F486321

General Info

Members Datasets Scaffolds Average Seq Length
940 416 937 152

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0454926|Ga0501040_0454926_47_574
Length 175
Sequence MAPSLWRPSSIVLIGCIRKGESMNEASGTVDAVGIATILKSLPHRYPFLMVDRVVNIRGEEFGMGIKNVTINEPQFLGHFPDNPIFPGVLLIEGMAQTAGVLCVLAWPKGSPPPYVYFMTIDEAKFRKPVVPGDTVEFHMTMVRRRKNMWWYRGEAKVDGELVAEATLSAMMGER

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
255 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
256 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
257 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
260 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
335 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
380 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
381 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
390 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
398 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
399 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
402 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
409 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
410 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
411 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
412 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
415 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
416 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.21
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 5.43
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10010240 3300001991 Bacteria 1671
2 JGI24750J21931_1005052 3300002070 Bacteria 1615
3 JGI24744J21845_10000313 3300002077 Bacteria 8167
4 JGI24034J26672_10002721 3300002239 Bacteria 2439
5 JGI24742J22300_10003208 3300002244 Bacteria 2647
6 JGI24751J29686_10033142 3300002459 Bacteria 1071
7 rootH1_10126579 3300003316 Bacteria 2940
8 rootH2_10349800 3300003320 Bacteria 1169
9 rootL2_10111746 3300003322 Bacteria 7827
10 Ga0055536_1028189 3300003781 Bacteria 1535
11 JGI25405J52794_10006356 3300003911 Bacteria 2158
12 JGI25405J52794_10010918 3300003911 Bacteria 1734
13 Ga0058860_11801317 3300004801 Bacteria 536
14 Ga0065704_10471892 3300005289 Bacteria 683
15 Ga0070658_10176257 3300005327 Bacteria 1798
16 Ga0070676_10150439 3300005328 Bacteria 1489
17 Ga0070683_100039407 3300005329 Bacteria 4337
18 Ga0070670_100016106 3300005331 Bacteria 6416
19 Ga0070670_100084996 3300005331 Bacteria 2719
20 Ga0068869_100772394 3300005334 Bacteria 824
21 Ga0070666_10003883 3300005335 Bacteria 9078
22 Ga0070666_10192017 3300005335 Bacteria 1435
23 Ga0070680_100311056 3300005336 Bacteria 1337
24 Ga0070680_101087240 3300005336 Bacteria 691
25 Ga0068868_100121320 3300005338 Bacteria 2132
26 Ga0068868_100585545 3300005338 Bacteria 987
27 Ga0070660_100041561 3300005339 Bacteria 3505
28 Ga0070687_101036976 3300005343 Bacteria 596
29 Ga0070661_100013819 3300005344 Bacteria 5674
30 Ga0070692_10583006 3300005345 Bacteria 737
31 Ga0070668_100046181 3300005347 Bacteria 3343
32 Ga0070668_100999569 3300005347 Bacteria 752
33 Ga0070669_100054968 3300005353 Bacteria 2917
34 Ga0070675_100097445 3300005354 Bacteria 2472
35 Ga0070675_101089942 3300005354 Bacteria 734
36 Ga0070671_100003576 3300005355 Bacteria 12156
37 Ga0070674_100094227 3300005356 Bacteria 2168
38 Ga0070674_100370433 3300005356 Bacteria 1162
39 Ga0070674_100595920 3300005356 Bacteria 933
40 Ga0070673_100015590 3300005364 Bacteria 5345
41 Ga0070673_101196151 3300005364 Bacteria 712
42 Ga0070688_100026564 3300005365 Bacteria 3441
43 Ga0070688_101035173 3300005365 Bacteria 654
44 Ga0070659_100058332 3300005366 Bacteria 3046
45 Ga0070659_101039357 3300005366 Bacteria 720
46 Ga0070667_100029202 3300005367 Bacteria 4593
47 Ga0070709_10008529 3300005434 Bacteria 5632
48 Ga0070709_10032134 3300005434 Bacteria 3163
49 Ga0070709_10155738 3300005434 Bacteria 1584
50 Ga0070709_10816516 3300005434 Bacteria 733
51 Ga0070709_10883600 3300005434 Bacteria 706
52 Ga0070714_100002895 3300005435 Bacteria 12704
53 Ga0070714_100206652 3300005435 Bacteria 1798
54 Ga0070714_100359938 3300005435 Bacteria 1368
55 Ga0070714_100475997 3300005435 Bacteria 1189
56 Ga0070714_101345751 3300005435 Bacteria 697
57 Ga0070713_100000522 3300005436 Bacteria 24346
58 Ga0070713_100011440 3300005436 Bacteria 6463
59 Ga0070713_100103130 3300005436 Bacteria 2475
60 Ga0070713_101544619 3300005436 Bacteria 644
61 Ga0070710_10007403 3300005437 Bacteria 5314
62 Ga0070710_10011480 3300005437 Bacteria 4376
63 Ga0070701_10077299 3300005438 Bacteria 1793
64 Ga0070711_100015376 3300005439 Bacteria 4843
65 Ga0070711_100139364 3300005439 Bacteria 1816
66 Ga0070711_100355271 3300005439 Bacteria 1179
67 Ga0070711_100425696 3300005439 Bacteria 1082
68 Ga0070705_100012203 3300005440 Bacteria 4362
69 Ga0070700_100046983 3300005441 Bacteria 2669
70 Ga0070694_100141017 3300005444 Bacteria 1751
71 Ga0070708_100045800 3300005445 Bacteria 3856
72 Ga0070708_100512822 3300005445 Bacteria 1131
73 Ga0070663_100153321 3300005455 Bacteria 1768
74 Ga0070662_100045218 3300005457 Bacteria 3157
75 Ga0070662_100747252 3300005457 Bacteria 829
76 Ga0070681_10279122 3300005458 Bacteria 1581
77 Ga0068867_100011501 3300005459 Bacteria 6247
78 Ga0070685_10003961 3300005466 Bacteria 7483
79 Ga0070707_100340290 3300005468 Bacteria 1457
80 Ga0070698_100132969 3300005471 Bacteria 2442
81 Ga0070698_100298832 3300005471 Bacteria 1541
82 Ga0070698_100939994 3300005471 Bacteria 811
83 Ga0070699_100027933 3300005518 Bacteria 4867
84 Ga0070699_100090652 3300005518 Bacteria 2672
85 Ga0070679_100110386 3300005530 Bacteria 2736
86 Ga0070684_100009679 3300005535 Bacteria 7603
87 Ga0070684_100081079 3300005535 Bacteria 2871
88 Ga0068853_100162531 3300005539 Bacteria 2016
89 Ga0068853_100347238 3300005539 Bacteria 1380
90 Ga0070672_100704898 3300005543 Bacteria 884
91 Ga0070686_100007896 3300005544 Bacteria 5949
92 Ga0070686_100898859 3300005544 Bacteria 720
93 Ga0070693_100272157 3300005547 Bacteria 1131
94 Ga0070665_100145699 3300005548 Bacteria 2371
95 Ga0070704_101768070 3300005549 Bacteria 572
96 Ga0068855_100510734 3300005563 Bacteria 1305
97 Ga0068854_100039606 3300005578 Bacteria 3321
98 Ga0068854_100281684 3300005578 Bacteria 1339
99 Ga0068856_100194447 3300005614 Bacteria 2042
100 Ga0068856_100236265 3300005614 Bacteria 1843
101 Ga0070702_100002486 3300005615 Bacteria 7976
102 Ga0068852_100007204 3300005616 Bacteria 8107
103 Ga0068859_100102927 3300005617 Bacteria 2913
104 Ga0068864_100025576 3300005618 Bacteria 4973
105 Ga0068866_10077946 3300005718 Bacteria 1771
106 Ga0068861_100032968 3300005719 Bacteria 3818
107 Ga0068870_10002509 3300005840 Bacteria 7660
108 Ga0068858_100001353 3300005842 Bacteria 25256
109 Ga0068858_102156578 3300005842 Bacteria 551
110 Ga0068860_101235203 3300005843 Bacteria 768
111 Ga0081455_10000853 3300005937 Bacteria 39265
112 Ga0081455_10003196 3300005937 Bacteria 18983
113 Ga0081455_10005182 3300005937 Bacteria 14347
114 Ga0081455_10017568 3300005937 Bacteria 6850
115 Ga0081455_10018403 3300005937 Bacteria 6658
116 Ga0081455_10075759 3300005937 Bacteria 2774
117 Ga0081455_10307322 3300005937 Bacteria 1135
118 Ga0081455_10343728 3300005937 Bacteria 1055
119 Ga0081538_10061297 3300005981 Bacteria 2154
120 Ga0081540_1001438 3300005983 Bacteria 20573
121 Ga0081540_1016305 3300005983 Bacteria 4655
122 Ga0081540_1040839 3300005983 Bacteria 2413
123 Ga0081540_1049164 3300005983 Bacteria 2106
124 Ga0081539_10144285 3300005985 Bacteria 1153
125 Ga0070717_10000447 3300006028 Bacteria 26109
126 Ga0070717_10026215 3300006028 Bacteria 4648
127 Ga0070717_10327619 3300006028 Bacteria 1366
128 Ga0070717_10621699 3300006028 Bacteria 980
129 Ga0075365_10026205 3300006038 Bacteria 3699
130 Ga0075365_10105076 3300006038 Bacteria 1937
131 Ga0075365_10126740 3300006038 Bacteria 1764
132 Ga0075365_10262379 3300006038 Bacteria 1215
133 Ga0075365_10521466 3300006038 Bacteria 840
134 Ga0075368_10028207 3300006042 Bacteria 2168
135 Ga0075368_10259479 3300006042 Bacteria 744
136 Ga0075363_100013666 3300006048 Bacteria 3945
137 Ga0075363_100112409 3300006048 Bacteria 1515
138 Ga0075363_100855048 3300006048 Bacteria 555
139 Ga0075364_10186859 3300006051 Bacteria 1403
140 Ga0075364_10250201 3300006051 Bacteria 1204
141 Ga0075364_10275628 3300006051 Bacteria 1144
142 Ga0070715_10005522 3300006163 Bacteria 4223
143 Ga0070716_100012986 3300006173 Bacteria 4233
144 Ga0070716_100140853 3300006173 Bacteria 1538
145 Ga0070716_100373168 3300006173 Bacteria 1017
146 Ga0070716_101438023 3300006173 Bacteria 562
147 Ga0070712_100002337 3300006175 Bacteria 11684
148 Ga0070712_100020236 3300006175 Bacteria 4353
149 Ga0070712_100024652 3300006175 Bacteria 3989
150 Ga0070712_100178157 3300006175 Bacteria 1654
151 Ga0070712_100372892 3300006175 Bacteria 1173
152 Ga0070712_101236825 3300006175 Bacteria 650
153 Ga0075367_10206246 3300006178 Bacteria 1228
154 Ga0075367_10233502 3300006178 Bacteria 1152
155 Ga0075369_10398190 3300006186 Bacteria 649
156 Ga0075366_10118105 3300006195 Bacteria 1598
157 Ga0097621_100054866 3300006237 Bacteria 3252
158 Ga0075370_10061293 3300006353 Bacteria 2143
159 Ga0075370_10236984 3300006353 Bacteria 1080
160 Ga0075428_100032651 3300006844 Bacteria 5749
161 Ga0075428_100616526 3300006844 Bacteria 1158
162 Ga0075428_102250835 3300006844 Bacteria 562
163 Ga0075430_100130875 3300006846 Bacteria 2091
164 Ga0075430_100977995 3300006846 Bacteria 697
165 Ga0075431_100094711 3300006847 Bacteria 3082
166 Ga0075431_100123790 3300006847 Bacteria 2668
167 Ga0075431_100165818 3300006847 Bacteria 2271
168 Ga0075431_100319383 3300006847 Bacteria 1566
169 Ga0075434_100082619 3300006871 Bacteria 3210
170 Ga0075434_100129902 3300006871 Bacteria 2538
171 Ga0075434_100223693 3300006871 Bacteria 1902
172 Ga0075434_102000193 3300006871 Bacteria 585
173 Ga0075429_100595149 3300006880 Bacteria 969
174 Ga0068865_100003113 3300006881 Bacteria 9921
175 Ga0075436_100062940 3300006914 Bacteria 2565
176 Ga0075436_100102789 3300006914 Bacteria 1991
177 Ga0097620_100102923 3300006931 Bacteria 2913
178 Ga0075435_100098114 3300007076 Bacteria 2425
179 Ga0075435_100114282 3300007076 Bacteria 2247
180 Ga0075435_100269692 3300007076 Bacteria 1451
181 Ga0099794_10412353 3300007265 Bacteria 706
182 Ga0099795_10000471 3300007788 Bacteria 7485
183 Ga0099795_10287614 3300007788 Bacteria 719
184 Ga0105251_10064962 3300009011 Bacteria 1709
185 Ga0105240_10459193 3300009093 Bacteria 1424
186 Ga0111539_10038873 3300009094 Bacteria 5740
187 Ga0111539_10054141 3300009094 Bacteria 4775
188 Ga0111539_10863925 3300009094 Bacteria 1052
189 Ga0105245_10084772 3300009098 Bacteria 2903
190 Ga0105247_10013158 3300009101 Bacteria 4964
191 Ga0105247_10494935 3300009101 Bacteria 890
192 Ga0114129_10070412 3300009147 Bacteria 4877
193 Ga0114129_10126224 3300009147 Bacteria 3517
194 Ga0114129_10162344 3300009147 Bacteria 3051
195 Ga0114129_10163069 3300009147 Bacteria 3043
196 Ga0114129_11822507 3300009147 Bacteria 739
197 Ga0105243_10005394 3300009148 Bacteria 9976
198 Ga0105243_10410580 3300009148 Bacteria 1260
199 Ga0105241_10044871 3300009174 Bacteria 3351
200 Ga0105241_10094656 3300009174 Bacteria 2363
201 Ga0105241_10205172 3300009174 Bacteria 1649
202 Ga0105242_10056726 3300009176 Bacteria 3205
203 Ga0105242_10612562 3300009176 Bacteria 1053
204 Ga0105248_10008040 3300009177 Bacteria 11580
205 Ga0105248_10114652 3300009177 Bacteria 3040
206 Ga0105237_10041440 3300009545 Bacteria 4643
207 Ga0105237_11166238 3300009545 Bacteria 777
208 Ga0105238_10048324 3300009551 Bacteria 4289
209 Ga0105238_10059259 3300009551 Bacteria 3835
210 Ga0099796_10020829 3300010159 Bacteria 2010
211 Ga0099796_10090127 3300010159 Bacteria 1139
212 Ga0105239_10165897 3300010375 Bacteria 2469
213 Ga0105239_10551872 3300010375 Bacteria 1312
214 Ga0105239_11477827 3300010375 Bacteria 785
215 Ga0157373_10225828 3300013100 Bacteria 1322
216 Ga0157373_10801518 3300013100 Bacteria 695
217 Ga0157370_10196828 3300013104 Bacteria 1870
218 Ga0157369_10484673 3300013105 Bacteria 1280
219 Ga0157374_10010277 3300013296 Bacteria 8047
220 Ga0157378_10042417 3300013297 Bacteria 4038
221 Ga0157378_10195208 3300013297 Bacteria 1912
222 Ga0157378_11261457 3300013297 Bacteria 779
223 Ga0163162_11035397 3300013306 Bacteria 929
224 Ga0163162_11633588 3300013306 Bacteria 735
225 Ga0157372_10176313 3300013307 Bacteria 2474
226 Ga0157375_13558122 3300013308 Bacteria 518
227 Ga0157375_13756222 3300013308 Bacteria 504
228 Ga0163163_10091049 3300014325 Bacteria 3064
229 Ga0157380_10273023 3300014326 Bacteria 1542
230 Ga0157380_12527946 3300014326 Bacteria 579
231 Ga0182008_10428574 3300014497 Bacteria 715
232 Ga0157377_10056931 3300014745 Bacteria 2221
233 Ga0157379_10023158 3300014968 Bacteria 5508
234 Ga0157379_11904597 3300014968 Bacteria 586
235 Ga0157376_10077982 3300014969 Bacteria 2835
236 Ga0157376_11486705 3300014969 Bacteria 710
237 Ga0157376_12740371 3300014969 Bacteria 533
238 Ga0163161_11284526 3300017792 Bacteria 636
239 Ga0154015_1598321 3300020610 Bacteria 738
240 Ga0213872_10238494 3300021361 Bacteria 769
241 Ga0213876_10009505 3300021384 Bacteria 5231
242 Ga0213876_10133043 3300021384 Bacteria 1322
243 Ga0213876_10156730 3300021384 Bacteria 1211
244 Ga0213875_10044777 3300021388 Bacteria 2078
245 Ga0213875_10140922 3300021388 Bacteria 1128
246 Ga0209676_1000159 3300025292 Bacteria 161731
247 Ga0207697_10150676 3300025315 Bacteria 1012
248 Ga0207656_10066026 3300025321 Bacteria 1598
249 Ga0207692_10007792 3300025898 Bacteria 4403
250 Ga0207692_10039102 3300025898 Bacteria 2331
251 Ga0207642_10668345 3300025899 Bacteria 652
252 Ga0207710_10602385 3300025900 Bacteria 574
253 Ga0207688_10000371 3300025901 Bacteria 20925
254 Ga0207680_10024833 3300025903 Unclassified 3296
255 Ga0207680_10150487 3300025903 Bacteria 1551
256 Ga0207647_10017077 3300025904 Bacteria 4940
257 Ga0207685_10009849 3300025905 Bacteria 2793
258 Ga0207685_10491006 3300025905 Bacteria 645
259 Ga0207699_10002470 3300025906 Bacteria 8722
260 Ga0207699_10114748 3300025906 Bacteria 1732
261 Ga0207699_10850225 3300025906 Bacteria 672
262 Ga0207645_10008321 3300025907 Bacteria 7245
263 Ga0207643_10000431 3300025908 Bacteria 27730
264 Ga0207684_10006975 3300025910 Bacteria 10220
265 Ga0207654_10158291 3300025911 Bacteria 1461
266 Ga0207654_10158395 3300025911 Bacteria 1460
267 Ga0207654_10159056 3300025911 Bacteria 1457
268 Ga0207707_10390987 3300025912 Bacteria 1195
269 Ga0207695_10332160 3300025913 Bacteria 1408
270 Ga0207695_10352336 3300025913 Bacteria 1359
271 Ga0207671_10804905 3300025914 Bacteria 745
272 Ga0207693_10001524 3300025915 Bacteria 20450
273 Ga0207693_10032576 3300025915 Bacteria 4112
274 Ga0207693_10032964 3300025915 Bacteria 4088
275 Ga0207693_10046830 3300025915 Bacteria 3397
276 Ga0207693_10187803 3300025915 Bacteria 1626
277 Ga0207693_10332682 3300025915 Bacteria 1189
278 Ga0207693_11161978 3300025915 Bacteria 584
279 Ga0207663_10003084 3300025916 Bacteria 8079
280 Ga0207663_10036466 3300025916 Bacteria 2959
281 Ga0207663_10078702 3300025916 Bacteria 2150
282 Ga0207663_10089727 3300025916 Bacteria 2036
283 Ga0207663_10529093 3300025916 Bacteria 919
284 Ga0207662_10002627 3300025918 Bacteria 9061
285 Ga0207657_10029403 3300025919 Bacteria 5002
286 Ga0207694_10145615 3300025924 Bacteria 1907
287 Ga0207694_10298741 3300025924 Bacteria 1325
288 Ga0207650_10011186 3300025925 Bacteria 6172
289 Ga0207650_10035669 3300025925 Bacteria 3614
290 Ga0207659_10015818 3300025926 Bacteria 4900
291 Ga0207687_10660979 3300025927 Bacteria 885
292 Ga0207700_10005352 3300025928 Bacteria 7660
293 Ga0207700_10041070 3300025928 Bacteria 3382
294 Ga0207700_10220746 3300025928 Bacteria 1607
295 Ga0207700_10276936 3300025928 Bacteria 1442
296 Ga0207700_10370966 3300025928 Bacteria 1250
297 Ga0207664_10049629 3300025929 Bacteria 3305
298 Ga0207664_10466482 3300025929 Bacteria 1128
299 Ga0207664_10711390 3300025929 Bacteria 903
300 Ga0207644_10079804 3300025931 Bacteria 2415
301 Ga0207690_10093662 3300025932 Bacteria 2129
302 Ga0207690_10552054 3300025932 Bacteria 937
303 Ga0207690_11344030 3300025932 Bacteria 597
304 Ga0207706_10008492 3300025933 Bacteria 9474
305 Ga0207686_10096107 3300025934 Bacteria 1967
306 Ga0207709_10235941 3300025935 Bacteria 1328
307 Ga0207709_10371001 3300025935 Bacteria 1086
308 Ga0207669_10018462 3300025937 Bacteria 3606
309 Ga0207669_10539696 3300025937 Bacteria 939
310 Ga0207704_10218884 3300025938 Bacteria 1407
311 Ga0207665_10003612 3300025939 Bacteria 10333
312 Ga0207665_10109700 3300025939 Bacteria 1937
313 Ga0207665_10264003 3300025939 Bacteria 1276
314 Ga0207665_10831986 3300025939 Bacteria 730
315 Ga0207691_10000542 3300025940 Bacteria 37831
316 Ga0207711_10102115 3300025941 Bacteria 2538
317 Ga0207711_10105870 3300025941 Bacteria 2495
318 Ga0207689_10027542 3300025942 Bacteria 4755
319 Ga0207661_10085889 3300025944 Bacteria 2610
320 Ga0207661_10116859 3300025944 Bacteria 2265
321 Ga0207679_11369121 3300025945 Bacteria 649
322 Ga0207667_10079146 3300025949 Bacteria 3407
323 Ga0207667_10240297 3300025949 Bacteria 1854
324 Ga0207651_10254305 3300025960 Bacteria 1439
325 Ga0207712_11063342 3300025961 Bacteria 719
326 Ga0207640_11327486 3300025981 Unclassified 643
327 Ga0207703_10025601 3300026035 Bacteria 4641
328 Ga0207678_10016045 3300026067 Bacteria 6578
329 Ga0207708_10000532 3300026075 Bacteria 29369
330 Ga0207702_10308755 3300026078 Bacteria 1503
331 Ga0207702_11798893 3300026078 Bacteria 605
332 Ga0207641_10024795 3300026088 Bacteria 4944
333 Ga0207648_10000825 3300026089 Bacteria 34995
334 Ga0207676_10007032 3300026095 Bacteria 7972
335 Ga0207674_11031328 3300026116 Bacteria 792
336 Ga0207675_100007077 3300026118 Bacteria 10601
337 Ga0207683_10004559 3300026121 Bacteria 11934
338 Ga0207698_10105288 3300026142 Bacteria 2350
339 Ga0209179_1016308 3300027512 Bacteria 1392
340 Ga0209179_1063980 3300027512 Bacteria 801
341 Ga0209588_1090760 3300027671 Bacteria 984
342 Ga0209813_10260963 3300027866 Bacteria 661
343 Ga0207428_10245798 3300027907 Bacteria 1335
344 Ga0268266_10145977 3300028379 Bacteria 2127
345 Ga0268266_10749129 3300028379 Bacteria 943
346 Ga0268264_10022950 3300028381 Bacteria 5091
347 Ga0265337_1004133 3300028556 Bacteria 6096
348 Ga0265334_10027575 3300028573 Bacteria 2288
349 Ga0265318_10011032 3300028577 Bacteria 3910
350 Ga0265336_10087998 3300028666 Bacteria 926
351 Ga0265338_10065318 3300028800 Bacteria 3157
352 Ga0265338_10074105 3300028800 Bacteria 2898
353 Ga0265330_10053545 3300031235 Bacteria 1765
354 Ga0265330_10271205 3300031235 Bacteria 715
355 Ga0265328_10117361 3300031239 Bacteria 991
356 Ga0265320_10018286 3300031240 Bacteria 3864
357 Ga0265325_10004432 3300031241 Bacteria 8874
358 Ga0265325_10014870 3300031241 Bacteria 4388
359 Ga0265325_10022005 3300031241 Bacteria 3496
360 Ga0265325_10035421 3300031241 Bacteria 2651
361 Ga0265325_10090686 3300031241 Bacteria 1508
362 Ga0265329_10008172 3300031242 Bacteria 3989
363 Ga0265329_10111677 3300031242 Bacteria 874
364 Ga0265340_10010895 3300031247 Bacteria 4849
365 Ga0265340_10035432 3300031247 Bacteria 2478
366 Ga0265340_10048589 3300031247 Bacteria 2062
367 Ga0265340_10052416 3300031247 Bacteria 1973
368 Ga0265340_10153195 3300031247 Bacteria 1049
369 Ga0265339_10004315 3300031249 Bacteria 9721
370 Ga0265339_10059257 3300031249 Bacteria 2065
371 Ga0265339_10112600 3300031249 Bacteria 1406
372 Ga0265331_10150366 3300031250 Bacteria 1057
373 Ga0265331_10233196 3300031250 Bacteria 826
374 Ga0265327_10001294 3300031251 Bacteria 32796
375 Ga0265316_10011100 3300031344 Bacteria 8160
376 Ga0265316_10030377 3300031344 Bacteria 4431
377 Ga0265316_10092294 3300031344 Bacteria 2308
378 Ga0307408_100841761 3300031548 Bacteria 836
379 Ga0265313_10001120 3300031595 Bacteria 25611
380 Ga0265313_10067965 3300031595 Bacteria 1647
381 Ga0265313_10140178 3300031595 Bacteria 1040
382 Ga0265313_10163575 3300031595 Bacteria 944
383 Ga0316575_10039180 3300031665 Bacteria 1870
384 Ga0265314_10006793 3300031711 Bacteria 10032
385 Ga0265314_10019360 3300031711 Bacteria 5275
386 Ga0265314_10041851 3300031711 Bacteria 3274
387 Ga0265314_10069302 3300031711 Bacteria 2368
388 Ga0265314_10162338 3300031711 Bacteria 1358
389 Ga0265342_10000233 3300031712 Bacteria 62514
390 Ga0265342_10012942 3300031712 Bacteria 5624
391 Ga0265342_10016663 3300031712 Bacteria 4796
392 Ga0265342_10026466 3300031712 Bacteria 3634
393 Ga0307413_10433359 3300031824 Bacteria 1039
394 Ga0307413_11097757 3300031824 Bacteria 687
395 Ga0373950_0064100 3300034818 Bacteria 742
396 Ga0373926_0045113 3300035083 Bacteria 1580
397 Ga0373926_0103277 3300035083 Bacteria 1067
398 Ga0373926_0276031 3300035083 Bacteria 654
399 Ga0373926_0416027 3300035083 Bacteria 532
400 Ga0373934_0263862 3300035086 Bacteria 713
401 Ga0373944_0008559 3300035089 Bacteria 2765
402 Ga0373944_0041535 3300035089 Bacteria 1423
403 Ga0373949_0108854 3300035090 Bacteria 767
404 Ga0373949_0134638 3300035090 Bacteria 704
405 Ga0373951_0038271 3300035091 Bacteria 1150
406 Ga0373923_0000130 3300035111 Bacteria 13950
407 Ga0373936_0002001 3300035113 Bacteria 7545
408 Ga0373936_0009131 3300035113 Bacteria 3737
409 Ga0373936_0304613 3300035113 Bacteria 720
410 Ga0373939_0025484 3300035114 Bacteria 1658
411 Ga0373941_0002860 3300035115 Bacteria 3850
412 Ga0373941_0325938 3300035115 Bacteria 619
413 Ga0373945_0006478 3300035116 Bacteria 3778
414 Ga0373945_0055086 3300035116 Bacteria 1471
415 Ga0373945_0062667 3300035116 Bacteria 1391
416 Ga0373953_0001083 3300035117 Bacteria 7695
417 Ga0373954_0003503 3300035118 Bacteria 6667
418 Ga0373954_0006098 3300035118 Bacteria 5246
419 Ga0373954_0036631 3300035118 Bacteria 2278
420 Ga0373956_0079882 3300035119 Bacteria 1500
421 Ga0373956_0441166 3300035119 Bacteria 621
422 Ga0373957_0006799 3300035120 Bacteria 3623
423 Ga0373957_0091339 3300035120 Bacteria 1210
424 Ga0373960_0087607 3300035121 Bacteria 991
425 Ga0373943_0006735 3300035170 Bacteria 5157
426 Ga0373943_0010190 3300035170 Bacteria 4215
427 Ga0373943_0018696 3300035170 Bacteria 3185
428 Ga0373943_0120920 3300035170 Bacteria 1391
429 Ga0373943_0162973 3300035170 Bacteria 1215
430 Ga0373943_0326561 3300035170 Unclassified 875
431 Ga0373946_0008089 3300035171 Bacteria 3860
432 Ga0373946_0030547 3300035171 Bacteria 2151
433 Ga0373946_0296563 3300035171 Bacteria 798
434 Ga0373946_0508747 3300035171 Bacteria 618
435 Ga0373955_0001349 3300035172 Bacteria 10428
436 Ga0373955_0035612 3300035172 Bacteria 2637
437 Ga0373955_0057076 3300035172 Bacteria 2144
438 Ga0373924_0000822 3300035410 Bacteria 9703
439 Ga0373924_0076424 3300035410 Bacteria 1419
440 Ga0373931_0978720 3300035691 Bacteria 572
441 Ga0373935_0000032 3300035692 Bacteria 54807
442 Ga0373935_0012233 3300035692 Bacteria 5160
443 Ga0373935_0106885 3300035692 Bacteria 1852
444 Ga0373935_0298255 3300035692 Bacteria 1138
445 Ga0373935_0434345 3300035692 Bacteria 946
446 Ga0373927_0004218 3300035695 Bacteria 10090
447 Ga0373927_0009160 3300035695 Bacteria 6645
448 Ga0373927_0011509 3300035695 Bacteria 5894
449 Ga0373927_0019283 3300035695 Bacteria 4473
450 Ga0373927_0021733 3300035695 Bacteria 4205
451 Ga0373927_0358530 3300035695 Bacteria 961
452 Ga0373927_0377681 3300035695 Bacteria 934
453 Ga0373927_0391480 3300035695 Bacteria 917
454 Ga0373933_0002204 3300035724 Bacteria 11131
455 Ga0373933_0680178 3300035724 Bacteria 676
456 Ga0373947_0000298 3300035725 Bacteria 27892
457 Ga0373947_0008510 3300035725 Bacteria 5908
458 Ga0373947_0018711 3300035725 Bacteria 3988
459 Ga0373947_0242557 3300035725 Bacteria 1189
460 Ga0373937_0000326 3300036401 Bacteria 45214
461 Ga0373937_0013503 3300036401 Bacteria 7194
462 Ga0373937_0194055 3300036401 Bacteria 1908
463 Ga0373925_0000012 3300037068 Bacteria 202139
464 Ga0373925_0005229 3300037068 Bacteria 9702
465 Ga0373925_0033074 3300037068 Bacteria 3810
466 Ga0373925_0125891 3300037068 Bacteria 1993
467 Ga0373925_0345542 3300037068 Bacteria 1207
468 Ga0395900_0088706 3300037418 Bacteria 3180
469 Ga0395900_0356599 3300037418 Bacteria 1435
470 Ga0436364_0687434 3300037853 Bacteria 2596
471 Ga0436364_0878561 3300037853 Bacteria 3735
472 Ga0436364_0956945 3300037853 Bacteria 6276
473 Ga0395901_0132208 3300038443 Bacteria 2622
474 Ga0395901_0828402 3300038443 Bacteria 912
475 Ga0436365_0204673 3300039437 Bacteria 13501
476 Ga0436365_0381000 3300039437 Bacteria 1610
477 Ga0436365_0849289 3300039437 Bacteria 1981
478 Ga0436365_0988571 3300039437 Bacteria 6004
479 Ga0436365_1793152 3300039437 Bacteria 856
480 Ga0436360_0487319 3300039438 Bacteria 1077
481 Ga0436360_0554890 3300039438 Bacteria 872
482 Ga0436361_0203502 3300039447 Bacteria 9652
483 Ga0436361_0224754 3300039447 Bacteria 2261
484 Ga0436361_1089976 3300039447 Bacteria 1389
485 Ga0436363_0525535 3300039450 Bacteria 2288
486 Ga0436362_0207204 3300039453 Bacteria 1778
487 Ga0436362_1296964 3300039453 Bacteria 1055
488 Ga0439439_0107708 3300041406 Bacteria 770
489 Ga0439453_0147701 3300041408 Bacteria 556
490 Ga0451798_0720422 3300041458 Bacteria 1121
491 Ga0439441_017757 3300042001 Bacteria 1281
492 Ga0439441_031596 3300042001 Bacteria 1029
493 Ga0439446_0043516 3300042156 Bacteria 1327
494 Ga0439459_0144034 3300042438 Bacteria 618
495 Ga0466965_0351988 3300044683 Bacteria 807
496 Ga0466966_0259871 3300044684 Bacteria 1045
497 Ga0466963_0018436 3300044694 Bacteria 4364
498 Ga0466963_0142899 3300044694 Bacteria 1659
499 Ga0466971_0072309 3300044719 Bacteria 1567
500 Ga0466957_0081691 3300044842 Bacteria 2013
501 Ga0466957_0160277 3300044842 Bacteria 1461
502 Ga0466960_0559024 3300044901 Bacteria 676
503 Ga0466958_0354192 3300045836 Bacteria 945
504 Ga0466958_0765747 3300045836 Bacteria 629
505 Ga0466958_0966986 3300045836 Bacteria 556
506 Ga0466967_0005469 3300045976 Bacteria 8806
507 Ga0466967_0364323 3300045976 Bacteria 1401
508 Ga0466967_1928483 3300045976 Bacteria 587
509 Ga0495617_084789 3300046452 Bacteria 1037
510 Ga0495627_143729 3300046453 Bacteria 668
511 Ga0495592_0000033 3300046454 Bacteria 127028
512 Ga0495592_0447852 3300046454 Bacteria 809
513 Ga0495603_0013141 3300046455 Bacteria 5004
514 Ga0495603_0133783 3300046455 Bacteria 1443
515 Ga0495603_0511071 3300046455 Bacteria 688
516 Ga0495590_0109177 3300046457 Bacteria 987
517 Ga0495629_0030342 3300046459 Bacteria 3834
518 Ga0495629_0034630 3300046459 Bacteria 3570
519 Ga0495629_0311781 3300046459 Bacteria 1076
520 Ga0495638_0023057 3300046460 Bacteria 4077
521 Ga0495641_0287445 3300046461 Unclassified 740
522 Ga0495651_0000413 3300046462 Bacteria 33195
523 Ga0495651_0062559 3300046462 Bacteria 2847
524 Ga0495651_0353910 3300046462 Bacteria 970
525 Ga0495651_0378400 3300046462 Bacteria 929
526 Ga0495651_0507490 3300046462 Bacteria 771
527 Ga0495653_0000240 3300046463 Bacteria 44123
528 Ga0495653_0088025 3300046463 Bacteria 2279
529 Ga0495580_0177062 3300046472 Bacteria 1473
530 Ga0495580_0463712 3300046472 Bacteria 849
531 Ga0495582_0073850 3300046473 Bacteria 1888
532 Ga0495582_0417031 3300046473 Bacteria 774
533 Ga0495639_0355456 3300046475 Bacteria 736
534 Ga0495639_0444108 3300046475 Bacteria 658
535 Ga0495639_0496539 3300046475 Bacteria 623
536 Ga0495662_0001477 3300046476 Bacteria 11636
537 Ga0495662_0003230 3300046476 Bacteria 8232
538 Ga0495662_0014966 3300046476 Bacteria 3769
539 Ga0495664_0000005 3300046477 Bacteria 439635
540 Ga0495664_0001023 3300046477 Bacteria 14461
541 Ga0495664_0455576 3300046477 Bacteria 766
542 Ga0495664_0756466 3300046477 Bacteria 572
543 Ga0495584_0005882 3300046491 Bacteria 6465
544 Ga0495584_0245701 3300046491 Bacteria 910
545 Ga0495585_0223475 3300046492 Bacteria 949
546 Ga0495594_0194796 3300046499 Bacteria 1155
547 Ga0495596_0096200 3300046500 Bacteria 1150
548 Ga0495607_0358007 3300046501 Bacteria 672
549 Ga0495583_0203406 3300046506 Bacteria 804
550 Ga0495608_0000003 3300046511 Bacteria 369831
551 Ga0495608_0004805 3300046511 Bacteria 9660
552 Ga0495618_0000009 3300046514 Bacteria 200423
553 Ga0495618_0001656 3300046514 Bacteria 14823
554 Ga0495618_0175149 3300046514 Bacteria 1364
555 Ga0495620_0219282 3300046515 Bacteria 728
556 Ga0495628_0000010 3300046516 Bacteria 234932
557 Ga0495628_0092408 3300046516 Bacteria 2341
558 Ga0495628_0605948 3300046516 Bacteria 782
559 Ga0495630_0005686 3300046517 Bacteria 8814
560 Ga0495630_0033852 3300046517 Bacteria 3811
561 Ga0495630_0094914 3300046517 Bacteria 2254
562 Ga0495630_0449175 3300046517 Bacteria 988
563 Ga0495630_0727812 3300046517 Bacteria 759
564 Ga0495632_0143703 3300046519 Bacteria 1106
565 Ga0495637_0132127 3300046520 Bacteria 953
566 Ga0495644_0296305 3300046523 Bacteria 632
567 Ga0495663_0303998 3300046525 Bacteria 575
568 Ga0495666_0041406 3300046526 Bacteria 2231
569 Ga0495666_0059152 3300046526 Bacteria 1833
570 Ga0495666_0073000 3300046526 Bacteria 1629
571 Ga0495652_0000016 3300046529 Bacteria 212723
572 Ga0495652_0068272 3300046529 Bacteria 2978
573 Ga0495665_0007508 3300046531 Bacteria 5902
574 Ga0495665_0358252 3300046531 Bacteria 742
575 Ga0495640_0000015 3300046533 Bacteria 160055
576 Ga0495640_0003394 3300046533 Bacteria 12819
577 Ga0495640_0063647 3300046533 Bacteria 2497
578 Ga0495640_0282524 3300046533 Bacteria 1033
579 Ga0495640_0591792 3300046533 Bacteria 670
580 Ga0495586_0018556 3300046535 Bacteria 3704
581 Ga0495586_0159461 3300046535 Bacteria 1272
582 Ga0495587_0000009 3300046536 Bacteria 241480
583 Ga0495587_0097972 3300046536 Bacteria 1690
584 Ga0495587_0221576 3300046536 Bacteria 1067
585 Ga0495609_0157891 3300046538 Bacteria 963
586 Ga0495609_0267757 3300046538 Bacteria 701
587 Ga0495621_0085070 3300046539 Bacteria 1185
588 Ga0495621_0332225 3300046539 Bacteria 635
589 Ga0495645_0000005 3300046543 Bacteria 443917
590 Ga0495645_0002744 3300046543 Bacteria 11963
591 Ga0495645_0141654 3300046543 Bacteria 1677
592 Ga0495622_0016147 3300046557 Bacteria 3476
593 Ga0495633_0034046 3300046558 Bacteria 2452
594 Ga0495667_0000073 3300046559 Bacteria 74946
595 Ga0495667_0106557 3300046559 Bacteria 1812
596 Ga0495667_0347959 3300046559 Bacteria 936
597 Ga0495656_0043198 3300046615 Bacteria 1891
598 Ga0495656_0071219 3300046615 Bacteria 1545
599 Ga0495656_0363345 3300046615 Bacteria 752
600 Ga0495656_0467704 3300046615 Bacteria 666
601 Ga0495668_0106233 3300046616 Bacteria 1536
602 Ga0495668_0859657 3300046616 Bacteria 503
603 Ga0495634_0000170 3300046642 Bacteria 60197
604 Ga0495634_0010447 3300046642 Bacteria 6800
605 Ga0495634_0024771 3300046642 Bacteria 4206
606 Ga0495634_0173662 3300046642 Bacteria 1353
607 Ga0495634_0178865 3300046642 Bacteria 1329
608 Ga0495625_0160415 3300046660 Bacteria 1507
609 Ga0495635_0000013 3300046663 Bacteria 221753
610 Ga0495635_0004001 3300046663 Bacteria 10241
611 Ga0495635_0281250 3300046663 Bacteria 1118
612 Ga0495635_0301416 3300046663 Bacteria 1074
613 Ga0495659_0051660 3300046664 Bacteria 1498
614 Ga0495657_0000579 3300046675 Bacteria 33681
615 Ga0495657_0138006 3300046675 Bacteria 1522
616 Ga0495657_0233420 3300046675 Bacteria 1112
617 Ga0495657_0480467 3300046675 Bacteria 726
618 Ga0495599_0000011 3300046678 Bacteria 207639
619 Ga0495599_0054487 3300046678 Bacteria 2505
620 Ga0495599_0451881 3300046678 Bacteria 761
621 Ga0495623_0000005 3300046679 Bacteria 140586
622 Ga0495623_0561502 3300046679 Bacteria 596
623 Ga0495646_0000011 3300046680 Bacteria 195220
624 Ga0495646_0116965 3300046680 Bacteria 1512
625 Ga0495646_0213745 3300046680 Bacteria 1045
626 Ga0495647_0016516 3300046681 Bacteria 2599
627 Ga0495658_0012827 3300046683 Bacteria 4256
628 Ga0495658_0100152 3300046683 Bacteria 1729
629 Ga0495658_0110900 3300046683 Bacteria 1649
630 Ga0495658_0435550 3300046683 Bacteria 837
631 Ga0495613_0065799 3300046689 Bacteria 2648
632 Ga0495613_0431352 3300046689 Bacteria 895
633 Ga0495624_0003168 3300046690 Bacteria 12254
634 Ga0495624_0046775 3300046690 Bacteria 2751
635 Ga0495624_0262050 3300046690 Bacteria 1044
636 Ga0495624_0682456 3300046690 Bacteria 610
637 Ga0495670_0055322 3300046691 Bacteria 1990
638 Ga0495671_0085036 3300046692 Bacteria 1550
639 Ga0495589_0235832 3300046794 Bacteria 857
640 Ga0495600_0000004 3300046809 Bacteria 180417
641 Ga0495600_0128268 3300046809 Bacteria 1649
642 Ga0495600_0679605 3300046809 Bacteria 620
643 Ga0495600_0732485 3300046809 Bacteria 593
644 Ga0495581_0028659 3300047315 Bacteria 3228
645 Ga0495581_0030029 3300047315 Bacteria 3151
646 Ga0495581_0327074 3300047315 Bacteria 895
647 Ga0495581_0327090 3300047315 Bacteria 895
648 Ga0495581_0637726 3300047315 Bacteria 616
649 Ga0495604_0000006 3300047317 Bacteria 420480
650 Ga0495604_0089869 3300047317 Bacteria 2282
651 Ga0495604_0117046 3300047317 Bacteria 1934
652 Ga0495604_0248953 3300047317 Bacteria 1212
653 Ga0495604_0406799 3300047317 Bacteria 895
654 Ga0495674_0000005 3300047319 Bacteria 375129
655 Ga0495674_0002588 3300047319 Bacteria 17615
656 Ga0495674_0011651 3300047319 Bacteria 8292
657 Ga0495674_0040438 3300047319 Bacteria 4170
658 Ga0495674_0269677 3300047319 Bacteria 1397
659 Ga0495674_0507245 3300047319 Bacteria 964
660 Ga0495676_0019255 3300047321 Bacteria 6005
661 Ga0495676_0030454 3300047321 Bacteria 4579
662 Ga0495676_0123010 3300047321 Bacteria 1884
663 Ga0495680_0000141 3300047322 Bacteria 72373
664 Ga0495680_0043962 3300047322 Bacteria 3534
665 Ga0495680_0191813 3300047322 Bacteria 1470
666 Ga0495680_0271873 3300047322 Bacteria 1196
667 Ga0495675_0000070 3300047444 Bacteria 71129
668 Ga0495675_0024946 3300047444 Bacteria 3814
669 Ga0495677_0217987 3300047445 Bacteria 743
670 Ga0495679_031483 3300047446 Bacteria 1711
671 Ga0495681_0092961 3300047470 Bacteria 1329
672 Ga0495681_0192679 3300047470 Bacteria 831
673 Ga0495684_0000001 3300047471 Bacteria 369809
674 Ga0495684_0002341 3300047471 Bacteria 15138
675 Ga0495684_0020709 3300047471 Bacteria 5067
676 Ga0495684_0023444 3300047471 Bacteria 4744
677 Ga0495684_0559776 3300047471 Bacteria 777
678 Ga0495684_0753483 3300047471 Bacteria 640
679 Ga0495684_0857308 3300047471 Bacteria 589
680 Ga0495593_0000703 3300047673 Bacteria 19309
681 Ga0495593_0234383 3300047673 Bacteria 920
682 Ga0495593_0398182 3300047673 Bacteria 688
683 Ga0495602_0000003 3300048088 Bacteria 357240
684 Ga0495614_0135030 3300048089 Bacteria 1094
685 Ga0495614_0476385 3300048089 Bacteria 592
686 Ga0495626_0145235 3300048091 Bacteria 1004
687 Ga0496100_0330649 3300048903 Bacteria 1147
688 Ga0496100_0354701 3300048903 Bacteria 1108
689 Ga0496100_0685608 3300048903 Bacteria 799
690 Ga0496101_0065375 3300048904 Bacteria 2651
691 Ga0496101_0674695 3300048904 Bacteria 816
692 Ga0496102_0002538 3300048905 Bacteria 15566
693 Ga0496102_0032009 3300048905 Bacteria 4722
694 Ga0496102_0043973 3300048905 Bacteria 4051
695 Ga0496102_0731811 3300048905 Bacteria 912
696 Ga0496103_0008867 3300048906 Bacteria 5965
697 Ga0496104_0003699 3300048907 Bacteria 13194
698 Ga0496104_0005339 3300048907 Bacteria 11240
699 Ga0496104_0005656 3300048907 Bacteria 10946
700 Ga0496104_0042076 3300048907 Bacteria 4285
701 Ga0496105_0006937 3300048908 Bacteria 8724
702 Ga0496105_0035873 3300048908 Bacteria 4084
703 Ga0496105_0214532 3300048908 Bacteria 1568
704 Ga0496105_0453051 3300048908 Bacteria 1013
705 Ga0496106_0012088 3300048909 Bacteria 6371
706 Ga0496106_0031771 3300048909 Bacteria 3934
707 Ga0496106_0052175 3300048909 Bacteria 3084
708 Ga0496106_0229568 3300048909 Bacteria 1482
709 Ga0496106_1050807 3300048909 Bacteria 639
710 Ga0496107_0483632 3300048910 Bacteria 919
711 Ga0496107_0987140 3300048910 Bacteria 611
712 Ga0496108_0014122 3300048911 Bacteria 6514
713 Ga0496108_0081845 3300048911 Bacteria 2736
714 Ga0496109_0072699 3300048912 Bacteria 3159
715 Ga0496109_0074841 3300048912 Bacteria 3113
716 Ga0496109_0316108 3300048912 Bacteria 1473
717 Ga0496109_1047195 3300048912 Bacteria 753
718 Ga0496110_0020506 3300048913 Bacteria 5581
719 Ga0496110_0074141 3300048913 Bacteria 3021
720 Ga0496111_0000520 3300048914 Bacteria 19882
721 Ga0496111_0034353 3300048914 Bacteria 3620
722 Ga0496111_0060793 3300048914 Bacteria 2739
723 Ga0496112_0032097 3300048915 Bacteria 5097
724 Ga0496112_0082669 3300048915 Bacteria 3175
725 Ga0496112_0928936 3300048915 Bacteria 791
726 Ga0496113_0004173 3300048916 Bacteria 8825
727 Ga0496113_0034836 3300048916 Bacteria 3677
728 Ga0496113_0417091 3300048916 Bacteria 1078
729 Ga0496113_0717908 3300048916 Bacteria 797
730 Ga0496114_0021128 3300048917 Bacteria 5292
731 Ga0496114_0117326 3300048917 Bacteria 2286
732 Ga0496114_0524216 3300048917 Bacteria 1048
733 Ga0496114_0527142 3300048917 Bacteria 1044
734 Ga0496115_0009264 3300048918 Bacteria 7315
735 Ga0496115_0025115 3300048918 Bacteria 4636
736 Ga0496115_0086887 3300048918 Bacteria 2552
737 Ga0501031_0030368 3300049568 Bacteria 3524
738 Ga0501031_0053740 3300049568 Bacteria 2625
739 Ga0501032_0011792 3300049569 Bacteria 6264
740 Ga0501032_0022476 3300049569 Bacteria 4370
741 Ga0501032_0026172 3300049569 Bacteria 4016
742 Ga0501032_0891231 3300049569 Bacteria 560
743 Ga0501033_0012022 3300049570 Bacteria 6611
744 Ga0501033_0057569 3300049570 Bacteria 2872
745 Ga0501033_0094697 3300049570 Bacteria 2183
746 Ga0501033_0931933 3300049570 Unclassified 583
747 Ga0501034_0000097 3300049571 Bacteria 161027
748 Ga0501034_0003959 3300049571 Bacteria 16646
749 Ga0501034_0006739 3300049571 Bacteria 12298
750 Ga0501034_0031402 3300049571 Bacteria 5394
751 Ga0501034_0087154 3300049571 Bacteria 3122
752 Ga0501034_0105534 3300049571 Bacteria 2810
753 Ga0501034_0108834 3300049571 Bacteria 2762
754 Ga0501034_0110063 3300049571 Bacteria 2746
755 Ga0501034_0477465 3300049571 Bacteria 1162
756 Ga0501034_0595480 3300049571 Bacteria 1011
757 Ga0501036_0002226 3300049572 Bacteria 15163
758 Ga0501036_0003062 3300049572 Bacteria 13321
759 Ga0501036_0586633 3300049572 Bacteria 925
760 Ga0501037_0048015 3300049573 Bacteria 3128
761 Ga0501037_0055716 3300049573 Bacteria 2891
762 Ga0501037_0125438 3300049573 Bacteria 1844
763 Ga0501037_0159662 3300049573 Bacteria 1607
764 Ga0501037_0383636 3300049573 Bacteria 965
765 Ga0501037_0793588 3300049573 Bacteria 625
766 Ga0501038_0002646 3300049574 Bacteria 16747
767 Ga0501038_0043193 3300049574 Bacteria 3920
768 Ga0501038_0073137 3300049574 Bacteria 2903
769 Ga0501038_0226098 3300049574 Bacteria 1491
770 Ga0501038_0401393 3300049574 Bacteria 1061
771 Ga0501038_0929008 3300049574 Bacteria 641
772 Ga0501039_0032726 3300049575 Bacteria 4009
773 Ga0501039_0116119 3300049575 Bacteria 2095
774 Ga0501039_0274341 3300049575 Bacteria 1326
775 Ga0501039_0492366 3300049575 Bacteria 963
776 Ga0501040_0112491 3300049576 Bacteria 1905
777 Ga0501040_0454926 3300049576 Bacteria 922
778 Ga0501042_0195786 3300049578 Bacteria 1458
779 Ga0501043_0003254 3300049579 Bacteria 13391
780 Ga0501043_0059364 3300049579 Bacteria 3002
781 Ga0501043_0312917 3300049579 Bacteria 1198
782 Ga0501046_0048704 3300049580 Bacteria 3354
783 Ga0501046_0152148 3300049580 Bacteria 1745
784 Ga0501046_0342683 3300049580 Bacteria 1086
785 Ga0501046_0552650 3300049580 Bacteria 821
786 Ga0501047_0000010 3300049581 Bacteria 429357
787 Ga0501047_0023364 3300049581 Bacteria 5937
788 Ga0501047_0031269 3300049581 Bacteria 5134
789 Ga0501047_0131177 3300049581 Bacteria 2387
790 Ga0501047_0189545 3300049581 Bacteria 1920
791 Ga0501048_0002496 3300049582 Bacteria 14045
792 Ga0501048_0056670 3300049582 Bacteria 2780
793 Ga0501067_0073636 3300049583 Bacteria 1892
794 Ga0501068_0028385 3300049584 Bacteria 3309
795 Ga0501068_0042380 3300049584 Bacteria 2737
796 Ga0501068_0055856 3300049584 Bacteria 2392
797 Ga0501068_0059611 3300049584 Bacteria 2317
798 Ga0501068_0128273 3300049584 Bacteria 1585
799 Ga0501069_0015441 3300049585 Bacteria 4093
800 Ga0501069_0020409 3300049585 Bacteria 3590
801 Ga0501069_0302408 3300049585 Bacteria 938
802 Ga0501070_0017811 3300049586 Bacteria 5964
803 Ga0501070_0038350 3300049586 Bacteria 3997
804 Ga0501070_0046396 3300049586 Bacteria 3613
805 Ga0501070_0065155 3300049586 Bacteria 3017
806 Ga0501070_0186837 3300049586 Bacteria 1704
807 Ga0501070_0189787 3300049586 Bacteria 1689
808 Ga0501070_0491927 3300049586 Bacteria 986
809 Ga0501071_0159645 3300049587 Bacteria 1684
810 Ga0501071_0238219 3300049587 Bacteria 1372
811 Ga0501071_0296665 3300049587 Bacteria 1225
812 Ga0501071_0610133 3300049587 Bacteria 839
813 Ga0501073_0069621 3300049589 Bacteria 2451
814 Ga0501073_0099474 3300049589 Bacteria 2019
815 Ga0501073_0108787 3300049589 Bacteria 1923
816 Ga0501074_0008172 3300049590 Bacteria 7586
817 Ga0501074_0193078 3300049590 Bacteria 1451
818 Ga0501074_0238875 3300049590 Bacteria 1292
819 Ga0501074_0334132 3300049590 Bacteria 1076
820 Ga0501074_0833276 3300049590 Bacteria 650
821 Ga0501074_1017274 3300049590 Bacteria 582
822 Ga0501075_0449918 3300049591 Bacteria 982
823 Ga0501075_0789823 3300049591 Unclassified 722
824 Ga0501076_0127152 3300049592 Bacteria 2066
825 Ga0501076_1485493 3300049592 Bacteria 556
826 Ga0501077_0913701 3300049593 Bacteria 565
827 Ga0501079_0359075 3300049741 Bacteria 1142
828 Ga0501079_0407732 3300049741 Bacteria 1066
829 Ga0501079_0619246 3300049741 Bacteria 852
830 Ga0501080_0006002 3300049742 Bacteria 10888
831 Ga0501080_0006165 3300049742 Bacteria 10759
832 Ga0501080_0031760 3300049742 Bacteria 4920
833 Ga0501080_0049363 3300049742 Bacteria 3917
834 Ga0501080_0401778 3300049742 Bacteria 1232
835 Ga0501080_0541182 3300049742 Bacteria 1038
836 Ga0501080_0621352 3300049742 Bacteria 958
837 Ga0501080_1031869 3300049742 Bacteria 712
838 Ga0501080_1042089 3300049742 Unclassified 708
839 Ga0501081_0279521 3300049743 Bacteria 1222
840 Ga0501083_0000677 3300049744 Bacteria 22173
841 Ga0501083_0024934 3300049744 Bacteria 4142
842 Ga0501083_0057721 3300049744 Bacteria 2598
843 Ga0501083_0218332 3300049744 Bacteria 1242
844 Ga0501083_0230649 3300049744 Bacteria 1206
845 Ga0501083_0783196 3300049744 Unclassified 620
846 Ga0501035_0029489 3300049822 Bacteria 5003
847 Ga0501035_0032444 3300049822 Bacteria 4751
848 Ga0501035_0119190 3300049822 Bacteria 2308
849 Ga0501035_0190491 3300049822 Bacteria 1763
850 Ga0501035_0531694 3300049822 Bacteria 965
851 Ga0501035_0651987 3300049822 Bacteria 853
852 Ga0501044_0002568 3300049823 Bacteria 20676
853 Ga0501044_0081657 3300049823 Bacteria 3271
854 Ga0501044_0173859 3300049823 Bacteria 2124
855 Ga0501044_0332973 3300049823 Bacteria 1440
856 Ga0501044_0858025 3300049823 Bacteria 784
857 Ga0501044_1018031 3300049823 Bacteria 700
858 Ga0501045_0268657 3300049824 Bacteria 1270
859 Ga0501045_0366055 3300049824 Bacteria 1073
860 Ga0501045_0653646 3300049824 Unclassified 777
861 nmdc:mga03n38_29764_c1 3300050490 Bacteria 2288
862 nmdc:mga03n38_48607_c1 3300050490 Bacteria 1882
863 nmdc:mga03n38_52258_c1 3300050490 Bacteria 1828
864 nmdc:mga00v17_221042_c1 3300050491 Bacteria 1226
865 nmdc:mga00v17_299995_c1 3300050491 Bacteria 1043
866 nmdc:mga00v17_382140_c1 3300050491 Bacteria 915
867 nmdc:mga0yw44_108417_c1 3300050492 Bacteria 1777
868 nmdc:mga0yw44_13748_c1 3300050492 Bacteria 4274
869 nmdc:mga0yw44_308540_c1 3300050492 Bacteria 1061
870 nmdc:mga0yw44_452187_c1 3300050492 Bacteria 870
871 nmdc:mga06z11_249044_c1 3300050494 Bacteria 1046
872 nmdc:mga06z11_295462_c1 3300050494 Bacteria 962
873 nmdc:mga06z11_373919_c1 3300050494 Bacteria 515
874 nmdc:mga06z11_448821_c1 3300050494 Bacteria 779
875 nmdc:mga04h51_138102_c1 3300050495 Bacteria 922
876 nmdc:mga04h51_294673_c1 3300050495 Bacteria 660
877 nmdc:mga07m45_184276_c1 3300050496 Bacteria 1214
878 nmdc:mga07m45_40848_c2 3300050496 Bacteria 1648
879 nmdc:mga05p37_111062_c1 3300050507 Bacteria 3371
880 nmdc:mga05p37_461907_c1 3300050507 Bacteria 1467
881 nmdc:mga05p37_535190_c1 3300050507 Bacteria 1337
882 nmdc:mga05p37_62442_c1 3300050507 Bacteria 4585
883 nmdc:mga05p37_70164_c1 3300050507 Bacteria 4310
884 nmdc:mga0qj67_516077_c1 3300050509 Bacteria 960
885 nmdc:mga06r32_338648_c1 3300050510 Bacteria 1489
886 nmdc:mga06r32_922211_c1 3300050510 Bacteria 829
887 nmdc:mga06r32_95751_c1 3300050510 Bacteria 2906
888 nmdc:mga08y16_217314_c1 3300050511 Bacteria 1979
889 nmdc:mga08y16_28718_c1 3300050511 Bacteria 5862
890 nmdc:mga0n895_2142469_c1 3300050512 Bacteria 515
891 nmdc:mga0n895_235211_c1 3300050512 Bacteria 1859
892 nmdc:mga0n895_44768_c1 3300050512 Bacteria 4316
893 nmdc:mga0rr50_130487_c1 3300050513 Bacteria 2012
894 nmdc:mga0rr50_436217_c1 3300050513 Bacteria 1109
895 nmdc:mga0rr50_579730_c1 3300050513 Bacteria 956
896 nmdc:mga0rr50_910756_c1 3300050513 Bacteria 750
897 nmdc:mga08x19_1184617_c1 3300050514 Bacteria 542
898 nmdc:mga0a205_223853_c1 3300050515 Bacteria 1766
899 Ga0495601_0000005 3300053077 Bacteria 387079
900 Ga0495601_0000361 3300053077 Bacteria 23954
901 Ga0495601_0009361 3300053077 Bacteria 5792
902 Ga0495601_0009806 3300053077 Bacteria 5666
903 Ga0495612_0000001 3300053078 Bacteria 418244
904 Ga0495612_0000321 3300053078 Bacteria 19426
905 Ga0495612_0261214 3300053078 Bacteria 771
906 Ga0495595_0000070 3300053084 Bacteria 50736
907 Ga0495595_0019093 3300053084 Bacteria 2970
908 Ga0495595_0026039 3300053084 Bacteria 2596
909 Ga0495595_0061510 3300053084 Bacteria 1759
910 Ga0495595_0329323 3300053084 Bacteria 769
911 Ga0495619_0000007 3300053085 Bacteria 369936
912 Ga0495619_0003250 3300053085 Bacteria 10517
913 Ga0495619_0004866 3300053085 Bacteria 8524
914 Ga0495619_0028211 3300053085 Bacteria 3620
915 Ga0495619_0042476 3300053085 Bacteria 2977
916 Ga0495619_0045458 3300053085 Bacteria 2885
917 Ga0495619_0124706 3300053085 Bacteria 1767
918 Ga0495619_0314345 3300053085 Bacteria 1085
919 Ga0500566_0235380 3300053094 Bacteria 901
920 Ga0500650_0027389 3300053098 Bacteria 2565
921 Ga0500562_063632 3300053108 Bacteria 992
922 Ga0500559_0063075 3300053136 Bacteria 1656
923 Ga0500616_0137945 3300053153 Bacteria 1143
924 Ga0501084_0105761 3300054114 Unclassified 2364
925 Ga0501084_0109726 3300054114 Bacteria 2318
926 Ga0501084_0138605 3300054114 Bacteria 2048
927 Ga0501084_0367418 3300054114 Bacteria 1216
928 Ga0501084_0522989 3300054114 Bacteria 1003
929 Ga0501084_0990049 3300054114 Bacteria 707
930 Ga0501084_1419456 3300054114 Bacteria 581
931 Ga0501082_0361599 3300060353 Bacteria 1266
932 Ga0501082_0413055 3300060353 Bacteria 1178
933 Ga0501082_0565055 3300060353 Bacteria 995
934 Ga0466962_0142796 3300061719 Bacteria 1160
935 Ga0530510_0052121 3300061734 Unclassified 2957
936 Ga0530510_0069077 3300061734 Bacteria 2564
937 Ga0530510_0649400 3300061734 Bacteria 803

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0401393 Ga0501038_0401393_665_1042 123
2 3300046675 Ga0495657_0480467 Ga0495657_0480467_326_709 124
3 3300048089 Ga0495614_0476385 Ga0495614_0476385_170_553 124
4 3300045976 Ga0466967_1928483 Ga0466967_1928483_20_427 132
5 3300026116 Ga0207674_11031328 Ga0207674_110313282 137
6 3300005457 Ga0070662_100747252 Ga0070662_1007472522 138
7 3300009093 Ga0105240_10459193 Ga0105240_104591932 138
8 3300013297 Ga0157378_10195208 Ga0157378_101952082 138
9 3300025913 Ga0207695_10332160 Ga0207695_103321602 138
10 3300046660 Ga0495625_0160415 Ga0495625_0160415_734_1159 138
11 3300021384 Ga0213876_10009505 Ga0213876_100095055 140
12 3300039437 Ga0436365_0204673 Ga0436365_0204673_521_1015 140
13 3300035086 Ga0373934_0263862 Ga0373934_0263862_14_451 143
14 3300046809 Ga0495600_0679605 Ga0495600_0679605_14_451 143
15 3300003316 rootH1_10126579 rootH1_101265794 144
16 3300003322 rootL2_10111746 rootL2_101117465 144
17 3300003781 Ga0055536_1028189 Ga0055536_10281892 144
18 3300005335 Ga0070666_10192017 Ga0070666_101920171 144
19 3300009174 Ga0105241_10205172 Ga0105241_102051722 144
20 3300025292 Ga0209676_1000159 Ga0209676_1000159159 144
21 3300025903 Ga0207680_10024833 Ga0207680_100248332 144
22 3300025911 Ga0207654_10159056 Ga0207654_101590562 144
23 3300027907 Ga0207428_10245798 Ga0207428_102457982 144
24 3300049570 Ga0501033_0931933 Ga0501033_0931933_110_553 144
25 3300053136 Ga0500559_0063075 Ga0500559_0063075_184_660 144
26 3300005356 Ga0070674_100595920 Ga0070674_1005959201 145
27 3300006051 Ga0075364_10186859 Ga0075364_101868592 145
28 3300006195 Ga0075366_10118105 Ga0075366_101181052 145
29 3300046539 Ga0495621_0332225 Ga0495621_0332225_150_617 145
30 3300050491 nmdc:mga00v17_221042_c1 nmdc:mga00v17_221042_c1_348_815 145
31 3300050494 nmdc:mga06z11_373919_c1 nmdc:mga06z11_373919_c1_31_504 145
32 3300045836 Ga0466958_0354192 Ga0466958_0354192_227_682 146
33 3300005937 Ga0081455_10003196 Ga0081455_100031967 147
34 3300021384 Ga0213876_10156730 Ga0213876_101567302 147
35 3300039437 Ga0436365_0381000 Ga0436365_0381000_339_788 147
36 3300049568 Ga0501031_0030368 Ga0501031_0030368_394_843 147
37 3300049569 Ga0501032_0022476 Ga0501032_0022476_1053_1502 147
38 3300049570 Ga0501033_0012022 Ga0501033_0012022_28_477 147
39 3300049571 Ga0501034_0108834 Ga0501034_0108834_480_929 147
40 3300049571 Ga0501034_0477465 Ga0501034_0477465_560_1009 147
41 3300049573 Ga0501037_0125438 Ga0501037_0125438_1044_1493 147
42 3300049574 Ga0501038_0043193 Ga0501038_0043193_209_658 147
43 3300049579 Ga0501043_0312917 Ga0501043_0312917_568_1017 147
44 3300049580 Ga0501046_0552650 Ga0501046_0552650_190_639 147
45 3300049581 Ga0501047_0031269 Ga0501047_0031269_2935_3384 147
46 3300049581 Ga0501047_0131177 Ga0501047_0131177_1160_1609 147
47 3300049586 Ga0501070_0186837 Ga0501070_0186837_734_1183 147
48 3300049587 Ga0501071_0238219 Ga0501071_0238219_828_1277 147
49 3300049742 Ga0501080_0541182 Ga0501080_0541182_338_787 147
50 3300049822 Ga0501035_0119190 Ga0501035_0119190_1425_1874 147
51 3300049823 Ga0501044_0081657 Ga0501044_0081657_813_1262 147
52 3300005289 Ga0065704_10471892 Ga0065704_104718921 148
53 3300005343 Ga0070687_101036976 Ga0070687_1010369761 148
54 3300005436 Ga0070713_101544619 Ga0070713_1015446191 148
55 3300005439 Ga0070711_100355271 Ga0070711_1003552712 148
56 3300005544 Ga0070686_100898859 Ga0070686_1008988591 148
57 3300009094 Ga0111539_10038873 Ga0111539_100388733 148
58 3300009148 Ga0105243_10410580 Ga0105243_104105802 148
59 3300009177 Ga0105248_10114652 Ga0105248_101146523 148
60 3300014326 Ga0157380_12527946 Ga0157380_125279461 148
61 3300025915 Ga0207693_11161978 Ga0207693_111619782 148
62 3300025916 Ga0207663_10529093 Ga0207663_105290932 148
63 3300025935 Ga0207709_10371001 Ga0207709_103710011 148
64 3300025941 Ga0207711_10102115 Ga0207711_101021153 148
65 3300028577 Ga0265318_10011032 Ga0265318_100110325 148
66 3300031235 Ga0265330_10271205 Ga0265330_102712052 148
67 3300031239 Ga0265328_10117361 Ga0265328_101173611 148
68 3300031240 Ga0265320_10018286 Ga0265320_100182864 148
69 3300031241 Ga0265325_10022005 Ga0265325_100220053 148
70 3300031241 Ga0265325_10035421 Ga0265325_100354213 148
71 3300031242 Ga0265329_10008172 Ga0265329_100081722 148
72 3300031247 Ga0265340_10048589 Ga0265340_100485892 148
73 3300031247 Ga0265340_10153195 Ga0265340_101531952 148
74 3300031249 Ga0265339_10059257 Ga0265339_100592572 148
75 3300031249 Ga0265339_10112600 Ga0265339_101126002 148
76 3300031250 Ga0265331_10233196 Ga0265331_102331962 148
77 3300031251 Ga0265327_10001294 Ga0265327_1000129412 148
78 3300031344 Ga0265316_10030377 Ga0265316_100303773 148
79 3300031344 Ga0265316_10092294 Ga0265316_100922943 148
80 3300031595 Ga0265313_10067965 Ga0265313_100679652 148
81 3300031711 Ga0265314_10041851 Ga0265314_100418512 148
82 3300031711 Ga0265314_10162338 Ga0265314_101623382 148
83 3300031712 Ga0265342_10012942 Ga0265342_100129424 148
84 3300031712 Ga0265342_10026466 Ga0265342_100264662 148
85 3300035083 Ga0373926_0276031 Ga0373926_0276031_142_597 148
86 3300035115 Ga0373941_0325938 Ga0373941_0325938_38_490 148
87 3300035116 Ga0373945_0062667 Ga0373945_0062667_123_578 148
88 3300035118 Ga0373954_0006098 Ga0373954_0006098_4462_4917 148
89 3300035119 Ga0373956_0441166 Ga0373956_0441166_92_547 148
90 3300035170 Ga0373943_0162973 Ga0373943_0162973_71_526 148
91 3300035171 Ga0373946_0296563 Ga0373946_0296563_172_627 148
92 3300035172 Ga0373955_0057076 Ga0373955_0057076_1329_1784 148
93 3300035692 Ga0373935_0434345 Ga0373935_0434345_400_855 148
94 3300035695 Ga0373927_0377681 Ga0373927_0377681_199_654 148
95 3300035724 Ga0373933_0680178 Ga0373933_0680178_68_523 148
96 3300035725 Ga0373947_0242557 Ga0373947_0242557_37_492 148
97 3300036401 Ga0373937_0194055 Ga0373937_0194055_1270_1725 148
98 3300037068 Ga0373925_0345542 Ga0373925_0345542_114_569 148
99 3300041406 Ga0439439_0107708 Ga0439439_0107708_286_738 148
100 3300042001 Ga0439441_017757 Ga0439441_017757_523_975 148
101 3300042156 Ga0439446_0043516 Ga0439446_0043516_483_935 148
102 3300042438 Ga0439459_0144034 Ga0439459_0144034_134_586 148
103 3300044683 Ga0466965_0351988 Ga0466965_0351988_292_759 148
104 3300044684 Ga0466966_0259871 Ga0466966_0259871_44_538 148
105 3300044694 Ga0466963_0018436 Ga0466963_0018436_2940_3395 148
106 3300044694 Ga0466963_0142899 Ga0466963_0142899_328_783 148
107 3300044719 Ga0466971_0072309 Ga0466971_0072309_845_1300 148
108 3300044842 Ga0466957_0081691 Ga0466957_0081691_347_802 148
109 3300044842 Ga0466957_0160277 Ga0466957_0160277_663_1118 148
110 3300044901 Ga0466960_0559024 Ga0466960_0559024_86_541 148
111 3300045836 Ga0466958_0765747 Ga0466958_0765747_122_577 148
112 3300045836 Ga0466958_0966986 Ga0466958_0966986_14_469 148
113 3300045976 Ga0466967_0005469 Ga0466967_0005469_4253_4708 148
114 3300045976 Ga0466967_0364323 Ga0466967_0364323_540_1007 148
115 3300046454 Ga0495592_0447852 Ga0495592_0447852_302_757 148
116 3300046462 Ga0495651_0062559 Ga0495651_0062559_1924_2379 148
117 3300046462 Ga0495651_0507490 Ga0495651_0507490_52_510 148
118 3300046473 Ga0495582_0417031 Ga0495582_0417031_277_732 148
119 3300046475 Ga0495639_0355456 Ga0495639_0355456_213_668 148
120 3300046477 Ga0495664_0756466 Ga0495664_0756466_59_514 148
121 3300046499 Ga0495594_0194796 Ga0495594_0194796_176_631 148
122 3300046511 Ga0495608_0004805 Ga0495608_0004805_1221_1676 148
123 3300046514 Ga0495618_0175149 Ga0495618_0175149_77_532 148
124 3300046517 Ga0495630_0449175 Ga0495630_0449175_310_765 148
125 3300046526 Ga0495666_0059152 Ga0495666_0059152_1016_1471 148
126 3300046533 Ga0495640_0282524 Ga0495640_0282524_63_518 148
127 3300046536 Ga0495587_0097972 Ga0495587_0097972_695_1150 148
128 3300046543 Ga0495645_0141654 Ga0495645_0141654_604_1059 148
129 3300046559 Ga0495667_0347959 Ga0495667_0347959_82_537 148
130 3300046663 Ga0495635_0301416 Ga0495635_0301416_265_720 148
131 3300046675 Ga0495657_0138006 Ga0495657_0138006_247_702 148
132 3300046678 Ga0495599_0054487 Ga0495599_0054487_296_751 148
133 3300046679 Ga0495623_0561502 Ga0495623_0561502_13_468 148
134 3300046680 Ga0495646_0213745 Ga0495646_0213745_41_496 148
135 3300046683 Ga0495658_0435550 Ga0495658_0435550_19_474 148
136 3300046689 Ga0495613_0431352 Ga0495613_0431352_400_855 148
137 3300046690 Ga0495624_0682456 Ga0495624_0682456_41_496 148
138 3300046809 Ga0495600_0128268 Ga0495600_0128268_442_897 148
139 3300047315 Ga0495581_0327074 Ga0495581_0327074_155_610 148
140 3300047317 Ga0495604_0089869 Ga0495604_0089869_604_1059 148
141 3300047319 Ga0495674_0040438 Ga0495674_0040438_385_840 148
142 3300047322 Ga0495680_0043962 Ga0495680_0043962_2443_2898 148
143 3300047471 Ga0495684_0753483 Ga0495684_0753483_77_532 148
144 3300047673 Ga0495593_0234383 Ga0495593_0234383_372_827 148
145 3300048089 Ga0495614_0135030 Ga0495614_0135030_377_832 148
146 3300050511 nmdc:mga08y16_217314_c1 nmdc:mga08y16_217314_c1_651_1127 148
147 3300053078 Ga0495612_0261214 Ga0495612_0261214_130_585 148
148 3300053084 Ga0495595_0329323 Ga0495595_0329323_184_639 148
149 3300053085 Ga0495619_0042476 Ga0495619_0042476_1919_2374 148
150 3300053085 Ga0495619_0045458 Ga0495619_0045458_1364_1822 148
151 3300054114 Ga0501084_1419456 Ga0501084_1419456_55_510 148
152 3300061719 Ga0466962_0142796 Ga0466962_0142796_280_735 148
153 3300005354 Ga0070675_101089942 Ga0070675_1010899422 149
154 3300005356 Ga0070674_100370433 Ga0070674_1003704332 149
155 3300005364 Ga0070673_101196151 Ga0070673_1011961512 149
156 3300005434 Ga0070709_10816516 Ga0070709_108165162 149
157 3300005435 Ga0070714_100359938 Ga0070714_1003599382 149
158 3300005435 Ga0070714_100475997 Ga0070714_1004759972 149
159 3300005436 Ga0070713_100103130 Ga0070713_1001031303 149
160 3300005543 Ga0070672_100704898 Ga0070672_1007048982 149
161 3300006028 Ga0070717_10621699 Ga0070717_106216992 149
162 3300006038 Ga0075365_10521466 Ga0075365_105214662 149
163 3300006048 Ga0075363_100013666 Ga0075363_1000136663 149
164 3300006175 Ga0070712_100002337 Ga0070712_1000023374 149
165 3300006175 Ga0070712_100024652 Ga0070712_1000246523 149
166 3300006178 Ga0075367_10233502 Ga0075367_102335022 149
167 3300006186 Ga0075369_10398190 Ga0075369_103981902 149
168 3300006353 Ga0075370_10236984 Ga0075370_102369841 149
169 3300006844 Ga0075428_100616526 Ga0075428_1006165262 149
170 3300006847 Ga0075431_100094711 Ga0075431_1000947112 149
171 3300007265 Ga0099794_10412353 Ga0099794_104123531 149
172 3300007788 Ga0099795_10000471 Ga0099795_100004714 149
173 3300007788 Ga0099795_10287614 Ga0099795_102876141 149
174 3300009147 Ga0114129_11822507 Ga0114129_118225072 149
175 3300010159 Ga0099796_10020829 Ga0099796_100208292 149
176 3300010159 Ga0099796_10090127 Ga0099796_100901272 149
177 3300013308 Ga0157375_13756222 Ga0157375_137562221 149
178 3300025905 Ga0207685_10491006 Ga0207685_104910061 149
179 3300025915 Ga0207693_10001524 Ga0207693_100015242 149
180 3300025915 Ga0207693_10032576 Ga0207693_100325763 149
181 3300025916 Ga0207663_10036466 Ga0207663_100364663 149
182 3300025928 Ga0207700_10220746 Ga0207700_102207463 149
183 3300025929 Ga0207664_10711390 Ga0207664_107113902 149
184 3300025932 Ga0207690_10552054 Ga0207690_105520542 149
185 3300025937 Ga0207669_10539696 Ga0207669_105396962 149
186 3300025960 Ga0207651_10254305 Ga0207651_102543052 149
187 3300026078 Ga0207702_11798893 Ga0207702_117988932 149
188 3300027512 Ga0209179_1016308 Ga0209179_10163082 149
189 3300027512 Ga0209179_1063980 Ga0209179_10639801 149
190 3300028573 Ga0265334_10027575 Ga0265334_100275752 149
191 3300028666 Ga0265336_10087998 Ga0265336_100879982 149
192 3300028800 Ga0265338_10065318 Ga0265338_100653183 149
193 3300031235 Ga0265330_10053545 Ga0265330_100535452 149
194 3300031241 Ga0265325_10014870 Ga0265325_100148703 149
195 3300031247 Ga0265340_10052416 Ga0265340_100524162 149
196 3300031548 Ga0307408_100841761 Ga0307408_1008417612 149
197 3300031595 Ga0265313_10163575 Ga0265313_101635752 149
198 3300031711 Ga0265314_10006793 Ga0265314_100067936 149
199 3300031712 Ga0265342_10016663 Ga0265342_100166632 149
200 3300034818 Ga0373950_0064100 Ga0373950_0064100_276_731 149
201 3300035083 Ga0373926_0045113 Ga0373926_0045113_373_828 149
202 3300035083 Ga0373926_0103277 Ga0373926_0103277_178_636 149
203 3300035089 Ga0373944_0041535 Ga0373944_0041535_450_905 149
204 3300035090 Ga0373949_0134638 Ga0373949_0134638_13_465 149
205 3300035111 Ga0373923_0000130 Ga0373923_0000130_4690_5145 149
206 3300035113 Ga0373936_0002001 Ga0373936_0002001_3036_3491 149
207 3300035113 Ga0373936_0009131 Ga0373936_0009131_706_1164 149
208 3300035116 Ga0373945_0006478 Ga0373945_0006478_3236_3691 149
209 3300035116 Ga0373945_0055086 Ga0373945_0055086_655_1113 149
210 3300035117 Ga0373953_0001083 Ga0373953_0001083_5489_5944 149
211 3300035118 Ga0373954_0003503 Ga0373954_0003503_3621_4076 149
212 3300035120 Ga0373957_0091339 Ga0373957_0091339_421_876 149
213 3300035170 Ga0373943_0010190 Ga0373943_0010190_3610_4068 149
214 3300035170 Ga0373943_0018696 Ga0373943_0018696_2305_2760 149
215 3300035171 Ga0373946_0030547 Ga0373946_0030547_1258_1713 149
216 3300035172 Ga0373955_0001349 Ga0373955_0001349_585_1040 149
217 3300035410 Ga0373924_0000822 Ga0373924_0000822_4346_4801 149
218 3300035410 Ga0373924_0076424 Ga0373924_0076424_29_487 149
219 3300035692 Ga0373935_0000032 Ga0373935_0000032_38632_39087 149
220 3300035692 Ga0373935_0012233 Ga0373935_0012233_1960_2418 149
221 3300035692 Ga0373935_0106885 Ga0373935_0106885_1330_1788 149
222 3300035695 Ga0373927_0004218 Ga0373927_0004218_584_1042 149
223 3300035695 Ga0373927_0009160 Ga0373927_0009160_4143_4598 149
224 3300035695 Ga0373927_0011509 Ga0373927_0011509_5276_5734 149
225 3300035724 Ga0373933_0002204 Ga0373933_0002204_3342_3797 149
226 3300035725 Ga0373947_0000298 Ga0373947_0000298_14668_15123 149
227 3300035725 Ga0373947_0008510 Ga0373947_0008510_89_547 149
228 3300036401 Ga0373937_0000326 Ga0373937_0000326_20395_20850 149
229 3300037068 Ga0373925_0000012 Ga0373925_0000012_2883_3338 149
230 3300037068 Ga0373925_0005229 Ga0373925_0005229_4681_5139 149
231 3300037068 Ga0373925_0125891 Ga0373925_0125891_412_870 149
232 3300046454 Ga0495592_0000033 Ga0495592_0000033_123428_123883 149
233 3300046459 Ga0495629_0030342 Ga0495629_0030342_1194_1649 149
234 3300046459 Ga0495629_0034630 Ga0495629_0034630_370_828 149
235 3300046462 Ga0495651_0000413 Ga0495651_0000413_3334_3789 149
236 3300046462 Ga0495651_0353910 Ga0495651_0353910_439_897 149
237 3300046463 Ga0495653_0000240 Ga0495653_0000240_15675_16130 149
238 3300046463 Ga0495653_0088025 Ga0495653_0088025_1506_1964 149
239 3300046475 Ga0495639_0444108 Ga0495639_0444108_20_478 149
240 3300046476 Ga0495662_0001477 Ga0495662_0001477_9181_9639 149
241 3300046476 Ga0495662_0003230 Ga0495662_0003230_5769_6224 149
242 3300046477 Ga0495664_0000005 Ga0495664_0000005_423484_423939 149
243 3300046477 Ga0495664_0001023 Ga0495664_0001023_13460_13918 149
244 3300046511 Ga0495608_0000003 Ga0495608_0000003_15638_16093 149
245 3300046514 Ga0495618_0000009 Ga0495618_0000009_184342_184797 149
246 3300046514 Ga0495618_0001656 Ga0495618_0001656_4600_5058 149
247 3300046516 Ga0495628_0000010 Ga0495628_0000010_199434_199889 149
248 3300046516 Ga0495628_0605948 Ga0495628_0605948_155_613 149
249 3300046517 Ga0495630_0005686 Ga0495630_0005686_3203_3658 149
250 3300046517 Ga0495630_0094914 Ga0495630_0094914_1661_2119 149
251 3300046526 Ga0495666_0073000 Ga0495666_0073000_779_1237 149
252 3300046529 Ga0495652_0000016 Ga0495652_0000016_196537_196992 149
253 3300046529 Ga0495652_0068272 Ga0495652_0068272_1582_2040 149
254 3300046531 Ga0495665_0007508 Ga0495665_0007508_5126_5584 149
255 3300046531 Ga0495665_0358252 Ga0495665_0358252_77_535 149
256 3300046533 Ga0495640_0000015 Ga0495640_0000015_143883_144338 149
257 3300046533 Ga0495640_0003394 Ga0495640_0003394_7763_8221 149
258 3300046533 Ga0495640_0063647 Ga0495640_0063647_277_735 149
259 3300046535 Ga0495586_0018556 Ga0495586_0018556_3039_3497 149
260 3300046535 Ga0495586_0159461 Ga0495586_0159461_183_638 149
261 3300046536 Ga0495587_0000009 Ga0495587_0000009_35056_35511 149
262 3300046543 Ga0495645_0000005 Ga0495645_0000005_423455_423910 149
263 3300046543 Ga0495645_0002744 Ga0495645_0002744_7224_7682 149
264 3300046559 Ga0495667_0000073 Ga0495667_0000073_15721_16176 149
265 3300046559 Ga0495667_0106557 Ga0495667_0106557_533_991 149
266 3300046642 Ga0495634_0000170 Ga0495634_0000170_44020_44475 149
267 3300046642 Ga0495634_0010447 Ga0495634_0010447_2086_2544 149
268 3300046642 Ga0495634_0024771 Ga0495634_0024771_3168_3626 149
269 3300046663 Ga0495635_0000013 Ga0495635_0000013_15692_16147 149
270 3300046663 Ga0495635_0004001 Ga0495635_0004001_2661_3119 149
271 3300046675 Ga0495657_0000579 Ga0495657_0000579_17950_18405 149
272 3300046678 Ga0495599_0000011 Ga0495599_0000011_191538_191993 149
273 3300046679 Ga0495623_0000005 Ga0495623_0000005_127842_128297 149
274 3300046680 Ga0495646_0000011 Ga0495646_0000011_191433_191888 149
275 3300046680 Ga0495646_0116965 Ga0495646_0116965_173_631 149
276 3300046683 Ga0495658_0012827 Ga0495658_0012827_2404_2862 149
277 3300046683 Ga0495658_0100152 Ga0495658_0100152_511_966 149
278 3300046689 Ga0495613_0065799 Ga0495613_0065799_1594_2049 149
279 3300046690 Ga0495624_0003168 Ga0495624_0003168_9472_9930 149
280 3300046690 Ga0495624_0046775 Ga0495624_0046775_953_1408 149
281 3300046809 Ga0495600_0000004 Ga0495600_0000004_15656_16111 149
282 3300047315 Ga0495581_0028659 Ga0495581_0028659_1029_1484 149
283 3300047315 Ga0495581_0030029 Ga0495581_0030029_267_725 149
284 3300047317 Ga0495604_0000006 Ga0495604_0000006_184357_184812 149
285 3300047319 Ga0495674_0000005 Ga0495674_0000005_20933_21388 149
286 3300047319 Ga0495674_0002588 Ga0495674_0002588_10463_10921 149
287 3300047321 Ga0495676_0123010 Ga0495676_0123010_330_788 149
288 3300047322 Ga0495680_0000141 Ga0495680_0000141_15569_16024 149
289 3300047322 Ga0495680_0191813 Ga0495680_0191813_446_904 149
290 3300047444 Ga0495675_0000070 Ga0495675_0000070_55193_55648 149
291 3300047471 Ga0495684_0000001 Ga0495684_0000001_353718_354173 149
292 3300047471 Ga0495684_0002341 Ga0495684_0002341_10356_10814 149
293 3300047471 Ga0495684_0020709 Ga0495684_0020709_4451_4909 149
294 3300047471 Ga0495684_0023444 Ga0495684_0023444_3847_4305 149
295 3300047673 Ga0495593_0000703 Ga0495593_0000703_2283_2738 149
296 3300048088 Ga0495602_0000003 Ga0495602_0000003_3176_3631 149
297 3300049590 Ga0501074_0833276 Ga0501074_0833276_58_513 149
298 3300049592 Ga0501076_1485493 Ga0501076_1485493_10_513 149
299 3300050490 nmdc:mga03n38_52258_c1 nmdc:mga03n38_52258_c1_1213_1671 149
300 3300050492 nmdc:mga0yw44_452187_c1 nmdc:mga0yw44_452187_c1_246_704 149
301 3300050494 nmdc:mga06z11_448821_c1 nmdc:mga06z11_448821_c1_191_649 149
302 3300050496 nmdc:mga07m45_40848_c2 nmdc:mga07m45_40848_c2_927_1385 149
303 3300053077 Ga0495601_0000005 Ga0495601_0000005_351622_352077 149
304 3300053077 Ga0495601_0009806 Ga0495601_0009806_4793_5251 149
305 3300053078 Ga0495612_0000001 Ga0495612_0000001_64048_64503 149
306 3300053078 Ga0495612_0000321 Ga0495612_0000321_13128_13586 149
307 3300053084 Ga0495595_0000070 Ga0495595_0000070_34541_34996 149
308 3300053084 Ga0495595_0026039 Ga0495595_0026039_579_1037 149
309 3300053085 Ga0495619_0000007 Ga0495619_0000007_353742_354197 149
310 3300053085 Ga0495619_0003250 Ga0495619_0003250_9705_10163 149
311 3300003911 JGI25405J52794_10010918 JGI25405J52794_100109182 150
312 3300005329 Ga0070683_100039407 Ga0070683_1000394073 150
313 3300005336 Ga0070680_100311056 Ga0070680_1003110562 150
314 3300005345 Ga0070692_10583006 Ga0070692_105830062 150
315 3300005366 Ga0070659_101039357 Ga0070659_1010393571 150
316 3300005434 Ga0070709_10032134 Ga0070709_100321344 150
317 3300005435 Ga0070714_100206652 Ga0070714_1002066522 150
318 3300005437 Ga0070710_10011480 Ga0070710_100114805 150
319 3300005439 Ga0070711_100139364 Ga0070711_1001393642 150
320 3300005458 Ga0070681_10279122 Ga0070681_102791222 150
321 3300005471 Ga0070698_100298832 Ga0070698_1002988322 150
322 3300005530 Ga0070679_100110386 Ga0070679_1001103862 150
323 3300005535 Ga0070684_100009679 Ga0070684_1000096794 150
324 3300005539 Ga0068853_100162531 Ga0068853_1001625312 150
325 3300005578 Ga0068854_100281684 Ga0068854_1002816842 150
326 3300005614 Ga0068856_100194447 Ga0068856_1001944473 150
327 3300005614 Ga0068856_100236265 Ga0068856_1002362652 150
328 3300005937 Ga0081455_10005182 Ga0081455_100051826 150
329 3300005937 Ga0081455_10017568 Ga0081455_100175685 150
330 3300005983 Ga0081540_1001438 Ga0081540_10014381 150
331 3300005983 Ga0081540_1040839 Ga0081540_10408394 150
332 3300005983 Ga0081540_1049164 Ga0081540_10491642 150
333 3300006038 Ga0075365_10026205 Ga0075365_100262053 150
334 3300006048 Ga0075363_100855048 Ga0075363_1008550482 150
335 3300006051 Ga0075364_10275628 Ga0075364_102756282 150
336 3300006173 Ga0070716_101438023 Ga0070716_1014380231 150
337 3300006175 Ga0070712_100178157 Ga0070712_1001781572 150
338 3300006353 Ga0075370_10061293 Ga0075370_100612933 150
339 3300006871 Ga0075434_100223693 Ga0075434_1002236932 150
340 3300006914 Ga0075436_100062940 Ga0075436_1000629403 150
341 3300009174 Ga0105241_10094656 Ga0105241_100946563 150
342 3300009545 Ga0105237_10041440 Ga0105237_100414401 150
343 3300009551 Ga0105238_10048324 Ga0105238_100483242 150
344 3300010375 Ga0105239_11477827 Ga0105239_114778271 150
345 3300013100 Ga0157373_10225828 Ga0157373_102258282 150
346 3300013104 Ga0157370_10196828 Ga0157370_101968282 150
347 3300013105 Ga0157369_10484673 Ga0157369_104846732 150
348 3300013307 Ga0157372_10176313 Ga0157372_101763132 150
349 3300020610 Ga0154015_1598321 Ga0154015_15983212 150
350 3300021388 Ga0213875_10044777 Ga0213875_100447772 150
351 3300025898 Ga0207692_10039102 Ga0207692_100391023 150
352 3300025906 Ga0207699_10114748 Ga0207699_101147482 150
353 3300025911 Ga0207654_10158291 Ga0207654_101582912 150
354 3300025912 Ga0207707_10390987 Ga0207707_103909872 150
355 3300025913 Ga0207695_10352336 Ga0207695_103523362 150
356 3300025915 Ga0207693_10046830 Ga0207693_100468302 150
357 3300025916 Ga0207663_10089727 Ga0207663_100897273 150
358 3300025924 Ga0207694_10298741 Ga0207694_102987412 150
359 3300025929 Ga0207664_10466482 Ga0207664_104664822 150
360 3300025932 Ga0207690_11344030 Ga0207690_113440301 150
361 3300025939 Ga0207665_10109700 Ga0207665_101097003 150
362 3300025944 Ga0207661_10085889 Ga0207661_100858893 150
363 3300025949 Ga0207667_10079146 Ga0207667_100791464 150
364 3300026078 Ga0207702_10308755 Ga0207702_103087552 150
365 3300028800 Ga0265338_10074105 Ga0265338_100741053 150
366 3300031241 Ga0265325_10004432 Ga0265325_100044326 150
367 3300031241 Ga0265325_10090686 Ga0265325_100906862 150
368 3300031247 Ga0265340_10035432 Ga0265340_100354322 150
369 3300031595 Ga0265313_10001120 Ga0265313_1000112017 150
370 3300031595 Ga0265313_10140178 Ga0265313_101401782 150
371 3300031665 Ga0316575_10039180 Ga0316575_100391802 150
372 3300031711 Ga0265314_10019360 Ga0265314_100193604 150
373 3300031824 Ga0307413_11097757 Ga0307413_110977572 150
374 3300035114 Ga0373939_0025484 Ga0373939_0025484_151_609 150
375 3300035118 Ga0373954_0036631 Ga0373954_0036631_989_1465 150
376 3300035119 Ga0373956_0079882 Ga0373956_0079882_85_561 150
377 3300035120 Ga0373957_0006799 Ga0373957_0006799_962_1438 150
378 3300035691 Ga0373931_0978720 Ga0373931_0978720_11_469 150
379 3300036401 Ga0373937_0013503 Ga0373937_0013503_6434_6910 150
380 3300037853 Ga0436364_0878561 Ga0436364_0878561_1181_1639 150
381 3300037853 Ga0436364_0956945 Ga0436364_0956945_4607_5068 150
382 3300039437 Ga0436365_1793152 Ga0436365_1793152_255_728 150
383 3300039438 Ga0436360_0487319 Ga0436360_0487319_500_961 150
384 3300039438 Ga0436360_0554890 Ga0436360_0554890_107_580 150
385 3300039453 Ga0436362_0207204 Ga0436362_0207204_274_735 150
386 3300046536 Ga0495587_0221576 Ga0495587_0221576_301_777 150
387 3300046615 Ga0495656_0467704 Ga0495656_0467704_117_590 150
388 3300046675 Ga0495657_0233420 Ga0495657_0233420_526_1002 150
389 3300046678 Ga0495599_0451881 Ga0495599_0451881_73_549 150
390 3300047317 Ga0495604_0117046 Ga0495604_0117046_1405_1881 150
391 3300047444 Ga0495675_0024946 Ga0495675_0024946_1478_1954 150
392 3300049571 Ga0501034_0006739 Ga0501034_0006739_9391_9849 150
393 3300049571 Ga0501034_0087154 Ga0501034_0087154_1747_2205 150
394 3300049571 Ga0501034_0110063 Ga0501034_0110063_1694_2152 150
395 3300049585 Ga0501069_0020409 Ga0501069_0020409_601_1059 150
396 3300049586 Ga0501070_0038350 Ga0501070_0038350_345_803 150
397 3300049586 Ga0501070_0065155 Ga0501070_0065155_1435_1893 150
398 3300049586 Ga0501070_0491927 Ga0501070_0491927_258_716 150
399 3300049742 Ga0501080_0049363 Ga0501080_0049363_2367_2825 150
400 3300049742 Ga0501080_0621352 Ga0501080_0621352_487_945 150
401 3300049744 Ga0501083_0024934 Ga0501083_0024934_2409_2867 150
402 3300049744 Ga0501083_0057721 Ga0501083_0057721_1161_1619 150
403 3300049822 Ga0501035_0029489 Ga0501035_0029489_1460_1918 150
404 3300049822 Ga0501035_0531694 Ga0501035_0531694_23_481 150
405 3300050491 nmdc:mga00v17_299995_c1 nmdc:mga00v17_299995_c1_358_825 150
406 3300050496 nmdc:mga07m45_184276_c1 nmdc:mga07m45_184276_c1_674_1141 150
407 3300050512 nmdc:mga0n895_235211_c1 nmdc:mga0n895_235211_c1_986_1444 150
408 3300053077 Ga0495601_0009361 Ga0495601_0009361_2093_2569 150
409 3300053085 Ga0495619_0004866 Ga0495619_0004866_6025_6501 150
410 3300053098 Ga0500650_0027389 Ga0500650_0027389_1151_1609 150
411 3300053108 Ga0500562_063632 Ga0500562_063632_236_694 150
412 3300054114 Ga0501084_0990049 Ga0501084_0990049_90_548 150
413 3300060353 Ga0501082_0361599 Ga0501082_0361599_237_695 150
414 iso_pu_bacteria 2643221547 2643756295 150
415 iso_pu_bacteria 2828305725 2828309601 150
416 3300001991 JGI24743J22301_10010240 JGI24743J22301_100102403 151
417 3300002070 JGI24750J21931_1005052 JGI24750J21931_10050523 151
418 3300002077 JGI24744J21845_10000313 JGI24744J21845_100003136 151
419 3300002239 JGI24034J26672_10002721 JGI24034J26672_100027211 151
420 3300002244 JGI24742J22300_10003208 JGI24742J22300_100032083 151
421 3300002459 JGI24751J29686_10033142 JGI24751J29686_100331422 151
422 3300003320 rootH2_10349800 rootH2_103498002 151
423 3300003911 JGI25405J52794_10006356 JGI25405J52794_100063563 151
424 3300004801 Ga0058860_11801317 Ga0058860_118013171 151
425 3300005327 Ga0070658_10176257 Ga0070658_101762572 151
426 3300005328 Ga0070676_10150439 Ga0070676_101504392 151
427 3300005331 Ga0070670_100016106 Ga0070670_1000161063 151
428 3300005331 Ga0070670_100084996 Ga0070670_1000849962 151
429 3300005334 Ga0068869_100772394 Ga0068869_1007723942 151
430 3300005335 Ga0070666_10003883 Ga0070666_100038833 151
431 3300005336 Ga0070680_101087240 Ga0070680_1010872401 151
432 3300005338 Ga0068868_100121320 Ga0068868_1001213202 151
433 3300005338 Ga0068868_100585545 Ga0068868_1005855452 151
434 3300005339 Ga0070660_100041561 Ga0070660_1000415614 151
435 3300005344 Ga0070661_100013819 Ga0070661_1000138193 151
436 3300005347 Ga0070668_100046181 Ga0070668_1000461812 151
437 3300005347 Ga0070668_100999569 Ga0070668_1009995691 151
438 3300005353 Ga0070669_100054968 Ga0070669_1000549682 151
439 3300005354 Ga0070675_100097445 Ga0070675_1000974453 151
440 3300005355 Ga0070671_100003576 Ga0070671_1000035761 151
441 3300005356 Ga0070674_100094227 Ga0070674_1000942273 151
442 3300005364 Ga0070673_100015590 Ga0070673_1000155904 151
443 3300005365 Ga0070688_100026564 Ga0070688_1000265643 151
444 3300005365 Ga0070688_101035173 Ga0070688_1010351732 151
445 3300005366 Ga0070659_100058332 Ga0070659_1000583322 151
446 3300005367 Ga0070667_100029202 Ga0070667_1000292023 151
447 3300005434 Ga0070709_10008529 Ga0070709_100085294 151
448 3300005434 Ga0070709_10155738 Ga0070709_101557382 151
449 3300005434 Ga0070709_10883600 Ga0070709_108836002 151
450 3300005435 Ga0070714_100002895 Ga0070714_1000028959 151
451 3300005435 Ga0070714_101345751 Ga0070714_1013457511 151
452 3300005436 Ga0070713_100000522 Ga0070713_10000052218 151
453 3300005436 Ga0070713_100011440 Ga0070713_1000114406 151
454 3300005437 Ga0070710_10007403 Ga0070710_100074034 151
455 3300005438 Ga0070701_10077299 Ga0070701_100772992 151
456 3300005439 Ga0070711_100015376 Ga0070711_1000153764 151
457 3300005439 Ga0070711_100425696 Ga0070711_1004256961 151
458 3300005440 Ga0070705_100012203 Ga0070705_1000122034 151
459 3300005441 Ga0070700_100046983 Ga0070700_1000469832 151
460 3300005444 Ga0070694_100141017 Ga0070694_1001410172 151
461 3300005445 Ga0070708_100045800 Ga0070708_1000458005 151
462 3300005445 Ga0070708_100512822 Ga0070708_1005128221 151
463 3300005455 Ga0070663_100153321 Ga0070663_1001533211 151
464 3300005457 Ga0070662_100045218 Ga0070662_1000452183 151
465 3300005459 Ga0068867_100011501 Ga0068867_1000115013 151
466 3300005466 Ga0070685_10003961 Ga0070685_100039615 151
467 3300005468 Ga0070707_100340290 Ga0070707_1003402902 151
468 3300005471 Ga0070698_100132969 Ga0070698_1001329692 151
469 3300005471 Ga0070698_100939994 Ga0070698_1009399942 151
470 3300005518 Ga0070699_100027933 Ga0070699_1000279334 151
471 3300005518 Ga0070699_100090652 Ga0070699_1000906522 151
472 3300005535 Ga0070684_100081079 Ga0070684_1000810792 151
473 3300005539 Ga0068853_100347238 Ga0068853_1003472382 151
474 3300005544 Ga0070686_100007896 Ga0070686_1000078962 151
475 3300005547 Ga0070693_100272157 Ga0070693_1002721571 151
476 3300005548 Ga0070665_100145699 Ga0070665_1001456992 151
477 3300005549 Ga0070704_101768070 Ga0070704_1017680701 151
478 3300005563 Ga0068855_100510734 Ga0068855_1005107341 151
479 3300005578 Ga0068854_100039606 Ga0068854_1000396064 151
480 3300005615 Ga0070702_100002486 Ga0070702_1000024867 151
481 3300005616 Ga0068852_100007204 Ga0068852_1000072042 151
482 3300005617 Ga0068859_100102927 Ga0068859_1001029274 151
483 3300005618 Ga0068864_100025576 Ga0068864_1000255764 151
484 3300005718 Ga0068866_10077946 Ga0068866_100779463 151
485 3300005719 Ga0068861_100032968 Ga0068861_1000329682 151
486 3300005840 Ga0068870_10002509 Ga0068870_100025095 151
487 3300005842 Ga0068858_100001353 Ga0068858_10000135318 151
488 3300005842 Ga0068858_102156578 Ga0068858_1021565781 151
489 3300005843 Ga0068860_101235203 Ga0068860_1012352032 151
490 3300005937 Ga0081455_10000853 Ga0081455_1000085332 151
491 3300005937 Ga0081455_10018403 Ga0081455_100184032 151
492 3300005937 Ga0081455_10075759 Ga0081455_100757592 151
493 3300005937 Ga0081455_10307322 Ga0081455_103073222 151
494 3300005937 Ga0081455_10343728 Ga0081455_103437282 151
495 3300005981 Ga0081538_10061297 Ga0081538_100612972 151
496 3300005983 Ga0081540_1016305 Ga0081540_10163053 151
497 3300005985 Ga0081539_10144285 Ga0081539_101442851 151
498 3300006028 Ga0070717_10000447 Ga0070717_100004475 151
499 3300006028 Ga0070717_10026215 Ga0070717_100262152 151
500 3300006028 Ga0070717_10327619 Ga0070717_103276192 151
501 3300006038 Ga0075365_10105076 Ga0075365_101050763 151
502 3300006038 Ga0075365_10126740 Ga0075365_101267401 151
503 3300006038 Ga0075365_10262379 Ga0075365_102623791 151
504 3300006042 Ga0075368_10028207 Ga0075368_100282073 151
505 3300006042 Ga0075368_10259479 Ga0075368_102594791 151
506 3300006048 Ga0075363_100112409 Ga0075363_1001124092 151
507 3300006051 Ga0075364_10250201 Ga0075364_102502012 151
508 3300006163 Ga0070715_10005522 Ga0070715_100055222 151
509 3300006173 Ga0070716_100012986 Ga0070716_1000129864 151
510 3300006173 Ga0070716_100140853 Ga0070716_1001408532 151
511 3300006173 Ga0070716_100373168 Ga0070716_1003731682 151
512 3300006175 Ga0070712_100020236 Ga0070712_1000202364 151
513 3300006175 Ga0070712_100372892 Ga0070712_1003728922 151
514 3300006175 Ga0070712_101236825 Ga0070712_1012368252 151
515 3300006178 Ga0075367_10206246 Ga0075367_102062461 151
516 3300006237 Ga0097621_100054866 Ga0097621_1000548664 151
517 3300006844 Ga0075428_100032651 Ga0075428_1000326513 151
518 3300006844 Ga0075428_102250835 Ga0075428_1022508352 151
519 3300006846 Ga0075430_100130875 Ga0075430_1001308753 151
520 3300006846 Ga0075430_100977995 Ga0075430_1009779951 151
521 3300006847 Ga0075431_100123790 Ga0075431_1001237902 151
522 3300006847 Ga0075431_100165818 Ga0075431_1001658182 151
523 3300006847 Ga0075431_100319383 Ga0075431_1003193832 151
524 3300006871 Ga0075434_100082619 Ga0075434_1000826194 151
525 3300006871 Ga0075434_100129902 Ga0075434_1001299023 151
526 3300006871 Ga0075434_102000193 Ga0075434_1020001932 151
527 3300006880 Ga0075429_100595149 Ga0075429_1005951492 151
528 3300006881 Ga0068865_100003113 Ga0068865_1000031136 151
529 3300006914 Ga0075436_100102789 Ga0075436_1001027891 151
530 3300006931 Ga0097620_100102923 Ga0097620_1001029232 151
531 3300007076 Ga0075435_100098114 Ga0075435_1000981143 151
532 3300007076 Ga0075435_100114282 Ga0075435_1001142822 151
533 3300007076 Ga0075435_100269692 Ga0075435_1002696922 151
534 3300009011 Ga0105251_10064962 Ga0105251_100649622 151
535 3300009094 Ga0111539_10054141 Ga0111539_100541414 151
536 3300009094 Ga0111539_10863925 Ga0111539_108639252 151
537 3300009098 Ga0105245_10084772 Ga0105245_100847724 151
538 3300009101 Ga0105247_10013158 Ga0105247_100131583 151
539 3300009101 Ga0105247_10494935 Ga0105247_104949351 151
540 3300009147 Ga0114129_10070412 Ga0114129_100704124 151
541 3300009147 Ga0114129_10126224 Ga0114129_101262243 151
542 3300009147 Ga0114129_10162344 Ga0114129_101623444 151
543 3300009147 Ga0114129_10163069 Ga0114129_101630693 151
544 3300009148 Ga0105243_10005394 Ga0105243_100053944 151
545 3300009174 Ga0105241_10044871 Ga0105241_100448714 151
546 3300009176 Ga0105242_10056726 Ga0105242_100567262 151
547 3300009176 Ga0105242_10612562 Ga0105242_106125621 151
548 3300009177 Ga0105248_10008040 Ga0105248_1000804011 151
549 3300009545 Ga0105237_11166238 Ga0105237_111662381 151
550 3300009551 Ga0105238_10059259 Ga0105238_100592593 151
551 3300010375 Ga0105239_10165897 Ga0105239_101658972 151
552 3300010375 Ga0105239_10551872 Ga0105239_105518722 151
553 3300013100 Ga0157373_10801518 Ga0157373_108015182 151
554 3300013296 Ga0157374_10010277 Ga0157374_100102775 151
555 3300013297 Ga0157378_10042417 Ga0157378_100424173 151
556 3300013297 Ga0157378_11261457 Ga0157378_112614572 151
557 3300013306 Ga0163162_11035397 Ga0163162_110353972 151
558 3300013306 Ga0163162_11633588 Ga0163162_116335882 151
559 3300013308 Ga0157375_13558122 Ga0157375_135581221 151
560 3300014325 Ga0163163_10091049 Ga0163163_100910492 151
561 3300014326 Ga0157380_10273023 Ga0157380_102730232 151
562 3300014497 Ga0182008_10428574 Ga0182008_104285742 151
563 3300014745 Ga0157377_10056931 Ga0157377_100569312 151
564 3300014968 Ga0157379_10023158 Ga0157379_100231584 151
565 3300014968 Ga0157379_11904597 Ga0157379_119045972 151
566 3300014969 Ga0157376_10077982 Ga0157376_100779824 151
567 3300014969 Ga0157376_11486705 Ga0157376_114867051 151
568 3300014969 Ga0157376_12740371 Ga0157376_127403711 151
569 3300017792 Ga0163161_11284526 Ga0163161_112845262 151
570 3300021361 Ga0213872_10238494 Ga0213872_102384941 151
571 3300021384 Ga0213876_10133043 Ga0213876_101330432 151
572 3300021388 Ga0213875_10140922 Ga0213875_101409222 151
573 3300025315 Ga0207697_10150676 Ga0207697_101506762 151
574 3300025321 Ga0207656_10066026 Ga0207656_100660261 151
575 3300025898 Ga0207692_10007792 Ga0207692_100077923 151
576 3300025899 Ga0207642_10668345 Ga0207642_106683452 151
577 3300025900 Ga0207710_10602385 Ga0207710_106023851 151
578 3300025901 Ga0207688_10000371 Ga0207688_1000037112 151
579 3300025903 Ga0207680_10150487 Ga0207680_101504871 151
580 3300025904 Ga0207647_10017077 Ga0207647_100170774 151
581 3300025905 Ga0207685_10009849 Ga0207685_100098493 151
582 3300025906 Ga0207699_10002470 Ga0207699_100024703 151
583 3300025906 Ga0207699_10850225 Ga0207699_108502252 151
584 3300025907 Ga0207645_10008321 Ga0207645_100083214 151
585 3300025908 Ga0207643_10000431 Ga0207643_1000043126 151
586 3300025910 Ga0207684_10006975 Ga0207684_100069754 151
587 3300025911 Ga0207654_10158395 Ga0207654_101583952 151
588 3300025914 Ga0207671_10804905 Ga0207671_108049052 151
589 3300025915 Ga0207693_10032964 Ga0207693_100329643 151
590 3300025915 Ga0207693_10187803 Ga0207693_101878032 151
591 3300025915 Ga0207693_10332682 Ga0207693_103326822 151
592 3300025916 Ga0207663_10003084 Ga0207663_100030845 151
593 3300025916 Ga0207663_10078702 Ga0207663_100787023 151
594 3300025918 Ga0207662_10002627 Ga0207662_1000262711 151
595 3300025919 Ga0207657_10029403 Ga0207657_100294033 151
596 3300025924 Ga0207694_10145615 Ga0207694_101456153 151
597 3300025925 Ga0207650_10011186 Ga0207650_100111865 151
598 3300025925 Ga0207650_10035669 Ga0207650_100356694 151
599 3300025926 Ga0207659_10015818 Ga0207659_100158184 151
600 3300025927 Ga0207687_10660979 Ga0207687_106609792 151
601 3300025928 Ga0207700_10005352 Ga0207700_100053527 151
602 3300025928 Ga0207700_10041070 Ga0207700_100410703 151
603 3300025928 Ga0207700_10276936 Ga0207700_102769362 151
604 3300025928 Ga0207700_10370966 Ga0207700_103709661 151
605 3300025929 Ga0207664_10049629 Ga0207664_100496293 151
606 3300025931 Ga0207644_10079804 Ga0207644_100798043 151
607 3300025932 Ga0207690_10093662 Ga0207690_100936622 151
608 3300025933 Ga0207706_10008492 Ga0207706_100084923 151
609 3300025934 Ga0207686_10096107 Ga0207686_100961072 151
610 3300025935 Ga0207709_10235941 Ga0207709_102359412 151
611 3300025937 Ga0207669_10018462 Ga0207669_100184621 151
612 3300025938 Ga0207704_10218884 Ga0207704_102188841 151
613 3300025939 Ga0207665_10003612 Ga0207665_100036128 151
614 3300025939 Ga0207665_10264003 Ga0207665_102640031 151
615 3300025939 Ga0207665_10831986 Ga0207665_108319862 151
616 3300025940 Ga0207691_10000542 Ga0207691_1000054226 151
617 3300025941 Ga0207711_10105870 Ga0207711_101058703 151
618 3300025942 Ga0207689_10027542 Ga0207689_100275425 151
619 3300025944 Ga0207661_10116859 Ga0207661_101168593 151
620 3300025945 Ga0207679_11369121 Ga0207679_113691211 151
621 3300025949 Ga0207667_10240297 Ga0207667_102402972 151
622 3300025961 Ga0207712_11063342 Ga0207712_110633421 151
623 3300025981 Ga0207640_11327486 Ga0207640_113274861 151
624 3300026035 Ga0207703_10025601 Ga0207703_100256014 151
625 3300026067 Ga0207678_10016045 Ga0207678_100160453 151
626 3300026075 Ga0207708_10000532 Ga0207708_1000053215 151
627 3300026088 Ga0207641_10024795 Ga0207641_100247952 151
628 3300026089 Ga0207648_10000825 Ga0207648_1000082529 151
629 3300026095 Ga0207676_10007032 Ga0207676_100070322 151
630 3300026118 Ga0207675_100007077 Ga0207675_1000070772 151
631 3300026121 Ga0207683_10004559 Ga0207683_1000455910 151
632 3300026142 Ga0207698_10105288 Ga0207698_101052883 151
633 3300027671 Ga0209588_1090760 Ga0209588_10907601 151
634 3300027866 Ga0209813_10260963 Ga0209813_102609631 151
635 3300028379 Ga0268266_10145977 Ga0268266_101459773 151
636 3300028379 Ga0268266_10749129 Ga0268266_107491292 151
637 3300028381 Ga0268264_10022950 Ga0268264_100229504 151
638 3300028556 Ga0265337_1004133 Ga0265337_10041334 151
639 3300031242 Ga0265329_10111677 Ga0265329_101116771 151
640 3300031247 Ga0265340_10010895 Ga0265340_100108954 151
641 3300031249 Ga0265339_10004315 Ga0265339_100043153 151
642 3300031250 Ga0265331_10150366 Ga0265331_101503662 151
643 3300031344 Ga0265316_10011100 Ga0265316_100111005 151
644 3300031711 Ga0265314_10069302 Ga0265314_100693023 151
645 3300031712 Ga0265342_10000233 Ga0265342_100002332 151
646 3300031824 Ga0307413_10433359 Ga0307413_104333592 151
647 3300035083 Ga0373926_0416027 Ga0373926_0416027_57_512 151
648 3300035089 Ga0373944_0008559 Ga0373944_0008559_2230_2685 151
649 3300035090 Ga0373949_0108854 Ga0373949_0108854_187_642 151
650 3300035091 Ga0373951_0038271 Ga0373951_0038271_52_507 151
651 3300035113 Ga0373936_0304613 Ga0373936_0304613_223_678 151
652 3300035115 Ga0373941_0002860 Ga0373941_0002860_1763_2257 151
653 3300035121 Ga0373960_0087607 Ga0373960_0087607_322_777 151
654 3300035170 Ga0373943_0006735 Ga0373943_0006735_1863_2318 151
655 3300035170 Ga0373943_0120920 Ga0373943_0120920_252_713 151
656 3300035170 Ga0373943_0326561 Ga0373943_0326561_322_777 151
657 3300035171 Ga0373946_0008089 Ga0373946_0008089_86_541 151
658 3300035171 Ga0373946_0508747 Ga0373946_0508747_54_509 151
659 3300035172 Ga0373955_0035612 Ga0373955_0035612_84_539 151
660 3300035692 Ga0373935_0298255 Ga0373935_0298255_338_793 151
661 3300035695 Ga0373927_0019283 Ga0373927_0019283_985_1440 151
662 3300035695 Ga0373927_0021733 Ga0373927_0021733_329_784 151
663 3300035695 Ga0373927_0358530 Ga0373927_0358530_334_795 151
664 3300035695 Ga0373927_0391480 Ga0373927_0391480_46_501 151
665 3300035725 Ga0373947_0018711 Ga0373947_0018711_349_804 151
666 3300037068 Ga0373925_0033074 Ga0373925_0033074_2868_3323 151
667 3300037418 Ga0395900_0088706 Ga0395900_0088706_1138_1593 151
668 3300037418 Ga0395900_0356599 Ga0395900_0356599_360_824 151
669 3300037853 Ga0436364_0687434 Ga0436364_0687434_471_932 151
670 3300038443 Ga0395901_0132208 Ga0395901_0132208_1819_2274 151
671 3300038443 Ga0395901_0828402 Ga0395901_0828402_30_494 151
672 3300039437 Ga0436365_0849289 Ga0436365_0849289_624_1088 151
673 3300039437 Ga0436365_0988571 Ga0436365_0988571_326_790 151
674 3300039447 Ga0436361_0203502 Ga0436361_0203502_6924_7382 151
675 3300039447 Ga0436361_0224754 Ga0436361_0224754_277_741 151
676 3300039447 Ga0436361_1089976 Ga0436361_1089976_136_600 151
677 3300039450 Ga0436363_0525535 Ga0436363_0525535_1394_1858 151
678 3300039453 Ga0436362_1296964 Ga0436362_1296964_18_482 151
679 3300041408 Ga0439453_0147701 Ga0439453_0147701_31_537 151
680 3300041458 Ga0451798_0720422 Ga0451798_0720422_20_475 151
681 3300042001 Ga0439441_031596 Ga0439441_031596_425_931 151
682 3300046452 Ga0495617_084789 Ga0495617_084789_465_920 151
683 3300046453 Ga0495627_143729 Ga0495627_143729_40_495 151
684 3300046455 Ga0495603_0013141 Ga0495603_0013141_3371_3826 151
685 3300046455 Ga0495603_0133783 Ga0495603_0133783_322_777 151
686 3300046455 Ga0495603_0511071 Ga0495603_0511071_39_500 151
687 3300046457 Ga0495590_0109177 Ga0495590_0109177_14_469 151
688 3300046459 Ga0495629_0311781 Ga0495629_0311781_205_660 151
689 3300046460 Ga0495638_0023057 Ga0495638_0023057_3222_3677 151
690 3300046461 Ga0495641_0287445 Ga0495641_0287445_218_673 151
691 3300046462 Ga0495651_0378400 Ga0495651_0378400_296_760 151
692 3300046472 Ga0495580_0177062 Ga0495580_0177062_520_975 151
693 3300046472 Ga0495580_0463712 Ga0495580_0463712_182_643 151
694 3300046473 Ga0495582_0073850 Ga0495582_0073850_1080_1535 151
695 3300046475 Ga0495639_0496539 Ga0495639_0496539_107_562 151
696 3300046476 Ga0495662_0014966 Ga0495662_0014966_1085_1540 151
697 3300046477 Ga0495664_0455576 Ga0495664_0455576_190_645 151
698 3300046491 Ga0495584_0005882 Ga0495584_0005882_198_653 151
699 3300046491 Ga0495584_0245701 Ga0495584_0245701_322_777 151
700 3300046492 Ga0495585_0223475 Ga0495585_0223475_240_695 151
701 3300046500 Ga0495596_0096200 Ga0495596_0096200_440_895 151
702 3300046501 Ga0495607_0358007 Ga0495607_0358007_75_530 151
703 3300046506 Ga0495583_0203406 Ga0495583_0203406_65_520 151
704 3300046515 Ga0495620_0219282 Ga0495620_0219282_180_635 151
705 3300046516 Ga0495628_0092408 Ga0495628_0092408_986_1441 151
706 3300046517 Ga0495630_0033852 Ga0495630_0033852_1897_2358 151
707 3300046517 Ga0495630_0727812 Ga0495630_0727812_276_731 151
708 3300046519 Ga0495632_0143703 Ga0495632_0143703_131_586 151
709 3300046520 Ga0495637_0132127 Ga0495637_0132127_159_614 151
710 3300046523 Ga0495644_0296305 Ga0495644_0296305_35_490 151
711 3300046525 Ga0495663_0303998 Ga0495663_0303998_64_519 151
712 3300046526 Ga0495666_0041406 Ga0495666_0041406_1472_1927 151
713 3300046533 Ga0495640_0591792 Ga0495640_0591792_176_631 151
714 3300046538 Ga0495609_0157891 Ga0495609_0157891_308_763 151
715 3300046538 Ga0495609_0267757 Ga0495609_0267757_132_587 151
716 3300046539 Ga0495621_0085070 Ga0495621_0085070_458_913 151
717 3300046557 Ga0495622_0016147 Ga0495622_0016147_2047_2502 151
718 3300046558 Ga0495633_0034046 Ga0495633_0034046_750_1205 151
719 3300046615 Ga0495656_0043198 Ga0495656_0043198_1088_1543 151
720 3300046615 Ga0495656_0071219 Ga0495656_0071219_409_864 151
721 3300046615 Ga0495656_0363345 Ga0495656_0363345_241_702 151
722 3300046616 Ga0495668_0106233 Ga0495668_0106233_382_837 151
723 3300046616 Ga0495668_0859657 Ga0495668_0859657_23_484 151
724 3300046642 Ga0495634_0173662 Ga0495634_0173662_353_814 151
725 3300046642 Ga0495634_0178865 Ga0495634_0178865_483_938 151
726 3300046663 Ga0495635_0281250 Ga0495635_0281250_204_659 151
727 3300046664 Ga0495659_0051660 Ga0495659_0051660_773_1228 151
728 3300046681 Ga0495647_0016516 Ga0495647_0016516_992_1447 151
729 3300046683 Ga0495658_0110900 Ga0495658_0110900_439_894 151
730 3300046690 Ga0495624_0262050 Ga0495624_0262050_98_553 151
731 3300046691 Ga0495670_0055322 Ga0495670_0055322_890_1345 151
732 3300046692 Ga0495671_0085036 Ga0495671_0085036_529_984 151
733 3300046794 Ga0495589_0235832 Ga0495589_0235832_39_494 151
734 3300046809 Ga0495600_0732485 Ga0495600_0732485_20_475 151
735 3300047315 Ga0495581_0327090 Ga0495581_0327090_429_884 151
736 3300047315 Ga0495581_0637726 Ga0495581_0637726_124_579 151
737 3300047317 Ga0495604_0248953 Ga0495604_0248953_663_1118 151
738 3300047317 Ga0495604_0406799 Ga0495604_0406799_299_763 151
739 3300047319 Ga0495674_0011651 Ga0495674_0011651_3073_3534 151
740 3300047319 Ga0495674_0269677 Ga0495674_0269677_75_530 151
741 3300047319 Ga0495674_0507245 Ga0495674_0507245_414_869 151
742 3300047321 Ga0495676_0019255 Ga0495676_0019255_350_805 151
743 3300047321 Ga0495676_0030454 Ga0495676_0030454_3775_4230 151
744 3300047322 Ga0495680_0271873 Ga0495680_0271873_632_1096 151
745 3300047445 Ga0495677_0217987 Ga0495677_0217987_266_721 151
746 3300047446 Ga0495679_031483 Ga0495679_031483_302_757 151
747 3300047470 Ga0495681_0092961 Ga0495681_0092961_680_1135 151
748 3300047470 Ga0495681_0192679 Ga0495681_0192679_359_814 151
749 3300047471 Ga0495684_0559776 Ga0495684_0559776_135_590 151
750 3300047471 Ga0495684_0857308 Ga0495684_0857308_59_535 151
751 3300047673 Ga0495593_0398182 Ga0495593_0398182_179_634 151
752 3300048091 Ga0495626_0145235 Ga0495626_0145235_328_783 151
753 3300048903 Ga0496100_0330649 Ga0496100_0330649_331_795 151
754 3300048903 Ga0496100_0354701 Ga0496100_0354701_97_552 151
755 3300048903 Ga0496100_0685608 Ga0496100_0685608_262_717 151
756 3300048904 Ga0496101_0065375 Ga0496101_0065375_1883_2338 151
757 3300048904 Ga0496101_0674695 Ga0496101_0674695_135_599 151
758 3300048905 Ga0496102_0002538 Ga0496102_0002538_2320_2775 151
759 3300048905 Ga0496102_0032009 Ga0496102_0032009_565_1020 151
760 3300048905 Ga0496102_0043973 Ga0496102_0043973_272_736 151
761 3300048905 Ga0496102_0731811 Ga0496102_0731811_355_810 151
762 3300048906 Ga0496103_0008867 Ga0496103_0008867_5483_5938 151
763 3300048907 Ga0496104_0003699 Ga0496104_0003699_9916_10371 151
764 3300048907 Ga0496104_0005339 Ga0496104_0005339_3686_4141 151
765 3300048907 Ga0496104_0005656 Ga0496104_0005656_3257_3712 151
766 3300048907 Ga0496104_0042076 Ga0496104_0042076_1650_2105 151
767 3300048908 Ga0496105_0006937 Ga0496105_0006937_1235_1690 151
768 3300048908 Ga0496105_0035873 Ga0496105_0035873_2833_3288 151
769 3300048908 Ga0496105_0214532 Ga0496105_0214532_669_1133 151
770 3300048908 Ga0496105_0453051 Ga0496105_0453051_302_757 151
771 3300048909 Ga0496106_0012088 Ga0496106_0012088_4682_5137 151
772 3300048909 Ga0496106_0031771 Ga0496106_0031771_344_799 151
773 3300048909 Ga0496106_0052175 Ga0496106_0052175_67_522 151
774 3300048909 Ga0496106_0229568 Ga0496106_0229568_214_678 151
775 3300048909 Ga0496106_1050807 Ga0496106_1050807_69_524 151
776 3300048910 Ga0496107_0483632 Ga0496107_0483632_86_550 151
777 3300048910 Ga0496107_0987140 Ga0496107_0987140_71_526 151
778 3300048911 Ga0496108_0014122 Ga0496108_0014122_4035_4490 151
779 3300048911 Ga0496108_0081845 Ga0496108_0081845_1756_2211 151
780 3300048912 Ga0496109_0072699 Ga0496109_0072699_1094_1549 151
781 3300048912 Ga0496109_0074841 Ga0496109_0074841_61_516 151
782 3300048912 Ga0496109_0316108 Ga0496109_0316108_175_630 151
783 3300048912 Ga0496109_1047195 Ga0496109_1047195_158_613 151
784 3300048913 Ga0496110_0020506 Ga0496110_0020506_4144_4602 151
785 3300048913 Ga0496110_0074141 Ga0496110_0074141_2346_2801 151
786 3300048914 Ga0496111_0000520 Ga0496111_0000520_17402_17857 151
787 3300048914 Ga0496111_0034353 Ga0496111_0034353_1410_1865 151
788 3300048914 Ga0496111_0060793 Ga0496111_0060793_974_1438 151
789 3300048915 Ga0496112_0032097 Ga0496112_0032097_2026_2481 151
790 3300048915 Ga0496112_0082669 Ga0496112_0082669_965_1420 151
791 3300048915 Ga0496112_0928936 Ga0496112_0928936_69_527 151
792 3300048916 Ga0496113_0004173 Ga0496113_0004173_1487_1942 151
793 3300048916 Ga0496113_0034836 Ga0496113_0034836_2268_2723 151
794 3300048916 Ga0496113_0417091 Ga0496113_0417091_482_937 151
795 3300048916 Ga0496113_0717908 Ga0496113_0717908_38_502 151
796 3300048917 Ga0496114_0021128 Ga0496114_0021128_1363_1818 151
797 3300048917 Ga0496114_0117326 Ga0496114_0117326_1761_2216 151
798 3300048917 Ga0496114_0524216 Ga0496114_0524216_203_667 151
799 3300048917 Ga0496114_0527142 Ga0496114_0527142_388_843 151
800 3300048918 Ga0496115_0009264 Ga0496115_0009264_2552_3007 151
801 3300048918 Ga0496115_0025115 Ga0496115_0025115_2716_3171 151
802 3300048918 Ga0496115_0086887 Ga0496115_0086887_860_1315 151
803 3300049568 Ga0501031_0053740 Ga0501031_0053740_65_526 151
804 3300049569 Ga0501032_0011792 Ga0501032_0011792_1428_1889 151
805 3300049569 Ga0501032_0026172 Ga0501032_0026172_647_1141 151
806 3300049569 Ga0501032_0891231 Ga0501032_0891231_51_512 151
807 3300049570 Ga0501033_0057569 Ga0501033_0057569_515_976 151
808 3300049570 Ga0501033_0094697 Ga0501033_0094697_1200_1694 151
809 3300049571 Ga0501034_0000097 Ga0501034_0000097_128605_129066 151
810 3300049571 Ga0501034_0003959 Ga0501034_0003959_10586_11086 151
811 3300049571 Ga0501034_0031402 Ga0501034_0031402_2995_3456 151
812 3300049571 Ga0501034_0105534 Ga0501034_0105534_1571_2032 151
813 3300049571 Ga0501034_0595480 Ga0501034_0595480_188_649 151
814 3300049572 Ga0501036_0002226 Ga0501036_0002226_1557_2018 151
815 3300049572 Ga0501036_0003062 Ga0501036_0003062_3898_4398 151
816 3300049572 Ga0501036_0586633 Ga0501036_0586633_314_775 151
817 3300049573 Ga0501037_0048015 Ga0501037_0048015_229_690 151
818 3300049573 Ga0501037_0055716 Ga0501037_0055716_181_681 151
819 3300049573 Ga0501037_0159662 Ga0501037_0159662_362_856 151
820 3300049573 Ga0501037_0383636 Ga0501037_0383636_401_862 151
821 3300049573 Ga0501037_0793588 Ga0501037_0793588_32_493 151
822 3300049574 Ga0501038_0002646 Ga0501038_0002646_12677_13138 151
823 3300049574 Ga0501038_0073137 Ga0501038_0073137_2358_2819 151
824 3300049574 Ga0501038_0226098 Ga0501038_0226098_12_512 151
825 3300049574 Ga0501038_0929008 Ga0501038_0929008_70_531 151
826 3300049575 Ga0501039_0032726 Ga0501039_0032726_2122_2616 151
827 3300049575 Ga0501039_0116119 Ga0501039_0116119_183_644 151
828 3300049575 Ga0501039_0274341 Ga0501039_0274341_41_496 151
829 3300049575 Ga0501039_0492366 Ga0501039_0492366_288_749 151
830 3300049576 Ga0501040_0112491 Ga0501040_0112491_1084_1545 151
831 3300049576 Ga0501040_0454926 Ga0501040_0454926_47_574 151
832 3300049578 Ga0501042_0195786 Ga0501042_0195786_203_658 151
833 3300049579 Ga0501043_0003254 Ga0501043_0003254_3041_3541 151
834 3300049579 Ga0501043_0059364 Ga0501043_0059364_1839_2327 151
835 3300049580 Ga0501046_0048704 Ga0501046_0048704_2159_2620 151
836 3300049580 Ga0501046_0152148 Ga0501046_0152148_1242_1703 151
837 3300049580 Ga0501046_0342683 Ga0501046_0342683_380_907 151
838 3300049581 Ga0501047_0000010 Ga0501047_0000010_5838_6338 151
839 3300049581 Ga0501047_0023364 Ga0501047_0023364_1571_2065 151
840 3300049581 Ga0501047_0189545 Ga0501047_0189545_269_730 151
841 3300049582 Ga0501048_0002496 Ga0501048_0002496_148_648 151
842 3300049582 Ga0501048_0056670 Ga0501048_0056670_2188_2649 151
843 3300049583 Ga0501067_0073636 Ga0501067_0073636_1341_1802 151
844 3300049584 Ga0501068_0028385 Ga0501068_0028385_2561_3022 151
845 3300049584 Ga0501068_0042380 Ga0501068_0042380_399_893 151
846 3300049584 Ga0501068_0055856 Ga0501068_0055856_1653_2114 151
847 3300049584 Ga0501068_0059611 Ga0501068_0059611_533_994 151
848 3300049584 Ga0501068_0128273 Ga0501068_0128273_341_841 151
849 3300049585 Ga0501069_0015441 Ga0501069_0015441_225_686 151
850 3300049585 Ga0501069_0302408 Ga0501069_0302408_259_753 151
851 3300049586 Ga0501070_0017811 Ga0501070_0017811_1746_2240 151
852 3300049586 Ga0501070_0046396 Ga0501070_0046396_1747_2247 151
853 3300049586 Ga0501070_0189787 Ga0501070_0189787_1212_1673 151
854 3300049587 Ga0501071_0159645 Ga0501071_0159645_908_1369 151
855 3300049587 Ga0501071_0296665 Ga0501071_0296665_78_533 151
856 3300049587 Ga0501071_0610133 Ga0501071_0610133_83_544 151
857 3300049589 Ga0501073_0069621 Ga0501073_0069621_1603_2064 151
858 3300049589 Ga0501073_0099474 Ga0501073_0099474_1476_1937 151
859 3300049589 Ga0501073_0108787 Ga0501073_0108787_380_874 151
860 3300049590 Ga0501074_0008172 Ga0501074_0008172_5134_5634 151
861 3300049590 Ga0501074_0193078 Ga0501074_0193078_601_1095 151
862 3300049590 Ga0501074_0238875 Ga0501074_0238875_173_634 151
863 3300049590 Ga0501074_0334132 Ga0501074_0334132_443_898 151
864 3300049590 Ga0501074_1017274 Ga0501074_1017274_61_522 151
865 3300049591 Ga0501075_0449918 Ga0501075_0449918_315_776 151
866 3300049591 Ga0501075_0789823 Ga0501075_0789823_248_703 151
867 3300049592 Ga0501076_0127152 Ga0501076_0127152_888_1349 151
868 3300049593 Ga0501077_0913701 Ga0501077_0913701_78_536 151
869 3300049741 Ga0501079_0359075 Ga0501079_0359075_110_565 151
870 3300049741 Ga0501079_0407732 Ga0501079_0407732_375_869 151
871 3300049741 Ga0501079_0619246 Ga0501079_0619246_186_647 151
872 3300049742 Ga0501080_0006002 Ga0501080_0006002_10162_10623 151
873 3300049742 Ga0501080_0006165 Ga0501080_0006165_48_509 151
874 3300049742 Ga0501080_0031760 Ga0501080_0031760_1141_1635 151
875 3300049742 Ga0501080_0401778 Ga0501080_0401778_84_545 151
876 3300049742 Ga0501080_1031869 Ga0501080_1031869_218_679 151
877 3300049742 Ga0501080_1042089 Ga0501080_1042089_189_644 151
878 3300049743 Ga0501081_0279521 Ga0501081_0279521_447_908 151
879 3300049744 Ga0501083_0000677 Ga0501083_0000677_4954_5454 151
880 3300049744 Ga0501083_0218332 Ga0501083_0218332_698_1159 151
881 3300049744 Ga0501083_0230649 Ga0501083_0230649_519_1013 151
882 3300049744 Ga0501083_0783196 Ga0501083_0783196_101_556 151
883 3300049822 Ga0501035_0032444 Ga0501035_0032444_2774_3268 151
884 3300049822 Ga0501035_0190491 Ga0501035_0190491_362_823 151
885 3300049822 Ga0501035_0651987 Ga0501035_0651987_301_762 151
886 3300049823 Ga0501044_0002568 Ga0501044_0002568_11958_12458 151
887 3300049823 Ga0501044_0173859 Ga0501044_0173859_452_913 151
888 3300049823 Ga0501044_0332973 Ga0501044_0332973_616_1110 151
889 3300049823 Ga0501044_0858025 Ga0501044_0858025_257_718 151
890 3300049823 Ga0501044_1018031 Ga0501044_1018031_55_582 151
891 3300049824 Ga0501045_0268657 Ga0501045_0268657_340_819 151
892 3300049824 Ga0501045_0366055 Ga0501045_0366055_170_631 151
893 3300049824 Ga0501045_0653646 Ga0501045_0653646_140_595 151
894 3300050490 nmdc:mga03n38_29764_c1 nmdc:mga03n38_29764_c1_21_482 151
895 3300050490 nmdc:mga03n38_48607_c1 nmdc:mga03n38_48607_c1_220_675 151
896 3300050491 nmdc:mga00v17_382140_c1 nmdc:mga00v17_382140_c1_49_504 151
897 3300050492 nmdc:mga0yw44_108417_c1 nmdc:mga0yw44_108417_c1_107_562 151
898 3300050492 nmdc:mga0yw44_13748_c1 nmdc:mga0yw44_13748_c1_1382_1837 151
899 3300050492 nmdc:mga0yw44_308540_c1 nmdc:mga0yw44_308540_c1_63_518 151
900 3300050494 nmdc:mga06z11_249044_c1 nmdc:mga06z11_249044_c1_248_703 151
901 3300050494 nmdc:mga06z11_295462_c1 nmdc:mga06z11_295462_c1_119_574 151
902 3300050495 nmdc:mga04h51_138102_c1 nmdc:mga04h51_138102_c1_207_662 151
903 3300050495 nmdc:mga04h51_294673_c1 nmdc:mga04h51_294673_c1_77_535 151
904 3300050507 nmdc:mga05p37_111062_c1 nmdc:mga05p37_111062_c1_875_1330 151
905 3300050507 nmdc:mga05p37_461907_c1 nmdc:mga05p37_461907_c1_680_1138 151
906 3300050507 nmdc:mga05p37_535190_c1 nmdc:mga05p37_535190_c1_856_1311 151
907 3300050507 nmdc:mga05p37_62442_c1 nmdc:mga05p37_62442_c1_2891_3346 151
908 3300050507 nmdc:mga05p37_70164_c1 nmdc:mga05p37_70164_c1_2186_2641 151
909 3300050509 nmdc:mga0qj67_516077_c1 nmdc:mga0qj67_516077_c1_364_819 151
910 3300050510 nmdc:mga06r32_338648_c1 nmdc:mga06r32_338648_c1_305_760 151
911 3300050510 nmdc:mga06r32_922211_c1 nmdc:mga06r32_922211_c1_231_686 151
912 3300050510 nmdc:mga06r32_95751_c1 nmdc:mga06r32_95751_c1_1217_1672 151
913 3300050511 nmdc:mga08y16_28718_c1 nmdc:mga08y16_28718_c1_2186_2641 151
914 3300050512 nmdc:mga0n895_2142469_c1 nmdc:mga0n895_2142469_c1_16_477 151
915 3300050512 nmdc:mga0n895_44768_c1 nmdc:mga0n895_44768_c1_2932_3387 151
916 3300050513 nmdc:mga0rr50_130487_c1 nmdc:mga0rr50_130487_c1_300_758 151
917 3300050513 nmdc:mga0rr50_436217_c1 nmdc:mga0rr50_436217_c1_567_1022 151
918 3300050513 nmdc:mga0rr50_579730_c1 nmdc:mga0rr50_579730_c1_172_627 151
919 3300050513 nmdc:mga0rr50_910756_c1 nmdc:mga0rr50_910756_c1_166_621 151
920 3300050514 nmdc:mga08x19_1184617_c1 nmdc:mga08x19_1184617_c1_57_512 151
921 3300050515 nmdc:mga0a205_223853_c1 nmdc:mga0a205_223853_c1_35_493 151
922 3300053077 Ga0495601_0000361 Ga0495601_0000361_14727_15188 151
923 3300053084 Ga0495595_0019093 Ga0495595_0019093_258_722 151
924 3300053084 Ga0495595_0061510 Ga0495595_0061510_327_782 151
925 3300053085 Ga0495619_0028211 Ga0495619_0028211_2144_2608 151
926 3300053085 Ga0495619_0124706 Ga0495619_0124706_887_1363 151
927 3300053085 Ga0495619_0314345 Ga0495619_0314345_219_704 151
928 3300053094 Ga0500566_0235380 Ga0500566_0235380_294_749 151
929 3300053153 Ga0500616_0137945 Ga0500616_0137945_628_1089 151
930 3300054114 Ga0501084_0105761 Ga0501084_0105761_603_1058 151
931 3300054114 Ga0501084_0109726 Ga0501084_0109726_1123_1578 151
932 3300054114 Ga0501084_0138605 Ga0501084_0138605_585_1046 151
933 3300054114 Ga0501084_0367418 Ga0501084_0367418_285_746 151
934 3300054114 Ga0501084_0522989 Ga0501084_0522989_413_940 151
935 3300060353 Ga0501082_0413055 Ga0501082_0413055_271_765 151
936 3300060353 Ga0501082_0565055 Ga0501082_0565055_473_934 151
937 3300061734 Ga0530510_0052121 Ga0530510_0052121_2492_2947 151
938 3300061734 Ga0530510_0069077 Ga0530510_0069077_1583_2038 151
939 3300061734 Ga0530510_0649400 Ga0530510_0649400_56_511 151
940 iso_pu_bacteria 8054563764 8054567780 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

42

167

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6x-assembly1.cif.gz_F crystal structure of campylobacter jejuni fabz 0.9724 12 151
3d6x-assembly1.cif.gz_D crystal structure of campylobacter jejuni fabz 0.9714 11 151
3doz-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase (fabz) from helicobacter pylori in complex with compound 3k 0.9627 10 151
3d6x-assembly1.cif.gz_A crystal structure of campylobacter jejuni fabz 0.962 11 151
3d6x-assembly1.cif.gz_C crystal structure of campylobacter jejuni fabz 0.9592 12 150
ID Description Score Start End Superfamily
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9626 9 151 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.956 11 150 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9541 11 151 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9489 11 150 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9419 11 151 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A656Z5U0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) 0.9839 27 151 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2E7FXR6-F1-model_v4 deleted 0.9764 11 151
AF-A0A3M0CGW3-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9748 10 151 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A2D7BQS1-F1-model_v4 Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acylglucosamine N-acyltransferase (EC 2.3.1.191)] 0.9747 10 151 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0016410
GO:0019171
AF-A0A3M1GB20-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) 0.973 17 151 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171

Feature Viewer

pLDDT pTM Quality
88.58 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map