F486265

General Info

Members Datasets Scaffolds Average Seq Length
938 420 1876 109

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_1259757|Ga0501034_1259757_205_591
Length 128
Sequence MRRLIAPLVCASAGYSRETIMAVKPRIKLDKKEAKKGDIVEVKALVSHIMETGQRKDASGNVIPRKILNKFVCTVAGKQVFSADFEPAISANPYIQFKFRAETSGPVVLTWIDDDGSTIVGEETIKVD

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
203 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
204 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
223 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
224 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
228 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
349 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
352 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
353 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
357 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
358 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
359 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
363 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
364 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
365 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
366 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
371 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
372 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
376 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
379 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
380 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
385 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
386 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
387 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
388 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
389 2643221651 Afipia sp. Root123D2 Isolate Unclassified
390 2643221736 Bosea sp. Root483D1 Isolate Unclassified
391 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
392 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
393 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
394 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
395 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
396 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
397 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
398 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
399 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
400 2841760612 Bosea sp. Tri-49 Isolate Nodule
401 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
402 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
403 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
404 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
405 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
406 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
407 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
408 2844104063 Bosea sp. Tri-39 Isolate Nodule
409 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
410 2851182111 Bosea sp. Tri-44 Isolate Nodule
411 2851246043 Bosea sp. Tri-54 Isolate Nodule
412 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
413 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
414 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
415 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
416 2906610324
417 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
418 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
419 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
420 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0
Isolates 3.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.35
Nodule 2.24
Rhizoplane 4.8
Rhizosphere 71.64
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_1259757 3300049571 Bacteria 617
2 2214578602 2209111006 Bacteria 525
3 JGI25406J46586_10155184 3300003203 Bacteria 668
4 JGI25407J50210_10152214 3300003373 Bacteria 569
5 JGI25404J52841_10016298 3300003659 Bacteria 1612
6 JGI25404J52841_10030164 3300003659 Bacteria 1162
7 Ga0065165_1000209 3300005262 Bacteria 101834
8 Ga0065712_10041572 3300005290 Bacteria 811
9 Ga0065712_10109852 3300005290 Bacteria 1848
10 Ga0065715_10149271 3300005293 Bacteria 1745
11 Ga0065715_10473769 3300005293 Bacteria 804
12 Ga0065715_11108973 3300005293 Bacteria 518
13 Ga0065707_10353061 3300005295 Bacteria 915
14 Ga0065707_10915669 3300005295 Bacteria 562
15 Ga0070658_10051167 3300005327 Bacteria 3348
16 Ga0070676_10082647 3300005328 Bacteria 1952
17 Ga0070676_10588801 3300005328 Bacteria 801
18 Ga0070670_100691710 3300005331 Bacteria 917
19 Ga0070677_10005339 3300005333 Bacteria 4230
20 Ga0068869_100418842 3300005334 Bacteria 1105
21 Ga0070666_10457265 3300005335 Bacteria 922
22 Ga0070666_10516274 3300005335 Bacteria 867
23 Ga0070680_100013998 3300005336 Bacteria 6262
24 Ga0070680_100776942 3300005336 Bacteria 825
25 Ga0070682_101010531 3300005337 Bacteria 691
26 Ga0070682_101980250 3300005337 Bacteria 512
27 Ga0068868_100436736 3300005338 Bacteria 1136
28 Ga0068868_100536470 3300005338 Bacteria 1029
29 Ga0068868_101075155 3300005338 Bacteria 739
30 Ga0068868_101098853 3300005338 Bacteria 731
31 Ga0070660_100068441 3300005339 Bacteria 2767
32 Ga0070689_101600186 3300005340 Bacteria 592
33 Ga0070689_101641183 3300005340 Bacteria 584
34 Ga0070691_10038192 3300005341 Bacteria 2267
35 Ga0070691_10278604 3300005341 Unclassified 906
36 Ga0070687_100192906 3300005343 Bacteria 1229
37 Ga0070687_100241285 3300005343 Bacteria 1118
38 Ga0070661_100132513 3300005344 Bacteria 1873
39 Ga0070692_10877072 3300005345 Bacteria 619
40 Ga0070692_10927052 3300005345 Bacteria 604
41 Ga0070668_100046891 3300005347 Bacteria 3321
42 Ga0070668_100156589 3300005347 Bacteria 1846
43 Ga0070668_100453176 3300005347 Bacteria 1103
44 Ga0070668_100750281 3300005347 Bacteria 864
45 Ga0070668_101945558 3300005347 Bacteria 542
46 Ga0070669_100154343 3300005353 Bacteria 1779
47 Ga0070669_101234906 3300005353 Bacteria 646
48 Ga0070669_101311396 3300005353 Bacteria 627
49 Ga0070675_100053020 3300005354 Bacteria 3335
50 Ga0070675_100399015 3300005354 Bacteria 1227
51 Ga0070675_100912966 3300005354 Bacteria 805
52 Ga0070675_101484049 3300005354 Bacteria 625
53 Ga0070671_100042683 3300005355 Bacteria 3769
54 Ga0070671_100364071 3300005355 Bacteria 1235
55 Ga0070671_100920699 3300005355 Bacteria 764
56 Ga0070671_100932751 3300005355 Bacteria 759
57 Ga0070674_100049857 3300005356 Bacteria 2880
58 Ga0070674_100118576 3300005356 Bacteria 1956
59 Ga0070674_100972696 3300005356 Bacteria 743
60 Ga0070674_101199435 3300005356 Bacteria 674
61 Ga0070673_100071920 3300005364 Bacteria 2780
62 Ga0070673_100207545 3300005364 Bacteria 1690
63 Ga0070673_100368452 3300005364 Bacteria 1278
64 Ga0070688_100766106 3300005365 Bacteria 752
65 Ga0070688_101651374 3300005365 Bacteria 524
66 Ga0070688_101800320 3300005365 Bacteria 503
67 Ga0070659_100892224 3300005366 Bacteria 777
68 Ga0070659_101368238 3300005366 Bacteria 629
69 Ga0070667_100271139 3300005367 Bacteria 1522
70 Ga0070667_100985939 3300005367 Bacteria 786
71 Ga0070667_101423708 3300005367 Bacteria 650
72 Ga0070709_11087828 3300005434 Bacteria 639
73 Ga0070714_100424389 3300005435 Bacteria 1260
74 Ga0070713_100865579 3300005436 Bacteria 868
75 Ga0070701_11249118 3300005438 Bacteria 529
76 Ga0070705_100242665 3300005440 Bacteria 1260
77 Ga0070705_101889051 3300005440 Bacteria 508
78 Ga0070700_100258480 3300005441 Bacteria 1253
79 Ga0070700_100855913 3300005441 Bacteria 737
80 Ga0070700_100892536 3300005441 Bacteria 723
81 Ga0070700_101245636 3300005441 Bacteria 623
82 Ga0070663_100036370 3300005455 Bacteria 3421
83 Ga0070678_100151387 3300005456 Bacteria 1869
84 Ga0070678_100317943 3300005456 Bacteria 1328
85 Ga0070678_100494993 3300005456 Bacteria 1078
86 Ga0070662_100024505 3300005457 Bacteria 4157
87 Ga0070662_101024112 3300005457 Bacteria 707
88 Ga0070662_101458471 3300005457 Bacteria 590
89 Ga0070681_10411752 3300005458 Bacteria 1264
90 Ga0070681_11137461 3300005458 Bacteria 702
91 Ga0068867_100180068 3300005459 Bacteria 1680
92 Ga0068867_100980316 3300005459 Bacteria 765
93 Ga0068867_101603280 3300005459 Bacteria 608
94 Ga0070685_10099508 3300005466 Bacteria 1773
95 Ga0070698_101769061 3300005471 Bacteria 571
96 Ga0070679_100039578 3300005530 Bacteria 4685
97 Ga0070679_100439501 3300005530 Bacteria 1249
98 Ga0070684_101917378 3300005535 Bacteria 559
99 Ga0068853_100238749 3300005539 Bacteria 1665
100 Ga0068853_100924617 3300005539 Bacteria 838
101 Ga0068853_102303650 3300005539 Bacteria 522
102 Ga0070672_100575537 3300005543 Bacteria 979
103 Ga0070672_100968129 3300005543 Bacteria 753
104 Ga0070672_101050852 3300005543 Bacteria 723
105 Ga0070672_101122515 3300005543 Bacteria 699
106 Ga0070686_100402150 3300005544 Bacteria 1042
107 Ga0070686_101134246 3300005544 Bacteria 647
108 Ga0070695_101224100 3300005545 Bacteria 618
109 Ga0070693_100164029 3300005547 Bacteria 1418
110 Ga0070665_100542628 3300005548 Bacteria 1175
111 Ga0070664_100954992 3300005564 Bacteria 805
112 Ga0068857_100276960 3300005577 Bacteria 1542
113 Ga0068857_102025324 3300005577 Bacteria 565
114 Ga0068854_100609290 3300005578 Bacteria 933
115 Ga0068854_102071140 3300005578 Bacteria 525
116 Ga0068856_100813319 3300005614 Bacteria 954
117 Ga0068852_100914230 3300005616 Bacteria 895
118 Ga0068859_100207856 3300005617 Bacteria 2043
119 Ga0068859_100244509 3300005617 Bacteria 1884
120 Ga0068859_101182952 3300005617 Bacteria 842
121 Ga0068864_100080657 3300005618 Bacteria 2851
122 Ga0068864_100869790 3300005618 Bacteria 889
123 Ga0068861_100306416 3300005719 Bacteria 1378
124 Ga0068861_100975804 3300005719 Bacteria 807
125 Ga0068861_101336858 3300005719 Bacteria 698
126 Ga0068861_101535742 3300005719 Bacteria 654
127 Ga0068861_102016707 3300005719 Bacteria 576
128 Ga0068870_10264555 3300005840 Bacteria 1072
129 Ga0068870_10644837 3300005840 Bacteria 725
130 Ga0068863_100937727 3300005841 Bacteria 867
131 Ga0068858_100110809 3300005842 Bacteria 2563
132 Ga0068860_102644452 3300005843 Bacteria 521
133 Ga0068862_100019045 3300005844 Bacteria 5723
134 Ga0068862_101791972 3300005844 Bacteria 623
135 Ga0081455_10000196 3300005937 Bacteria 76949
136 Ga0081455_10030097 3300005937 Bacteria 4938
137 Ga0081455_10288312 3300005937 Bacteria 1183
138 Ga0081455_10467233 3300005937 Bacteria 857
139 Ga0081455_10767238 3300005937 Bacteria 608
140 Ga0081455_10770091 3300005937 Bacteria 607
141 Ga0081538_10010509 3300005981 Bacteria 7589
142 Ga0081538_10026508 3300005981 Bacteria 4051
143 Ga0081538_10066481 3300005981 Bacteria 2021
144 Ga0081538_10152432 3300005981 Bacteria 1044
145 Ga0081538_10336367 3300005981 Bacteria 548
146 Ga0081540_1000045 3300005983 Bacteria 134124
147 Ga0081540_1000293 3300005983 Bacteria 52532
148 Ga0081540_1005974 3300005983 Bacteria 8967
149 Ga0081540_1041402 3300005983 Bacteria 2389
150 Ga0081540_1259249 3300005983 Bacteria 604
151 Ga0081539_10002257 3300005985 Bacteria 28023
152 Ga0081539_10005839 3300005985 Bacteria 12218
153 Ga0081539_10015916 3300005985 Bacteria 5420
154 Ga0081539_10043106 3300005985 Bacteria 2619
155 Ga0081539_10421400 3300005985 Bacteria 554
156 Ga0070717_11889230 3300006028 Bacteria 539
157 Ga0075365_10004179 3300006038 Bacteria 7601
158 Ga0075365_10225049 3300006038 Bacteria 1316
159 Ga0075365_10963058 3300006038 Bacteria 601
160 Ga0075365_11144497 3300006038 Bacteria 548
161 Ga0075368_10002447 3300006042 Bacteria 6063
162 Ga0075368_10044175 3300006042 Bacteria 1757
163 Ga0075368_10104614 3300006042 Bacteria 1164
164 Ga0075368_10475193 3300006042 Bacteria 556
165 Ga0075363_100047388 3300006048 Bacteria 2282
166 Ga0075363_100101691 3300006048 Bacteria 1591
167 Ga0075363_100251267 3300006048 Bacteria 1018
168 Ga0075363_100540210 3300006048 Bacteria 695
169 Ga0075364_10021661 3300006051 Bacteria 4051
170 Ga0075364_10155242 3300006051 Bacteria 1543
171 Ga0075364_10486711 3300006051 Bacteria 843
172 Ga0075364_10954163 3300006051 Bacteria 583
173 Ga0070715_10573342 3300006163 Bacteria 657
174 Ga0075362_10103278 3300006177 Bacteria 1335
175 Ga0075362_10190721 3300006177 Bacteria 995
176 Ga0075362_10193124 3300006177 Bacteria 989
177 Ga0075362_10207732 3300006177 Bacteria 954
178 Ga0075362_10317903 3300006177 Bacteria 775
179 Ga0075362_10323043 3300006177 Bacteria 769
180 Ga0075367_10037371 3300006178 Bacteria 2821
181 Ga0075367_10097412 3300006178 Bacteria 1794
182 Ga0075367_10104264 3300006178 Bacteria 1736
183 Ga0075367_10425883 3300006178 Bacteria 840
184 Ga0075369_10022004 3300006186 Bacteria 2627
185 Ga0075369_10029118 3300006186 Bacteria 2318
186 Ga0075369_10310598 3300006186 Bacteria 737
187 Ga0075369_10495105 3300006186 Bacteria 581
188 Ga0075366_10003832 3300006195 Bacteria 8009
189 Ga0075366_10191871 3300006195 Bacteria 1241
190 Ga0075366_10223416 3300006195 Bacteria 1147
191 Ga0075366_10702648 3300006195 Bacteria 628
192 Ga0075366_10802218 3300006195 Bacteria 586
193 Ga0075366_10980056 3300006195 Bacteria 527
194 Ga0097621_100760050 3300006237 Bacteria 896
195 Ga0075370_10111276 3300006353 Bacteria 1590
196 Ga0075370_10227312 3300006353 Bacteria 1104
197 Ga0075370_10428665 3300006353 Bacteria 795
198 Ga0075428_100118754 3300006844 Bacteria 2879
199 Ga0075428_100179086 3300006844 Bacteria 2295
200 Ga0075428_100182655 3300006844 Bacteria 2270
201 Ga0075428_100302389 3300006844 Bacteria 1720
202 Ga0075428_100464305 3300006844 Bacteria 1355
203 Ga0075428_100595785 3300006844 Bacteria 1181
204 Ga0075428_101349636 3300006844 Bacteria 749
205 Ga0075428_101878361 3300006844 Bacteria 622
206 Ga0075428_102042025 3300006844 Bacteria 594
207 Ga0075430_100315400 3300006846 Bacteria 1293
208 Ga0075430_100635753 3300006846 Bacteria 880
209 Ga0075430_100733528 3300006846 Bacteria 814
210 Ga0075430_101796853 3300006846 Bacteria 503
211 Ga0075431_100217230 3300006847 Bacteria 1951
212 Ga0075431_100259704 3300006847 Bacteria 1763
213 Ga0075431_101929329 3300006847 Bacteria 546
214 Ga0075433_10000349 3300006852 Bacteria 28807
215 Ga0075433_10237570 3300006852 Bacteria 1618
216 Ga0075434_100002239 3300006871 Bacteria 16904
217 Ga0075434_100825207 3300006871 Bacteria 943
218 Ga0075429_100367620 3300006880 Bacteria 1259
219 Ga0068865_100068815 3300006881 Bacteria 2504
220 Ga0097620_100207870 3300006931 Bacteria 2043
221 Ga0097620_100244532 3300006931 Bacteria 1884
222 Ga0097620_101183088 3300006931 Bacteria 842
223 Ga0105240_11836601 3300009093 Bacteria 631
224 Ga0111539_10012734 3300009094 Bacteria 10533
225 Ga0111539_10021737 3300009094 Bacteria 7889
226 Ga0111539_10772926 3300009094 Bacteria 1118
227 Ga0111539_10905049 3300009094 Bacteria 1026
228 Ga0111539_11106387 3300009094 Bacteria 921
229 Ga0111539_11179906 3300009094 Bacteria 889
230 Ga0111539_11249317 3300009094 Bacteria 862
231 Ga0105245_10089093 3300009098 Bacteria 2836
232 Ga0105245_12678660 3300009098 Bacteria 552
233 Ga0105247_10106654 3300009101 Bacteria 1798
234 Ga0105247_10637354 3300009101 Bacteria 795
235 Ga0105247_11092863 3300009101 Bacteria 629
236 Ga0114129_10050036 3300009147 Bacteria 5871
237 Ga0114129_10176057 3300009147 Bacteria 2914
238 Ga0114129_10348670 3300009147 Bacteria 1962
239 Ga0114129_10532367 3300009147 Bacteria 1530
240 Ga0114129_10739919 3300009147 Bacteria 1260
241 Ga0114129_11938248 3300009147 Bacteria 714
242 Ga0114129_11952726 3300009147 Bacteria 711
243 Ga0105243_10120148 3300009148 Bacteria 2214
244 Ga0105243_10538936 3300009148 Bacteria 1113
245 Ga0105243_11419579 3300009148 Bacteria 715
246 Ga0105243_12048742 3300009148 Bacteria 607
247 Ga0105243_12330739 3300009148 Bacteria 573
248 Ga0105241_10773668 3300009174 Bacteria 882
249 Ga0105242_10028530 3300009176 Bacteria 4445
250 Ga0105242_10126286 3300009176 Bacteria 2202
251 Ga0105242_10915164 3300009176 Bacteria 878
252 Ga0105242_13081227 3300009176 Bacteria 516
253 Ga0105248_12284510 3300009177 Bacteria 616
254 Ga0105237_11122493 3300009545 Bacteria 793
255 Ga0105238_10052564 3300009551 Bacteria 4096
256 Ga0105238_12076525 3300009551 Bacteria 602
257 Ga0105238_12816528 3300009551 Bacteria 523
258 Ga0105249_10325553 3300009553 Bacteria 1549
259 Ga0105249_10427743 3300009553 Bacteria 1359
260 Ga0105249_11156726 3300009553 Bacteria 844
261 Ga0105249_12103459 3300009553 Bacteria 637
262 Ga0105249_12963999 3300009553 Unclassified 545
263 Ga0105033_127389 3300009986 Bacteria 524
264 Ga0105239_11371255 3300010375 Bacteria 816
265 Ga0105239_11511145 3300010375 Bacteria 776
266 Ga0105239_12711056 3300010375 Bacteria 578
267 Ga0105246_10503784 3300011119 Bacteria 1029
268 Ga0105246_10574124 3300011119 Bacteria 970
269 Ga0105246_11068936 3300011119 Bacteria 735
270 Ga0105246_11204281 3300011119 Bacteria 697
271 Ga0171462_1019 3300013250 Bacteria 146628
272 Ga0157374_11751972 3300013296 Bacteria 646
273 Ga0157378_10652755 3300013297 Bacteria 1068
274 Ga0157378_10719677 3300013297 Bacteria 1019
275 Ga0157378_11053755 3300013297 Bacteria 849
276 Ga0157378_11626389 3300013297 Bacteria 692
277 Ga0157378_11969916 3300013297 Bacteria 634
278 Ga0163162_10264081 3300013306 Bacteria 1853
279 Ga0163162_11388182 3300013306 Bacteria 799
280 Ga0163162_11589783 3300013306 Bacteria 746
281 Ga0157372_10265167 3300013307 Bacteria 1994
282 Ga0157375_10095534 3300013308 Bacteria 3043
283 Ga0157375_10613731 3300013308 Bacteria 1246
284 Ga0157375_11647247 3300013308 Bacteria 759
285 Ga0157375_12373474 3300013308 Bacteria 633
286 Ga0163163_10274635 3300014325 Bacteria 1736
287 Ga0163163_10376107 3300014325 Bacteria 1478
288 Ga0163163_11554449 3300014325 Bacteria 723
289 Ga0163163_11737403 3300014325 Bacteria 684
290 Ga0163163_12943638 3300014325 Bacteria 531
291 Ga0157380_10182965 3300014326 Bacteria 1843
292 Ga0157380_10233581 3300014326 Bacteria 1653
293 Ga0157380_10238944 3300014326 Bacteria 1637
294 Ga0157380_10354008 3300014326 Bacteria 1375
295 Ga0157380_10399625 3300014326 Bacteria 1303
296 Ga0157380_10560860 3300014326 Bacteria 1122
297 Ga0157380_11121781 3300014326 Bacteria 826
298 Ga0157380_11350319 3300014326 Bacteria 762
299 Ga0157377_10568648 3300014745 Bacteria 804
300 Ga0157379_10257636 3300014968 Bacteria 1585
301 Ga0157379_10689022 3300014968 Bacteria 959
302 Ga0157379_10767813 3300014968 Bacteria 908
303 Ga0157379_11487286 3300014968 Bacteria 658
304 Ga0157379_12214182 3300014968 Bacteria 546
305 Ga0157376_10218970 3300014969 Bacteria 1762
306 Ga0157376_10528577 3300014969 Bacteria 1164
307 Ga0163161_10239411 3300017792 Bacteria 1411
308 Ga0163161_10556768 3300017792 Bacteria 940
309 Ga0163161_10787817 3300017792 Bacteria 798
310 Ga0163161_11150669 3300017792 Bacteria 669
311 Ga0163161_11363935 3300017792 Bacteria 618
312 Ga0163161_11417323 3300017792 Bacteria 607
313 Ga0213873_10151259 3300021358 Bacteria 699
314 Ga0213876_10016344 3300021384 Bacteria 3923
315 Ga0209563_111903 3300025230 Bacteria 1209
316 Ga0209130_1000902 3300025284 Bacteria 23951
317 Ga0209025_1002026 3300025294 Bacteria 23125
318 Ga0209564_1018758 3300025295 Bacteria 2620
319 Ga0209758_1000217 3300025297 Bacteria 124619
320 Ga0209758_1011197 3300025297 Bacteria 5232
321 Ga0209758_1056197 3300025297 Bacteria 1331
322 Ga0207426_1011624 3300025302 Bacteria 3342
323 Ga0207697_10068546 3300025315 Bacteria 1484
324 Ga0207697_10519618 3300025315 Bacteria 525
325 Ga0207682_10004236 3300025893 Bacteria 6060
326 Ga0207688_10108544 3300025901 Bacteria 1609
327 Ga0207688_10238838 3300025901 Bacteria 1098
328 Ga0207688_10274329 3300025901 Bacteria 1026
329 Ga0207688_10381604 3300025901 Bacteria 872
330 Ga0207680_10747833 3300025903 Bacteria 701
331 Ga0207680_10763552 3300025903 Bacteria 693
332 Ga0207647_10499691 3300025904 Bacteria 678
333 Ga0207685_10036835 3300025905 Bacteria 1797
334 Ga0207645_10158842 3300025907 Bacteria 1478
335 Ga0207645_10902106 3300025907 Bacteria 600
336 Ga0207643_10031625 3300025908 Bacteria 2951
337 Ga0207643_10052375 3300025908 Bacteria 2318
338 Ga0207705_10197107 3300025909 Bacteria 1525
339 Ga0207705_10446602 3300025909 Bacteria 1002
340 Ga0207707_11115763 3300025912 Bacteria 642
341 Ga0207671_10909534 3300025914 Bacteria 695
342 Ga0207693_10479360 3300025915 Bacteria 971
343 Ga0207660_10033192 3300025917 Bacteria 3568
344 Ga0207660_10159978 3300025917 Bacteria 1737
345 Ga0207660_10526299 3300025917 Bacteria 960
346 Ga0207662_10789813 3300025918 Bacteria 669
347 Ga0207657_10036283 3300025919 Bacteria 4413
348 Ga0207649_10812100 3300025920 Bacteria 730
349 Ga0207649_10879712 3300025920 Bacteria 702
350 Ga0207652_10087919 3300025921 Bacteria 2725
351 Ga0207652_11013140 3300025921 Bacteria 729
352 Ga0207681_10504468 3300025923 Bacteria 991
353 Ga0207694_10034613 3300025924 Bacteria 3873
354 Ga0207694_10785825 3300025924 Bacteria 804
355 Ga0207650_10072997 3300025925 Bacteria 2584
356 Ga0207650_10571018 3300025925 Bacteria 949
357 Ga0207659_10194783 3300025926 Bacteria 1615
358 Ga0207659_10248543 3300025926 Bacteria 1442
359 Ga0207659_10427521 3300025926 Bacteria 1112
360 Ga0207687_10073143 3300025927 Bacteria 2454
361 Ga0207687_10082073 3300025927 Bacteria 2331
362 Ga0207700_11057627 3300025928 Bacteria 726
363 Ga0207664_10660810 3300025929 Bacteria 939
364 Ga0207664_11041069 3300025929 Bacteria 733
365 Ga0207644_10816364 3300025931 Bacteria 780
366 Ga0207644_11353943 3300025931 Bacteria 598
367 Ga0207690_10226205 3300025932 Bacteria 1434
368 Ga0207690_10701773 3300025932 Bacteria 832
369 Ga0207706_10193394 3300025933 Bacteria 1785
370 Ga0207706_10687813 3300025933 Bacteria 874
371 Ga0207686_10472432 3300025934 Bacteria 968
372 Ga0207686_10507210 3300025934 Bacteria 937
373 Ga0207686_10807081 3300025934 Bacteria 752
374 Ga0207686_11402580 3300025934 Bacteria 575
375 Ga0207709_10427329 3300025935 Bacteria 1019
376 Ga0207709_11354802 3300025935 Bacteria 589
377 Ga0207670_10261065 3300025936 Bacteria 1343
378 Ga0207670_10513944 3300025936 Bacteria 974
379 Ga0207670_10758267 3300025936 Bacteria 806
380 Ga0207670_11510678 3300025936 Bacteria 571
381 Ga0207669_10089327 3300025937 Bacteria 2001
382 Ga0207669_10131129 3300025937 Bacteria 1722
383 Ga0207669_10321847 3300025937 Bacteria 1184
384 Ga0207669_10690468 3300025937 Bacteria 838
385 Ga0207669_11084327 3300025937 Bacteria 675
386 Ga0207669_11085933 3300025937 Bacteria 675
387 Ga0207704_10081617 3300025938 Bacteria 2092
388 Ga0207704_11935384 3300025938 Bacteria 507
389 Ga0207665_10158317 3300025939 Bacteria 1627
390 Ga0207665_11000299 3300025939 Bacteria 665
391 Ga0207691_10000889 3300025940 Bacteria 29629
392 Ga0207691_10211291 3300025940 Bacteria 1685
393 Ga0207691_11454699 3300025940 Bacteria 561
394 Ga0207711_10145410 3300025941 Bacteria 2136
395 Ga0207689_10219148 3300025942 Bacteria 1572
396 Ga0207689_11515400 3300025942 Bacteria 560
397 Ga0207661_12089559 3300025944 Bacteria 512
398 Ga0207679_10467741 3300025945 Bacteria 1120
399 Ga0207679_11072224 3300025945 Bacteria 739
400 Ga0207651_10088947 3300025960 Bacteria 2253
401 Ga0207651_10120816 3300025960 Bacteria 1986
402 Ga0207651_10276221 3300025960 Bacteria 1386
403 Ga0207651_11039147 3300025960 Bacteria 733
404 Ga0207712_10114548 3300025961 Bacteria 2028
405 Ga0207712_10505893 3300025961 Bacteria 1033
406 Ga0207712_10579609 3300025961 Bacteria 968
407 Ga0207668_10130855 3300025972 Bacteria 1916
408 Ga0207668_10177886 3300025972 Bacteria 1675
409 Ga0207668_10807762 3300025972 Bacteria 831
410 Ga0207668_10918208 3300025972 Bacteria 780
411 Ga0207658_10097946 3300025986 Bacteria 2291
412 Ga0207677_10360834 3300026023 Bacteria 1220
413 Ga0207677_10377408 3300026023 Bacteria 1196
414 Ga0207677_10992209 3300026023 Bacteria 761
415 Ga0207677_11141255 3300026023 Bacteria 712
416 Ga0207703_10470694 3300026035 Bacteria 1176
417 Ga0207703_10472201 3300026035 Bacteria 1174
418 Ga0207703_10801611 3300026035 Bacteria 899
419 Ga0207639_10486751 3300026041 Bacteria 1125
420 Ga0207639_11320472 3300026041 Bacteria 677
421 Ga0207639_11752006 3300026041 Bacteria 582
422 Ga0207678_10093158 3300026067 Bacteria 2574
423 Ga0207678_10215433 3300026067 Bacteria 1643
424 Ga0207708_10267660 3300026075 Bacteria 1381
425 Ga0207708_10531335 3300026075 Bacteria 989
426 Ga0207708_10568734 3300026075 Bacteria 957
427 Ga0207708_10630715 3300026075 Bacteria 911
428 Ga0207702_11029361 3300026078 Bacteria 817
429 Ga0207702_11269118 3300026078 Bacteria 731
430 Ga0207641_11200030 3300026088 Bacteria 758
431 Ga0207648_10018063 3300026089 Bacteria 6389
432 Ga0207648_11208915 3300026089 Bacteria 710
433 Ga0207676_10077147 3300026095 Bacteria 2694
434 Ga0207676_10714352 3300026095 Bacteria 972
435 Ga0207674_10030080 3300026116 Bacteria 5713
436 Ga0207674_10472557 3300026116 Bacteria 1212
437 Ga0207675_100087107 3300026118 Bacteria 2933
438 Ga0207675_100204833 3300026118 Bacteria 1896
439 Ga0207675_100423784 3300026118 Bacteria 1315
440 Ga0207675_102506247 3300026118 Bacteria 527
441 Ga0207683_10010378 3300026121 Bacteria 7947
442 Ga0207683_10013613 3300026121 Bacteria 6939
443 Ga0207683_10247194 3300026121 Bacteria 1627
444 Ga0207698_10459905 3300026142 Bacteria 1230
445 Ga0207698_10881938 3300026142 Bacteria 901
446 Ga0207698_12478612 3300026142 Bacteria 529
447 Ga0209813_10161979 3300027866 Bacteria 808
448 Ga0209813_10256961 3300027866 Bacteria 666
449 Ga0207428_10017950 3300027907 Bacteria 6060
450 Ga0207428_10040717 3300027907 Bacteria 3766
451 Ga0207428_10110162 3300027907 Bacteria 2120
452 Ga0268266_10207967 3300028379 Bacteria 1794
453 Ga0268266_10969032 3300028379 Bacteria 823
454 Ga0268266_11661538 3300028379 Bacteria 614
455 Ga0268266_12309932 3300028379 Bacteria 509
456 Ga0268265_10401654 3300028380 Bacteria 1267
457 Ga0268265_11362447 3300028380 Bacteria 711
458 Ga0268265_11911601 3300028380 Bacteria 600
459 Ga0268265_12668205 3300028380 Bacteria 505
460 Ga0268264_10227117 3300028381 Bacteria 1721
461 Ga0268264_10433727 3300028381 Bacteria 1269
462 Ga0307515_10091522 3300028794 Bacteria 3799
463 Ga0265325_10000492 3300031241 Bacteria 28656
464 Ga0265340_10038117 3300031247 Bacteria 2379
465 Ga0265340_10076710 3300031247 Bacteria 1578
466 Ga0265316_10048868 3300031344 Bacteria 3336
467 Ga0265316_10092702 3300031344 Bacteria 2303
468 Ga0307513_10021442 3300031456 Bacteria 7626
469 Ga0307513_10248609 3300031456 Bacteria 1577
470 Ga0307513_10369951 3300031456 Bacteria 1176
471 Ga0307513_10618677 3300031456 Bacteria 791
472 Ga0307509_10815100 3300031507 Bacteria 598
473 Ga0307408_100903089 3300031548 Bacteria 809
474 Ga0265342_10057614 3300031712 Bacteria 2299
475 Ga0307405_11152041 3300031731 Bacteria 669
476 Ga0307405_11411564 3300031731 Bacteria 609
477 Ga0307406_10154832 3300031901 Bacteria 1640
478 Ga0307406_10458211 3300031901 Bacteria 1025
479 Ga0307412_11666693 3300031911 Bacteria 584
480 Ga0307412_11688076 3300031911 Bacteria 580
481 Ga0307412_11793923 3300031911 Bacteria 564
482 Ga0307412_12308429 3300031911 Bacteria 502
483 Ga0307409_100454418 3300031995 Bacteria 1237
484 Ga0307409_100628485 3300031995 Bacteria 1065
485 Ga0307409_101353277 3300031995 Bacteria 738
486 Ga0307416_100733300 3300032002 Bacteria 1080
487 Ga0307411_11355194 3300032005 Bacteria 650
488 Ga0307415_100052547 3300032126 Bacteria 2772
489 Ga0307415_102467610 3300032126 Bacteria 512
490 Ga0373950_0028275 3300034818 Bacteria 1027
491 Ga0373958_0094967 3300034819 Bacteria 692
492 Ga0373928_0012494 3300035084 Bacteria 1694
493 Ga0373928_0242371 3300035084 Unclassified 534
494 Ga0373940_0002719 3300035088 Bacteria 3493
495 Ga0373949_0024472 3300035090 Bacteria 1404
496 Ga0373949_0048777 3300035090 Bacteria 1062
497 Ga0373960_0335040 3300035121 Bacteria 570
498 Ga0373942_0067068 3300035207 Bacteria 1040
499 Ga0316574_0241910 3300035398 Bacteria 1154
500 Ga0373931_0455752 3300035691 Bacteria 819
501 Ga0373931_0612353 3300035691 Bacteria 713
502 Ga0395898_1138396 3300037466 Bacteria 713
503 Ga0395905_0571708 3300037471 Bacteria 1032
504 Ga0237816_08265 3300039145 Bacteria 640
505 Ga0436365_0755682 3300039437 Bacteria 1128
506 Ga0436365_1027753 3300039437 Bacteria 677
507 Ga0436365_1252986 3300039437 Bacteria 961
508 Ga0436365_1289747 3300039437 Bacteria 769
509 Ga0436365_1651064 3300039437 Bacteria 4965
510 Ga0436365_1890676 3300039437 Bacteria 7132
511 Ga0436360_1181788 3300039438 Bacteria 819
512 Ga0436362_0604495 3300039453 Bacteria 1329
513 Ga0439439_0235279 3300041406 Bacteria 540
514 Ga0439453_0016915 3300041408 Bacteria 1276
515 Ga0439453_0027963 3300041408 Bacteria 1053
516 Ga0439453_0039775 3300041408 Bacteria 918
517 Ga0439461_0071616 3300041410 Bacteria 804
518 Ga0451789_0411068 3300041443 Bacteria 1418
519 Ga0451791_0426884 3300041451 Bacteria 524
520 Ga0451797_0687038 3300041453 Bacteria 778
521 Ga0451839_1270928 3300041496 Bacteria 651
522 Ga0451841_0805672 3300041498 Bacteria 661
523 Ga0451843_0255968 3300041509 Bacteria 666
524 Ga0451843_0427283 3300041509 Bacteria 507
525 Ga0451853_3383827 3300041512 Bacteria 572
526 Ga0439441_008039 3300042001 Bacteria 1715
527 Ga0439441_130143 3300042001 Bacteria 582
528 Ga0439443_028971 3300042003 Bacteria 905
529 Ga0439446_0027497 3300042156 Bacteria 1633
530 Ga0439434_0212964 3300042435 Bacteria 654
531 Ga0439435_0019364 3300042436 Bacteria 1743
532 Ga0439444_0016539 3300042437 Bacteria 1258
533 Ga0439464_0056449 3300042439 Bacteria 1144
534 Ga0439440_0027727 3300042993 Bacteria 1318
535 Ga0466967_0234889 3300045976 Bacteria 1747
536 Ga0495603_0281648 3300046455 Bacteria 956
537 Ga0495629_0947594 3300046459 Bacteria 562
538 Ga0495638_0001856 3300046460 Bacteria 18277
539 Ga0495638_0017590 3300046460 Bacteria 4763
540 Ga0495638_0050217 3300046460 Bacteria 2605
541 Ga0495605_0143411 3300046474 Bacteria 1070
542 Ga0495664_0345171 3300046477 Bacteria 897
543 Ga0495584_0489114 3300046491 Bacteria 627
544 Ga0495596_0332611 3300046500 Bacteria 591
545 Ga0495607_0031262 3300046501 Bacteria 3260
546 Ga0495606_0063802 3300046507 Bacteria 2347
547 Ga0495608_0213092 3300046511 Bacteria 1214
548 Ga0495616_0040932 3300046513 Bacteria 2366
549 Ga0495618_0764146 3300046514 Bacteria 565
550 Ga0495620_0129614 3300046515 Bacteria 990
551 Ga0495620_0187261 3300046515 Bacteria 799
552 Ga0495631_0286363 3300046518 Bacteria 701
553 Ga0495632_0500947 3300046519 Bacteria 524
554 Ga0495637_0180815 3300046520 Bacteria 782
555 Ga0495643_0088042 3300046522 Bacteria 1606
556 Ga0495648_0000859 3300046524 Bacteria 32055
557 Ga0495663_0117853 3300046525 Bacteria 887
558 Ga0495654_0456257 3300046530 Bacteria 502
559 Ga0495598_0025940 3300046537 Bacteria 1602
560 Ga0495597_0075048 3300046542 Bacteria 1452
561 Ga0495622_0021150 3300046557 Bacteria 3031
562 Ga0495667_0059393 3300046559 Bacteria 2510
563 Ga0495656_0008096 3300046615 Bacteria 3742
564 Ga0495668_0521141 3300046616 Bacteria 655
565 Ga0495668_0834524 3300046616 Bacteria 511
566 Ga0495611_0220783 3300046648 Bacteria 882
567 Ga0495625_0199459 3300046660 Bacteria 1321
568 Ga0495625_0794855 3300046660 Bacteria 551
569 Ga0495661_0037786 3300046665 Bacteria 3012
570 Ga0495670_0117268 3300046691 Bacteria 1381
571 Ga0495671_0033442 3300046692 Bacteria 2619
572 Ga0495660_0027480 3300046810 Bacteria 3219
573 Ga0495581_0765410 3300047315 Bacteria 555
574 Ga0495636_0142587 3300047318 Bacteria 1071
575 Ga0495672_0075809 3300047320 Bacteria 1890
576 Ga0495673_0215055 3300047469 Bacteria 714
577 Ga0495673_0297914 3300047469 Bacteria 579
578 Ga0495686_0144734 3300047472 Bacteria 1400
579 Ga0495686_0452624 3300047472 Bacteria 682
580 Ga0495615_0120012 3300048090 Bacteria 760
581 Ga0495626_0022268 3300048091 Bacteria 3131
582 Ga0496100_0032369 3300048903 Bacteria 3261
583 Ga0496100_0212125 3300048903 Bacteria 1417
584 Ga0496100_0412854 3300048903 Bacteria 1030
585 Ga0496100_0756373 3300048903 Bacteria 760
586 Ga0496100_1478921 3300048903 Bacteria 536
587 Ga0496101_0379805 3300048904 Bacteria 1112
588 Ga0496101_0702501 3300048904 Unclassified 798
589 Ga0496102_0183530 3300048905 Bacteria 1971
590 Ga0496102_0317457 3300048905 Bacteria 1468
591 Ga0496104_0002236 3300048907 Bacteria 16698
592 Ga0496104_0015358 3300048907 Bacteria 6934
593 Ga0496104_0224291 3300048907 Bacteria 1791
594 Ga0496105_0007126 3300048908 Bacteria 8625
595 Ga0496105_0087197 3300048908 Bacteria 2579
596 Ga0496106_0063854 3300048909 Bacteria 2800
597 Ga0496106_0316621 3300048909 Bacteria 1252
598 Ga0496106_1517416 3300048909 Bacteria 515
599 Ga0496107_0095771 3300048910 Bacteria 2172
600 Ga0496107_0617356 3300048910 Bacteria 801
601 Ga0496108_0106953 3300048911 Bacteria 2389
602 Ga0496108_0259668 3300048911 Bacteria 1512
603 Ga0496109_0109600 3300048912 Bacteria 2567
604 Ga0496109_0375569 3300048912 Bacteria 1343
605 Ga0496109_0592422 3300048912 Bacteria 1045
606 Ga0496110_0395208 3300048913 Bacteria 1260
607 Ga0496110_0621744 3300048913 Bacteria 979
608 Ga0496110_0638454 3300048913 Bacteria 964
609 Ga0496110_1517974 3300048913 Bacteria 580
610 Ga0496112_0231140 3300048915 Bacteria 1804
611 Ga0496112_0356470 3300048915 Bacteria 1405
612 Ga0496112_1385053 3300048915 Bacteria 618
613 Ga0496112_1872157 3300048915 Bacteria 511
614 Ga0496113_0148934 3300048916 Bacteria 1845
615 Ga0496113_0319178 3300048916 Bacteria 1245
616 Ga0496114_0044139 3300048917 Bacteria 3698
617 Ga0496114_0830785 3300048917 Bacteria 803
618 Ga0496114_1328837 3300048917 Bacteria 606
619 Ga0496114_1583171 3300048917 Bacteria 543
620 Ga0496115_0010124 3300048918 Bacteria 7034
621 Ga0496115_0042092 3300048918 Bacteria 3638
622 Ga0496115_0164982 3300048918 Bacteria 1832
623 Ga0496116_0023936 3300048919 Bacteria 4531
624 Ga0496117_0102747 3300048920 Bacteria 1803
625 Ga0496118_0136476 3300048921 Bacteria 1564
626 Ga0496119_0057075 3300048922 Bacteria 2362
627 Ga0496120_0066692 3300048923 Bacteria 1990
628 Ga0496121_0001090 3300048924 Bacteria 47969
629 Ga0496121_0026263 3300048924 Bacteria 5493
630 Ga0496121_0150509 3300048924 Bacteria 1713
631 Ga0496122_0007688 3300048925 Bacteria 11882
632 Ga0496122_0543093 3300048925 Bacteria 555
633 Ga0496123_0186955 3300048926 Bacteria 1075
634 Ga0496123_0276748 3300048926 Bacteria 813
635 Ga0496124_0335945 3300048927 Bacteria 1075
636 Ga0496124_0639814 3300048927 Bacteria 685
637 Ga0496124_0893368 3300048927 Bacteria 540
638 Ga0496125_0000252 3300048928 Bacteria 109988
639 Ga0496125_0000566 3300048928 Bacteria 63595
640 Ga0496125_0001454 3300048928 Bacteria 34388
641 Ga0496125_0143619 3300048928 Bacteria 1654
642 Ga0496126_0072197 3300048929 Bacteria 3070
643 Ga0496126_0074628 3300048929 Bacteria 3011
644 Ga0496126_0293370 3300048929 Bacteria 1344
645 Ga0495678_050712 3300049459 Bacteria 1607
646 Ga0501031_0213233 3300049568 Bacteria 1258
647 Ga0501031_0350544 3300049568 Bacteria 956
648 Ga0501032_0022475 3300049569 Bacteria 4370
649 Ga0501032_0362429 3300049569 Bacteria 933
650 Ga0501032_0971569 3300049569 Bacteria 534
651 Ga0501033_0034246 3300049570 Bacteria 3811
652 Ga0501033_0051505 3300049570 Bacteria 3051
653 Ga0501033_0229197 3300049570 Bacteria 1320
654 Ga0501033_0266530 3300049570 Bacteria 1211
655 Ga0501033_0766753 3300049570 Unclassified 654
656 Ga0501034_0091478 3300049571 Bacteria 3040
657 Ga0501034_0187416 3300049571 Bacteria 2032
658 Ga0501034_0189550 3300049571 Bacteria 2019
659 Ga0501034_0219409 3300049571 Bacteria 1854
660 Ga0501034_0229221 3300049571 Bacteria 1807
661 Ga0501034_0679670 3300049571 Bacteria 929
662 Ga0501036_0072422 3300049572 Bacteria 2912
663 Ga0501036_0203548 3300049572 Bacteria 1665
664 Ga0501036_0420616 3300049572 Bacteria 1114
665 Ga0501036_0449920 3300049572 Bacteria 1073
666 Ga0501036_1341745 3300049572 Bacteria 581
667 Ga0501036_1364045 3300049572 Bacteria 575
668 Ga0501036_1644588 3300049572 Bacteria 518
669 Ga0501037_0003013 3300049573 Bacteria 12234
670 Ga0501037_0298615 3300049573 Bacteria 1119
671 Ga0501037_0490042 3300049573 Bacteria 835
672 Ga0501038_0040986 3300049574 Bacteria 4040
673 Ga0501038_0123626 3300049574 Bacteria 2131
674 Ga0501038_0530526 3300049574 Bacteria 897
675 Ga0501038_1235850 3300049574 Unclassified 541
676 Ga0501038_1262943 3300049574 Bacteria 534
677 Ga0501039_0012604 3300049575 Bacteria 6461
678 Ga0501039_0093853 3300049575 Bacteria 2339
679 Ga0501039_0165302 3300049575 Bacteria 1740
680 Ga0501040_0411503 3300049576 Bacteria 972
681 Ga0501040_1164593 3300049576 Bacteria 559
682 Ga0501041_0401512 3300049577 Bacteria 868
683 Ga0501041_0638323 3300049577 Bacteria 680
684 Ga0501042_0045932 3300049578 Bacteria 3113
685 Ga0501042_0167681 3300049578 Bacteria 1584
686 Ga0501043_0132534 3300049579 Bacteria 1953
687 Ga0501043_0190807 3300049579 Bacteria 1593
688 Ga0501043_0255513 3300049579 Bacteria 1349
689 Ga0501043_0621027 3300049579 Bacteria 796
690 Ga0501046_0035916 3300049580 Bacteria 3991
691 Ga0501046_0073172 3300049580 Bacteria 2660
692 Ga0501046_0096383 3300049580 Bacteria 2272
693 Ga0501046_0998962 3300049580 Unclassified 581
694 Ga0501047_0136974 3300049581 Bacteria 2328
695 Ga0501047_0162134 3300049581 Bacteria 2107
696 Ga0501047_0353517 3300049581 Bacteria 1306
697 Ga0501047_0394931 3300049581 Bacteria 1216
698 Ga0501047_1132811 3300049581 Bacteria 596
699 Ga0501048_0020394 3300049582 Bacteria 4857
700 Ga0501048_0146814 3300049582 Bacteria 1668
701 Ga0501048_0592618 3300049582 Bacteria 796
702 Ga0501067_0036698 3300049583 Bacteria 2721
703 Ga0501067_0056276 3300049583 Bacteria 2179
704 Ga0501067_0111752 3300049583 Bacteria 1519
705 Ga0501068_0151513 3300049584 Bacteria 1457
706 Ga0501069_0112454 3300049585 Bacteria 1551
707 Ga0501070_0009260 3300049586 Bacteria 8330
708 Ga0501070_0172082 3300049586 Bacteria 1783
709 Ga0501070_0793749 3300049586 Bacteria 744
710 Ga0501071_0078678 3300049587 Bacteria 2410
711 Ga0501071_0116039 3300049587 Bacteria 1982
712 Ga0501071_0188311 3300049587 Bacteria 1547
713 Ga0501071_0627853 3300049587 Bacteria 826
714 Ga0501071_1125318 3300049587 Bacteria 607
715 Ga0501072_0005240 3300049588 Bacteria 9870
716 Ga0501072_0192649 3300049588 Bacteria 1626
717 Ga0501072_0514449 3300049588 Bacteria 946
718 Ga0501073_0029808 3300049589 Bacteria 3898
719 Ga0501073_0282529 3300049589 Bacteria 1145
720 Ga0501073_0591350 3300049589 Bacteria 767
721 Ga0501074_0155885 3300049590 Bacteria 1631
722 Ga0501074_0678135 3300049590 Bacteria 728
723 Ga0501075_0165221 3300049591 Bacteria 1689
724 Ga0501075_0417884 3300049591 Bacteria 1022
725 Ga0501075_0536198 3300049591 Bacteria 893
726 Ga0501075_0909463 3300049591 Bacteria 669
727 Ga0501076_0157801 3300049592 Bacteria 1847
728 Ga0501076_0222639 3300049592 Bacteria 1542
729 Ga0501076_0226131 3300049592 Bacteria 1529
730 Ga0501076_1355418 3300049592 Bacteria 585
731 Ga0501077_0092185 3300049593 Bacteria 1920
732 Ga0501077_0654797 3300049593 Bacteria 675
733 Ga0501077_0678480 3300049593 Bacteria 662
734 Ga0501077_1005037 3300049593 Bacteria 537
735 Ga0501077_1120002 3300049593 Bacteria 507
736 Ga0501079_0052864 3300049741 Bacteria 3134
737 Ga0501079_0208242 3300049741 Bacteria 1527
738 Ga0501079_0510527 3300049741 Bacteria 945
739 Ga0501079_0665487 3300049741 Bacteria 820
740 Ga0501080_0020013 3300049742 Bacteria 6195
741 Ga0501080_0073111 3300049742 Bacteria 3190
742 Ga0501080_0108802 3300049742 Bacteria 2569
743 Ga0501080_0230623 3300049742 Bacteria 1692
744 Ga0501080_0479701 3300049742 Bacteria 1113
745 Ga0501080_0815371 3300049742 Bacteria 818
746 Ga0501080_1644127 3300049742 Bacteria 543
747 Ga0501081_0140554 3300049743 Bacteria 1730
748 Ga0501081_0264421 3300049743 Bacteria 1257
749 Ga0501081_0314230 3300049743 Bacteria 1151
750 Ga0501081_0704708 3300049743 Bacteria 758
751 Ga0501081_1121583 3300049743 Bacteria 595
752 Ga0501081_1520025 3300049743 Bacteria 509
753 Ga0501083_0017239 3300049744 Bacteria 5035
754 Ga0501083_0098118 3300049744 Bacteria 1933
755 Ga0501035_0019125 3300049822 Bacteria 6305
756 Ga0501035_0280386 3300049822 Bacteria 1408
757 Ga0501035_0507264 3300049822 Bacteria 992
758 Ga0501035_0809646 3300049822 Bacteria 748
759 Ga0501044_0000140 3300049823 Bacteria 88672
760 Ga0501044_0075920 3300049823 Bacteria 3412
761 Ga0501044_0140214 3300049823 Bacteria 2406
762 Ga0501044_0497508 3300049823 Bacteria 1121
763 Ga0501044_0644155 3300049823 Bacteria 949
764 Ga0501044_0846933 3300049823 Bacteria 791
765 Ga0501044_1344427 3300049823 Bacteria 580
766 Ga0501045_0022475 3300049824 Bacteria 4517
767 Ga0501045_0371757 3300049824 Bacteria 1064
768 Ga0501045_0528106 3300049824 Bacteria 876
769 nmdc:mga03683_100192_c1 3300050489 Bacteria 820
770 nmdc:mga03683_220442_c1 3300050489 Bacteria 875
771 nmdc:mga03683_589135_c1 3300050489 Bacteria 544
772 nmdc:mga03683_82153_c1 3300050489 Bacteria 1048
773 nmdc:mga03n38_140041_c1 3300050490 Bacteria 1207
774 nmdc:mga03n38_202881_c1 3300050490 Bacteria 1027
775 nmdc:mga03n38_36002_c1 3300050490 Bacteria 2125
776 nmdc:mga03n38_525051_c1 3300050490 Bacteria 667
777 nmdc:mga03n38_571265_c1 3300050490 Bacteria 641
778 nmdc:mga00v17_19035_c1 3300050491 Bacteria 3912
779 nmdc:mga00v17_206029_c1 3300050491 Bacteria 1272
780 nmdc:mga0yw44_10125_c1 3300050492 Bacteria 4803
781 nmdc:mga0yw44_475714_c1 3300050492 Bacteria 847
782 nmdc:mga0yw44_504944_c1 3300050492 Bacteria 821
783 nmdc:mga0yw44_524966_c1 3300050492 Bacteria 804
784 nmdc:mga0k408_244099_c1 3300050493 Bacteria 1072
785 nmdc:mga0k408_275244_c1 3300050493 Bacteria 1005
786 nmdc:mga0k408_279892_c1 3300050493 Bacteria 996
787 nmdc:mga0k408_323835_c1 3300050493 Bacteria 920
788 nmdc:mga0k408_378226_c1 3300050493 Unclassified 504
789 nmdc:mga0k408_408468_c1 3300050493 Bacteria 808
790 nmdc:mga0k408_49335_c1 3300050493 Bacteria 2436
791 nmdc:mga0k408_578242_c1 3300050493 Bacteria 663
792 nmdc:mga06z11_138845_c1 3300050494 Bacteria 1372
793 nmdc:mga06z11_25779_c1 3300050494 Bacteria 2790
794 nmdc:mga06z11_2909_c1 3300050494 Bacteria 6586
795 nmdc:mga06z11_297300_c1 3300050494 Bacteria 959
796 nmdc:mga06z11_31578_c1 3300050494 Bacteria 2575
797 nmdc:mga06z11_39657_c1 3300050494 Bacteria 2345
798 nmdc:mga06z11_864954_c1 3300050494 Bacteria 551
799 nmdc:mga07m45_33970_c1 3300050496 Bacteria 1911
800 nmdc:mga07m45_404620_c1 3300050496 Bacteria 792
801 nmdc:mga07m45_735512_c1 3300050496 Bacteria 567
802 nmdc:mga05p37_457236_c1 3300050507 Bacteria 1476
803 nmdc:mga05p37_487479_c1 3300050507 Bacteria 1418
804 nmdc:mga05p37_609342_c1 3300050507 Bacteria 1231
805 nmdc:mga05p37_842213_c1 3300050507 Bacteria 997
806 nmdc:mga09592_1015526_c1 3300050508 Bacteria 693
807 nmdc:mga09592_1416295_c1 3300050508 Unclassified 568
808 nmdc:mga09592_1441015_c1 3300050508 Bacteria 562
809 nmdc:mga09592_382835_c1 3300050508 Bacteria 1216
810 nmdc:mga0qj67_291231_c1 3300050509 Bacteria 1323
811 nmdc:mga0qj67_688613_c1 3300050509 Bacteria 814
812 nmdc:mga0qj67_845669_c1 3300050509 Bacteria 723
813 nmdc:mga0qj67_877448_c1 3300050509 Bacteria 708
814 nmdc:mga06r32_300842_c1 3300050510 Bacteria 1590
815 nmdc:mga06r32_43346_c1 3300050510 Bacteria 4281
816 nmdc:mga06r32_537571_c1 3300050510 Bacteria 1144
817 nmdc:mga08y16_1308470_c1 3300050511 Bacteria 691
818 nmdc:mga08y16_161308_c1 3300050511 Bacteria 2330
819 nmdc:mga08y16_597145_c1 3300050511 Bacteria 1113
820 nmdc:mga08y16_63829_c1 3300050511 Bacteria 3847
821 nmdc:mga08y16_700921_c1 3300050511 Bacteria 1012
822 nmdc:mga0n895_1633_c1 3300050512 Bacteria 16940
823 nmdc:mga0a205_155568_c2 3300050515 Bacteria 1651
824 nmdc:mga0sz30_15111_c1 3300050516 Bacteria 3049
825 nmdc:mga0sz30_336856_c1 3300050516 Bacteria 674
826 nmdc:mga0sz30_51680_c1 3300050516 Bacteria 1744
827 Ga0500610_0280170 3300053079 Bacteria 748
828 Ga0500578_0160559 3300053086 Bacteria 1395
829 Ga0500643_027127 3300053087 Bacteria 1784
830 Ga0500644_0048130 3300053088 Bacteria 1449
831 Ga0500646_0016648 3300053090 Bacteria 1921
832 Ga0500651_0021060 3300053093 Bacteria 4063
833 Ga0500651_0026933 3300053093 Bacteria 3614
834 Ga0500566_0004029 3300053094 Bacteria 8763
835 Ga0500641_0002417 3300053096 Bacteria 6629
836 Ga0500641_0026924 3300053096 Bacteria 2236
837 Ga0500641_0293434 3300053096 Bacteria 670
838 Ga0500650_0000130 3300053098 Bacteria 19817
839 Ga0500650_0182263 3300053098 Bacteria 962
840 Ga0500556_0000066 3300053104 Bacteria 105850
841 Ga0500562_037640 3300053108 Bacteria 1284
842 Ga0500562_044858 3300053108 Bacteria 1178
843 Ga0500592_002474 3300053116 Bacteria 2977
844 Ga0500593_014188 3300053117 Bacteria 3413
845 Ga0500595_001089 3300053119 Bacteria 15076
846 Ga0500595_003717 3300053119 Bacteria 7039
847 Ga0500595_013828 3300053119 Bacteria 3081
848 Ga0500595_043501 3300053119 Bacteria 1429
849 Ga0500607_071651 3300053121 Bacteria 1788
850 Ga0500608_131224 3300053122 Bacteria 1123
851 Ga0500608_237218 3300053122 Bacteria 722
852 Ga0500608_277028 3300053122 Bacteria 637
853 Ga0500618_048912 3300053125 Bacteria 960
854 Ga0500642_0000072 3300053130 Bacteria 55645
855 Ga0500642_0107110 3300053130 Bacteria 1303
856 Ga0500642_0169441 3300053130 Bacteria 1022
857 Ga0500652_001780 3300053131 Bacteria 6527
858 Ga0500652_144336 3300053131 Bacteria 990
859 Ga0500559_0000413 3300053136 Bacteria 30711
860 Ga0500568_0000453 3300053139 Bacteria 30769
861 Ga0500568_0049035 3300053139 Bacteria 1667
862 Ga0500568_0174483 3300053139 Bacteria 791
863 Ga0500577_0521560 3300053142 Bacteria 519
864 Ga0500586_003954 3300053145 Bacteria 3566
865 Ga0500588_0301048 3300053146 Bacteria 607
866 Ga0500604_0027191 3300053151 Bacteria 1653
867 Ga0500604_0069710 3300053151 Bacteria 1119
868 Ga0500616_0000028 3300053153 Bacteria 435722
869 Ga0500616_0000177 3300053153 Bacteria 106498
870 Ga0500616_0068500 3300053153 Bacteria 1817
871 Ga0500616_0073614 3300053153 Bacteria 1734
872 Ga0500616_0129623 3300053153 Bacteria 1193
873 Ga0500622_0000223 3300053156 Bacteria 59337
874 Ga0500622_0061020 3300053156 Bacteria 1923
875 Ga0500627_0081998 3300053158 Bacteria 1439
876 Ga0500627_0197702 3300053158 Bacteria 901
877 Ga0500627_0249491 3300053158 Bacteria 786
878 Ga0500627_0509135 3300053158 Bacteria 500
879 Ga0500633_0041592 3300053160 Bacteria 1547
880 Ga0500636_0003274 3300053177 Bacteria 9079
881 Ga0500636_0021225 3300053177 Bacteria 3845
882 Ga0500637_0459932 3300053178 Bacteria 643
883 Ga0500609_024560 3300053731 Bacteria 826
884 Ga0500596_065139 3300053735 Bacteria 615
885 Ga0501084_0066185 3300054114 Bacteria 3023
886 Ga0501084_0172032 3300054114 Bacteria 1828
887 Ga0501084_0223698 3300054114 Bacteria 1588
888 Ga0501084_0467581 3300054114 Bacteria 1066
889 Ga0501084_0480142 3300054114 Bacteria 1051
890 Ga0501084_1145262 3300054114 Bacteria 653
891 Ga0501082_0000025 3300060353 Bacteria 103262
892 Ga0501082_0098054 3300060353 Bacteria 2534
893 Ga0501082_0102805 3300060353 Bacteria 2472
894 Ga0501082_0111040 3300060353 Bacteria 2373
895 Ga0501082_0357520 3300060353 Bacteria 1274
896 Ga0501082_0416113 3300060353 Bacteria 1174
897 Ga0501082_1068369 3300060353 Bacteria 706
898 Ga0501082_1833241 3300060353 Bacteria 529
899 Ga0530510_0102300 3300061734 Bacteria 2095
900 Ga0530510_0155140 3300061734 Bacteria 1692
901 Ga0530510_0393853 3300061734 Bacteria 1043
902 2508697539 2508501042 Bacteria 8719808
903 2513878874 2513237139 Bacteria 8737671
904 2514009841 2513237161 Bacteria 8871253
905 2524440266 2524023205 Bacteria 8918781
906 2603856983 2602042107 Bacteria 6226103
907 2644291143 2643221651 Bacteria 4798932
908 2644745783 2643221736 Bacteria 6608466
909 2745075417 2744054633 Bacteria 8678936
910 2793060624 2791355196 Bacteria 7323613
911 2805918268 2802429603 Bacteria 8777136
912 2824673013 2824671348 Bacteria 8369588
913 2824693792 2824687955 Bacteria 8360029
914 2824702645 2824696289 Bacteria 8335049
915 2824780907 2824773399 Bacteria 8360218
916 2828307058 2828305725 Bacteria 4916900
917 2838123077 2838122688 Bacteria 8803140
918 2841765849 2841760612 Bacteria 6454112
919 2841948142 2841941048 Bacteria 8688029
920 2841954405 2841949485 Bacteria 8680857
921 2841969793 2841966195 Bacteria 8673214
922 2841978775 2841974524 Bacteria 8931498
923 2841984098 2841983080 Bacteria 8395090
924 2842038121 2842038055 Bacteria 8002051
925 2842048933 2842045827 Bacteria 8006841
926 2844107459 2844104063 Bacteria 6440972
927 2847947302 2847939898 Bacteria 8606328
928 2851187752 2851182111 Bacteria 6047226
929 2851249499 2851246043 Bacteria 6439203
930 2857528659 2857524615 Bacteria 6615449
931 2874623081 2874620515 Bacteria 8290088
932 2893066181 2893066018 Bacteria 6158120
933 2904669901 2904666416 Bacteria 8226587
934 2906615709
935 2908741299 2908739725 Bacteria 8628932
936 2919076029 2919073203 Bacteria 6531949
937 2935988830 2935984226 Bacteria 8302647
938 8057531922 8057529695 Bacteria 6306553
939 Ga0501034_1259757
940 2214578602
941 JGI25406J46586_10155184
942 JGI25407J50210_10152214
943 JGI25404J52841_10016298
944 JGI25404J52841_10030164
945 Ga0065165_1000209
946 Ga0065712_10041572
947 Ga0065712_10109852
948 Ga0065715_10149271
949 Ga0065715_10473769
950 Ga0065715_11108973
951 Ga0065707_10353061
952 Ga0065707_10915669
953 Ga0070658_10051167
954 Ga0070676_10082647
955 Ga0070676_10588801
956 Ga0070670_100691710
957 Ga0070677_10005339
958 Ga0068869_100418842
959 Ga0070666_10457265
960 Ga0070666_10516274
961 Ga0070680_100013998
962 Ga0070680_100776942
963 Ga0070682_101010531
964 Ga0070682_101980250
965 Ga0068868_100436736
966 Ga0068868_100536470
967 Ga0068868_101075155
968 Ga0068868_101098853
969 Ga0070660_100068441
970 Ga0070689_101600186
971 Ga0070689_101641183
972 Ga0070691_10038192
973 Ga0070691_10278604
974 Ga0070687_100192906
975 Ga0070687_100241285
976 Ga0070661_100132513
977 Ga0070692_10877072
978 Ga0070692_10927052
979 Ga0070668_100046891
980 Ga0070668_100156589
981 Ga0070668_100453176
982 Ga0070668_100750281
983 Ga0070668_101945558
984 Ga0070669_100154343
985 Ga0070669_101234906
986 Ga0070669_101311396
987 Ga0070675_100053020
988 Ga0070675_100399015
989 Ga0070675_100912966
990 Ga0070675_101484049
991 Ga0070671_100042683
992 Ga0070671_100364071
993 Ga0070671_100920699
994 Ga0070671_100932751
995 Ga0070674_100049857
996 Ga0070674_100118576
997 Ga0070674_100972696
998 Ga0070674_101199435
999 Ga0070673_100071920
1000 Ga0070673_100207545
1001 Ga0070673_100368452
1002 Ga0070688_100766106
1003 Ga0070688_101651374
1004 Ga0070688_101800320
1005 Ga0070659_100892224
1006 Ga0070659_101368238
1007 Ga0070667_100271139
1008 Ga0070667_100985939
1009 Ga0070667_101423708
1010 Ga0070709_11087828
1011 Ga0070714_100424389
1012 Ga0070713_100865579
1013 Ga0070701_11249118
1014 Ga0070705_100242665
1015 Ga0070705_101889051
1016 Ga0070700_100258480
1017 Ga0070700_100855913
1018 Ga0070700_100892536
1019 Ga0070700_101245636
1020 Ga0070663_100036370
1021 Ga0070678_100151387
1022 Ga0070678_100317943
1023 Ga0070678_100494993
1024 Ga0070662_100024505
1025 Ga0070662_101024112
1026 Ga0070662_101458471
1027 Ga0070681_10411752
1028 Ga0070681_11137461
1029 Ga0068867_100180068
1030 Ga0068867_100980316
1031 Ga0068867_101603280
1032 Ga0070685_10099508
1033 Ga0070698_101769061
1034 Ga0070679_100039578
1035 Ga0070679_100439501
1036 Ga0070684_101917378
1037 Ga0068853_100238749
1038 Ga0068853_100924617
1039 Ga0068853_102303650
1040 Ga0070672_100575537
1041 Ga0070672_100968129
1042 Ga0070672_101050852
1043 Ga0070672_101122515
1044 Ga0070686_100402150
1045 Ga0070686_101134246
1046 Ga0070695_101224100
1047 Ga0070693_100164029
1048 Ga0070665_100542628
1049 Ga0070664_100954992
1050 Ga0068857_100276960
1051 Ga0068857_102025324
1052 Ga0068854_100609290
1053 Ga0068854_102071140
1054 Ga0068856_100813319
1055 Ga0068852_100914230
1056 Ga0068859_100207856
1057 Ga0068859_100244509
1058 Ga0068859_101182952
1059 Ga0068864_100080657
1060 Ga0068864_100869790
1061 Ga0068861_100306416
1062 Ga0068861_100975804
1063 Ga0068861_101336858
1064 Ga0068861_101535742
1065 Ga0068861_102016707
1066 Ga0068870_10264555
1067 Ga0068870_10644837
1068 Ga0068863_100937727
1069 Ga0068858_100110809
1070 Ga0068860_102644452
1071 Ga0068862_100019045
1072 Ga0068862_101791972
1073 Ga0081455_10000196
1074 Ga0081455_10030097
1075 Ga0081455_10288312
1076 Ga0081455_10467233
1077 Ga0081455_10767238
1078 Ga0081455_10770091
1079 Ga0081538_10010509
1080 Ga0081538_10026508
1081 Ga0081538_10066481
1082 Ga0081538_10152432
1083 Ga0081538_10336367
1084 Ga0081540_1000045
1085 Ga0081540_1000293
1086 Ga0081540_1005974
1087 Ga0081540_1041402
1088 Ga0081540_1259249
1089 Ga0081539_10002257
1090 Ga0081539_10005839
1091 Ga0081539_10015916
1092 Ga0081539_10043106
1093 Ga0081539_10421400
1094 Ga0070717_11889230
1095 Ga0075365_10004179
1096 Ga0075365_10225049
1097 Ga0075365_10963058
1098 Ga0075365_11144497
1099 Ga0075368_10002447
1100 Ga0075368_10044175
1101 Ga0075368_10104614
1102 Ga0075368_10475193
1103 Ga0075363_100047388
1104 Ga0075363_100101691
1105 Ga0075363_100251267
1106 Ga0075363_100540210
1107 Ga0075364_10021661
1108 Ga0075364_10155242
1109 Ga0075364_10486711
1110 Ga0075364_10954163
1111 Ga0070715_10573342
1112 Ga0075362_10103278
1113 Ga0075362_10190721
1114 Ga0075362_10193124
1115 Ga0075362_10207732
1116 Ga0075362_10317903
1117 Ga0075362_10323043
1118 Ga0075367_10037371
1119 Ga0075367_10097412
1120 Ga0075367_10104264
1121 Ga0075367_10425883
1122 Ga0075369_10022004
1123 Ga0075369_10029118
1124 Ga0075369_10310598
1125 Ga0075369_10495105
1126 Ga0075366_10003832
1127 Ga0075366_10191871
1128 Ga0075366_10223416
1129 Ga0075366_10702648
1130 Ga0075366_10802218
1131 Ga0075366_10980056
1132 Ga0097621_100760050
1133 Ga0075370_10111276
1134 Ga0075370_10227312
1135 Ga0075370_10428665
1136 Ga0075428_100118754
1137 Ga0075428_100179086
1138 Ga0075428_100182655
1139 Ga0075428_100302389
1140 Ga0075428_100464305
1141 Ga0075428_100595785
1142 Ga0075428_101349636
1143 Ga0075428_101878361
1144 Ga0075428_102042025
1145 Ga0075430_100315400
1146 Ga0075430_100635753
1147 Ga0075430_100733528
1148 Ga0075430_101796853
1149 Ga0075431_100217230
1150 Ga0075431_100259704
1151 Ga0075431_101929329
1152 Ga0075433_10000349
1153 Ga0075433_10237570
1154 Ga0075434_100002239
1155 Ga0075434_100825207
1156 Ga0075429_100367620
1157 Ga0068865_100068815
1158 Ga0097620_100207870
1159 Ga0097620_100244532
1160 Ga0097620_101183088
1161 Ga0105240_11836601
1162 Ga0111539_10012734
1163 Ga0111539_10021737
1164 Ga0111539_10772926
1165 Ga0111539_10905049
1166 Ga0111539_11106387
1167 Ga0111539_11179906
1168 Ga0111539_11249317
1169 Ga0105245_10089093
1170 Ga0105245_12678660
1171 Ga0105247_10106654
1172 Ga0105247_10637354
1173 Ga0105247_11092863
1174 Ga0114129_10050036
1175 Ga0114129_10176057
1176 Ga0114129_10348670
1177 Ga0114129_10532367
1178 Ga0114129_10739919
1179 Ga0114129_11938248
1180 Ga0114129_11952726
1181 Ga0105243_10120148
1182 Ga0105243_10538936
1183 Ga0105243_11419579
1184 Ga0105243_12048742
1185 Ga0105243_12330739
1186 Ga0105241_10773668
1187 Ga0105242_10028530
1188 Ga0105242_10126286
1189 Ga0105242_10915164
1190 Ga0105242_13081227
1191 Ga0105248_12284510
1192 Ga0105237_11122493
1193 Ga0105238_10052564
1194 Ga0105238_12076525
1195 Ga0105238_12816528
1196 Ga0105249_10325553
1197 Ga0105249_10427743
1198 Ga0105249_11156726
1199 Ga0105249_12103459
1200 Ga0105249_12963999
1201 Ga0105033_127389
1202 Ga0105239_11371255
1203 Ga0105239_11511145
1204 Ga0105239_12711056
1205 Ga0105246_10503784
1206 Ga0105246_10574124
1207 Ga0105246_11068936
1208 Ga0105246_11204281
1209 Ga0171462_1019
1210 Ga0157374_11751972
1211 Ga0157378_10652755
1212 Ga0157378_10719677
1213 Ga0157378_11053755
1214 Ga0157378_11626389
1215 Ga0157378_11969916
1216 Ga0163162_10264081
1217 Ga0163162_11388182
1218 Ga0163162_11589783
1219 Ga0157372_10265167
1220 Ga0157375_10095534
1221 Ga0157375_10613731
1222 Ga0157375_11647247
1223 Ga0157375_12373474
1224 Ga0163163_10274635
1225 Ga0163163_10376107
1226 Ga0163163_11554449
1227 Ga0163163_11737403
1228 Ga0163163_12943638
1229 Ga0157380_10182965
1230 Ga0157380_10233581
1231 Ga0157380_10238944
1232 Ga0157380_10354008
1233 Ga0157380_10399625
1234 Ga0157380_10560860
1235 Ga0157380_11121781
1236 Ga0157380_11350319
1237 Ga0157377_10568648
1238 Ga0157379_10257636
1239 Ga0157379_10689022
1240 Ga0157379_10767813
1241 Ga0157379_11487286
1242 Ga0157379_12214182
1243 Ga0157376_10218970
1244 Ga0157376_10528577
1245 Ga0163161_10239411
1246 Ga0163161_10556768
1247 Ga0163161_10787817
1248 Ga0163161_11150669
1249 Ga0163161_11363935
1250 Ga0163161_11417323
1251 Ga0213873_10151259
1252 Ga0213876_10016344
1253 Ga0209563_111903
1254 Ga0209130_1000902
1255 Ga0209025_1002026
1256 Ga0209564_1018758
1257 Ga0209758_1000217
1258 Ga0209758_1011197
1259 Ga0209758_1056197
1260 Ga0207426_1011624
1261 Ga0207697_10068546
1262 Ga0207697_10519618
1263 Ga0207682_10004236
1264 Ga0207688_10108544
1265 Ga0207688_10238838
1266 Ga0207688_10274329
1267 Ga0207688_10381604
1268 Ga0207680_10747833
1269 Ga0207680_10763552
1270 Ga0207647_10499691
1271 Ga0207685_10036835
1272 Ga0207645_10158842
1273 Ga0207645_10902106
1274 Ga0207643_10031625
1275 Ga0207643_10052375
1276 Ga0207705_10197107
1277 Ga0207705_10446602
1278 Ga0207707_11115763
1279 Ga0207671_10909534
1280 Ga0207693_10479360
1281 Ga0207660_10033192
1282 Ga0207660_10159978
1283 Ga0207660_10526299
1284 Ga0207662_10789813
1285 Ga0207657_10036283
1286 Ga0207649_10812100
1287 Ga0207649_10879712
1288 Ga0207652_10087919
1289 Ga0207652_11013140
1290 Ga0207681_10504468
1291 Ga0207694_10034613
1292 Ga0207694_10785825
1293 Ga0207650_10072997
1294 Ga0207650_10571018
1295 Ga0207659_10194783
1296 Ga0207659_10248543
1297 Ga0207659_10427521
1298 Ga0207687_10073143
1299 Ga0207687_10082073
1300 Ga0207700_11057627
1301 Ga0207664_10660810
1302 Ga0207664_11041069
1303 Ga0207644_10816364
1304 Ga0207644_11353943
1305 Ga0207690_10226205
1306 Ga0207690_10701773
1307 Ga0207706_10193394
1308 Ga0207706_10687813
1309 Ga0207686_10472432
1310 Ga0207686_10507210
1311 Ga0207686_10807081
1312 Ga0207686_11402580
1313 Ga0207709_10427329
1314 Ga0207709_11354802
1315 Ga0207670_10261065
1316 Ga0207670_10513944
1317 Ga0207670_10758267
1318 Ga0207670_11510678
1319 Ga0207669_10089327
1320 Ga0207669_10131129
1321 Ga0207669_10321847
1322 Ga0207669_10690468
1323 Ga0207669_11084327
1324 Ga0207669_11085933
1325 Ga0207704_10081617
1326 Ga0207704_11935384
1327 Ga0207665_10158317
1328 Ga0207665_11000299
1329 Ga0207691_10000889
1330 Ga0207691_10211291
1331 Ga0207691_11454699
1332 Ga0207711_10145410
1333 Ga0207689_10219148
1334 Ga0207689_11515400
1335 Ga0207661_12089559
1336 Ga0207679_10467741
1337 Ga0207679_11072224
1338 Ga0207651_10088947
1339 Ga0207651_10120816
1340 Ga0207651_10276221
1341 Ga0207651_11039147
1342 Ga0207712_10114548
1343 Ga0207712_10505893
1344 Ga0207712_10579609
1345 Ga0207668_10130855
1346 Ga0207668_10177886
1347 Ga0207668_10807762
1348 Ga0207668_10918208
1349 Ga0207658_10097946
1350 Ga0207677_10360834
1351 Ga0207677_10377408
1352 Ga0207677_10992209
1353 Ga0207677_11141255
1354 Ga0207703_10470694
1355 Ga0207703_10472201
1356 Ga0207703_10801611
1357 Ga0207639_10486751
1358 Ga0207639_11320472
1359 Ga0207639_11752006
1360 Ga0207678_10093158
1361 Ga0207678_10215433
1362 Ga0207708_10267660
1363 Ga0207708_10531335
1364 Ga0207708_10568734
1365 Ga0207708_10630715
1366 Ga0207702_11029361
1367 Ga0207702_11269118
1368 Ga0207641_11200030
1369 Ga0207648_10018063
1370 Ga0207648_11208915
1371 Ga0207676_10077147
1372 Ga0207676_10714352
1373 Ga0207674_10030080
1374 Ga0207674_10472557
1375 Ga0207675_100087107
1376 Ga0207675_100204833
1377 Ga0207675_100423784
1378 Ga0207675_102506247
1379 Ga0207683_10010378
1380 Ga0207683_10013613
1381 Ga0207683_10247194
1382 Ga0207698_10459905
1383 Ga0207698_10881938
1384 Ga0207698_12478612
1385 Ga0209813_10161979
1386 Ga0209813_10256961
1387 Ga0207428_10017950
1388 Ga0207428_10040717
1389 Ga0207428_10110162
1390 Ga0268266_10207967
1391 Ga0268266_10969032
1392 Ga0268266_11661538
1393 Ga0268266_12309932
1394 Ga0268265_10401654
1395 Ga0268265_11362447
1396 Ga0268265_11911601
1397 Ga0268265_12668205
1398 Ga0268264_10227117
1399 Ga0268264_10433727
1400 Ga0307515_10091522
1401 Ga0265325_10000492
1402 Ga0265340_10038117
1403 Ga0265340_10076710
1404 Ga0265316_10048868
1405 Ga0265316_10092702
1406 Ga0307513_10021442
1407 Ga0307513_10248609
1408 Ga0307513_10369951
1409 Ga0307513_10618677
1410 Ga0307509_10815100
1411 Ga0307408_100903089
1412 Ga0265342_10057614
1413 Ga0307405_11152041
1414 Ga0307405_11411564
1415 Ga0307406_10154832
1416 Ga0307406_10458211
1417 Ga0307412_11666693
1418 Ga0307412_11688076
1419 Ga0307412_11793923
1420 Ga0307412_12308429
1421 Ga0307409_100454418
1422 Ga0307409_100628485
1423 Ga0307409_101353277
1424 Ga0307416_100733300
1425 Ga0307411_11355194
1426 Ga0307415_100052547
1427 Ga0307415_102467610
1428 Ga0373950_0028275
1429 Ga0373958_0094967
1430 Ga0373928_0012494
1431 Ga0373928_0242371
1432 Ga0373940_0002719
1433 Ga0373949_0024472
1434 Ga0373949_0048777
1435 Ga0373960_0335040
1436 Ga0373942_0067068
1437 Ga0316574_0241910
1438 Ga0373931_0455752
1439 Ga0373931_0612353
1440 Ga0395898_1138396
1441 Ga0395905_0571708
1442 Ga0237816_08265
1443 Ga0436365_0755682
1444 Ga0436365_1027753
1445 Ga0436365_1252986
1446 Ga0436365_1289747
1447 Ga0436365_1651064
1448 Ga0436365_1890676
1449 Ga0436360_1181788
1450 Ga0436362_0604495
1451 Ga0439439_0235279
1452 Ga0439453_0016915
1453 Ga0439453_0027963
1454 Ga0439453_0039775
1455 Ga0439461_0071616
1456 Ga0451789_0411068
1457 Ga0451791_0426884
1458 Ga0451797_0687038
1459 Ga0451839_1270928
1460 Ga0451841_0805672
1461 Ga0451843_0255968
1462 Ga0451843_0427283
1463 Ga0451853_3383827
1464 Ga0439441_008039
1465 Ga0439441_130143
1466 Ga0439443_028971
1467 Ga0439446_0027497
1468 Ga0439434_0212964
1469 Ga0439435_0019364
1470 Ga0439444_0016539
1471 Ga0439464_0056449
1472 Ga0439440_0027727
1473 Ga0466967_0234889
1474 Ga0495603_0281648
1475 Ga0495629_0947594
1476 Ga0495638_0001856
1477 Ga0495638_0017590
1478 Ga0495638_0050217
1479 Ga0495605_0143411
1480 Ga0495664_0345171
1481 Ga0495584_0489114
1482 Ga0495596_0332611
1483 Ga0495607_0031262
1484 Ga0495606_0063802
1485 Ga0495608_0213092
1486 Ga0495616_0040932
1487 Ga0495618_0764146
1488 Ga0495620_0129614
1489 Ga0495620_0187261
1490 Ga0495631_0286363
1491 Ga0495632_0500947
1492 Ga0495637_0180815
1493 Ga0495643_0088042
1494 Ga0495648_0000859
1495 Ga0495663_0117853
1496 Ga0495654_0456257
1497 Ga0495598_0025940
1498 Ga0495597_0075048
1499 Ga0495622_0021150
1500 Ga0495667_0059393
1501 Ga0495656_0008096
1502 Ga0495668_0521141
1503 Ga0495668_0834524
1504 Ga0495611_0220783
1505 Ga0495625_0199459
1506 Ga0495625_0794855
1507 Ga0495661_0037786
1508 Ga0495670_0117268
1509 Ga0495671_0033442
1510 Ga0495660_0027480
1511 Ga0495581_0765410
1512 Ga0495636_0142587
1513 Ga0495672_0075809
1514 Ga0495673_0215055
1515 Ga0495673_0297914
1516 Ga0495686_0144734
1517 Ga0495686_0452624
1518 Ga0495615_0120012
1519 Ga0495626_0022268
1520 Ga0496100_0032369
1521 Ga0496100_0212125
1522 Ga0496100_0412854
1523 Ga0496100_0756373
1524 Ga0496100_1478921
1525 Ga0496101_0379805
1526 Ga0496101_0702501
1527 Ga0496102_0183530
1528 Ga0496102_0317457
1529 Ga0496104_0002236
1530 Ga0496104_0015358
1531 Ga0496104_0224291
1532 Ga0496105_0007126
1533 Ga0496105_0087197
1534 Ga0496106_0063854
1535 Ga0496106_0316621
1536 Ga0496106_1517416
1537 Ga0496107_0095771
1538 Ga0496107_0617356
1539 Ga0496108_0106953
1540 Ga0496108_0259668
1541 Ga0496109_0109600
1542 Ga0496109_0375569
1543 Ga0496109_0592422
1544 Ga0496110_0395208
1545 Ga0496110_0621744
1546 Ga0496110_0638454
1547 Ga0496110_1517974
1548 Ga0496112_0231140
1549 Ga0496112_0356470
1550 Ga0496112_1385053
1551 Ga0496112_1872157
1552 Ga0496113_0148934
1553 Ga0496113_0319178
1554 Ga0496114_0044139
1555 Ga0496114_0830785
1556 Ga0496114_1328837
1557 Ga0496114_1583171
1558 Ga0496115_0010124
1559 Ga0496115_0042092
1560 Ga0496115_0164982
1561 Ga0496116_0023936
1562 Ga0496117_0102747
1563 Ga0496118_0136476
1564 Ga0496119_0057075
1565 Ga0496120_0066692
1566 Ga0496121_0001090
1567 Ga0496121_0026263
1568 Ga0496121_0150509
1569 Ga0496122_0007688
1570 Ga0496122_0543093
1571 Ga0496123_0186955
1572 Ga0496123_0276748
1573 Ga0496124_0335945
1574 Ga0496124_0639814
1575 Ga0496124_0893368
1576 Ga0496125_0000252
1577 Ga0496125_0000566
1578 Ga0496125_0001454
1579 Ga0496125_0143619
1580 Ga0496126_0072197
1581 Ga0496126_0074628
1582 Ga0496126_0293370
1583 Ga0495678_050712
1584 Ga0501031_0213233
1585 Ga0501031_0350544
1586 Ga0501032_0022475
1587 Ga0501032_0362429
1588 Ga0501032_0971569
1589 Ga0501033_0034246
1590 Ga0501033_0051505
1591 Ga0501033_0229197
1592 Ga0501033_0266530
1593 Ga0501033_0766753
1594 Ga0501034_0091478
1595 Ga0501034_0187416
1596 Ga0501034_0189550
1597 Ga0501034_0219409
1598 Ga0501034_0229221
1599 Ga0501034_0679670
1600 Ga0501036_0072422
1601 Ga0501036_0203548
1602 Ga0501036_0420616
1603 Ga0501036_0449920
1604 Ga0501036_1341745
1605 Ga0501036_1364045
1606 Ga0501036_1644588
1607 Ga0501037_0003013
1608 Ga0501037_0298615
1609 Ga0501037_0490042
1610 Ga0501038_0040986
1611 Ga0501038_0123626
1612 Ga0501038_0530526
1613 Ga0501038_1235850
1614 Ga0501038_1262943
1615 Ga0501039_0012604
1616 Ga0501039_0093853
1617 Ga0501039_0165302
1618 Ga0501040_0411503
1619 Ga0501040_1164593
1620 Ga0501041_0401512
1621 Ga0501041_0638323
1622 Ga0501042_0045932
1623 Ga0501042_0167681
1624 Ga0501043_0132534
1625 Ga0501043_0190807
1626 Ga0501043_0255513
1627 Ga0501043_0621027
1628 Ga0501046_0035916
1629 Ga0501046_0073172
1630 Ga0501046_0096383
1631 Ga0501046_0998962
1632 Ga0501047_0136974
1633 Ga0501047_0162134
1634 Ga0501047_0353517
1635 Ga0501047_0394931
1636 Ga0501047_1132811
1637 Ga0501048_0020394
1638 Ga0501048_0146814
1639 Ga0501048_0592618
1640 Ga0501067_0036698
1641 Ga0501067_0056276
1642 Ga0501067_0111752
1643 Ga0501068_0151513
1644 Ga0501069_0112454
1645 Ga0501070_0009260
1646 Ga0501070_0172082
1647 Ga0501070_0793749
1648 Ga0501071_0078678
1649 Ga0501071_0116039
1650 Ga0501071_0188311
1651 Ga0501071_0627853
1652 Ga0501071_1125318
1653 Ga0501072_0005240
1654 Ga0501072_0192649
1655 Ga0501072_0514449
1656 Ga0501073_0029808
1657 Ga0501073_0282529
1658 Ga0501073_0591350
1659 Ga0501074_0155885
1660 Ga0501074_0678135
1661 Ga0501075_0165221
1662 Ga0501075_0417884
1663 Ga0501075_0536198
1664 Ga0501075_0909463
1665 Ga0501076_0157801
1666 Ga0501076_0222639
1667 Ga0501076_0226131
1668 Ga0501076_1355418
1669 Ga0501077_0092185
1670 Ga0501077_0654797
1671 Ga0501077_0678480
1672 Ga0501077_1005037
1673 Ga0501077_1120002
1674 Ga0501079_0052864
1675 Ga0501079_0208242
1676 Ga0501079_0510527
1677 Ga0501079_0665487
1678 Ga0501080_0020013
1679 Ga0501080_0073111
1680 Ga0501080_0108802
1681 Ga0501080_0230623
1682 Ga0501080_0479701
1683 Ga0501080_0815371
1684 Ga0501080_1644127
1685 Ga0501081_0140554
1686 Ga0501081_0264421
1687 Ga0501081_0314230
1688 Ga0501081_0704708
1689 Ga0501081_1121583
1690 Ga0501081_1520025
1691 Ga0501083_0017239
1692 Ga0501083_0098118
1693 Ga0501035_0019125
1694 Ga0501035_0280386
1695 Ga0501035_0507264
1696 Ga0501035_0809646
1697 Ga0501044_0000140
1698 Ga0501044_0075920
1699 Ga0501044_0140214
1700 Ga0501044_0497508
1701 Ga0501044_0644155
1702 Ga0501044_0846933
1703 Ga0501044_1344427
1704 Ga0501045_0022475
1705 Ga0501045_0371757
1706 Ga0501045_0528106
1707 nmdc:mga03683_100192_c1
1708 nmdc:mga03683_220442_c1
1709 nmdc:mga03683_589135_c1
1710 nmdc:mga03683_82153_c1
1711 nmdc:mga03n38_140041_c1
1712 nmdc:mga03n38_202881_c1
1713 nmdc:mga03n38_36002_c1
1714 nmdc:mga03n38_525051_c1
1715 nmdc:mga03n38_571265_c1
1716 nmdc:mga00v17_19035_c1
1717 nmdc:mga00v17_206029_c1
1718 nmdc:mga0yw44_10125_c1
1719 nmdc:mga0yw44_475714_c1
1720 nmdc:mga0yw44_504944_c1
1721 nmdc:mga0yw44_524966_c1
1722 nmdc:mga0k408_244099_c1
1723 nmdc:mga0k408_275244_c1
1724 nmdc:mga0k408_279892_c1
1725 nmdc:mga0k408_323835_c1
1726 nmdc:mga0k408_378226_c1
1727 nmdc:mga0k408_408468_c1
1728 nmdc:mga0k408_49335_c1
1729 nmdc:mga0k408_578242_c1
1730 nmdc:mga06z11_138845_c1
1731 nmdc:mga06z11_25779_c1
1732 nmdc:mga06z11_2909_c1
1733 nmdc:mga06z11_297300_c1
1734 nmdc:mga06z11_31578_c1
1735 nmdc:mga06z11_39657_c1
1736 nmdc:mga06z11_864954_c1
1737 nmdc:mga07m45_33970_c1
1738 nmdc:mga07m45_404620_c1
1739 nmdc:mga07m45_735512_c1
1740 nmdc:mga05p37_457236_c1
1741 nmdc:mga05p37_487479_c1
1742 nmdc:mga05p37_609342_c1
1743 nmdc:mga05p37_842213_c1
1744 nmdc:mga09592_1015526_c1
1745 nmdc:mga09592_1416295_c1
1746 nmdc:mga09592_1441015_c1
1747 nmdc:mga09592_382835_c1
1748 nmdc:mga0qj67_291231_c1
1749 nmdc:mga0qj67_688613_c1
1750 nmdc:mga0qj67_845669_c1
1751 nmdc:mga0qj67_877448_c1
1752 nmdc:mga06r32_300842_c1
1753 nmdc:mga06r32_43346_c1
1754 nmdc:mga06r32_537571_c1
1755 nmdc:mga08y16_1308470_c1
1756 nmdc:mga08y16_161308_c1
1757 nmdc:mga08y16_597145_c1
1758 nmdc:mga08y16_63829_c1
1759 nmdc:mga08y16_700921_c1
1760 nmdc:mga0n895_1633_c1
1761 nmdc:mga0a205_155568_c2
1762 nmdc:mga0sz30_15111_c1
1763 nmdc:mga0sz30_336856_c1
1764 nmdc:mga0sz30_51680_c1
1765 Ga0500610_0280170
1766 Ga0500578_0160559
1767 Ga0500643_027127
1768 Ga0500644_0048130
1769 Ga0500646_0016648
1770 Ga0500651_0021060
1771 Ga0500651_0026933
1772 Ga0500566_0004029
1773 Ga0500641_0002417
1774 Ga0500641_0026924
1775 Ga0500641_0293434
1776 Ga0500650_0000130
1777 Ga0500650_0182263
1778 Ga0500556_0000066
1779 Ga0500562_037640
1780 Ga0500562_044858
1781 Ga0500592_002474
1782 Ga0500593_014188
1783 Ga0500595_001089
1784 Ga0500595_003717
1785 Ga0500595_013828
1786 Ga0500595_043501
1787 Ga0500607_071651
1788 Ga0500608_131224
1789 Ga0500608_237218
1790 Ga0500608_277028
1791 Ga0500618_048912
1792 Ga0500642_0000072
1793 Ga0500642_0107110
1794 Ga0500642_0169441
1795 Ga0500652_001780
1796 Ga0500652_144336
1797 Ga0500559_0000413
1798 Ga0500568_0000453
1799 Ga0500568_0049035
1800 Ga0500568_0174483
1801 Ga0500577_0521560
1802 Ga0500586_003954
1803 Ga0500588_0301048
1804 Ga0500604_0027191
1805 Ga0500604_0069710
1806 Ga0500616_0000028
1807 Ga0500616_0000177
1808 Ga0500616_0068500
1809 Ga0500616_0073614
1810 Ga0500616_0129623
1811 Ga0500622_0000223
1812 Ga0500622_0061020
1813 Ga0500627_0081998
1814 Ga0500627_0197702
1815 Ga0500627_0249491
1816 Ga0500627_0509135
1817 Ga0500633_0041592
1818 Ga0500636_0003274
1819 Ga0500636_0021225
1820 Ga0500637_0459932
1821 Ga0500609_024560
1822 Ga0500596_065139
1823 Ga0501084_0066185
1824 Ga0501084_0172032
1825 Ga0501084_0223698
1826 Ga0501084_0467581
1827 Ga0501084_0480142
1828 Ga0501084_1145262
1829 Ga0501082_0000025
1830 Ga0501082_0098054
1831 Ga0501082_0102805
1832 Ga0501082_0111040
1833 Ga0501082_0357520
1834 Ga0501082_0416113
1835 Ga0501082_1068369
1836 Ga0501082_1833241
1837 Ga0530510_0102300
1838 Ga0530510_0155140
1839 Ga0530510_0393853
1840 2508697539
1841 2513878874
1842 2514009841
1843 2524440266
1844 2603856983
1845 2644291143
1846 2644745783
1847 2745075417
1848 2793060624
1849 2805918268
1850 2824673013
1851 2824693792
1852 2824702645
1853 2824780907
1854 2828307058
1855 2838123077
1856 2841765849
1857 2841948142
1858 2841954405
1859 2841969793
1860 2841978775
1861 2841984098
1862 2842038121
1863 2842048933
1864 2844107459
1865 2847947302
1866 2851187752
1867 2851249499
1868 2857528659
1869 2874623081
1870 2893066181
1871 2904669901
1872 2906615709
1873 2908741299
1874 2919076029
1875 2935988830
1876 8057531922

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

27

124

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8499 3 107
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8475 3 108
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8416 3 108
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.832 3 108
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8193 3 107
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8475 3 108 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.832 3 108 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.7899 5 108 2.60.40.2470
4j3oD03 Mainly Beta;Sandwich;Immunoglobulin-like;Outer membrane usher protein 0.7714 46 103 2.60.40.3110
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7503 3 106 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6P1B118-F1-model_v4 deleted 0.844 43 108
AF-A0A2M6VCV0-F1-model_v4 Ig-like SoxY domain-containing protein 0.8297 5 108
AF-A0A651FJ43-F1-model_v4 Sulfur oxidation protein 0.8287 3 108
AF-A0A6P1B118-F1-model_v4 deleted 0.8217 43 108
AF-A0A522V9H2-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.82 1 108

Map