495593_0000703_2283_2738 | 149 |
| 296 | 3300048088 | Ga0495602_0000003 | Ga0495602_0000003_3176_3631 | 149 |
| 297 | 3300049590 | Ga0501074_0833276 | Ga0501074_0833276_58_513 | 149 |
| 298 | 3300049592 | Ga0501076_1485493 | Ga0501076_1485493_10_513 | 149 |
| 299 | 3300050490 | nmdc:mga03n38_52258_c1 | nmdc:mga03n38_52258_c1_1213_1671 | 149 |
| 300 | 3300050492 | nmdc:mga0yw44_452187_c1 | nmdc:mga0yw44_452187_c1_246_704 | 149 |
| 301 | 3300050494 | nmdc:mga06z11_448821_c1 | nmdc:mga06z11_448821_c1_191_649 | 149 |
| 302 | 3300050496 | nmdc:mga07m45_40848_c2 | nmdc:mga07m45_40848_c2_927_1385 | 149 |
| 303 | 3300053077 | Ga0495601_0000005 | Ga0495601_0000005_351622_352077 | 149 |
| 304 | 3300053077 | Ga0495601_0009806 | Ga0495601_0009806_4793_5251 | 149 |
| 305 | 3300053078 | Ga0495612_0000001 | Ga0495612_0000001_64048_64503 | 149 |
| 306 | 3300053078 | Ga0495612_0000321 | Ga0495612_0000321_13128_13586 | 149 |
| 307 | 3300053084 | Ga0495595_0000070 | Ga0495595_0000070_34541_34996 | 149 |
| 308 | 3300053084 | Ga0495595_0026039 | Ga0495595_0026039_579_1037 | 149 |
| 309 | 3300053085 | Ga0495619_0000007 | Ga0495619_0000007_353742_354197 | 149 |
| 310 | 3300053085 | Ga0495619_0003250 | Ga0495619_0003250_9705_10163 | 149 |
| 311 | 3300003911 | JGI25405J52794_10010918 | JGI25405J52794_100109182 | 150 |
| 312 | 3300005329 | Ga0070683_100039407 | Ga0070683_1000394073 | 150 |
| 313 | 3300005336 | Ga0070680_100311056 | Ga0070680_1003110562 | 150 |
| 314 | 3300005345 | Ga0070692_10583006 | Ga0070692_105830062 | 150 |
| 315 | 3300005366 | Ga0070659_101039357 | Ga0070659_1010393571 | 150 |
| 316 | 3300005434 | Ga0070709_10032134 | Ga0070709_100321344 | 150 |
| 317 | 3300005435 | Ga0070714_100206652 | Ga0070714_1002066522 | 150 |
| 318 | 3300005437 | Ga0070710_10011480 | Ga0070710_100114805 | 150 |
| 319 | 3300005439 | Ga0070711_100139364 | Ga0070711_1001393642 | 150 |
| 320 | 3300005458 | Ga0070681_10279122 | Ga0070681_102791222 | 150 |
| 321 | 3300005471 | Ga0070698_100298832 | Ga0070698_1002988322 | 150 |
| 322 | 3300005530 | Ga0070679_100110386 | Ga0070679_1001103862 | 150 |
| 323 | 3300005535 | Ga0070684_100009679 | Ga0070684_1000096794 | 150 |
| 324 | 3300005539 | Ga0068853_100162531 | Ga0068853_1001625312 | 150 |
| 325 | 3300005578 | Ga0068854_100281684 | Ga0068854_1002816842 | 150 |
| 326 | 3300005614 | Ga0068856_100194447 | Ga0068856_1001944473 | 150 |
| 327 | 3300005614 | Ga0068856_100236265 | Ga0068856_1002362652 | 150 |
| 328 | 3300005937 | Ga0081455_10005182 | Ga0081455_100051826 | 150 |
| 329 | 3300005937 | Ga0081455_10017568 | Ga0081455_100175685 | 150 |
| 330 | 3300005983 | Ga0081540_1001438 | Ga0081540_10014381 | 150 |
| 331 | 3300005983 | Ga0081540_1040839 | Ga0081540_10408394 | 150 |
| 332 | 3300005983 | Ga0081540_1049164 | Ga0081540_10491642 | 150 |
| 333 | 3300006038 | Ga0075365_10026205 | Ga0075365_100262053 | 150 |
| 334 | 3300006048 | Ga0075363_100855048 | Ga0075363_1008550482 | 150 |
| 335 | 3300006051 | Ga0075364_10275628 | Ga0075364_102756282 | 150 |
| 336 | 3300006173 | Ga0070716_101438023 | Ga0070716_1014380231 | 150 |
| 337 | 3300006175 | Ga0070712_100178157 | Ga0070712_1001781572 | 150 |
| 338 | 3300006353 | Ga0075370_10061293 | Ga0075370_100612933 | 150 |
| 339 | 3300006871 | Ga0075434_100223693 | Ga0075434_1002236932 | 150 |
| 340 | 3300006914 | Ga0075436_100062940 | Ga0075436_1000629403 | 150 |
| 341 | 3300009174 | Ga0105241_10094656 | Ga0105241_100946563 | 150 |
| 342 | 3300009545 | Ga0105237_10041440 | Ga0105237_100414401 | 150 |
| 343 | 3300009551 | Ga0105238_10048324 | Ga0105238_100483242 | 150 |
| 344 | 3300010375 | Ga0105239_11477827 | Ga0105239_114778271 | 150 |
| 345 | 3300013100 | Ga0157373_10225828 | Ga0157373_102258282 | 150 |
| 346 | 3300013104 | Ga0157370_10196828 | Ga0157370_101968282 | 150 |
| 347 | 3300013105 | Ga0157369_10484673 | Ga0157369_104846732 | 150 |
| 348 | 3300013307 | Ga0157372_10176313 | Ga0157372_101763132 | 150 |
| 349 | 3300020610 | Ga0154015_1598321 | Ga0154015_15983212 | 150 |
| 350 | 3300021388 | Ga0213875_10044777 | Ga0213875_100447772 | 150 |
| 351 | 3300025898 | Ga0207692_10039102 | Ga0207692_100391023 | 150 |
| 352 | 3300025906 | Ga0207699_10114748 | Ga0207699_101147482 | 150 |
| 353 | 3300025911 | Ga0207654_10158291 | Ga0207654_101582912 | 150 |
| 354 | 3300025912 | Ga0207707_10390987 | Ga0207707_103909872 | 150 |
| 355 | 3300025913 | Ga0207695_10352336 | Ga0207695_103523362 | 150 |
| 356 | 3300025915 | Ga0207693_10046830 | Ga0207693_100468302 | 150 |
| 357 | 3300025916 | Ga0207663_10089727 | Ga0207663_100897273 | 150 |
| 358 | 3300025924 | Ga0207694_10298741 | Ga0207694_102987412 | 150 |
| 359 | 3300025929 | Ga0207664_10466482 | Ga0207664_104664822 | 150 |
| 360 | 3300025932 | Ga0207690_11344030 | Ga0207690_113440301 | 150 |
| 361 | 3300025939 | Ga0207665_10109700 | Ga0207665_101097003 | 150 |
| 362 | 3300025944 | Ga0207661_10085889 | Ga0207661_100858893 | 150 |
| 363 | 3300025949 | Ga0207667_10079146 | Ga0207667_100791464 | 150 |
| 364 | 3300026078 | Ga0207702_10308755 | Ga0207702_103087552 | 150 |
| 365 | 3300028800 | Ga0265338_10074105 | Ga0265338_100741053 | 150 |
| 366 | 3300031241 | Ga0265325_10004432 | Ga0265325_100044326 | 150 |
| 367 | 3300031241 | Ga0265325_10090686 | Ga0265325_100906862 | 150 |
| 368 | 3300031247 | Ga0265340_10035432 | Ga0265340_100354322 | 150 |
| 369 | 3300031595 | Ga0265313_10001120 | Ga0265313_1000112017 | 150 |
| 370 | 3300031595 | Ga0265313_10140178 | Ga0265313_101401782 | 150 |
| 371 | 3300031665 | Ga0316575_10039180 | Ga0316575_100391802 | 150 |
| 372 | 3300031711 | Ga0265314_10019360 | Ga0265314_100193604 | 150 |
| 373 | 3300031824 | Ga0307413_11097757 | Ga0307413_110977572 | 150 |
| 374 | 3300035114 | Ga0373939_0025484 | Ga0373939_0025484_151_609 | 150 |
| 375 | 3300035118 | Ga0373954_0036631 | Ga0373954_0036631_989_1465 | 150 |
| 376 | 3300035119 | Ga0373956_0079882 | Ga0373956_0079882_85_561 | 150 |
| 377 | 3300035120 | Ga0373957_0006799 | Ga0373957_0006799_962_1438 | 150 |
| 378 | 3300035691 | Ga0373931_0978720 | Ga0373931_0978720_11_469 | 150 |
| 379 | 3300036401 | Ga0373937_0013503 | Ga0373937_0013503_6434_6910 | 150 |
| 380 | 3300037853 | Ga0436364_0878561 | Ga0436364_0878561_1181_1639 | 150 |
| 381 | 3300037853 | Ga0436364_0956945 | Ga0436364_0956945_4607_5068 | 150 |
| 382 | 3300039437 | Ga0436365_1793152 | Ga0436365_1793152_255_728 | 150 |
| 383 | 3300039438 | Ga0436360_0487319 | Ga0436360_0487319_500_961 | 150 |
| 384 | 3300039438 | Ga0436360_0554890 | Ga0436360_0554890_107_580 | 150 |
| 385 | 3300039453 | Ga0436362_0207204 | Ga0436362_0207204_274_735 | 150 |
| 386 | 3300046536 | Ga0495587_0221576 | Ga0495587_0221576_301_777 | 150 |
| 387 | 3300046615 | Ga0495656_0467704 | Ga0495656_0467704_117_590 | 150 |
| 388 | 3300046675 | Ga0495657_0233420 | Ga0495657_0233420_526_1002 | 150 |
| 389 | 3300046678 | Ga0495599_0451881 | Ga0495599_0451881_73_549 | 150 |
| 390 | 3300047317 | Ga0495604_0117046 | Ga0495604_0117046_1405_1881 | 150 |
| 391 | 3300047444 | Ga0495675_0024946 | Ga0495675_0024946_1478_1954 | 150 |
| 392 | 3300049571 | Ga0501034_0006739 | Ga0501034_0006739_9391_9849 | 150 |
| 393 | 3300049571 | Ga0501034_0087154 | Ga0501034_0087154_1747_2205 | 150 |
| 394 | 3300049571 | Ga0501034_0110063 | Ga0501034_0110063_1694_2152 | 150 |
| 395 | 3300049585 | Ga0501069_0020409 | Ga0501069_0020409_601_1059 | 150 |
| 396 | 3300049586 | Ga0501070_0038350 | Ga0501070_0038350_345_803 | 150 |
| 397 | 3300049586 | Ga0501070_0065155 | Ga0501070_0065155_1435_1893 | 150 |
| 398 | 3300049586 | Ga0501070_0491927 | Ga0501070_0491927_258_716 | 150 |
| 399 | 3300049742 | Ga0501080_0049363 | Ga0501080_0049363_2367_2825 | 150 |
| 400 | 3300049742 | Ga0501080_0621352 | Ga0501080_0621352_487_945 | 150 |
| 401 | 3300049744 | Ga0501083_0024934 | Ga0501083_0024934_2409_2867 | 150 |
| 402 | 3300049744 | Ga0501083_0057721 | Ga0501083_0057721_1161_1619 | 150 |
| 403 | 3300049822 | Ga0501035_0029489 | Ga0501035_0029489_1460_1918 | 150 |
| 404 | 3300049822 | Ga0501035_0531694 | Ga0501035_0531694_23_481 | 150 |
| 405 | 3300050491 | nmdc:mga00v17_299995_c1 | nmdc:mga00v17_299995_c1_358_825 | 150 |
| 406 | 3300050496 | nmdc:mga07m45_184276_c1 | nmdc:mga07m45_184276_c1_674_1141 | 150 |
| 407 | 3300050512 | nmdc:mga0n895_235211_c1 | nmdc:mga0n895_235211_c1_986_1444 | 150 |
| 408 | 3300053077 | Ga0495601_0009361 | Ga0495601_0009361_2093_2569 | 150 |
| 409 | 3300053085 | Ga0495619_0004866 | Ga0495619_0004866_6025_6501 | 150 |
| 410 | 3300053098 | Ga0500650_0027389 | Ga0500650_0027389_1151_1609 | 150 |
| 411 | 3300053108 | Ga0500562_063632 | Ga0500562_063632_236_694 | 150 |
| 412 | 3300054114 | Ga0501084_0990049 | Ga0501084_0990049_90_548 | 150 |
| 413 | 3300060353 | Ga0501082_0361599 | Ga0501082_0361599_237_695 | 150 |
| 414 | iso_pu_bacteria | 2643221547 | 2643756295 | 150 |
| 415 | iso_pu_bacteria | 2828305725 | 2828309601 | 150 |
| 416 | 3300001991 | JGI24743J22301_10010240 | JGI24743J22301_100102403 | 151 |
| 417 | 3300002070 | JGI24750J21931_1005052 | JGI24750J21931_10050523 | 151 |
| 418 | 3300002077 | JGI24744J21845_10000313 | JGI24744J21845_100003136 | 151 |
| 419 | 3300002239 | JGI24034J26672_10002721 | JGI24034J26672_100027211 | 151 |
| 420 | 3300002244 | JGI24742J22300_10003208 | JGI24742J22300_100032083 | 151 |
| 421 | 3300002459 | JGI24751J29686_10033142 | JGI24751J29686_100331422 | 151 |
| 422 | 3300003320 | rootH2_10349800 | rootH2_103498002 | 151 |
| 423 | 3300003911 | JGI25405J52794_10006356 | JGI25405J52794_100063563 | 151 |
| 424 | 3300004801 | Ga0058860_11801317 | Ga0058860_118013171 | 151 |
| 425 | 3300005327 | Ga0070658_10176257 | Ga0070658_101762572 | 151 |
| 426 | 3300005328 | Ga0070676_10150439 | Ga0070676_101504392 | 151 |
| 427 | 3300005331 | Ga0070670_100016106 | Ga0070670_1000161063 | 151 |
| 428 | 3300005331 | Ga0070670_100084996 | Ga0070670_1000849962 | 151 |
| 429 | 3300005334 | Ga0068869_100772394 | Ga0068869_1007723942 | 151 |
| 430 | 3300005335 | Ga0070666_10003883 | Ga0070666_100038833 | 151 |
| 431 | 3300005336 | Ga0070680_101087240 | Ga0070680_1010872401 | 151 |
| 432 | 3300005338 | Ga0068868_100121320 | Ga0068868_1001213202 | 151 |
| 433 | 3300005338 | Ga0068868_100585545 | Ga0068868_1005855452 | 151 |
| 434 | 3300005339 | Ga0070660_100041561 | Ga0070660_1000415614 | 151 |
| 435 | 3300005344 | Ga0070661_100013819 | Ga0070661_1000138193 | 151 |
| 436 | 3300005347 | Ga0070668_100046181 | Ga0070668_1000461812 | 151 |
| 437 | 3300005347 | Ga0070668_100999569 | Ga0070668_1009995691 | 151 |
| 438 | 3300005353 | Ga0070669_100054968 | Ga0070669_1000549682 | 151 |
| 439 | 3300005354 | Ga0070675_100097445 | Ga0070675_1000974453 | 151 |
| 440 | 3300005355 | Ga0070671_100003576 | Ga0070671_1000035761 | 151 |
| 441 | 3300005356 | Ga0070674_100094227 | Ga0070674_1000942273 | 151 |
| 442 | 3300005364 | Ga0070673_100015590 | Ga0070673_1000155904 | 151 |
| 443 | 3300005365 | Ga0070688_100026564 | Ga0070688_1000265643 | 151 |
| 444 | 3300005365 | Ga0070688_101035173 | Ga0070688_1010351732 | 151 |
| 445 | 3300005366 | Ga0070659_100058332 | Ga0070659_1000583322 | 151 |
| 446 | 3300005367 | Ga0070667_100029202 | Ga0070667_1000292023 | 151 |
| 447 | 3300005434 | Ga0070709_10008529 | Ga0070709_100085294 | 151 |
| 448 | 3300005434 | Ga0070709_10155738 | Ga0070709_101557382 | 151 |
| 449 | 3300005434 | Ga0070709_10883600 | Ga0070709_108836002 | 151 |
| 450 | 3300005435 | Ga0070714_100002895 | Ga0070714_1000028959 | 151 |
| 451 | 3300005435 | Ga0070714_101345751 | Ga0070714_1013457511 | 151 |
| 452 | 3300005436 | Ga0070713_100000522 | Ga0070713_10000052218 | 151 |
| 453 | 3300005436 | Ga0070713_100011440 | Ga0070713_1000114406 | 151 |
| 454 | 3300005437 | Ga0070710_10007403 | Ga0070710_100074034 | 151 |
| 455 | 3300005438 | Ga0070701_10077299 | Ga0070701_100772992 | 151 |
| 456 | 3300005439 | Ga0070711_100015376 | Ga0070711_1000153764 | 151 |
| 457 | 3300005439 | Ga0070711_100425696 | Ga0070711_1004256961 | 151 |
| 458 | 3300005440 | Ga0070705_100012203 | Ga0070705_1000122034 | 151 |
| 459 | 3300005441 | Ga0070700_100046983 | Ga0070700_1000469832 | 151 |
| 460 | 3300005444 | Ga0070694_100141017 | Ga0070694_1001410172 | 151 |
| 461 | 3300005445 | Ga0070708_100045800 | Ga0070708_1000458005 | 151 |
| 462 | 3300005445 | Ga0070708_100512822 | Ga0070708_1005128221 | 151 |
| 463 | 3300005455 | Ga0070663_100153321 | Ga0070663_1001533211 | 151 |
| 464 | 3300005457 | Ga0070662_100045218 | Ga0070662_1000452183 | 151 |
| 465 | 3300005459 | Ga0068867_100011501 | Ga0068867_1000115013 | 151 |
| 466 | 3300005466 | Ga0070685_10003961 | Ga0070685_100039615 | 151 |
| 467 | 3300005468 | Ga0070707_100340290 | Ga0070707_1003402902 | 151 |
| 468 | 3300005471 | Ga0070698_100132969 | Ga0070698_1001329692 | 151 |
| 469 | 3300005471 | Ga0070698_100939994 | Ga0070698_1009399942 | 151 |
| 470 | 3300005518 | Ga0070699_100027933 | Ga0070699_1000279334 | 151 |
| 471 | 3300005518 | Ga0070699_100090652 | Ga0070699_1000906522 | 151 |
| 472 | 3300005535 | Ga0070684_100081079 | Ga0070684_1000810792 | 151 |
| 473 | 3300005539 | Ga0068853_100347238 | Ga0068853_1003472382 | 151 |
| 474 | 3300005544 | Ga0070686_100007896 | Ga0070686_1000078962 | 151 |
| 475 | 3300005547 | Ga0070693_100272157 | Ga0070693_1002721571 | 151 |
| 476 | 3300005548 | Ga0070665_100145699 | Ga0070665_1001456992 | 151 |
| 477 | 3300005549 | Ga0070704_101768070 | Ga0070704_1017680701 | 151 |
| 478 | 3300005563 | Ga0068855_100510734 | Ga0068855_1005107341 | 151 |
| 479 | 3300005578 | Ga0068854_100039606 | Ga0068854_1000396064 | 151 |
| 480 | 3300005615 | Ga0070702_100002486 | Ga0070702_1000024867 | 151 |
| 481 | 3300005616 | Ga0068852_100007204 | Ga0068852_1000072042 | 151 |
| 482 | 3300005617 | Ga0068859_100102927 | Ga0068859_1001029274 | 151 |
| 483 | 3300005618 | Ga0068864_100025576 | Ga0068864_1000255764 | 151 |
| 484 | 3300005718 | Ga0068866_10077946 | Ga0068866_100779463 | 151 |
| 485 | 3300005719 | Ga0068861_100032968 | Ga0068861_1000329682 | 151 |
| 486 | 3300005840 | Ga0068870_10002509 | Ga0068870_100025095 | 151 |
| 487 | 3300005842 | Ga0068858_100001353 | Ga0068858_10000135318 | 151 |
| 488 | 3300005842 | Ga0068858_102156578 | Ga0068858_1021565781 | 151 |
| 489 | 3300005843 | Ga0068860_101235203 | Ga0068860_1012352032 | 151 |
| 490 | 3300005937 | Ga0081455_10000853 | Ga0081455_1000085332 | 151 |
| 491 | 3300005937 | Ga0081455_10018403 | Ga0081455_100184032 | 151 |
| 492 | 3300005937 | Ga0081455_10075759 | Ga0081455_100757592 | 151 |
| 493 | 3300005937 | Ga0081455_10307322 | Ga0081455_103073222 | 151 |
| 494 | 3300005937 | Ga0081455_10343728 | Ga0081455_103437282 | 151 |
| 495 | 3300005981 | Ga0081538_10061297 | Ga0081538_100612972 | 151 |
| 496 | 3300005983 | Ga0081540_1016305 | Ga0081540_10163053 | 151 |
| 497 | 3300005985 | Ga0081539_10144285 | Ga0081539_101442851 | 151 |
| 498 | 3300006028 | Ga0070717_10000447 | Ga0070717_100004475 | 151 |
| 499 | 3300006028 | Ga0070717_10026215 | Ga0070717_100262152 | 151 |
| 500 | 3300006028 | Ga0070717_10327619 | Ga0070717_103276192 | 151 |
| 501 | 3300006038 | Ga0075365_10105076 | Ga0075365_101050763 | 151 |
| 502 | 3300006038 | Ga0075365_10126740 | Ga0075365_101267401 | 151 |
| 503 | 3300006038 | Ga0075365_10262379 | Ga0075365_102623791 | 151 |
| 504 | 3300006042 | Ga0075368_10028207 | Ga0075368_100282073 | 151 |
| 505 | 3300006042 | Ga0075368_10259479 | Ga0075368_102594791 | 151 |
| 506 | 3300006048 | Ga0075363_100112409 | Ga0075363_1001124092 | 151 |
| 507 | 3300006051 | Ga0075364_10250201 | Ga0075364_102502012 | 151 |
| 508 | 3300006163 | Ga0070715_10005522 | Ga0070715_100055222 | 151 |
| 509 | 3300006173 | Ga0070716_100012986 | Ga0070716_1000129864 | 151 |
| 510 | 3300006173 | Ga0070716_100140853 | Ga0070716_1001408532 | 151 |
| 511 | 3300006173 | Ga0070716_100373168 | Ga0070716_1003731682 | 151 |
| 512 | 3300006175 | Ga0070712_100020236 | Ga0070712_1000202364 | 151 |
| 513 | 3300006175 | Ga0070712_100372892 | Ga0070712_1003728922 | 151 |
| 514 | 3300006175 | Ga0070712_101236825 | Ga0070712_1012368252 | 151 |
| 515 | 3300006178 | Ga0075367_10206246 | Ga0075367_102062461 | 151 |
| 516 | 3300006237 | Ga0097621_100054866 | Ga0097621_1000548664 | 151 |
| 517 | 3300006844 | Ga0075428_100032651 | Ga0075428_1000326513 | 151 |
| 518 | 3300006844 | Ga0075428_102250835 | Ga0075428_1022508352 | 151 |
| 519 | 3300006846 | Ga0075430_100130875 | Ga0075430_1001308753 | 151 |
| 520 | 3300006846 | Ga0075430_100977995 | Ga0075430_1009779951 | 151 |
| 521 | 3300006847 | Ga0075431_100123790 | Ga0075431_1001237902 | 151 |
| 522 | 3300006847 | Ga0075431_100165818 | Ga0075431_1001658182 | 151 |
| 523 | 3300006847 | Ga0075431_100319383 | Ga0075431_1003193832 | 151 |
| 524 | 3300006871 | Ga0075434_100082619 | Ga0075434_1000826194 | 151 |
| 525 | 3300006871 | Ga0075434_100129902 | Ga0075434_1001299023 | 151 |
| 526 | 3300006871 | Ga0075434_102000193 | Ga0075434_1020001932 | 151 |
| 527 | 3300006880 | Ga0075429_100595149 | Ga0075429_1005951492 | 151 |
| 528 | 3300006881 | Ga0068865_100003113 | Ga0068865_1000031136 | 151 |
| 529 | 3300006914 | Ga0075436_100102789 | Ga0075436_1001027891 | 151 |
| 530 | 3300006931 | Ga0097620_100102923 | Ga0097620_1001029232 | 151 |
| 531 | 3300007076 | Ga0075435_100098114 | Ga0075435_1000981143 | 151 |
| 532 | 3300007076 | Ga0075435_100114282 | Ga0075435_1001142822 | 151 |
| 533 | 3300007076 | Ga0075435_100269692 | Ga0075435_1002696922 | 151 |
| 534 | 3300009011 | Ga0105251_10064962 | Ga0105251_100649622 | 151 |
| 535 | 3300009094 | Ga0111539_10054141 | Ga0111539_100541414 | 151 |
| 536 | 3300009094 | Ga0111539_10863925 | Ga0111539_108639252 | 151 |
| 537 | 3300009098 | Ga0105245_10084772 | Ga0105245_100847724 | 151 |
| 538 | 3300009101 | Ga0105247_10013158 | Ga0105247_100131583 | 151 |
| 539 | 3300009101 | Ga0105247_10494935 | Ga0105247_104949351 | 151 |
| 540 | 3300009147 | Ga0114129_10070412 | Ga0114129_100704124 | 151 |
| 541 | 3300009147 | Ga0114129_10126224 | Ga0114129_101262243 | 151 |
| 542 | 3300009147 | Ga0114129_10162344 | Ga0114129_101623444 | 151 |
| 543 | 3300009147 | Ga0114129_10163069 | Ga0114129_101630693 | 151 |
| 544 | 3300009148 | Ga0105243_10005394 | Ga0105243_100053944 | 151 |
| 545 | 3300009174 | Ga0105241_10044871 | Ga0105241_100448714 | 151 |
| 546 | 3300009176 | Ga0105242_10056726 | Ga0105242_100567262 | 151 |
| 547 | 3300009176 | Ga0105242_10612562 | Ga0105242_106125621 | 151 |
| 548 | 3300009177 | Ga0105248_10008040 | Ga0105248_1000804011 | 151 |
| 549 | 3300009545 | Ga0105237_11166238 | Ga0105237_111662381 | 151 |
| 550 | 3300009551 | Ga0105238_10059259 | Ga0105238_100592593 | 151 |
| 551 | 3300010375 | Ga0105239_10165897 | Ga0105239_101658972 | 151 |
| 552 | 3300010375 | Ga0105239_10551872 | Ga0105239_105518722 | 151 |
| 553 | 3300013100 | Ga0157373_10801518 | Ga0157373_108015182 | 151 |
| 554 | 3300013296 | Ga0157374_10010277 | Ga0157374_100102775 | 151 |
| 555 | 3300013297 | Ga0157378_10042417 | Ga0157378_100424173 | 151 |
| 556 | 3300013297 | Ga0157378_11261457 | Ga0157378_112614572 | 151 |
| 557 | 3300013306 | Ga0163162_11035397 | Ga0163162_110353972 | 151 |
| 558 | 3300013306 | Ga0163162_11633588 | Ga0163162_116335882 | 151 |
| 559 | 3300013308 | Ga0157375_13558122 | Ga0157375_135581221 | 151 |
| 560 | 3300014325 | Ga0163163_10091049 | Ga0163163_100910492 | 151 |
| 561 | 3300014326 | Ga0157380_10273023 | Ga0157380_102730232 | 151 |
| 562 | 3300014497 | Ga0182008_10428574 | Ga0182008_104285742 | 151 |
| 563 | 3300014745 | Ga0157377_10056931 | Ga0157377_100569312 | 151 |
| 564 | 3300014968 | Ga0157379_10023158 | Ga0157379_100231584 | 151 |
| 565 | 3300014968 | Ga0157379_11904597 | Ga0157379_119045972 | 151 |
| 566 | 3300014969 | Ga0157376_10077982 | Ga0157376_100779824 | 151 |
| 567 | 3300014969 | Ga0157376_11486705 | Ga0157376_114867051 | 151 |
| 568 | 3300014969 | Ga0157376_12740371 | Ga0157376_127403711 | 151 |
| 569 | 3300017792 | Ga0163161_11284526 | Ga0163161_112845262 | 151 |
| 570 | 3300021361 | Ga0213872_10238494 | Ga0213872_102384941 | 151 |
| 571 | 3300021384 | Ga0213876_10133043 | Ga0213876_101330432 | 151 |
| 572 | 3300021388 | Ga0213875_10140922 | Ga0213875_101409222 | 151 |
| 573 | 3300025315 | Ga0207697_10150676 | Ga0207697_101506762 | 151 |
| 574 | 3300025321 | Ga0207656_10066026 | Ga0207656_100660261 | 151 |
| 575 | 3300025898 | Ga0207692_10007792 | Ga0207692_100077923 | 151 |
| 576 | 3300025899 | Ga0207642_10668345 | Ga0207642_106683452 | 151 |
| 577 | 3300025900 | Ga0207710_10602385 | Ga0207710_106023851 | 151 |
| 578 | 3300025901 | Ga0207688_10000371 | Ga0207688_1000037112 | 151 |
| 579 | 3300025903 | Ga0207680_10150487 | Ga0207680_101504871 | 151 |
| 580 | 3300025904 | Ga0207647_10017077 | Ga0207647_100170774 | 151 |
| 581 | 3300025905 | Ga0207685_10009849 | Ga0207685_100098493 | 151 |
| 582 | 3300025906 | Ga0207699_10002470 | Ga0207699_100024703 | 151 |
| 583 | 3300025906 | Ga0207699_10850225 | Ga0207699_108502252 | 151 |
| 584 | 3300025907 | Ga0207645_10008321 | Ga0207645_100083214 | 151 |
| 585 | 3300025908 | Ga0207643_10000431 | Ga0207643_1000043126 | 151 |
| 586 | 3300025910 | Ga0207684_10006975 | Ga0207684_100069754 | 151 |
| 587 | 3300025911 | Ga0207654_10158395 | Ga0207654_101583952 | 151 |
| 588 | 3300025914 | Ga0207671_10804905 | Ga0207671_108049052 | 151 |
| 589 | 3300025915 | Ga0207693_10032964 | Ga0207693_100329643 | 151 |
| 590 | 3300025915 | Ga0207693_10187803 | Ga0207693_101878032 | 151 |
| 591 | 3300025915 | Ga0207693_10332682 | Ga0207693_103326822 | 151 |
| 592 | 3300025916 | Ga0207663_10003084 | Ga0207663_100030845 | 151 |
| 593 | 3300025916 | Ga0207663_10078702 | Ga0207663_100787023 | 151 |
| 594 | 3300025918 | Ga0207662_10002627 | Ga0207662_1000262711 | 151 |
| 595 | 3300025919 | Ga0207657_10029403 | Ga0207657_100294033 | 151 |
| 596 | 3300025924 | Ga0207694_10145615 | Ga0207694_101456153 | 151 |
| 597 | 3300025925 | Ga0207650_10011186 | Ga0207650_100111865 | 151 |
| 598 | 3300025925 | Ga0207650_10035669 | Ga0207650_100356694 | 151 |
| 599 | 3300025926 | Ga0207659_10015818 | Ga0207659_100158184 | 151 |
| 600 | 3300025927 | Ga0207687_10660979 | Ga0207687_106609792 | 151 |
| 601 | 3300025928 | Ga0207700_10005352 | Ga0207700_100053527 | 151 |
| 602 | 3300025928 | Ga0207700_10041070 | Ga0207700_100410703 | 151 |
| 603 | 3300025928 | Ga0207700_10276936 | Ga0207700_102769362 | 151 |
| 604 | 3300025928 | Ga0207700_10370966 | Ga0207700_103709661 | 151 |
| 605 | 3300025929 | Ga0207664_10049629 | Ga0207664_100496293 | 151 |
| 606 | 3300025931 | Ga0207644_10079804 | Ga0207644_100798043 | 151 |
| 607 | 3300025932 | Ga0207690_10093662 | Ga0207690_100936622 | 151 |
| 608 | 3300025933 | Ga0207706_10008492 | Ga0207706_100084923 | 151 |
| 609 | 3300025934 | Ga0207686_10096107 | Ga0207686_100961072 | 151 |
| 610 | 3300025935 | Ga0207709_10235941 | Ga0207709_102359412 | 151 |
| 611 | 3300025937 | Ga0207669_10018462 | Ga0207669_100184621 | 151 |
| 612 | 3300025938 | Ga0207704_10218884 | Ga0207704_102188841 | 151 |
| 613 | 3300025939 | Ga0207665_10003612 | Ga0207665_100036128 | 151 |
| 614 | 3300025939 | Ga0207665_10264003 | Ga0207665_102640031 | 151 |
| 615 | 3300025939 | Ga0207665_10831986 | Ga0207665_108319862 | 151 |
| 616 | 3300025940 | Ga0207691_10000542 | Ga0207691_1000054226 | 151 |
| 617 | 3300025941 | Ga0207711_10105870 | Ga0207711_101058703 | 151 |
| 618 | 3300025942 | Ga0207689_10027542 | Ga0207689_100275425 | 151 |
| 619 | 3300025944 | Ga0207661_10116859 | Ga0207661_101168593 | 151 |
| 620 | 3300025945 | Ga0207679_11369121 | Ga0207679_113691211 | 151 |
| 621 | 3300025949 | Ga0207667_10240297 | Ga0207667_102402972 | 151 |
| 622 | 3300025961 | Ga0207712_11063342 | Ga0207712_110633421 | 151 |
| 623 | 3300025981 | Ga0207640_11327486 | Ga0207640_113274861 | 151 |
| 624 | 3300026035 | Ga0207703_10025601 | Ga0207703_100256014 | 151 |
| 625 | 3300026067 | Ga0207678_10016045 | Ga0207678_100160453 | 151 |
| 626 | 3300026075 | Ga0207708_10000532 | Ga0207708_1000053215 | 151 |
| 627 | 3300026088 | Ga0207641_10024795 | Ga0207641_100247952 | 151 |
| 628 | 3300026089 | Ga0207648_10000825 | Ga0207648_1000082529 | 151 |
| 629 | 3300026095 | Ga0207676_10007032 | Ga0207676_100070322 | 151 |
| 630 | 3300026118 | Ga0207675_100007077 | Ga0207675_1000070772 | 151 |
| 631 | 3300026121 | Ga0207683_10004559 | Ga0207683_1000455910 | 151 |
| 632 | 3300026142 | Ga0207698_10105288 | Ga0207698_101052883 | 151 |
| 633 | 3300027671 | Ga0209588_1090760 | Ga0209588_10907601 | 151 |
| 634 | 3300027866 | Ga0209813_10260963 | Ga0209813_102609631 | 151 |
| 635 | 3300028379 | Ga0268266_10145977 | Ga0268266_101459773 | 151 |
| 636 | 3300028379 | Ga0268266_10749129 | Ga0268266_107491292 | 151 |
| 637 | 3300028381 | Ga0268264_10022950 | Ga0268264_100229504 | 151 |
| 638 | 3300028556 | Ga0265337_1004133 | Ga0265337_10041334 | 151 |
| 639 | 3300031242 | Ga0265329_10111677 | Ga0265329_101116771 | 151 |
| 640 | 3300031247 | Ga0265340_10010895 | Ga0265340_100108954 | 151 |
| 641 | 3300031249 | Ga0265339_10004315 | Ga0265339_100043153 | 151 |
| 642 | 3300031250 | Ga0265331_10150366 | Ga0265331_101503662 | 151 |
| 643 | 3300031344 | Ga0265316_10011100 | Ga0265316_100111005 | 151 |
| 644 | 3300031711 | Ga0265314_10069302 | Ga0265314_100693023 | 151 |
| 645 | 3300031712 | Ga0265342_10000233 | Ga0265342_100002332 | 151 |
| 646 | 3300031824 | Ga0307413_10433359 | Ga0307413_104333592 | 151 |
| 647 | 3300035083 | Ga0373926_0416027 | Ga0373926_0416027_57_512 | 151 |
| 648 | 3300035089 | Ga0373944_0008559 | Ga0373944_0008559_2230_2685 | 151 |
| 649 | 3300035090 | Ga0373949_0108854 | Ga0373949_0108854_187_642 | 151 |
| 650 | 3300035091 | Ga0373951_0038271 | Ga0373951_0038271_52_507 | 151 |
| 651 | 3300035113 | Ga0373936_0304613 | Ga0373936_0304613_223_678 | 151 |
| 652 | 3300035115 | Ga0373941_0002860 | Ga0373941_0002860_1763_2257 | 151 |
| 653 | 3300035121 | Ga0373960_0087607 | Ga0373960_0087607_322_777 | 151 |
| 654 | 3300035170 | Ga0373943_0006735 | Ga0373943_0006735_1863_2318 | 151 |
| 655 | 3300035170 | Ga0373943_0120920 | Ga0373943_0120920_252_713 | 151 |
| 656 | 3300035170 | Ga0373943_0326561 | Ga0373943_0326561_322_777 | 151 |
| 657 | 3300035171 | Ga0373946_0008089 | Ga0373946_0008089_86_541 | 151 |
| 658 | 3300035171 | Ga0373946_0508747 | Ga0373946_0508747_54_509 | 151 |
| 659 | 3300035172 | Ga0373955_0035612 | Ga0373955_0035612_84_539 | 151 |
| 660 | 3300035692 | Ga0373935_0298255 | Ga0373935_0298255_338_793 | 151 |
| 661 | 3300035695 | Ga0373927_0019283 | Ga0373927_0019283_985_1440 | 151 |
| 662 | 3300035695 | Ga0373927_0021733 | Ga0373927_0021733_329_784 | 151 |
| 663 | 3300035695 | Ga0373927_0358530 | Ga0373927_0358530_334_795 | 151 |
| 664 | 3300035695 | Ga0373927_0391480 | Ga0373927_0391480_46_501 | 151 |
| 665 | 3300035725 | Ga0373947_0018711 | Ga0373947_0018711_349_804 | 151 |
| 666 | 3300037068 | Ga0373925_0033074 | Ga0373925_0033074_2868_3323 | 151 |
| 667 | 3300037418 | Ga0395900_0088706 | Ga0395900_0088706_1138_1593 | 151 |
| 668 | 3300037418 | Ga0395900_0356599 | Ga0395900_0356599_360_824 | 151 |
| 669 | 3300037853 | Ga0436364_0687434 | Ga0436364_0687434_471_932 | 151 |
| 670 | 3300038443 | Ga0395901_0132208 | Ga0395901_0132208_1819_2274 | 151 |
| 671 | 3300038443 | Ga0395901_0828402 | Ga0395901_0828402_30_494 | 151 |
| 672 | 3300039437 | Ga0436365_0849289 | Ga0436365_0849289_624_1088 | 151 |
| 673 | 3300039437 | Ga0436365_0988571 | Ga0436365_0988571_326_790 | 151 |
| 674 | 3300039447 | Ga0436361_0203502 | Ga0436361_0203502_6924_7382 | 151 |
| 675 | 3300039447 | Ga0436361_0224754 | Ga0436361_0224754_277_741 | 151 |
| 676 | 3300039447 | Ga0436361_1089976 | Ga0436361_1089976_136_600 | 151 |
| 677 | 3300039450 | Ga0436363_0525535 | Ga0436363_0525535_1394_1858 | 151 |
| 678 | 3300039453 | Ga0436362_1296964 | Ga0436362_1296964_18_482 | 151 |
| 679 | 3300041408 | Ga0439453_0147701 | Ga0439453_0147701_31_537 | 151 |
| 680 | 3300041458 | Ga0451798_0720422 | Ga0451798_0720422_20_475 | 151 |
| 681 | 3300042001 | Ga0439441_031596 | Ga0439441_031596_425_931 | 151 |
| 682 | 3300046452 | Ga0495617_084789 | Ga0495617_084789_465_920 | 151 |
| 683 | 3300046453 | Ga0495627_143729 | Ga0495627_143729_40_495 | 151 |
| 684 | 3300046455 | Ga0495603_0013141 | Ga0495603_0013141_3371_3826 | 151 |
| 685 | 3300046455 | Ga0495603_0133783 | Ga0495603_0133783_322_777 | 151 |
| 686 | 3300046455 | Ga0495603_0511071 | Ga0495603_0511071_39_500 | 151 |
| 687 | 3300046457 | Ga0495590_0109177 | Ga0495590_0109177_14_469 | 151 |
| 688 | 3300046459 | Ga0495629_0311781 | Ga0495629_0311781_205_660 | 151 |
| 689 | 3300046460 | Ga0495638_0023057 | Ga0495638_0023057_3222_3677 | 151 |
| 690 | 3300046461 | Ga0495641_0287445 | Ga0495641_0287445_218_673 | 151 |
| 691 | 3300046462 | Ga0495651_0378400 | Ga0495651_0378400_296_760 | 151 |
| 692 | 3300046472 | Ga0495580_0177062 | Ga0495580_0177062_520_975 | 151 |
| 693 | 3300046472 | Ga0495580_0463712 | Ga0495580_0463712_182_643 | 151 |
| 694 | 3300046473 | Ga0495582_0073850 | Ga0495582_0073850_1080_1535 | 151 |
| 695 | 3300046475 | Ga0495639_0496539 | Ga0495639_0496539_107_562 | 151 |
| 696 | 3300046476 | Ga0495662_0014966 | Ga0495662_0014966_1085_1540 | 151 |
| 697 | 3300046477 | Ga0495664_0455576 | Ga0495664_0455576_190_645 | 151 |
| 698 | 3300046491 | Ga0495584_0005882 | Ga0495584_0005882_198_653 | 151 |
| 699 | 3300046491 | Ga0495584_0245701 | Ga0495584_0245701_322_777 | 151 |
| 700 | 3300046492 | Ga0495585_0223475 | Ga0495585_0223475_240_695 | 151 |
| 701 | 3300046500 | Ga0495596_0096200 | Ga0495596_0096200_440_895 | 151 |
| 702 | 3300046501 | Ga0495607_0358007 | Ga0495607_0358007_75_530 | 151 |
| 703 | 3300046506 | Ga0495583_0203406 | Ga0495583_0203406_65_520 | 151 |
| 704 | 3300046515 | Ga0495620_0219282 | Ga0495620_0219282_180_635 | 151 |
| 705 | 3300046516 | Ga0495628_0092408 | Ga0495628_0092408_986_1441 | 151 |
| 706 | 3300046517 | Ga0495630_0033852 | Ga0495630_0033852_1897_2358 | 151 |
| 707 | 3300046517 | Ga0495630_0727812 | Ga0495630_0727812_276_731 | 151 |
| 708 | 3300046519 | Ga0495632_0143703 | Ga0495632_0143703_131_586 | 151 |
| 709 | 3300046520 | Ga0495637_0132127 | Ga0495637_0132127_159_614 | 151 |
| 710 | 3300046523 | Ga0495644_0296305 | Ga0495644_0296305_35_490 | 151 |
| 711 | 3300046525 | Ga0495663_0303998 | Ga0495663_0303998_64_519 | 151 |
| 712 | 3300046526 | Ga0495666_0041406 | Ga0495666_0041406_1472_1927 | 151 |
| 713 | 3300046533 | Ga0495640_0591792 | Ga0495640_0591792_176_631 | 151 |
| 714 | 3300046538 | Ga0495609_0157891 | Ga0495609_0157891_308_763 | 151 |
| 715 | 3300046538 | Ga0495609_0267757 | Ga0495609_0267757_132_587 | 151 |
| 716 | 3300046539 | Ga0495621_0085070 | Ga0495621_0085070_458_913 | 151 |
| 717 | 3300046557 | Ga0495622_0016147 | Ga0495622_0016147_2047_2502 | 151 |
| 718 | 3300046558 | Ga0495633_0034046 | Ga0495633_0034046_750_1205 | 151 |
| 719 | 3300046615 | Ga0495656_0043198 | Ga0495656_0043198_1088_1543 | 151 |
| 720 | 3300046615 | Ga0495656_0071219 | Ga0495656_0071219_409_864 | 151 |
| 721 | 3300046615 | Ga0495656_0363345 | Ga0495656_0363345_241_702 | 151 |
| 722 | 3300046616 | Ga0495668_0106233 | Ga0495668_0106233_382_837 | 151 |
| 723 | 3300046616 | Ga0495668_0859657 | Ga0495668_0859657_23_484 | 151 |
| 724 | 3300046642 | Ga0495634_0173662 | Ga0495634_0173662_353_814 | 151 |
| 725 | 3300046642 | Ga0495634_0178865 | Ga0495634_0178865_483_938 | 151 |
| 726 | 3300046663 | Ga0495635_0281250 | Ga0495635_0281250_204_659 | 151 |
| 727 | 3300046664 | Ga0495659_0051660 | Ga0495659_0051660_773_1228 | 151 |
| 728 | 3300046681 | Ga0495647_0016516 | Ga0495647_0016516_992_1447 | 151 |
| 729 | 3300046683 | Ga0495658_0110900 | Ga0495658_0110900_439_894 | 151 |
| 730 | 3300046690 | Ga0495624_0262050 | Ga0495624_0262050_98_553 | 151 |
| 731 | 3300046691 | Ga0495670_0055322 | Ga0495670_0055322_890_1345 | 151 |
| 732 | 3300046692 | Ga0495671_0085036 | Ga0495671_0085036_529_984 | 151 |
| 733 | 3300046794 | Ga0495589_0235832 | Ga0495589_0235832_39_494 | 151 |
| 734 | 3300046809 | Ga0495600_0732485 | Ga0495600_0732485_20_475 | 151 |
| 735 | 3300047315 | Ga0495581_0327090 | Ga0495581_0327090_429_884 | 151 |
| 736 | 3300047315 | Ga0495581_0637726 | Ga0495581_0637726_124_579 | 151 |
| 737 | 3300047317 | Ga0495604_0248953 | Ga0495604_0248953_663_1118 | 151 |
| 738 | 3300047317 | Ga0495604_0406799 | Ga0495604_0406799_299_763 | 151 |
| 739 | 3300047319 | Ga0495674_0011651 | Ga0495674_0011651_3073_3534 | 151 |
| 740 | 3300047319 | Ga0495674_0269677 | Ga0495674_0269677_75_530 | 151 |
| 741 | 3300047319 | Ga0495674_0507245 | Ga0495674_0507245_414_869 | 151 |
| 742 | 3300047321 | Ga0495676_0019255 | Ga0495676_0019255_350_805 | 151 |
| 743 | 3300047321 | Ga0495676_0030454 | Ga0495676_0030454_3775_4230 | 151 |
| 744 | 3300047322 | Ga0495680_0271873 | Ga0495680_0271873_632_1096 | 151 |
| 745 | 3300047445 | Ga0495677_0217987 | Ga0495677_0217987_266_721 | 151 |
| 746 | 3300047446 | Ga0495679_031483 | Ga0495679_031483_302_757 | 151 |
| 747 | 3300047470 | Ga0495681_0092961 | Ga0495681_0092961_680_1135 | 151 |
| 748 | 3300047470 | Ga0495681_0192679 | Ga0495681_0192679_359_814 | 151 |
| 749 | 3300047471 | Ga0495684_0559776 | Ga0495684_0559776_135_590 | 151 |
| 750 | 3300047471 | Ga0495684_0857308 | Ga0495684_0857308_59_535 | 151 |
| 751 | 3300047673 | Ga0495593_0398182 | Ga0495593_0398182_179_634 | 151 |
| 752 | 3300048091 | Ga0495626_0145235 | Ga0495626_0145235_328_783 | 151 |
| 753 | 3300048903 | Ga0496100_0330649 | Ga0496100_0330649_331_795 | 151 |
| 754 | 3300048903 | Ga0496100_0354701 | Ga0496100_0354701_97_552 | 151 |
| 755 | 3300048903 | Ga0496100_0685608 | Ga0496100_0685608_262_717 | 151 |
| 756 | 3300048904 | Ga0496101_0065375 | Ga0496101_0065375_1883_2338 | 151 |
| 757 | 3300048904 | Ga0496101_0674695 | Ga0496101_0674695_135_599 | 151 |
| 758 | 3300048905 | Ga0496102_0002538 | Ga0496102_0002538_2320_2775 | 151 |
| 759 | 3300048905 | Ga0496102_0032009 | Ga0496102_0032009_565_1020 | 151 |
| 760 | 3300048905 | Ga0496102_0043973 | Ga0496102_0043973_272_736 | 151 |
| 761 | 3300048905 | Ga0496102_0731811 | Ga0496102_0731811_355_810 | 151 |
| 762 | 3300048906 | Ga0496103_0008867 | Ga0496103_0008867_5483_5938 | 151 |
| 763 | 3300048907 | Ga0496104_0003699 | Ga0496104_0003699_9916_10371 | 151 |
| 764 | 3300048907 | Ga0496104_0005339 | Ga0496104_0005339_3686_4141 | 151 |
| 765 | 3300048907 | Ga0496104_0005656 | Ga0496104_0005656_3257_3712 | 151 |
| 766 | 3300048907 | Ga0496104_0042076 | Ga0496104_0042076_1650_2105 | 151 |
| 767 | 3300048908 | Ga0496105_0006937 | Ga0496105_0006937_1235_1690 | 151 |
| 768 | 3300048908 | Ga0496105_0035873 | Ga0496105_0035873_2833_3288 | 151 |
| 769 | 3300048908 | Ga0496105_0214532 | Ga0496105_0214532_669_1133 | 151 |
| 770 | 3300048908 | Ga0496105_0453051 | Ga0496105_0453051_302_757 | 151 |
| 771 | 3300048909 | Ga0496106_0012088 | Ga0496106_0012088_4682_5137 | 151 |
| 772 | 3300048909 | Ga0496106_0031771 | Ga0496106_0031771_344_799 | 151 |
| 773 | 3300048909 | Ga0496106_0052175 | Ga0496106_0052175_67_522 | 151 |
| 774 | 3300048909 | Ga0496106_0229568 | Ga0496106_0229568_214_678 | 151 |
| 775 | 3300048909 | Ga0496106_1050807 | Ga0496106_1050807_69_524 | 151 |
| 776 | 3300048910 | Ga0496107_0483632 | Ga0496107_0483632_86_550 | 151 |
| 777 | 3300048910 | Ga0496107_0987140 | Ga0496107_0987140_71_526 | 151 |
| 778 | 3300048911 | Ga0496108_0014122 | Ga0496108_0014122_4035_4490 | 151 |
| 779 | 3300048911 | Ga0496108_0081845 | Ga0496108_0081845_1756_2211 | 151 |
| 780 | 3300048912 | Ga0496109_0072699 | Ga0496109_0072699_1094_1549 | 151 |
| 781 | 3300048912 | Ga0496109_0074841 | Ga0496109_0074841_61_516 | 151 |
| 782 | 3300048912 | Ga0496109_0316108 | Ga0496109_0316108_175_630 | 151 |
| 783 | 3300048912 | Ga0496109_1047195 | Ga0496109_1047195_158_613 | 151 |
| 784 | 3300048913 | Ga0496110_0020506 | Ga0496110_0020506_4144_4602 | 151 |
| 785 | 3300048913 | Ga0496110_0074141 | Ga0496110_0074141_2346_2801 | 151 |
| 786 | 3300048914 | Ga0496111_0000520 | Ga0496111_0000520_17402_17857 | 151 |
| 787 | 3300048914 | Ga0496111_0034353 | Ga0496111_0034353_1410_1865 | 151 |
| 788 | 3300048914 | Ga0496111_0060793 | Ga0496111_0060793_974_1438 | 151 |
| 789 | 3300048915 | Ga0496112_0032097 | Ga0496112_0032097_2026_2481 | 151 |
| 790 | 3300048915 | Ga0496112_0082669 | Ga0496112_0082669_965_1420 | 151 |
| 791 | 3300048915 | Ga0496112_0928936 | Ga0496112_0928936_69_527 | 151 |
| 792 | 3300048916 | Ga0496113_0004173 | Ga0496113_0004173_1487_1942 | 151 |
| 793 | 3300048916 | Ga0496113_0034836 | Ga0496113_0034836_2268_2723 | 151 |
| 794 | 3300048916 | Ga0496113_0417091 | Ga0496113_0417091_482_937 | 151 |
| 795 | 3300048916 | Ga0496113_0717908 | Ga0496113_0717908_38_502 | 151 |
| 796 | 3300048917 | Ga0496114_0021128 | Ga0496114_0021128_1363_1818 | 151 |
| 797 | 3300048917 | Ga0496114_0117326 | Ga0496114_0117326_1761_2216 | 151 |
| 798 | 3300048917 | Ga0496114_0524216 | Ga0496114_0524216_203_667 | 151 |
| 799 | 3300048917 | Ga0496114_0527142 | Ga0496114_0527142_388_843 | 151 |
| 800 | 3300048918 | Ga0496115_0009264 | Ga0496115_0009264_2552_3007 | 151 |
| 801 | 3300048918 | Ga0496115_0025115 | Ga0496115_0025115_2716_3171 | 151 |
| 802 | 3300048918 | Ga0496115_0086887 | Ga0496115_0086887_860_1315 | 151 |
| 803 | 3300049568 | Ga0501031_0053740 | Ga0501031_0053740_65_526 | 151 |
| 804 | 3300049569 | Ga0501032_0011792 | Ga0501032_0011792_1428_1889 | 151 |
| 805 | 3300049569 | Ga0501032_0026172 | Ga0501032_0026172_647_1141 | 151 |
| 806 | 3300049569 | Ga0501032_0891231 | Ga0501032_0891231_51_512 | 151 |
| 807 | 3300049570 | Ga0501033_0057569 | Ga0501033_0057569_515_976 | 151 |
| 808 | 3300049570 | Ga0501033_0094697 | Ga0501033_0094697_1200_1694 | 151 |
| 809 | 3300049571 | Ga0501034_0000097 | Ga0501034_0000097_128605_129066 | 151 |
| 810 | 3300049571 | Ga0501034_0003959 | Ga0501034_0003959_10586_11086 | 151 |
| 811 | 3300049571 | Ga0501034_0031402 | Ga0501034_0031402_2995_3456 | 151 |
| 812 | 3300049571 | Ga0501034_0105534 | Ga0501034_0105534_1571_2032 | 151 |
| 813 | 3300049571 | Ga0501034_0595480 | Ga0501034_0595480_188_649 | 151 |
| 814 | 3300049572 | Ga0501036_0002226 | Ga0501036_0002226_1557_2018 | 151 |
| 815 | 3300049572 | Ga0501036_0003062 | Ga0501036_0003062_3898_4398 | 151 |
| 816 | 3300049572 | Ga0501036_0586633 | Ga0501036_0586633_314_775 | 151 |
| 817 | 3300049573 | Ga0501037_0048015 | Ga0501037_0048015_229_690 | 151 |
| 818 | 3300049573 | Ga0501037_0055716 | Ga0501037_0055716_181_681 | 151 |
| 819 | 3300049573 | Ga0501037_0159662 | Ga0501037_0159662_362_856 | 151 |
| 820 | 3300049573 | Ga0501037_0383636 | Ga0501037_0383636_401_862 | 151 |
| 821 | 3300049573 | Ga0501037_0793588 | Ga0501037_0793588_32_493 | 151 |
| 822 | 3300049574 | Ga0501038_0002646 | Ga0501038_0002646_12677_13138 | 151 |
| 823 | 3300049574 | Ga0501038_0073137 | Ga0501038_0073137_2358_2819 | 151 |
| 824 | 3300049574 | Ga0501038_0226098 | Ga0501038_0226098_12_512 | 151 |
| 825 | 3300049574 | Ga0501038_0929008 | Ga0501038_0929008_70_531 | 151 |
| 826 | 3300049575 | Ga0501039_0032726 | Ga0501039_0032726_2122_2616 | 151 |
| 827 | 3300049575 | Ga0501039_0116119 | Ga0501039_0116119_183_644 | 151 |
| 828 | 3300049575 | Ga0501039_0274341 | Ga0501039_0274341_41_496 | 151 |
| 829 | 3300049575 | Ga0501039_0492366 | Ga0501039_0492366_288_749 | 151 |
| 830 | 3300049576 | Ga0501040_0112491 | Ga0501040_0112491_1084_1545 | 151 |
| 831 | 3300049576 | Ga0501040_0454926 | Ga0501040_0454926_47_574 | 151 |
| 832 | 3300049578 | Ga0501042_0195786 | Ga0501042_0195786_203_658 | 151 |
| 833 | 3300049579 | Ga0501043_0003254 | Ga0501043_0003254_3041_3541 | 151 |
| 834 | 3300049579 | Ga0501043_0059364 | Ga0501043_0059364_1839_2327 | 151 |
| 835 | 3300049580 | Ga0501046_0048704 | Ga0501046_0048704_2159_2620 | 151 |
| 836 | 3300049580 | Ga0501046_0152148 | Ga0501046_0152148_1242_1703 | 151 |
| 837 | 3300049580 | Ga0501046_0342683 | Ga0501046_0342683_380_907 | 151 |
| 838 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_5838_6338 | 151 |
| 839 | 3300049581 | Ga0501047_0023364 | Ga0501047_0023364_1571_2065 | 151 |
| 840 | 3300049581 | Ga0501047_0189545 | Ga0501047_0189545_269_730 | 151 |
| 841 | 3300049582 | Ga0501048_0002496 | Ga0501048_0002496_148_648 | 151 |
| 842 | 3300049582 | Ga0501048_0056670 | Ga0501048_0056670_2188_2649 | 151 |
| 843 | 3300049583 | Ga0501067_0073636 | Ga0501067_0073636_1341_1802 | 151 |
| 844 | 3300049584 | Ga0501068_0028385 | Ga0501068_0028385_2561_3022 | 151 |
| 845 | 3300049584 | Ga0501068_0042380 | Ga0501068_0042380_399_893 | 151 |
| 846 | 3300049584 | Ga0501068_0055856 | Ga0501068_0055856_1653_2114 | 151 |
| 847 | 3300049584 | Ga0501068_0059611 | Ga0501068_0059611_533_994 | 151 |
| 848 | 3300049584 | Ga0501068_0128273 | Ga0501068_0128273_341_841 | 151 |
| 849 | 3300049585 | Ga0501069_0015441 | Ga0501069_0015441_225_686 | 151 |
| 850 | 3300049585 | Ga0501069_0302408 | Ga0501069_0302408_259_753 | 151 |
| 851 | 3300049586 | Ga0501070_0017811 | Ga0501070_0017811_1746_2240 | 151 |
| 852 | 3300049586 | Ga0501070_0046396 | Ga0501070_0046396_1747_2247 | 151 |
| 853 | 3300049586 | Ga0501070_0189787 | Ga0501070_0189787_1212_1673 | 151 |
| 854 | 3300049587 | Ga0501071_0159645 | Ga0501071_0159645_908_1369 | 151 |
| 855 | 3300049587 | Ga0501071_0296665 | Ga0501071_0296665_78_533 | 151 |
| 856 | 3300049587 | Ga0501071_0610133 | Ga0501071_0610133_83_544 | 151 |
| 857 | 3300049589 | Ga0501073_0069621 | Ga0501073_0069621_1603_2064 | 151 |
| 858 | 3300049589 | Ga0501073_0099474 | Ga0501073_0099474_1476_1937 | 151 |
| 859 | 3300049589 | Ga0501073_0108787 | Ga0501073_0108787_380_874 | 151 |
| 860 | 3300049590 | Ga0501074_0008172 | Ga0501074_0008172_5134_5634 | 151 |
| 861 | 3300049590 | Ga0501074_0193078 | Ga0501074_0193078_601_1095 | 151 |
| 862 | 3300049590 | Ga0501074_0238875 | Ga0501074_0238875_173_634 | 151 |
| 863 | 3300049590 | Ga0501074_0334132 | Ga0501074_0334132_443_898 | 151 |
| 864 | 3300049590 | Ga0501074_1017274 | Ga0501074_1017274_61_522 | 151 |
| 865 | 3300049591 | Ga0501075_0449918 | Ga0501075_0449918_315_776 | 151 |
| 866 | 3300049591 | Ga0501075_0789823 | Ga0501075_0789823_248_703 | 151 |
| 867 | 3300049592 | Ga0501076_0127152 | Ga0501076_0127152_888_1349 | 151 |
| 868 | 3300049593 | Ga0501077_0913701 | Ga0501077_0913701_78_536 | 151 |
| 869 | 3300049741 | Ga0501079_0359075 | Ga0501079_0359075_110_565 | 151 |
| 870 | 3300049741 | Ga0501079_0407732 | Ga0501079_0407732_375_869 | 151 |
| 871 | 3300049741 | Ga0501079_0619246 | Ga0501079_0619246_186_647 | 151 |
| 872 | 3300049742 | Ga0501080_0006002 | Ga0501080_0006002_10162_10623 | 151 |
| 873 | 3300049742 | Ga0501080_0006165 | Ga0501080_0006165_48_509 | 151 |
| 874 | 3300049742 | Ga0501080_0031760 | Ga0501080_0031760_1141_1635 | 151 |
| 875 | 3300049742 | Ga0501080_0401778 | Ga0501080_0401778_84_545 | 151 |
| 876 | 3300049742 | Ga0501080_1031869 | Ga0501080_1031869_218_679 | 151 |
| 877 | 3300049742 | Ga0501080_1042089 | Ga0501080_1042089_189_644 | 151 |
| 878 | 3300049743 | Ga0501081_0279521 | Ga0501081_0279521_447_908 | 151 |
| 879 | 3300049744 | Ga0501083_0000677 | Ga0501083_0000677_4954_5454 | 151 |
| 880 | 3300049744 | Ga0501083_0218332 | Ga0501083_0218332_698_1159 | 151 |
| 881 | 3300049744 | Ga0501083_0230649 | Ga0501083_0230649_519_1013 | 151 |
| 882 | 3300049744 | Ga0501083_0783196 | Ga0501083_0783196_101_556 | 151 |
| 883 | 3300049822 | Ga0501035_0032444 | Ga0501035_0032444_2774_3268 | 151 |
| 884 | 3300049822 | Ga0501035_0190491 | Ga0501035_0190491_362_823 | 151 |
| 885 | 3300049822 | Ga0501035_0651987 | Ga0501035_0651987_301_762 | 151 |
| 886 | 3300049823 | Ga0501044_0002568 | Ga0501044_0002568_11958_12458 | 151 |
| 887 | 3300049823 | Ga0501044_0173859 | Ga0501044_0173859_452_913 | 151 |
| 888 | 3300049823 | Ga0501044_0332973 | Ga0501044_0332973_616_1110 | 151 |
| 889 | 3300049823 | Ga0501044_0858025 | Ga0501044_0858025_257_718 | 151 |
| 890 | 3300049823 | Ga0501044_1018031 | Ga0501044_1018031_55_582 | 151 |
| 891 | 3300049824 | Ga0501045_0268657 | Ga0501045_0268657_340_819 | 151 |
| 892 | 3300049824 | Ga0501045_0366055 | Ga0501045_0366055_170_631 | 151 |
| 893 | 3300049824 | Ga0501045_0653646 | Ga0501045_0653646_140_595 | 151 |
| 894 | 3300050490 | nmdc:mga03n38_29764_c1 | nmdc:mga03n38_29764_c1_21_482 | 151 |
| 895 | 3300050490 | nmdc:mga03n38_48607_c1 | nmdc:mga03n38_48607_c1_220_675 | 151 |
| 896 | 3300050491 | nmdc:mga00v17_382140_c1 | nmdc:mga00v17_382140_c1_49_504 | 151 |
| 897 | 3300050492 | nmdc:mga0yw44_108417_c1 | nmdc:mga0yw44_108417_c1_107_562 | 151 |
| 898 | 3300050492 | nmdc:mga0yw44_13748_c1 | nmdc:mga0yw44_13748_c1_1382_1837 | 151 |
| 899 | 3300050492 | nmdc:mga0yw44_308540_c1 | nmdc:mga0yw44_308540_c1_63_518 | 151 |
| 900 | 3300050494 | nmdc:mga06z11_249044_c1 | nmdc:mga06z11_249044_c1_248_703 | 151 |
| 901 | 3300050494 | nmdc:mga06z11_295462_c1 | nmdc:mga06z11_295462_c1_119_574 | 151 |
| 902 | 3300050495 | nmdc:mga04h51_138102_c1 | nmdc:mga04h51_138102_c1_207_662 | 151 |
| 903 | 3300050495 | nmdc:mga04h51_294673_c1 | nmdc:mga04h51_294673_c1_77_535 | 151 |
| 904 | 3300050507 | nmdc:mga05p37_111062_c1 | nmdc:mga05p37_111062_c1_875_1330 | 151 |
| 905 | 3300050507 | nmdc:mga05p37_461907_c1 | nmdc:mga05p37_461907_c1_680_1138 | 151 |
| 906 | 3300050507 | nmdc:mga05p37_535190_c1 | nmdc:mga05p37_535190_c1_856_1311 | 151 |
| 907 | 3300050507 | nmdc:mga05p37_62442_c1 | nmdc:mga05p37_62442_c1_2891_3346 | 151 |
| 908 | 3300050507 | nmdc:mga05p37_70164_c1 | nmdc:mga05p37_70164_c1_2186_2641 | 151 |
| 909 | 3300050509 | nmdc:mga0qj67_516077_c1 | nmdc:mga0qj67_516077_c1_364_819 | 151 |
| 910 | 3300050510 | nmdc:mga06r32_338648_c1 | nmdc:mga06r32_338648_c1_305_760 | 151 |
| 911 | 3300050510 | nmdc:mga06r32_922211_c1 | nmdc:mga06r32_922211_c1_231_686 | 151 |
| 912 | 3300050510 | nmdc:mga06r32_95751_c1 | nmdc:mga06r32_95751_c1_1217_1672 | 151 |
| 913 | 3300050511 | nmdc:mga08y16_28718_c1 | nmdc:mga08y16_28718_c1_2186_2641 | 151 |
| 914 | 3300050512 | nmdc:mga0n895_2142469_c1 | nmdc:mga0n895_2142469_c1_16_477 | 151 |
| 915 | 3300050512 | nmdc:mga0n895_44768_c1 | nmdc:mga0n895_44768_c1_2932_3387 | 151 |
| 916 | 3300050513 | nmdc:mga0rr50_130487_c1 | nmdc:mga0rr50_130487_c1_300_758 | 151 |
| 917 | 3300050513 | nmdc:mga0rr50_436217_c1 | nmdc:mga0rr50_436217_c1_567_1022 | 151 |
| 918 | 3300050513 | nmdc:mga0rr50_579730_c1 | nmdc:mga0rr50_579730_c1_172_627 | 151 |
| 919 | 3300050513 | nmdc:mga0rr50_910756_c1 | nmdc:mga0rr50_910756_c1_166_621 | 151 |
| 920 | 3300050514 | nmdc:mga08x19_1184617_c1 | nmdc:mga08x19_1184617_c1_57_512 | 151 |
| 921 | 3300050515 | nmdc:mga0a205_223853_c1 | nmdc:mga0a205_223853_c1_35_493 | 151 |
| 922 | 3300053077 | Ga0495601_0000361 | Ga0495601_0000361_14727_15188 | 151 |
| 923 | 3300053084 | Ga0495595_0019093 | Ga0495595_0019093_258_722 | 151 |
| 924 | 3300053084 | Ga0495595_0061510 | Ga0495595_0061510_327_782 | 151 |
| 925 | 3300053085 | Ga0495619_0028211 | Ga0495619_0028211_2144_2608 | 151 |
| 926 | 3300053085 | Ga0495619_0124706 | Ga0495619_0124706_887_1363 | 151 |
| 927 | 3300053085 | Ga0495619_0314345 | Ga0495619_0314345_219_704 | 151 |
| 928 | 3300053094 | Ga0500566_0235380 | Ga0500566_0235380_294_749 | 151 |
| 929 | 3300053153 | Ga0500616_0137945 | Ga0500616_0137945_628_1089 | 151 |
| 930 | 3300054114 | Ga0501084_0105761 | Ga0501084_0105761_603_1058 | 151 |
| 931 | 3300054114 | Ga0501084_0109726 | Ga0501084_0109726_1123_1578 | 151 |
| 932 | 3300054114 | Ga0501084_0138605 | Ga0501084_0138605_585_1046 | 151 |
| 933 | 3300054114 | Ga0501084_0367418 | Ga0501084_0367418_285_746 | 151 |
| 934 | 3300054114 | Ga0501084_0522989 | Ga0501084_0522989_413_940 | 151 |
| 935 | 3300060353 | Ga0501082_0413055 | Ga0501082_0413055_271_765 | 151 |
| 936 | 3300060353 | Ga0501082_0565055 | Ga0501082_0565055_473_934 | 151 |
| 937 | 3300061734 | Ga0530510_0052121 | Ga0530510_0052121_2492_2947 | 151 |
| 938 | 3300061734 | Ga0530510_0069077 | Ga0530510_0069077_1583_2038 | 151 |
| 939 | 3300061734 | Ga0530510_0649400 | Ga0530510_0649400_56_511 | 151 |
| 940 | iso_pu_bacteria | 8054563764 | 8054567780 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d6x-assembly1.cif.gz_F | crystal structure of campylobacter jejuni fabz | 0.9724 | 12 | 151 |
| 3d6x-assembly1.cif.gz_D | crystal structure of campylobacter jejuni fabz | 0.9714 | 11 | 151 |
| 3doz-assembly1.cif.gz_B | crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase (fabz) from helicobacter pylori in complex with compound 3k | 0.9627 | 10 | 151 |
| 3d6x-assembly1.cif.gz_A | crystal structure of campylobacter jejuni fabz | 0.962 | 11 | 151 |
| 3d6x-assembly1.cif.gz_C | crystal structure of campylobacter jejuni fabz | 0.9592 | 12 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gllA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9626 | 9 | 151 | 3.10.129.10 |
| 3d6xF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.956 | 11 | 150 | 3.10.129.10 |
| 4h4gA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9541 | 11 | 151 | 3.10.129.10 |
| 3d6xF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9489 | 11 | 150 | 3.10.129.10 |
| af_Q2FWF5_1_146_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9419 | 11 | 151 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656Z5U0-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9839 | 27 | 151 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A2E7FXR6-F1-model_v4 | deleted | 0.9764 | 11 | 151 |
|
| AF-A0A3M0CGW3-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9748 | 10 | 151 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A2D7BQS1-F1-model_v4 | Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acylglucosamine N-acyltransferase (EC 2.3.1.191)] | 0.9747 | 10 | 151 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0016410 GO:0019171 |
| AF-A0A3M1GB20-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) | 0.973 | 17 | 151 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar