F486253

General Info

Members Datasets Scaffolds Average Seq Length
938 372 1876 339

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10164443|Ga0207680_101644432
Length 398
Sequence MKAVRLHEFHSQPVIDDVPEPTISGPLDVIVKIGGAGVCRTDLHIIEGQWDAAMGTPLPYILGHENAGWVHEVGSAVTNVAVGDTVILHPTPTDGLCHACRAGDDMHCENSEFPGLSRDGGMAEYLLTSARACIKLNPETQPKDVAALADAGITAYHAVRKALPLLYPGTTAVIIGAGGLGHIGIQCLAELTGTTIIVVDRNPDALKLASELGAHHTVVGDGSQVDAVKDLTGGQGAHVVLDFVAEQGAEMDGWNMTRPAGSYYVIGYGGTLEIPTLGIISTERNIIGNIVGTYNELAELMVLAQNGKVTLHTKAYPLDAAPDAFADLDAGRVRGRAGQAKRLLQVRHRPGVLTAPQGEEPGDCLGVRHAGGVDWSAKKARSRRSVSLSSRRSTMRSS

Samples

Sample ID Description Type Environment
1 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
201 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
202 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
203 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
257 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
368 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
369 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
370 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
371 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
372 2895427314 Nonomuraea sp. PA05 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 3.52
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 5.86
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207680_10164443 3300025903 Bacteria 1490
2 JGI24739J22299_10015173 3300001989 Bacteria 2799
3 JGI24737J22298_10002884 3300001990 Bacteria 6100
4 JGI24738J21930_10004422 3300002075 Bacteria 3446
5 JGI24751J29686_10008716 3300002459 Bacteria 2077
6 JGI25404J52841_10000110 3300003659 Bacteria 8187
7 JGI25405J52794_10022847 3300003911 Bacteria 1270
8 Ga0058863_10057907 3300004799 Bacteria 2465
9 Ga0058861_12076710 3300004800 Bacteria 1568
10 Ga0070676_10063373 3300005328 Bacteria 2202
11 Ga0070683_100006175 3300005329 Bacteria 10049
12 Ga0070683_100008858 3300005329 Bacteria 8566
13 Ga0070683_100023868 3300005329 Bacteria 5474
14 Ga0070683_100128333 3300005329 Bacteria 2398
15 Ga0070683_100153074 3300005329 Bacteria 2186
16 Ga0070690_100053696 3300005330 Bacteria 2578
17 Ga0068869_100016172 3300005334 Bacteria 5024
18 Ga0070666_10003687 3300005335 Bacteria 9282
19 Ga0070680_100130257 3300005336 Bacteria 2104
20 Ga0070682_100001530 3300005337 Bacteria 12957
21 Ga0070682_100028308 3300005337 Bacteria 3369
22 Ga0070682_100112247 3300005337 Bacteria 1818
23 Ga0068868_100016661 3300005338 Bacteria 5464
24 Ga0068868_100056609 3300005338 Bacteria 3097
25 Ga0068868_100298950 3300005338 Bacteria 1367
26 Ga0068868_100400304 3300005338 Bacteria 1185
27 Ga0070660_100291076 3300005339 Bacteria 1337
28 Ga0070689_100007719 3300005340 Bacteria 7537
29 Ga0070691_10039297 3300005341 Bacteria 2235
30 Ga0070687_100002744 3300005343 Bacteria 6680
31 Ga0070687_100045413 3300005343 Bacteria 2243
32 Ga0070687_100059587 3300005343 Bacteria 2011
33 Ga0070661_100052906 3300005344 Bacteria 2971
34 Ga0070661_100128713 3300005344 Bacteria 1900
35 Ga0070692_10001338 3300005345 Bacteria 8877
36 Ga0070692_10006917 3300005345 Bacteria 4960
37 Ga0070668_100069076 3300005347 Bacteria 2748
38 Ga0070668_100102562 3300005347 Bacteria 2268
39 Ga0070668_100222106 3300005347 Bacteria 1559
40 Ga0070669_100379382 3300005353 Bacteria 1153
41 Ga0070675_100019552 3300005354 Bacteria 5399
42 Ga0070675_100042292 3300005354 Bacteria 3723
43 Ga0070675_100098235 3300005354 Bacteria 2462
44 Ga0070671_100098521 3300005355 Bacteria 2452
45 Ga0070673_100058317 3300005364 Bacteria 3052
46 Ga0070673_100123139 3300005364 Bacteria 2166
47 Ga0070688_100086216 3300005365 Bacteria 2042
48 Ga0070688_100123579 3300005365 Bacteria 1736
49 Ga0070659_100028002 3300005366 Bacteria 4347
50 Ga0070667_100294305 3300005367 Bacteria 1461
51 Ga0070709_10001845 3300005434 Bacteria 11489
52 Ga0070709_10004698 3300005434 Bacteria 7378
53 Ga0070709_10012100 3300005434 Bacteria 4823
54 Ga0070709_10104565 3300005434 Bacteria 1892
55 Ga0070714_100014299 3300005435 Bacteria 6374
56 Ga0070714_100031003 3300005435 Bacteria 4456
57 Ga0070714_100081309 3300005435 Bacteria 2820
58 Ga0070714_100094470 3300005435 Bacteria 2624
59 Ga0070714_100099899 3300005435 Bacteria 2554
60 Ga0070714_100106310 3300005435 Bacteria 2479
61 Ga0070714_100135331 3300005435 Bacteria 2206
62 Ga0070714_100360144 3300005435 Bacteria 1367
63 Ga0070713_100001308 3300005436 Bacteria 15921
64 Ga0070713_100013874 3300005436 Bacteria 5964
65 Ga0070713_100078635 3300005436 Bacteria 2808
66 Ga0070713_100084260 3300005436 Bacteria 2719
67 Ga0070713_100097261 3300005436 Bacteria 2543
68 Ga0070713_100105288 3300005436 Bacteria 2450
69 Ga0070713_100198755 3300005436 Bacteria 1809
70 Ga0070713_100323171 3300005436 Bacteria 1425
71 Ga0070710_10000547 3300005437 Bacteria 17763
72 Ga0070710_10015217 3300005437 Bacteria 3890
73 Ga0070710_10015577 3300005437 Bacteria 3851
74 Ga0070710_10044290 3300005437 Bacteria 2469
75 Ga0070710_10047328 3300005437 Bacteria 2398
76 Ga0070711_100013257 3300005439 Bacteria 5173
77 Ga0070711_100031143 3300005439 Bacteria 3538
78 Ga0070711_100305464 3300005439 Bacteria 1266
79 Ga0070705_100035968 3300005440 Bacteria 2780
80 Ga0070705_100059923 3300005440 Bacteria 2256
81 Ga0070700_100001333 3300005441 Bacteria 12262
82 Ga0070700_100006893 3300005441 Bacteria 6101
83 Ga0070700_100143285 3300005441 Bacteria 1626
84 Ga0070694_100034606 3300005444 Bacteria 3332
85 Ga0070708_100008323 3300005445 Bacteria 8329
86 Ga0070708_100021238 3300005445 Bacteria 5486
87 Ga0070708_100174560 3300005445 Bacteria 2007
88 Ga0070708_100223433 3300005445 Bacteria 1766
89 Ga0070708_100461179 3300005445 Bacteria 1199
90 Ga0070663_100012026 3300005455 Bacteria 5461
91 Ga0070663_100021451 3300005455 Bacteria 4297
92 Ga0070663_100121042 3300005455 Bacteria 1977
93 Ga0070678_100121963 3300005456 Bacteria 2057
94 Ga0070678_100277217 3300005456 Bacteria 1416
95 Ga0070662_100170815 3300005457 Bacteria 1707
96 Ga0070681_10034274 3300005458 Bacteria 5098
97 Ga0070681_10203892 3300005458 Bacteria 1895
98 Ga0070681_10204750 3300005458 Bacteria 1891
99 Ga0070681_10301669 3300005458 Bacteria 1511
100 Ga0070685_10010463 3300005466 Bacteria 4822
101 Ga0070685_10039298 3300005466 Bacteria 2687
102 Ga0070706_100020034 3300005467 Bacteria 6166
103 Ga0070706_100037288 3300005467 Bacteria 4490
104 Ga0070706_100123253 3300005467 Bacteria 2417
105 Ga0070706_100137874 3300005467 Bacteria 2276
106 Ga0070706_100282995 3300005467 Bacteria 1548
107 Ga0070706_100384709 3300005467 Bacteria 1306
108 Ga0070707_100000160 3300005468 Bacteria 64063
109 Ga0070707_100008664 3300005468 Bacteria 9438
110 Ga0070707_100045463 3300005468 Bacteria 4202
111 Ga0070707_100056840 3300005468 Bacteria 3753
112 Ga0070707_100115064 3300005468 Bacteria 2610
113 Ga0070707_100119699 3300005468 Bacteria 2556
114 Ga0070707_100344183 3300005468 Bacteria 1448
115 Ga0070707_100352832 3300005468 Bacteria 1428
116 Ga0070698_100001469 3300005471 Bacteria 26165
117 Ga0070698_100017508 3300005471 Bacteria 7551
118 Ga0070698_100018408 3300005471 Bacteria 7355
119 Ga0070698_100018701 3300005471 Bacteria 7294
120 Ga0070698_100020972 3300005471 Bacteria 6846
121 Ga0070698_100040643 3300005471 Bacteria 4778
122 Ga0070698_100064192 3300005471 Bacteria 3700
123 Ga0070698_100079808 3300005471 Bacteria 3268
124 Ga0070679_100252394 3300005530 Bacteria 1720
125 Ga0070679_100262987 3300005530 Bacteria 1680
126 Ga0070679_100378871 3300005530 Bacteria 1361
127 Ga0070684_100033201 3300005535 Bacteria 4404
128 Ga0070684_100037560 3300005535 Bacteria 4156
129 Ga0070684_100067262 3300005535 Bacteria 3146
130 Ga0070684_100152141 3300005535 Bacteria 2096
131 Ga0070697_100005308 3300005536 Bacteria 9903
132 Ga0068853_100061872 3300005539 Bacteria 3238
133 Ga0068853_100134809 3300005539 Bacteria 2213
134 Ga0070672_100003525 3300005543 Bacteria 10140
135 Ga0070672_100037372 3300005543 Bacteria 3704
136 Ga0070696_100111280 3300005546 Bacteria 1972
137 Ga0070693_100022094 3300005547 Bacteria 3377
138 Ga0070693_100081175 3300005547 Bacteria 1933
139 Ga0070693_100136975 3300005547 Bacteria 1537
140 Ga0070665_100112224 3300005548 Bacteria 2729
141 Ga0070665_100185375 3300005548 Bacteria 2082
142 Ga0070665_100464171 3300005548 Bacteria 1276
143 Ga0068855_100166485 3300005563 Bacteria 2498
144 Ga0068855_100261283 3300005563 Bacteria 1928
145 Ga0070664_100009450 3300005564 Bacteria 7904
146 Ga0070664_100072800 3300005564 Bacteria 2947
147 Ga0070664_100106180 3300005564 Bacteria 2446
148 Ga0068857_100021495 3300005577 Bacteria 5678
149 Ga0068857_100054923 3300005577 Bacteria 3535
150 Ga0068857_100075790 3300005577 Bacteria 2999
151 Ga0068857_100148902 3300005577 Bacteria 2119
152 Ga0068857_100387612 3300005577 Bacteria 1298
153 Ga0068857_100394657 3300005577 Bacteria 1287
154 Ga0068854_100036737 3300005578 Bacteria 3436
155 Ga0068854_100040277 3300005578 Bacteria 3296
156 Ga0068856_100064463 3300005614 Bacteria 3620
157 Ga0068856_100168302 3300005614 Bacteria 2203
158 Ga0068856_100229591 3300005614 Bacteria 1871
159 Ga0070702_100002665 3300005615 Bacteria 7793
160 Ga0070702_100038969 3300005615 Bacteria 2650
161 Ga0068852_100041522 3300005616 Bacteria 3888
162 Ga0068852_100055553 3300005616 Bacteria 3418
163 Ga0068864_100069147 3300005618 Bacteria 3070
164 Ga0068866_10042209 3300005718 Bacteria 2269
165 Ga0068861_100001645 3300005719 Bacteria 14262
166 Ga0068861_100066517 3300005719 Bacteria 2779
167 Ga0068851_10003583 3300005834 Bacteria 6922
168 Ga0068870_10003040 3300005840 Bacteria 7070
169 Ga0068870_10024595 3300005840 Bacteria 2981
170 Ga0068863_100257253 3300005841 Bacteria 1687
171 Ga0068863_100276366 3300005841 Bacteria 1626
172 Ga0068863_100373612 3300005841 Bacteria 1391
173 Ga0068858_100045820 3300005842 Bacteria 4054
174 Ga0068860_100023866 3300005843 Bacteria 5911
175 Ga0068860_100046507 3300005843 Bacteria 4137
176 Ga0068860_100357268 3300005843 Bacteria 1439
177 Ga0068862_100130519 3300005844 Bacteria 2222
178 Ga0081455_10004246 3300005937 Bacteria 16156
179 Ga0081455_10068353 3300005937 Bacteria 2958
180 Ga0081538_10007127 3300005981 Bacteria 9713
181 Ga0081538_10017739 3300005981 Bacteria 5385
182 Ga0081538_10073813 3300005981 Bacteria 1861
183 Ga0081540_1000120 3300005983 Bacteria 83032
184 Ga0081540_1000151 3300005983 Bacteria 71183
185 Ga0081540_1009731 3300005983 Bacteria 6592
186 Ga0081540_1090542 3300005983 Bacteria 1347
187 Ga0081539_10000088 3300005985 Bacteria 212765
188 Ga0081539_10019620 3300005985 Bacteria 4617
189 Ga0081539_10031233 3300005985 Bacteria 3288
190 Ga0070717_10017009 3300006028 Bacteria 5648
191 Ga0070717_10020504 3300006028 Bacteria 5200
192 Ga0070717_10157207 3300006028 Bacteria 1970
193 Ga0070717_10168002 3300006028 Bacteria 1906
194 Ga0070717_10267198 3300006028 Bacteria 1514
195 Ga0070717_10314877 3300006028 Bacteria 1393
196 Ga0070717_10445640 3300006028 Bacteria 1166
197 Ga0075432_10003181 3300006058 Bacteria 5538
198 Ga0075432_10024624 3300006058 Bacteria 2063
199 Ga0070715_10089936 3300006163 Bacteria 1410
200 Ga0070716_100000463 3300006173 Bacteria 16758
201 Ga0070716_100001656 3300006173 Bacteria 10048
202 Ga0070716_100041072 3300006173 Bacteria 2575
203 Ga0070716_100060795 3300006173 Bacteria 2184
204 Ga0070716_100180160 3300006173 Bacteria 1386
205 Ga0070712_100016067 3300006175 Bacteria 4830
206 Ga0070712_100030983 3300006175 Bacteria 3600
207 Ga0070712_100038697 3300006175 Bacteria 3261
208 Ga0070712_100048694 3300006175 Bacteria 2939
209 Ga0070712_100098642 3300006175 Bacteria 2155
210 Ga0068871_100015128 3300006358 Bacteria 5768
211 Ga0068871_100227547 3300006358 Bacteria 1618
212 Ga0075428_100016092 3300006844 Bacteria 8270
213 Ga0075428_100141187 3300006844 Bacteria 2619
214 Ga0075428_100175309 3300006844 Bacteria 2322
215 Ga0075430_100015969 3300006846 Bacteria 6394
216 Ga0075430_100050093 3300006846 Bacteria 3524
217 Ga0075431_100005042 3300006847 Bacteria 12993
218 Ga0075431_100204215 3300006847 Bacteria 2021
219 Ga0075431_100438901 3300006847 Bacteria 1302
220 Ga0075433_10012569 3300006852 Bacteria 6846
221 Ga0075433_10034987 3300006852 Bacteria 4317
222 Ga0075433_10210959 3300006852 Bacteria 1726
223 Ga0075434_100024769 3300006871 Bacteria 5867
224 Ga0075434_100027569 3300006871 Bacteria 5578
225 Ga0075434_100100357 3300006871 Bacteria 2900
226 Ga0075434_100153407 3300006871 Bacteria 2323
227 Ga0075429_100000523 3300006880 Bacteria 29137
228 Ga0075429_100064950 3300006880 Bacteria 3177
229 Ga0075429_100068612 3300006880 Bacteria 3086
230 Ga0068865_100002913 3300006881 Bacteria 10206
231 Ga0075436_100030844 3300006914 Bacteria 3689
232 Ga0075436_100039047 3300006914 Bacteria 3275
233 Ga0075436_100081511 3300006914 Bacteria 2243
234 Ga0075436_100172432 3300006914 Bacteria 1527
235 Ga0075435_100016706 3300007076 Bacteria 5536
236 Ga0075435_100029014 3300007076 Bacteria 4341
237 Ga0075435_100042523 3300007076 Bacteria 3635
238 Ga0075435_100158369 3300007076 Bacteria 1907
239 Ga0075435_100209861 3300007076 Bacteria 1652
240 Ga0099794_10157742 3300007265 Bacteria 1153
241 Ga0105251_10007024 3300009011 Bacteria 7024
242 Ga0105251_10028522 3300009011 Bacteria 2820
243 Ga0105240_10168020 3300009093 Bacteria 2600
244 Ga0105240_10231463 3300009093 Bacteria 2147
245 Ga0111539_10005398 3300009094 Bacteria 16536
246 Ga0111539_10096068 3300009094 Bacteria 3481
247 Ga0111539_10167769 3300009094 Bacteria 2565
248 Ga0105245_10010656 3300009098 Bacteria 7996
249 Ga0105245_10024069 3300009098 Bacteria 5346
250 Ga0105245_10054090 3300009098 Bacteria 3605
251 Ga0105247_10124515 3300009101 Bacteria 1674
252 Ga0114129_10008192 3300009147 Bacteria 14898
253 Ga0114129_10259716 3300009147 Bacteria 2329
254 Ga0114129_10341052 3300009147 Bacteria 1987
255 Ga0105243_10002407 3300009148 Bacteria 15669
256 Ga0105243_10056508 3300009148 Bacteria 3122
257 Ga0105243_10088166 3300009148 Bacteria 2549
258 Ga0105243_10155164 3300009148 Bacteria 1968
259 Ga0105241_10079210 3300009174 Bacteria 2568
260 Ga0105241_10092516 3300009174 Bacteria 2388
261 Ga0105248_10013191 3300009177 Bacteria 9097
262 Ga0105248_10125373 3300009177 Bacteria 2897
263 Ga0105237_10119773 3300009545 Bacteria 2626
264 Ga0105238_10011060 3300009551 Bacteria 9070
265 Ga0105238_10118337 3300009551 Bacteria 2629
266 Ga0105249_10005142 3300009553 Bacteria 11289
267 Ga0105249_10275602 3300009553 Bacteria 1677
268 Ga0105239_10251867 3300010375 Bacteria 1983
269 Ga0105239_10278877 3300010375 Bacteria 1881
270 Ga0105246_10064614 3300011119 Bacteria 2557
271 Ga0105246_10094692 3300011119 Bacteria 2160
272 Ga0105246_10109161 3300011119 Bacteria 2029
273 Ga0157326_1006018 3300012513 Bacteria 1291
274 Ga0157371_10099447 3300013102 Bacteria 2063
275 Ga0157371_10160338 3300013102 Bacteria 1606
276 Ga0157370_10169223 3300013104 Bacteria 2032
277 Ga0157369_10025837 3300013105 Bacteria 6514
278 Ga0157369_10066064 3300013105 Bacteria 3892
279 Ga0157374_10110540 3300013296 Bacteria 2643
280 Ga0157374_10268006 3300013296 Bacteria 1683
281 Ga0157378_10125781 3300013297 Bacteria 2368
282 Ga0163162_10180036 3300013306 Bacteria 2240
283 Ga0157372_10048110 3300013307 Bacteria 4740
284 Ga0157372_10151578 3300013307 Bacteria 2676
285 Ga0157372_10163633 3300013307 Bacteria 2572
286 Ga0157372_10299674 3300013307 Bacteria 1870
287 Ga0157375_10084612 3300013308 Bacteria 3221
288 Ga0157375_10364080 3300013308 Bacteria 1612
289 Ga0157375_10658329 3300013308 Bacteria 1203
290 Ga0163163_10033952 3300014325 Bacteria 4938
291 Ga0163163_10112154 3300014325 Bacteria 2756
292 Ga0163163_10172600 3300014325 Bacteria 2209
293 Ga0163163_10266266 3300014325 Bacteria 1765
294 Ga0157380_10017676 3300014326 Bacteria 5280
295 Ga0157380_10135123 3300014326 Bacteria 2110
296 Ga0182008_10015075 3300014497 Bacteria 4041
297 Ga0157377_10002600 3300014745 Bacteria 8017
298 Ga0157377_10013024 3300014745 Bacteria 4199
299 Ga0157379_10083516 3300014968 Bacteria 2863
300 Ga0157379_10299057 3300014968 Bacteria 1466
301 Ga0197907_10163216 3300020069 Bacteria 2081
302 Ga0197907_10622897 3300020069 Bacteria 3622
303 Ga0197907_11334031 3300020069 Bacteria 3250
304 Ga0206356_10944960 3300020070 Bacteria 2347
305 Ga0206356_11103474 3300020070 Bacteria 6562
306 Ga0206356_11265883 3300020070 Bacteria 3457
307 Ga0206349_1015767 3300020075 Bacteria 1884
308 Ga0206349_1048544 3300020075 Bacteria 2491
309 Ga0206349_1920315 3300020075 Bacteria 1473
310 Ga0206355_1227207 3300020076 Bacteria 1594
311 Ga0206351_10398476 3300020077 Bacteria 3042
312 Ga0206352_10632914 3300020078 Bacteria 3712
313 Ga0206352_11332995 3300020078 Bacteria 1444
314 Ga0206350_10871958 3300020080 Bacteria 1553
315 Ga0206354_10921791 3300020081 Bacteria 1777
316 Ga0206353_11114840 3300020082 Bacteria 1133
317 Ga0206353_11985371 3300020082 Bacteria 5341
318 Ga0213873_10048281 3300021358 Bacteria 1119
319 Ga0213876_10015660 3300021384 Bacteria 4013
320 Ga0213875_10000369 3300021388 Bacteria 41386
321 Ga0213875_10001208 3300021388 Bacteria 17598
322 Ga0213875_10023643 3300021388 Bacteria 2934
323 Ga0213875_10036111 3300021388 Bacteria 2330
324 Ga0224712_10001286 3300022467 Bacteria 5695
325 Ga0224712_10027858 3300022467 Bacteria 2014
326 Ga0224712_10052709 3300022467 Bacteria 1590
327 Ga0224572_1003707 3300024225 Bacteria 2601
328 Ga0207656_10044371 3300025321 Bacteria 1898
329 Ga0207653_10004343 3300025885 Bacteria 4454
330 Ga0207692_10001169 3300025898 Bacteria 9699
331 Ga0207692_10001923 3300025898 Bacteria 7911
332 Ga0207692_10002346 3300025898 Bacteria 7262
333 Ga0207692_10013014 3300025898 Bacteria 3595
334 Ga0207692_10038571 3300025898 Bacteria 2344
335 Ga0207710_10073656 3300025900 Bacteria 1571
336 Ga0207688_10002367 3300025901 Bacteria 10146
337 Ga0207688_10048571 3300025901 Bacteria 2371
338 Ga0207688_10158150 3300025901 Bacteria 1342
339 Ga0207647_10050610 3300025904 Bacteria 2571
340 Ga0207647_10054467 3300025904 Bacteria 2461
341 Ga0207699_10002039 3300025906 Bacteria 9541
342 Ga0207699_10007248 3300025906 Bacteria 5415
343 Ga0207699_10017119 3300025906 Bacteria 3806
344 Ga0207699_10301285 3300025906 Bacteria 1119
345 Ga0207645_10047084 3300025907 Bacteria 2754
346 Ga0207643_10000047 3300025908 Bacteria 79590
347 Ga0207643_10001968 3300025908 Bacteria 11336
348 Ga0207705_10016674 3300025909 Bacteria 5261
349 Ga0207705_10072054 3300025909 Bacteria 2505
350 Ga0207684_10004439 3300025910 Bacteria 13225
351 Ga0207684_10008143 3300025910 Bacteria 9347
352 Ga0207684_10064723 3300025910 Bacteria 3104
353 Ga0207684_10179885 3300025910 Bacteria 1823
354 Ga0207684_10227637 3300025910 Bacteria 1609
355 Ga0207654_10190239 3300025911 Bacteria 1345
356 Ga0207707_10005779 3300025912 Bacteria 10814
357 Ga0207695_10165807 3300025913 Bacteria 2137
358 Ga0207671_10232063 3300025914 Bacteria 1448
359 Ga0207693_10017053 3300025915 Bacteria 5797
360 Ga0207693_10031061 3300025915 Bacteria 4220
361 Ga0207693_10120882 3300025915 Bacteria 2057
362 Ga0207693_10126582 3300025915 Bacteria 2008
363 Ga0207693_10133772 3300025915 Bacteria 1949
364 Ga0207693_10144608 3300025915 Bacteria 1870
365 Ga0207693_10192006 3300025915 Bacteria 1607
366 Ga0207663_10003284 3300025916 Bacteria 7889
367 Ga0207663_10044124 3300025916 Bacteria 2735
368 Ga0207663_10047414 3300025916 Bacteria 2652
369 Ga0207663_10217526 3300025916 Bacteria 1388
370 Ga0207660_10006197 3300025917 Bacteria 7772
371 Ga0207662_10003528 3300025918 Bacteria 8063
372 Ga0207662_10067944 3300025918 Bacteria 2151
373 Ga0207657_10010443 3300025919 Bacteria 9267
374 Ga0207657_10026802 3300025919 Bacteria 5287
375 Ga0207649_10030950 3300025920 Bacteria 3175
376 Ga0207652_10160973 3300025921 Bacteria 2012
377 Ga0207646_10000202 3300025922 Bacteria 80937
378 Ga0207646_10009346 3300025922 Bacteria 9691
379 Ga0207646_10012343 3300025922 Bacteria 8216
380 Ga0207646_10059544 3300025922 Bacteria 3411
381 Ga0207646_10195762 3300025922 Bacteria 1825
382 Ga0207694_10209061 3300025924 Bacteria 1589
383 Ga0207694_10273430 3300025924 Bacteria 1386
384 Ga0207650_10003706 3300025925 Bacteria 10447
385 Ga0207659_10006605 3300025926 Bacteria 7123
386 Ga0207659_10052872 3300025926 Bacteria 2895
387 Ga0207687_10008057 3300025927 Bacteria 6894
388 Ga0207700_10000802 3300025928 Bacteria 18122
389 Ga0207700_10002718 3300025928 Bacteria 10198
390 Ga0207700_10003348 3300025928 Bacteria 9297
391 Ga0207700_10003872 3300025928 Bacteria 8745
392 Ga0207700_10015980 3300025928 Bacteria 4973
393 Ga0207700_10031504 3300025928 Bacteria 3768
394 Ga0207700_10061022 3300025928 Bacteria 2858
395 Ga0207700_10075878 3300025928 Bacteria 2606
396 Ga0207700_10076603 3300025928 Bacteria 2596
397 Ga0207700_10162415 3300025928 Bacteria 1856
398 Ga0207700_10278937 3300025928 Bacteria 1437
399 Ga0207700_10301169 3300025928 Bacteria 1384
400 Ga0207664_10000434 3300025929 Bacteria 29862
401 Ga0207664_10003595 3300025929 Bacteria 10369
402 Ga0207664_10004776 3300025929 Bacteria 9211
403 Ga0207664_10010630 3300025929 Bacteria 6505
404 Ga0207664_10019852 3300025929 Bacteria 4974
405 Ga0207664_10055160 3300025929 Bacteria 3153
406 Ga0207664_10086870 3300025929 Bacteria 2556
407 Ga0207664_10126895 3300025929 Bacteria 2143
408 Ga0207664_10141270 3300025929 Bacteria 2037
409 Ga0207664_10212546 3300025929 Bacteria 1674
410 Ga0207664_10279625 3300025929 Bacteria 1464
411 Ga0207664_10305498 3300025929 Bacteria 1400
412 Ga0207664_10368877 3300025929 Bacteria 1273
413 Ga0207644_10021893 3300025931 Bacteria 4359
414 Ga0207690_10039496 3300025932 Bacteria 3080
415 Ga0207690_10171174 3300025932 Bacteria 1627
416 Ga0207706_10018761 3300025933 Bacteria 6222
417 Ga0207709_10013687 3300025935 Bacteria 4475
418 Ga0207709_10133946 3300025935 Bacteria 1693
419 Ga0207669_10197500 3300025937 Bacteria 1457
420 Ga0207704_10039080 3300025938 Bacteria 2759
421 Ga0207665_10001204 3300025939 Bacteria 17440
422 Ga0207665_10001322 3300025939 Bacteria 16709
423 Ga0207665_10003578 3300025939 Bacteria 10383
424 Ga0207665_10049975 3300025939 Bacteria 2811
425 Ga0207665_10053760 3300025939 Bacteria 2714
426 Ga0207665_10096257 3300025939 Bacteria 2059
427 Ga0207665_10119269 3300025939 Bacteria 1862
428 Ga0207691_10006524 3300025940 Bacteria 11260
429 Ga0207691_10017101 3300025940 Bacteria 6881
430 Ga0207691_10053583 3300025940 Bacteria 3683
431 Ga0207711_10022453 3300025941 Bacteria 5276
432 Ga0207711_10089182 3300025941 Bacteria 2709
433 Ga0207711_10145181 3300025941 Bacteria 2137
434 Ga0207689_10007643 3300025942 Bacteria 9464
435 Ga0207689_10010182 3300025942 Bacteria 8102
436 Ga0207661_10001927 3300025944 Bacteria 14263
437 Ga0207661_10006171 3300025944 Bacteria 8470
438 Ga0207661_10009958 3300025944 Bacteria 6828
439 Ga0207661_10061703 3300025944 Bacteria 3030
440 Ga0207661_10158806 3300025944 Bacteria 1960
441 Ga0207661_10198120 3300025944 Bacteria 1764
442 Ga0207679_10020736 3300025945 Bacteria 4440
443 Ga0207679_10039648 3300025945 Bacteria 3366
444 Ga0207667_10051312 3300025949 Bacteria 4350
445 Ga0207667_10360948 3300025949 Bacteria 1481
446 Ga0207651_10004430 3300025960 Bacteria 7074
447 Ga0207651_10179406 3300025960 Bacteria 1678
448 Ga0207712_10092290 3300025961 Bacteria 2232
449 Ga0207712_10200918 3300025961 Bacteria 1581
450 Ga0207668_10251220 3300025972 Bacteria 1436
451 Ga0207668_10290289 3300025972 Bacteria 1345
452 Ga0207640_10120096 3300025981 Bacteria 1881
453 Ga0207658_10126879 3300025986 Bacteria 2044
454 Ga0207677_10013596 3300026023 Bacteria 4723
455 Ga0207703_10077606 3300026035 Bacteria 2758
456 Ga0207639_10207109 3300026041 Bacteria 1686
457 Ga0207678_10001230 3300026067 Bacteria 23573
458 Ga0207678_10003674 3300026067 Bacteria 13795
459 Ga0207678_10006155 3300026067 Bacteria 10674
460 Ga0207678_10008769 3300026067 Bacteria 8896
461 Ga0207678_10051684 3300026067 Bacteria 3547
462 Ga0207678_10080795 3300026067 Bacteria 2783
463 Ga0207708_10000794 3300026075 Bacteria 23829
464 Ga0207708_10018360 3300026075 Bacteria 5268
465 Ga0207708_10046783 3300026075 Bacteria 3295
466 Ga0207702_10003167 3300026078 Bacteria 15221
467 Ga0207702_10106816 3300026078 Bacteria 2481
468 Ga0207702_10118392 3300026078 Bacteria 2366
469 Ga0207702_10191778 3300026078 Bacteria 1889
470 Ga0207702_10241478 3300026078 Bacteria 1693
471 Ga0207641_10193282 3300026088 Bacteria 1872
472 Ga0207641_10309097 3300026088 Bacteria 1495
473 Ga0207648_10003416 3300026089 Bacteria 16672
474 Ga0207676_10002675 3300026095 Bacteria 12662
475 Ga0207676_10056869 3300026095 Bacteria 3078
476 Ga0207676_10071311 3300026095 Bacteria 2789
477 Ga0207674_10050696 3300026116 Bacteria 4239
478 Ga0207674_10054297 3300026116 Bacteria 4079
479 Ga0207674_10121191 3300026116 Bacteria 2583
480 Ga0207675_100005946 3300026118 Bacteria 11635
481 Ga0207675_100052984 3300026118 Bacteria 3786
482 Ga0207683_10001863 3300026121 Bacteria 18643
483 Ga0207683_10002655 3300026121 Bacteria 15618
484 Ga0207683_10148111 3300026121 Bacteria 2118
485 Ga0207698_10002277 3300026142 Bacteria 11364
486 Ga0207428_10141506 3300027907 Bacteria 1836
487 Ga0268266_10056963 3300028379 Bacteria 3362
488 Ga0268266_10077834 3300028379 Bacteria 2884
489 Ga0268265_10017611 3300028380 Bacteria 4935
490 Ga0268264_10019690 3300028381 Bacteria 5513
491 Ga0265337_1002887 3300028556 Bacteria 7666
492 Ga0265319_1000732 3300028563 Bacteria 21379
493 Ga0265334_10000486 3300028573 Bacteria 20557
494 Ga0265323_10004471 3300028653 Bacteria 6029
495 Ga0265322_10005894 3300028654 Bacteria 3612
496 Ga0265336_10002354 3300028666 Bacteria 7855
497 Ga0307515_10145062 3300028794 Bacteria 2520
498 Ga0265338_10000761 3300028800 Bacteria 54973
499 Ga0265338_10002109 3300028800 Bacteria 30668
500 Ga0265338_10013681 3300028800 Bacteria 9132
501 Ga0265338_10047411 3300028800 Bacteria 3924
502 Ga0307512_10004240 3300030522 Bacteria 15844
503 Ga0307512_10129700 3300030522 Bacteria 1586
504 Ga0265332_10001578 3300031238 Bacteria 12485
505 Ga0265320_10001637 3300031240 Bacteria 15996
506 Ga0265325_10021857 3300031241 Bacteria 3508
507 Ga0265340_10006866 3300031247 Bacteria 6225
508 Ga0265339_10016782 3300031249 Bacteria 4356
509 Ga0307513_10145083 3300031456 Bacteria 2293
510 Ga0307509_10208241 3300031507 Bacteria 1784
511 Ga0307508_10165042 3300031616 Bacteria 1818
512 Ga0265314_10050177 3300031711 Bacteria 2916
513 Ga0265342_10007626 3300031712 Bacteria 7891
514 Ga0307406_10041672 3300031901 Bacteria 2862
515 Ga0307406_10200546 3300031901 Bacteria 1468
516 Ga0307409_100361037 3300031995 Bacteria 1374
517 Ga0307416_100107807 3300032002 Bacteria 2446
518 Ga0307415_100049064 3300032126 Bacteria 2852
519 Ga0307415_100065727 3300032126 Bacteria 2528
520 Ga0307415_100167500 3300032126 Bacteria 1710
521 Ga0373948_0014379 3300034817 Bacteria 1441
522 Ga0373958_0003018 3300034819 Bacteria 2406
523 Ga0373926_0002431 3300035083 Bacteria 5901
524 Ga0373926_0007272 3300035083 Bacteria 3691
525 Ga0373926_0028332 3300035083 Bacteria 1965
526 Ga0373926_0051080 3300035083 Bacteria 1491
527 Ga0373928_0008796 3300035084 Bacteria 1965
528 Ga0373934_0000099 3300035086 Bacteria 30256
529 Ga0373934_0035628 3300035086 Bacteria 1958
530 Ga0373934_0061038 3300035086 Bacteria 1501
531 Ga0373951_0000016 3300035091 Bacteria 66469
532 Ga0373923_0001426 3300035111 Bacteria 6846
533 Ga0373923_0018329 3300035111 Bacteria 2692
534 Ga0373923_0026084 3300035111 Bacteria 2322
535 Ga0373936_0001273 3300035113 Bacteria 9116
536 Ga0373936_0026630 3300035113 Bacteria 2264
537 Ga0373936_0064291 3300035113 Bacteria 1503
538 Ga0373939_0020738 3300035114 Bacteria 1790
539 Ga0373945_0005462 3300035116 Bacteria 4068
540 Ga0373945_0023887 3300035116 Bacteria 2114
541 Ga0373953_0000124 3300035117 Bacteria 18926
542 Ga0373953_0011785 3300035117 Bacteria 3079
543 Ga0373953_0031266 3300035117 Bacteria 2069
544 Ga0373954_0007559 3300035118 Bacteria 4756
545 Ga0373954_0028198 3300035118 Bacteria 2580
546 Ga0373954_0031824 3300035118 Bacteria 2437
547 Ga0373954_0034235 3300035118 Bacteria 2352
548 Ga0373956_0058824 3300035119 Bacteria 1738
549 Ga0373957_0000241 3300035120 Bacteria 13672
550 Ga0373957_0000381 3300035120 Bacteria 11266
551 Ga0373957_0019936 3300035120 Bacteria 2365
552 Ga0373943_0000572 3300035170 Bacteria 15968
553 Ga0373943_0007492 3300035170 Bacteria 4903
554 Ga0373943_0127384 3300035170 Bacteria 1359
555 Ga0373946_0001505 3300035171 Bacteria 8092
556 Ga0373946_0004228 3300035171 Bacteria 5122
557 Ga0373946_0041390 3300035171 Bacteria 1889
558 Ga0373955_0000055 3300035172 Bacteria 44447
559 Ga0373955_0012456 3300035172 Bacteria 4086
560 Ga0373955_0032736 3300035172 Bacteria 2732
561 Ga0373942_0000635 3300035207 Bacteria 9862
562 Ga0373961_0017066 3300035241 Bacteria 1877
563 Ga0373962_0038660 3300035242 Bacteria 1336
564 Ga0373924_0003857 3300035410 Bacteria 5191
565 Ga0373924_0011757 3300035410 Bacteria 3256
566 Ga0373924_0014582 3300035410 Bacteria 2973
567 Ga0373924_0020488 3300035410 Bacteria 2571
568 Ga0373924_0028372 3300035410 Bacteria 2230
569 Ga0373924_0062605 3300035410 Bacteria 1558
570 Ga0373931_0013318 3300035691 Bacteria 4002
571 Ga0373931_0039660 3300035691 Bacteria 2467
572 Ga0373935_0014904 3300035692 Bacteria 4694
573 Ga0373935_0027567 3300035692 Bacteria 3511
574 Ga0373935_0096091 3300035692 Bacteria 1946
575 Ga0373927_0001709 3300035695 Bacteria 16400
576 Ga0373927_0227440 3300035695 Bacteria 1225
577 Ga0373933_0000067 3300035724 Bacteria 63675
578 Ga0373933_0005380 3300035724 Bacteria 6970
579 Ga0373933_0005970 3300035724 Bacteria 6624
580 Ga0373933_0006466 3300035724 Bacteria 6385
581 Ga0373933_0019951 3300035724 Bacteria 3795
582 Ga0373933_0025783 3300035724 Bacteria 3373
583 Ga0373933_0054704 3300035724 Bacteria 2392
584 Ga0373933_0071243 3300035724 Bacteria 2115
585 Ga0373947_0000014 3300035725 Bacteria 135749
586 Ga0373947_0000863 3300035725 Bacteria 18313
587 Ga0373947_0045457 3300035725 Bacteria 2627
588 Ga0373947_0144890 3300035725 Bacteria 1526
589 Ga0373947_0233329 3300035725 Bacteria 1212
590 Ga0373937_0028736 3300036401 Bacteria 5033
591 Ga0373937_0042408 3300036401 Bacteria 4151
592 Ga0373937_0281832 3300036401 Bacteria 1569
593 Ga0373925_0000098 3300037068 Bacteria 94011
594 Ga0373925_0001067 3300037068 Bacteria 24761
595 Ga0373925_0009743 3300037068 Bacteria 6979
596 Ga0373925_0025768 3300037068 Bacteria 4299
597 Ga0373925_0031917 3300037068 Bacteria 3874
598 Ga0373925_0133217 3300037068 Bacteria 1939
599 Ga0373925_0236906 3300037068 Bacteria 1460
600 Ga0395900_0133845 3300037418 Bacteria 2539
601 Ga0395900_0217114 3300037418 Bacteria 1929
602 Ga0395905_0019581 3300037471 Bacteria 6415
603 Ga0436364_0077046 3300037853 Bacteria 111992
604 Ga0436364_0431205 3300037853 Bacteria 3312
605 Ga0436364_0516238 3300037853 Bacteria 122645
606 Ga0436364_0814106 3300037853 Bacteria 79026
607 Ga0436364_0944859 3300037853 Bacteria 2524
608 Ga0436364_0950844 3300037853 Bacteria 2234
609 Ga0436364_1528828 3300037853 Bacteria 2099
610 Ga0395901_0015829 3300038443 Bacteria 7686
611 Ga0395901_0276136 3300038443 Bacteria 1747
612 Ga0436365_0415357 3300039437 Bacteria 3590
613 Ga0436365_1347536 3300039437 Bacteria 7553
614 Ga0436363_0003318 3300039450 Bacteria 2220
615 Ga0436363_0194878 3300039450 Bacteria 1108
616 Ga0436363_0371418 3300039450 Bacteria 1657
617 Ga0436362_1050135 3300039453 Bacteria 3863
618 Ga0439448_0046634 3300042005 Bacteria 1412
619 Ga0439458_0014043 3300042157 Bacteria 1806
620 Ga0466965_0126568 3300044683 Bacteria 1322
621 Ga0466966_0001861 3300044684 Bacteria 13690
622 Ga0466966_0199357 3300044684 Bacteria 1211
623 Ga0466963_0000579 3300044694 Bacteria 17367
624 Ga0466963_0042202 3300044694 Bacteria 2994
625 Ga0466964_0068868 3300044706 Bacteria 1491
626 Ga0466971_0017409 3300044719 Bacteria 3179
627 Ga0466970_0145287 3300044765 Bacteria 1308
628 Ga0466957_0010430 3300044842 Bacteria 5335
629 Ga0466957_0308686 3300044842 Bacteria 1065
630 Ga0466959_0002767 3300045049 Bacteria 11294
631 Ga0466959_0142076 3300045049 Bacteria 1696
632 Ga0466958_0000011 3300045836 Bacteria 57675
633 Ga0466958_0094881 3300045836 Bacteria 1849
634 Ga0466967_0107090 3300045976 Bacteria 2564
635 Ga0466967_0253317 3300045976 Bacteria 1682
636 Ga0466967_0431828 3300045976 Bacteria 1285
637 Ga0495592_0000041 3300046454 Bacteria 123431
638 Ga0495592_0006194 3300046454 Bacteria 8894
639 Ga0495592_0048918 3300046454 Bacteria 3143
640 Ga0495592_0049507 3300046454 Bacteria 3124
641 Ga0495592_0162824 3300046454 Bacteria 1533
642 Ga0495603_0057783 3300046455 Bacteria 2294
643 Ga0495603_0096208 3300046455 Bacteria 1730
644 Ga0495629_0083956 3300046459 Bacteria 2222
645 Ga0495629_0290849 3300046459 Bacteria 1120
646 Ga0495641_0057030 3300046461 Bacteria 1769
647 Ga0495641_0060153 3300046461 Bacteria 1716
648 Ga0495651_0000018 3300046462 Bacteria 123195
649 Ga0495651_0013924 3300046462 Bacteria 6219
650 Ga0495651_0015224 3300046462 Bacteria 5944
651 Ga0495651_0024775 3300046462 Bacteria 4668
652 Ga0495651_0025147 3300046462 Bacteria 4633
653 Ga0495651_0031827 3300046462 Bacteria 4112
654 Ga0495651_0049212 3300046462 Bacteria 3253
655 Ga0495651_0100191 3300046462 Bacteria 2158
656 Ga0495653_0003374 3300046463 Bacteria 12842
657 Ga0495653_0033876 3300046463 Bacteria 4044
658 Ga0495653_0039049 3300046463 Bacteria 3721
659 Ga0495653_0063611 3300046463 Bacteria 2783
660 Ga0495653_0112527 3300046463 Bacteria 1953
661 Ga0495580_0060395 3300046472 Bacteria 2663
662 Ga0495582_0001366 3300046473 Bacteria 13732
663 Ga0495582_0003779 3300046473 Bacteria 8535
664 Ga0495582_0008576 3300046473 Bacteria 5636
665 Ga0495639_0001907 3300046475 Bacteria 9248
666 Ga0495639_0030120 3300046475 Bacteria 2411
667 Ga0495662_0000323 3300046476 Bacteria 20764
668 Ga0495662_0016058 3300046476 Bacteria 3631
669 Ga0495664_0003915 3300046477 Bacteria 8124
670 Ga0495664_0019900 3300046477 Bacteria 3865
671 Ga0495664_0056282 3300046477 Bacteria 2339
672 Ga0495664_0130640 3300046477 Bacteria 1520
673 Ga0495664_0178354 3300046477 Bacteria 1288
674 Ga0495594_0050606 3300046499 Bacteria 2285
675 Ga0495608_0000039 3300046511 Bacteria 123195
676 Ga0495608_0000792 3300046511 Bacteria 22187
677 Ga0495608_0014699 3300046511 Bacteria 5432
678 Ga0495608_0016427 3300046511 Bacteria 5122
679 Ga0495608_0043536 3300046511 Bacteria 2999
680 Ga0495618_0013419 3300046514 Bacteria 4984
681 Ga0495618_0013910 3300046514 Bacteria 4898
682 Ga0495628_0011804 3300046516 Bacteria 7372
683 Ga0495628_0065959 3300046516 Bacteria 2830
684 Ga0495628_0074840 3300046516 Bacteria 2637
685 Ga0495628_0154569 3300046516 Bacteria 1746
686 Ga0495630_0000896 3300046517 Bacteria 20817
687 Ga0495630_0043362 3300046517 Bacteria 3360
688 Ga0495630_0055620 3300046517 Bacteria 2965
689 Ga0495630_0181480 3300046517 Bacteria 1605
690 Ga0495648_0001410 3300046524 Bacteria 23498
691 Ga0495652_0000092 3300046529 Bacteria 96258
692 Ga0495652_0012269 3300046529 Bacteria 7735
693 Ga0495652_0029773 3300046529 Bacteria 4793
694 Ga0495652_0090911 3300046529 Bacteria 2496
695 Ga0495652_0166531 3300046529 Bacteria 1705
696 Ga0495665_0008007 3300046531 Bacteria 5733
697 Ga0495665_0045010 3300046531 Bacteria 2344
698 Ga0495665_0093249 3300046531 Bacteria 1582
699 Ga0495640_0018148 3300046533 Bacteria 5227
700 Ga0495640_0035132 3300046533 Bacteria 3549
701 Ga0495640_0052974 3300046533 Bacteria 2783
702 Ga0495640_0057070 3300046533 Bacteria 2665
703 Ga0495586_0011918 3300046535 Bacteria 4618
704 Ga0495587_0000034 3300046536 Bacteria 123432
705 Ga0495587_0009139 3300046536 Bacteria 6357
706 Ga0495587_0020626 3300046536 Bacteria 4065
707 Ga0495587_0023913 3300046536 Bacteria 3750
708 Ga0495587_0037206 3300046536 Bacteria 2923
709 Ga0495587_0068912 3300046536 Bacteria 2060
710 Ga0495645_0005327 3300046543 Bacteria 8812
711 Ga0495645_0016393 3300046543 Bacteria 5288
712 Ga0495645_0063519 3300046543 Bacteria 2673
713 Ga0495622_0020308 3300046557 Bacteria 3093
714 Ga0495667_0000095 3300046559 Bacteria 63648
715 Ga0495667_0007511 3300046559 Bacteria 7396
716 Ga0495667_0014933 3300046559 Bacteria 5247
717 Ga0495667_0098838 3300046559 Bacteria 1889
718 Ga0495667_0104763 3300046559 Bacteria 1828
719 Ga0495634_0019677 3300046642 Bacteria 4794
720 Ga0495634_0043952 3300046642 Bacteria 3026
721 Ga0495634_0054893 3300046642 Bacteria 2665
722 Ga0495634_0089447 3300046642 Bacteria 2001
723 Ga0495611_0029525 3300046648 Bacteria 2405
724 Ga0495635_0007354 3300046663 Bacteria 7687
725 Ga0495635_0013253 3300046663 Bacteria 5770
726 Ga0495635_0033618 3300046663 Bacteria 3556
727 Ga0495635_0042046 3300046663 Bacteria 3157
728 Ga0495635_0043188 3300046663 Bacteria 3111
729 Ga0495635_0080411 3300046663 Bacteria 2230
730 Ga0495635_0151563 3300046663 Bacteria 1578
731 Ga0495588_0033326 3300046674 Bacteria 2600
732 Ga0495588_0128642 3300046674 Bacteria 1336
733 Ga0495657_0002131 3300046675 Bacteria 16805
734 Ga0495657_0012327 3300046675 Bacteria 6353
735 Ga0495657_0017361 3300046675 Bacteria 5226
736 Ga0495657_0018566 3300046675 Bacteria 5027
737 Ga0495657_0025382 3300046675 Bacteria 4208
738 Ga0495657_0058797 3300046675 Bacteria 2551
739 Ga0495657_0059200 3300046675 Bacteria 2541
740 Ga0495657_0068607 3300046675 Bacteria 2322
741 Ga0495657_0093482 3300046675 Bacteria 1924
742 Ga0495599_0000079 3300046678 Bacteria 67315
743 Ga0495599_0013573 3300046678 Bacteria 5034
744 Ga0495599_0067731 3300046678 Bacteria 2229
745 Ga0495599_0071360 3300046678 Bacteria 2167
746 Ga0495599_0105168 3300046678 Bacteria 1758
747 Ga0495623_0003739 3300046679 Bacteria 10038
748 Ga0495623_0069041 3300046679 Bacteria 2203
749 Ga0495623_0137252 3300046679 Bacteria 1458
750 Ga0495647_0002446 3300046681 Bacteria 5856
751 Ga0495658_0020999 3300046683 Bacteria 3436
752 Ga0495658_0128841 3300046683 Bacteria 1538
753 Ga0495658_0149920 3300046683 Bacteria 1432
754 Ga0495613_0001028 3300046689 Bacteria 21269
755 Ga0495624_0018109 3300046690 Bacteria 4714
756 Ga0495624_0024004 3300046690 Bacteria 4016
757 Ga0495624_0040782 3300046690 Bacteria 2972
758 Ga0495624_0154207 3300046690 Bacteria 1404
759 Ga0495600_0013528 3300046809 Bacteria 5130
760 Ga0495600_0047867 3300046809 Bacteria 2789
761 Ga0495600_0092304 3300046809 Bacteria 1974
762 Ga0495581_0011872 3300047315 Bacteria 5041
763 Ga0495581_0047659 3300047315 Bacteria 2476
764 Ga0495581_0052996 3300047315 Bacteria 2343
765 Ga0495581_0056829 3300047315 Bacteria 2258
766 Ga0495581_0063776 3300047315 Bacteria 2128
767 Ga0495604_0000039 3300047317 Bacteria 123431
768 Ga0495604_0048742 3300047317 Bacteria 3294
769 Ga0495604_0074440 3300047317 Bacteria 2559
770 Ga0495604_0091529 3300047317 Bacteria 2255
771 Ga0495674_0004472 3300047319 Bacteria 13454
772 Ga0495674_0006519 3300047319 Bacteria 11198
773 Ga0495674_0010815 3300047319 Bacteria 8632
774 Ga0495674_0024703 3300047319 Bacteria 5515
775 Ga0495674_0045898 3300047319 Bacteria 3879
776 Ga0495674_0056567 3300047319 Bacteria 3434
777 Ga0495674_0093454 3300047319 Bacteria 2566
778 Ga0495674_0147620 3300047319 Bacteria 1973
779 Ga0495674_0196407 3300047319 Bacteria 1675
780 Ga0495674_0269796 3300047319 Bacteria 1396
781 Ga0495676_0002873 3300047321 Bacteria 15536
782 Ga0495680_0000028 3300047322 Bacteria 112865
783 Ga0495680_0002589 3300047322 Bacteria 18416
784 Ga0495680_0011463 3300047322 Bacteria 7848
785 Ga0495680_0014737 3300047322 Bacteria 6758
786 Ga0495680_0028323 3300047322 Bacteria 4594
787 Ga0495680_0032047 3300047322 Bacteria 4271
788 Ga0495680_0096729 3300047322 Bacteria 2204
789 Ga0495680_0101464 3300047322 Bacteria 2143
790 Ga0495675_0001400 3300047444 Bacteria 14602
791 Ga0495675_0007204 3300047444 Bacteria 6849
792 Ga0495675_0009661 3300047444 Bacteria 6009
793 Ga0495684_0003210 3300047471 Bacteria 12824
794 Ga0495684_0011328 3300047471 Bacteria 6884
795 Ga0495684_0014614 3300047471 Bacteria 6041
796 Ga0495684_0021455 3300047471 Bacteria 4973
797 Ga0495684_0026257 3300047471 Bacteria 4474
798 Ga0495684_0062858 3300047471 Bacteria 2824
799 Ga0495684_0219504 3300047471 Bacteria 1394
800 Ga0495684_0245445 3300047471 Bacteria 1304
801 Ga0495684_0278255 3300047471 Bacteria 1208
802 Ga0495593_0006382 3300047673 Bacteria 6916
803 Ga0495593_0009521 3300047673 Bacteria 5636
804 Ga0495593_0073232 3300047673 Bacteria 1777
805 Ga0495602_0000043 3300048088 Bacteria 123431
806 Ga0495602_0025532 3300048088 Bacteria 5716
807 Ga0495602_0031454 3300048088 Bacteria 5017
808 Ga0495602_0057152 3300048088 Bacteria 3425
809 Ga0495602_0194084 3300048088 Bacteria 1554
810 Ga0495602_0233423 3300048088 Bacteria 1380
811 Ga0495614_0061516 3300048089 Bacteria 1613
812 Ga0496100_0069029 3300048903 Bacteria 2352
813 Ga0496101_0061619 3300048904 Bacteria 2725
814 Ga0496101_0185729 3300048904 Bacteria 1602
815 Ga0496101_0262810 3300048904 Bacteria 1346
816 Ga0496102_0016560 3300048905 Bacteria 6443
817 Ga0496102_0069522 3300048905 Bacteria 3232
818 Ga0496102_0102988 3300048905 Bacteria 2654
819 Ga0496103_0048563 3300048906 Bacteria 2622
820 Ga0496103_0251044 3300048906 Bacteria 1138
821 Ga0496104_0008746 3300048907 Bacteria 9002
822 Ga0496104_0017242 3300048907 Bacteria 6572
823 Ga0496104_0029512 3300048907 Bacteria 5088
824 Ga0496104_0051025 3300048907 Bacteria 3903
825 Ga0496105_0000867 3300048908 Bacteria 20689
826 Ga0496105_0007329 3300048908 Bacteria 8524
827 Ga0496105_0017432 3300048908 Bacteria 5758
828 Ga0496105_0096956 3300048908 Bacteria 2435
829 Ga0496105_0259830 3300048908 Bacteria 1404
830 Ga0496106_0027164 3300048909 Bacteria 4262
831 Ga0496106_0080285 3300048909 Bacteria 2505
832 Ga0496106_0116252 3300048909 Bacteria 2086
833 Ga0496107_0005550 3300048910 Bacteria 8639
834 Ga0496107_0020298 3300048910 Bacteria 4691
835 Ga0496108_0036618 3300048911 Bacteria 4083
836 Ga0496108_0077149 3300048911 Bacteria 2817
837 Ga0496108_0169025 3300048911 Bacteria 1891
838 Ga0496108_0171849 3300048911 Bacteria 1875
839 Ga0496108_0212366 3300048911 Bacteria 1680
840 Ga0496108_0251848 3300048911 Bacteria 1536
841 Ga0496108_0258695 3300048911 Bacteria 1515
842 Ga0496109_0007682 3300048912 Bacteria 9141
843 Ga0496109_0042456 3300048912 Bacteria 4119
844 Ga0496109_0059927 3300048912 Bacteria 3477
845 Ga0496109_0083065 3300048912 Bacteria 2954
846 Ga0496109_0437302 3300048912 Bacteria 1236
847 Ga0496110_0032843 3300048913 Bacteria 4486
848 Ga0496110_0040715 3300048913 Bacteria 4050
849 Ga0496110_0100784 3300048913 Bacteria 2589
850 Ga0496111_0135253 3300048914 Bacteria 1825
851 Ga0496112_0000776 3300048915 Bacteria 22480
852 Ga0496112_0051893 3300048915 Bacteria 4023
853 Ga0496112_0093175 3300048915 Bacteria 2983
854 Ga0496112_0119584 3300048915 Bacteria 2604
855 Ga0496112_0253291 3300048915 Bacteria 1711
856 Ga0496113_0134340 3300048916 Bacteria 1943
857 Ga0496113_0197190 3300048916 Bacteria 1599
858 Ga0496113_0202061 3300048916 Bacteria 1579
859 Ga0496114_0011016 3300048917 Bacteria 7210
860 Ga0496114_0050302 3300048917 Bacteria 3469
861 Ga0496114_0062546 3300048917 Bacteria 3115
862 Ga0496114_0161655 3300048917 Bacteria 1948
863 Ga0496115_0000561 3300048918 Bacteria 28823
864 Ga0496115_0003046 3300048918 Bacteria 12028
865 Ga0496115_0066274 3300048918 Bacteria 2918
866 Ga0496115_0143760 3300048918 Bacteria 1968
867 Ga0496119_0065714 3300048922 Bacteria 2147
868 Ga0496121_0083825 3300048924 Bacteria 2515
869 Ga0496124_0084426 3300048927 Bacteria 2604
870 Ga0496126_0060184 3300048929 Bacteria 3417
871 Ga0496126_0090211 3300048929 Bacteria 2697
872 Ga0496126_0115226 3300048929 Bacteria 2337
873 Ga0496126_0194423 3300048929 Bacteria 1716
874 Ga0501036_0098742 3300049572 Bacteria 2469
875 Ga0501039_0026986 3300049575 Bacteria 4415
876 Ga0501041_0035247 3300049577 Bacteria 3032
877 Ga0501041_0051541 3300049577 Bacteria 2508
878 Ga0501042_0289267 3300049578 Bacteria 1184
879 Ga0501035_0125821 3300049822 Bacteria 2237
880 nmdc:mga05p37_11179_c1 3300050507 Bacteria 10669
881 nmdc:mga05p37_22626_c1 3300050507 Bacteria 7622
882 nmdc:mga05p37_2523_c1 3300050507 Bacteria 21280
883 nmdc:mga05p37_269656_c1 3300050507 Bacteria 2034
884 nmdc:mga09592_36734_c1 3300050508 Bacteria 4105
885 nmdc:mga09592_79367_c1 3300050508 Bacteria 2794
886 nmdc:mga0qj67_19010_c1 3300050509 Bacteria 5245
887 nmdc:mga06r32_1163_c2 3300050510 Bacteria 6275
888 nmdc:mga06r32_44229_c1 3300050510 Bacteria 4240
889 nmdc:mga08y16_13231_c1 3300050511 Bacteria 8677
890 nmdc:mga08y16_142984_c1 3300050511 Bacteria 2487
891 nmdc:mga08y16_147441_c1 3300050511 Bacteria 2446
892 nmdc:mga0n895_151041_c1 3300050512 Bacteria 2353
893 nmdc:mga0n895_151509_c1 3300050512 Bacteria 2349
894 nmdc:mga0n895_229883_c1 3300050512 Bacteria 1883
895 nmdc:mga0n895_26038_c1 3300050512 Bacteria 5533
896 nmdc:mga0n895_403998_c1 3300050512 Bacteria 1381
897 nmdc:mga0n895_99738_c1 3300050512 Bacteria 2913
898 nmdc:mga0rr50_131443_c1 3300050513 Bacteria 2005
899 nmdc:mga0rr50_219629_c1 3300050513 Bacteria 1569
900 nmdc:mga0rr50_34496_c1 3300050513 Bacteria 3624
901 nmdc:mga08x19_20175_c1 3300050514 Bacteria 4103
902 nmdc:mga08x19_59388_c1 3300050514 Bacteria 2476
903 nmdc:mga0a205_28564_c1 3300050515 Bacteria 3867
904 Ga0495601_0005115 3300053077 Bacteria 7618
905 Ga0495601_0017476 3300053077 Bacteria 4354
906 Ga0495601_0055666 3300053077 Bacteria 2504
907 Ga0495601_0066440 3300053077 Bacteria 2295
908 Ga0495612_0027468 3300053078 Bacteria 2289
909 Ga0495595_0001127 3300053084 Bacteria 10340
910 Ga0495595_0002342 3300053084 Bacteria 7379
911 Ga0495595_0011263 3300053084 Bacteria 3735
912 Ga0495595_0038361 3300053084 Bacteria 2182
913 Ga0495595_0111972 3300053084 Bacteria 1324
914 Ga0495619_0002498 3300053085 Bacteria 12040
915 Ga0495619_0004190 3300053085 Bacteria 9201
916 Ga0495619_0091419 3300053085 Bacteria 2060
917 Ga0495619_0196464 3300053085 Bacteria 1397
918 Ga0495619_0211778 3300053085 Bacteria 1342
919 Ga0500594_0044935 3300053118 Bacteria 1223
920 Ga0501084_0073795 3300054114 Bacteria 2857
921 Ga0587084_006149 3300059477 Bacteria 1446
922 Ga0587077_013254 3300059493 Bacteria 1334
923 Ga0587080_008906 3300059503 Bacteria 1448
924 Ga0587082_005514 3300059504 Bacteria 1648
925 Ga0587082_009715 3300059504 Bacteria 1370
926 Ga0587083_0002177 3300059505 Bacteria 2390
927 Ga0587085_005247 3300059506 Bacteria 1518
928 Ga0587067_008933 3300059640 Bacteria 1480
929 Ga0587072_010019 3300059643 Bacteria 1524
930 Ga0587079_012556 3300059647 Bacteria 1387
931 Ga0587107_005676 3300059652 Bacteria 1331
932 Ga0466962_0004303 3300061719 Bacteria 6826
933 Ga0530510_0193782 3300061734 Bacteria 1509
934 2676485579 2675903059 Bacteria 8644972
935 2753271375 2751185782 Bacteria 11227053
936 2816424236 2816332119 Bacteria 8120218
937 2866553888 2866552031 Bacteria 5824618
938 2895435969 2895427314 Bacteria 13147766
939 Ga0207680_10164443
940 JGI24739J22299_10015173
941 JGI24737J22298_10002884
942 JGI24738J21930_10004422
943 JGI24751J29686_10008716
944 JGI25404J52841_10000110
945 JGI25405J52794_10022847
946 Ga0058863_10057907
947 Ga0058861_12076710
948 Ga0070676_10063373
949 Ga0070683_100006175
950 Ga0070683_100008858
951 Ga0070683_100023868
952 Ga0070683_100128333
953 Ga0070683_100153074
954 Ga0070690_100053696
955 Ga0068869_100016172
956 Ga0070666_10003687
957 Ga0070680_100130257
958 Ga0070682_100001530
959 Ga0070682_100028308
960 Ga0070682_100112247
961 Ga0068868_100016661
962 Ga0068868_100056609
963 Ga0068868_100298950
964 Ga0068868_100400304
965 Ga0070660_100291076
966 Ga0070689_100007719
967 Ga0070691_10039297
968 Ga0070687_100002744
969 Ga0070687_100045413
970 Ga0070687_100059587
971 Ga0070661_100052906
972 Ga0070661_100128713
973 Ga0070692_10001338
974 Ga0070692_10006917
975 Ga0070668_100069076
976 Ga0070668_100102562
977 Ga0070668_100222106
978 Ga0070669_100379382
979 Ga0070675_100019552
980 Ga0070675_100042292
981 Ga0070675_100098235
982 Ga0070671_100098521
983 Ga0070673_100058317
984 Ga0070673_100123139
985 Ga0070688_100086216
986 Ga0070688_100123579
987 Ga0070659_100028002
988 Ga0070667_100294305
989 Ga0070709_10001845
990 Ga0070709_10004698
991 Ga0070709_10012100
992 Ga0070709_10104565
993 Ga0070714_100014299
994 Ga0070714_100031003
995 Ga0070714_100081309
996 Ga0070714_100094470
997 Ga0070714_100099899
998 Ga0070714_100106310
999 Ga0070714_100135331
1000 Ga0070714_100360144
1001 Ga0070713_100001308
1002 Ga0070713_100013874
1003 Ga0070713_100078635
1004 Ga0070713_100084260
1005 Ga0070713_100097261
1006 Ga0070713_100105288
1007 Ga0070713_100198755
1008 Ga0070713_100323171
1009 Ga0070710_10000547
1010 Ga0070710_10015217
1011 Ga0070710_10015577
1012 Ga0070710_10044290
1013 Ga0070710_10047328
1014 Ga0070711_100013257
1015 Ga0070711_100031143
1016 Ga0070711_100305464
1017 Ga0070705_100035968
1018 Ga0070705_100059923
1019 Ga0070700_100001333
1020 Ga0070700_100006893
1021 Ga0070700_100143285
1022 Ga0070694_100034606
1023 Ga0070708_100008323
1024 Ga0070708_100021238
1025 Ga0070708_100174560
1026 Ga0070708_100223433
1027 Ga0070708_100461179
1028 Ga0070663_100012026
1029 Ga0070663_100021451
1030 Ga0070663_100121042
1031 Ga0070678_100121963
1032 Ga0070678_100277217
1033 Ga0070662_100170815
1034 Ga0070681_10034274
1035 Ga0070681_10203892
1036 Ga0070681_10204750
1037 Ga0070681_10301669
1038 Ga0070685_10010463
1039 Ga0070685_10039298
1040 Ga0070706_100020034
1041 Ga0070706_100037288
1042 Ga0070706_100123253
1043 Ga0070706_100137874
1044 Ga0070706_100282995
1045 Ga0070706_100384709
1046 Ga0070707_100000160
1047 Ga0070707_100008664
1048 Ga0070707_100045463
1049 Ga0070707_100056840
1050 Ga0070707_100115064
1051 Ga0070707_100119699
1052 Ga0070707_100344183
1053 Ga0070707_100352832
1054 Ga0070698_100001469
1055 Ga0070698_100017508
1056 Ga0070698_100018408
1057 Ga0070698_100018701
1058 Ga0070698_100020972
1059 Ga0070698_100040643
1060 Ga0070698_100064192
1061 Ga0070698_100079808
1062 Ga0070679_100252394
1063 Ga0070679_100262987
1064 Ga0070679_100378871
1065 Ga0070684_100033201
1066 Ga0070684_100037560
1067 Ga0070684_100067262
1068 Ga0070684_100152141
1069 Ga0070697_100005308
1070 Ga0068853_100061872
1071 Ga0068853_100134809
1072 Ga0070672_100003525
1073 Ga0070672_100037372
1074 Ga0070696_100111280
1075 Ga0070693_100022094
1076 Ga0070693_100081175
1077 Ga0070693_100136975
1078 Ga0070665_100112224
1079 Ga0070665_100185375
1080 Ga0070665_100464171
1081 Ga0068855_100166485
1082 Ga0068855_100261283
1083 Ga0070664_100009450
1084 Ga0070664_100072800
1085 Ga0070664_100106180
1086 Ga0068857_100021495
1087 Ga0068857_100054923
1088 Ga0068857_100075790
1089 Ga0068857_100148902
1090 Ga0068857_100387612
1091 Ga0068857_100394657
1092 Ga0068854_100036737
1093 Ga0068854_100040277
1094 Ga0068856_100064463
1095 Ga0068856_100168302
1096 Ga0068856_100229591
1097 Ga0070702_100002665
1098 Ga0070702_100038969
1099 Ga0068852_100041522
1100 Ga0068852_100055553
1101 Ga0068864_100069147
1102 Ga0068866_10042209
1103 Ga0068861_100001645
1104 Ga0068861_100066517
1105 Ga0068851_10003583
1106 Ga0068870_10003040
1107 Ga0068870_10024595
1108 Ga0068863_100257253
1109 Ga0068863_100276366
1110 Ga0068863_100373612
1111 Ga0068858_100045820
1112 Ga0068860_100023866
1113 Ga0068860_100046507
1114 Ga0068860_100357268
1115 Ga0068862_100130519
1116 Ga0081455_10004246
1117 Ga0081455_10068353
1118 Ga0081538_10007127
1119 Ga0081538_10017739
1120 Ga0081538_10073813
1121 Ga0081540_1000120
1122 Ga0081540_1000151
1123 Ga0081540_1009731
1124 Ga0081540_1090542
1125 Ga0081539_10000088
1126 Ga0081539_10019620
1127 Ga0081539_10031233
1128 Ga0070717_10017009
1129 Ga0070717_10020504
1130 Ga0070717_10157207
1131 Ga0070717_10168002
1132 Ga0070717_10267198
1133 Ga0070717_10314877
1134 Ga0070717_10445640
1135 Ga0075432_10003181
1136 Ga0075432_10024624
1137 Ga0070715_10089936
1138 Ga0070716_100000463
1139 Ga0070716_100001656
1140 Ga0070716_100041072
1141 Ga0070716_100060795
1142 Ga0070716_100180160
1143 Ga0070712_100016067
1144 Ga0070712_100030983
1145 Ga0070712_100038697
1146 Ga0070712_100048694
1147 Ga0070712_100098642
1148 Ga0068871_100015128
1149 Ga0068871_100227547
1150 Ga0075428_100016092
1151 Ga0075428_100141187
1152 Ga0075428_100175309
1153 Ga0075430_100015969
1154 Ga0075430_100050093
1155 Ga0075431_100005042
1156 Ga0075431_100204215
1157 Ga0075431_100438901
1158 Ga0075433_10012569
1159 Ga0075433_10034987
1160 Ga0075433_10210959
1161 Ga0075434_100024769
1162 Ga0075434_100027569
1163 Ga0075434_100100357
1164 Ga0075434_100153407
1165 Ga0075429_100000523
1166 Ga0075429_100064950
1167 Ga0075429_100068612
1168 Ga0068865_100002913
1169 Ga0075436_100030844
1170 Ga0075436_100039047
1171 Ga0075436_100081511
1172 Ga0075436_100172432
1173 Ga0075435_100016706
1174 Ga0075435_100029014
1175 Ga0075435_100042523
1176 Ga0075435_100158369
1177 Ga0075435_100209861
1178 Ga0099794_10157742
1179 Ga0105251_10007024
1180 Ga0105251_10028522
1181 Ga0105240_10168020
1182 Ga0105240_10231463
1183 Ga0111539_10005398
1184 Ga0111539_10096068
1185 Ga0111539_10167769
1186 Ga0105245_10010656
1187 Ga0105245_10024069
1188 Ga0105245_10054090
1189 Ga0105247_10124515
1190 Ga0114129_10008192
1191 Ga0114129_10259716
1192 Ga0114129_10341052
1193 Ga0105243_10002407
1194 Ga0105243_10056508
1195 Ga0105243_10088166
1196 Ga0105243_10155164
1197 Ga0105241_10079210
1198 Ga0105241_10092516
1199 Ga0105248_10013191
1200 Ga0105248_10125373
1201 Ga0105237_10119773
1202 Ga0105238_10011060
1203 Ga0105238_10118337
1204 Ga0105249_10005142
1205 Ga0105249_10275602
1206 Ga0105239_10251867
1207 Ga0105239_10278877
1208 Ga0105246_10064614
1209 Ga0105246_10094692
1210 Ga0105246_10109161
1211 Ga0157326_1006018
1212 Ga0157371_10099447
1213 Ga0157371_10160338
1214 Ga0157370_10169223
1215 Ga0157369_10025837
1216 Ga0157369_10066064
1217 Ga0157374_10110540
1218 Ga0157374_10268006
1219 Ga0157378_10125781
1220 Ga0163162_10180036
1221 Ga0157372_10048110
1222 Ga0157372_10151578
1223 Ga0157372_10163633
1224 Ga0157372_10299674
1225 Ga0157375_10084612
1226 Ga0157375_10364080
1227 Ga0157375_10658329
1228 Ga0163163_10033952
1229 Ga0163163_10112154
1230 Ga0163163_10172600
1231 Ga0163163_10266266
1232 Ga0157380_10017676
1233 Ga0157380_10135123
1234 Ga0182008_10015075
1235 Ga0157377_10002600
1236 Ga0157377_10013024
1237 Ga0157379_10083516
1238 Ga0157379_10299057
1239 Ga0197907_10163216
1240 Ga0197907_10622897
1241 Ga0197907_11334031
1242 Ga0206356_10944960
1243 Ga0206356_11103474
1244 Ga0206356_11265883
1245 Ga0206349_1015767
1246 Ga0206349_1048544
1247 Ga0206349_1920315
1248 Ga0206355_1227207
1249 Ga0206351_10398476
1250 Ga0206352_10632914
1251 Ga0206352_11332995
1252 Ga0206350_10871958
1253 Ga0206354_10921791
1254 Ga0206353_11114840
1255 Ga0206353_11985371
1256 Ga0213873_10048281
1257 Ga0213876_10015660
1258 Ga0213875_10000369
1259 Ga0213875_10001208
1260 Ga0213875_10023643
1261 Ga0213875_10036111
1262 Ga0224712_10001286
1263 Ga0224712_10027858
1264 Ga0224712_10052709
1265 Ga0224572_1003707
1266 Ga0207656_10044371
1267 Ga0207653_10004343
1268 Ga0207692_10001169
1269 Ga0207692_10001923
1270 Ga0207692_10002346
1271 Ga0207692_10013014
1272 Ga0207692_10038571
1273 Ga0207710_10073656
1274 Ga0207688_10002367
1275 Ga0207688_10048571
1276 Ga0207688_10158150
1277 Ga0207647_10050610
1278 Ga0207647_10054467
1279 Ga0207699_10002039
1280 Ga0207699_10007248
1281 Ga0207699_10017119
1282 Ga0207699_10301285
1283 Ga0207645_10047084
1284 Ga0207643_10000047
1285 Ga0207643_10001968
1286 Ga0207705_10016674
1287 Ga0207705_10072054
1288 Ga0207684_10004439
1289 Ga0207684_10008143
1290 Ga0207684_10064723
1291 Ga0207684_10179885
1292 Ga0207684_10227637
1293 Ga0207654_10190239
1294 Ga0207707_10005779
1295 Ga0207695_10165807
1296 Ga0207671_10232063
1297 Ga0207693_10017053
1298 Ga0207693_10031061
1299 Ga0207693_10120882
1300 Ga0207693_10126582
1301 Ga0207693_10133772
1302 Ga0207693_10144608
1303 Ga0207693_10192006
1304 Ga0207663_10003284
1305 Ga0207663_10044124
1306 Ga0207663_10047414
1307 Ga0207663_10217526
1308 Ga0207660_10006197
1309 Ga0207662_10003528
1310 Ga0207662_10067944
1311 Ga0207657_10010443
1312 Ga0207657_10026802
1313 Ga0207649_10030950
1314 Ga0207652_10160973
1315 Ga0207646_10000202
1316 Ga0207646_10009346
1317 Ga0207646_10012343
1318 Ga0207646_10059544
1319 Ga0207646_10195762
1320 Ga0207694_10209061
1321 Ga0207694_10273430
1322 Ga0207650_10003706
1323 Ga0207659_10006605
1324 Ga0207659_10052872
1325 Ga0207687_10008057
1326 Ga0207700_10000802
1327 Ga0207700_10002718
1328 Ga0207700_10003348
1329 Ga0207700_10003872
1330 Ga0207700_10015980
1331 Ga0207700_10031504
1332 Ga0207700_10061022
1333 Ga0207700_10075878
1334 Ga0207700_10076603
1335 Ga0207700_10162415
1336 Ga0207700_10278937
1337 Ga0207700_10301169
1338 Ga0207664_10000434
1339 Ga0207664_10003595
1340 Ga0207664_10004776
1341 Ga0207664_10010630
1342 Ga0207664_10019852
1343 Ga0207664_10055160
1344 Ga0207664_10086870
1345 Ga0207664_10126895
1346 Ga0207664_10141270
1347 Ga0207664_10212546
1348 Ga0207664_10279625
1349 Ga0207664_10305498
1350 Ga0207664_10368877
1351 Ga0207644_10021893
1352 Ga0207690_10039496
1353 Ga0207690_10171174
1354 Ga0207706_10018761
1355 Ga0207709_10013687
1356 Ga0207709_10133946
1357 Ga0207669_10197500
1358 Ga0207704_10039080
1359 Ga0207665_10001204
1360 Ga0207665_10001322
1361 Ga0207665_10003578
1362 Ga0207665_10049975
1363 Ga0207665_10053760
1364 Ga0207665_10096257
1365 Ga0207665_10119269
1366 Ga0207691_10006524
1367 Ga0207691_10017101
1368 Ga0207691_10053583
1369 Ga0207711_10022453
1370 Ga0207711_10089182
1371 Ga0207711_10145181
1372 Ga0207689_10007643
1373 Ga0207689_10010182
1374 Ga0207661_10001927
1375 Ga0207661_10006171
1376 Ga0207661_10009958
1377 Ga0207661_10061703
1378 Ga0207661_10158806
1379 Ga0207661_10198120
1380 Ga0207679_10020736
1381 Ga0207679_10039648
1382 Ga0207667_10051312
1383 Ga0207667_10360948
1384 Ga0207651_10004430
1385 Ga0207651_10179406
1386 Ga0207712_10092290
1387 Ga0207712_10200918
1388 Ga0207668_10251220
1389 Ga0207668_10290289
1390 Ga0207640_10120096
1391 Ga0207658_10126879
1392 Ga0207677_10013596
1393 Ga0207703_10077606
1394 Ga0207639_10207109
1395 Ga0207678_10001230
1396 Ga0207678_10003674
1397 Ga0207678_10006155
1398 Ga0207678_10008769
1399 Ga0207678_10051684
1400 Ga0207678_10080795
1401 Ga0207708_10000794
1402 Ga0207708_10018360
1403 Ga0207708_10046783
1404 Ga0207702_10003167
1405 Ga0207702_10106816
1406 Ga0207702_10118392
1407 Ga0207702_10191778
1408 Ga0207702_10241478
1409 Ga0207641_10193282
1410 Ga0207641_10309097
1411 Ga0207648_10003416
1412 Ga0207676_10002675
1413 Ga0207676_10056869
1414 Ga0207676_10071311
1415 Ga0207674_10050696
1416 Ga0207674_10054297
1417 Ga0207674_10121191
1418 Ga0207675_100005946
1419 Ga0207675_100052984
1420 Ga0207683_10001863
1421 Ga0207683_10002655
1422 Ga0207683_10148111
1423 Ga0207698_10002277
1424 Ga0207428_10141506
1425 Ga0268266_10056963
1426 Ga0268266_10077834
1427 Ga0268265_10017611
1428 Ga0268264_10019690
1429 Ga0265337_1002887
1430 Ga0265319_1000732
1431 Ga0265334_10000486
1432 Ga0265323_10004471
1433 Ga0265322_10005894
1434 Ga0265336_10002354
1435 Ga0307515_10145062
1436 Ga0265338_10000761
1437 Ga0265338_10002109
1438 Ga0265338_10013681
1439 Ga0265338_10047411
1440 Ga0307512_10004240
1441 Ga0307512_10129700
1442 Ga0265332_10001578
1443 Ga0265320_10001637
1444 Ga0265325_10021857
1445 Ga0265340_10006866
1446 Ga0265339_10016782
1447 Ga0307513_10145083
1448 Ga0307509_10208241
1449 Ga0307508_10165042
1450 Ga0265314_10050177
1451 Ga0265342_10007626
1452 Ga0307406_10041672
1453 Ga0307406_10200546
1454 Ga0307409_100361037
1455 Ga0307416_100107807
1456 Ga0307415_100049064
1457 Ga0307415_100065727
1458 Ga0307415_100167500
1459 Ga0373948_0014379
1460 Ga0373958_0003018
1461 Ga0373926_0002431
1462 Ga0373926_0007272
1463 Ga0373926_0028332
1464 Ga0373926_0051080
1465 Ga0373928_0008796
1466 Ga0373934_0000099
1467 Ga0373934_0035628
1468 Ga0373934_0061038
1469 Ga0373951_0000016
1470 Ga0373923_0001426
1471 Ga0373923_0018329
1472 Ga0373923_0026084
1473 Ga0373936_0001273
1474 Ga0373936_0026630
1475 Ga0373936_0064291
1476 Ga0373939_0020738
1477 Ga0373945_0005462
1478 Ga0373945_0023887
1479 Ga0373953_0000124
1480 Ga0373953_0011785
1481 Ga0373953_0031266
1482 Ga0373954_0007559
1483 Ga0373954_0028198
1484 Ga0373954_0031824
1485 Ga0373954_0034235
1486 Ga0373956_0058824
1487 Ga0373957_0000241
1488 Ga0373957_0000381
1489 Ga0373957_0019936
1490 Ga0373943_0000572
1491 Ga0373943_0007492
1492 Ga0373943_0127384
1493 Ga0373946_0001505
1494 Ga0373946_0004228
1495 Ga0373946_0041390
1496 Ga0373955_0000055
1497 Ga0373955_0012456
1498 Ga0373955_0032736
1499 Ga0373942_0000635
1500 Ga0373961_0017066
1501 Ga0373962_0038660
1502 Ga0373924_0003857
1503 Ga0373924_0011757
1504 Ga0373924_0014582
1505 Ga0373924_0020488
1506 Ga0373924_0028372
1507 Ga0373924_0062605
1508 Ga0373931_0013318
1509 Ga0373931_0039660
1510 Ga0373935_0014904
1511 Ga0373935_0027567
1512 Ga0373935_0096091
1513 Ga0373927_0001709
1514 Ga0373927_0227440
1515 Ga0373933_0000067
1516 Ga0373933_0005380
1517 Ga0373933_0005970
1518 Ga0373933_0006466
1519 Ga0373933_0019951
1520 Ga0373933_0025783
1521 Ga0373933_0054704
1522 Ga0373933_0071243
1523 Ga0373947_0000014
1524 Ga0373947_0000863
1525 Ga0373947_0045457
1526 Ga0373947_0144890
1527 Ga0373947_0233329
1528 Ga0373937_0028736
1529 Ga0373937_0042408
1530 Ga0373937_0281832
1531 Ga0373925_0000098
1532 Ga0373925_0001067
1533 Ga0373925_0009743
1534 Ga0373925_0025768
1535 Ga0373925_0031917
1536 Ga0373925_0133217
1537 Ga0373925_0236906
1538 Ga0395900_0133845
1539 Ga0395900_0217114
1540 Ga0395905_0019581
1541 Ga0436364_0077046
1542 Ga0436364_0431205
1543 Ga0436364_0516238
1544 Ga0436364_0814106
1545 Ga0436364_0944859
1546 Ga0436364_0950844
1547 Ga0436364_1528828
1548 Ga0395901_0015829
1549 Ga0395901_0276136
1550 Ga0436365_0415357
1551 Ga0436365_1347536
1552 Ga0436363_0003318
1553 Ga0436363_0194878
1554 Ga0436363_0371418
1555 Ga0436362_1050135
1556 Ga0439448_0046634
1557 Ga0439458_0014043
1558 Ga0466965_0126568
1559 Ga0466966_0001861
1560 Ga0466966_0199357
1561 Ga0466963_0000579
1562 Ga0466963_0042202
1563 Ga0466964_0068868
1564 Ga0466971_0017409
1565 Ga0466970_0145287
1566 Ga0466957_0010430
1567 Ga0466957_0308686
1568 Ga0466959_0002767
1569 Ga0466959_0142076
1570 Ga0466958_0000011
1571 Ga0466958_0094881
1572 Ga0466967_0107090
1573 Ga0466967_0253317
1574 Ga0466967_0431828
1575 Ga0495592_0000041
1576 Ga0495592_0006194
1577 Ga0495592_0048918
1578 Ga0495592_0049507
1579 Ga0495592_0162824
1580 Ga0495603_0057783
1581 Ga0495603_0096208
1582 Ga0495629_0083956
1583 Ga0495629_0290849
1584 Ga0495641_0057030
1585 Ga0495641_0060153
1586 Ga0495651_0000018
1587 Ga0495651_0013924
1588 Ga0495651_0015224
1589 Ga0495651_0024775
1590 Ga0495651_0025147
1591 Ga0495651_0031827
1592 Ga0495651_0049212
1593 Ga0495651_0100191
1594 Ga0495653_0003374
1595 Ga0495653_0033876
1596 Ga0495653_0039049
1597 Ga0495653_0063611
1598 Ga0495653_0112527
1599 Ga0495580_0060395
1600 Ga0495582_0001366
1601 Ga0495582_0003779
1602 Ga0495582_0008576
1603 Ga0495639_0001907
1604 Ga0495639_0030120
1605 Ga0495662_0000323
1606 Ga0495662_0016058
1607 Ga0495664_0003915
1608 Ga0495664_0019900
1609 Ga0495664_0056282
1610 Ga0495664_0130640
1611 Ga0495664_0178354
1612 Ga0495594_0050606
1613 Ga0495608_0000039
1614 Ga0495608_0000792
1615 Ga0495608_0014699
1616 Ga0495608_0016427
1617 Ga0495608_0043536
1618 Ga0495618_0013419
1619 Ga0495618_0013910
1620 Ga0495628_0011804
1621 Ga0495628_0065959
1622 Ga0495628_0074840
1623 Ga0495628_0154569
1624 Ga0495630_0000896
1625 Ga0495630_0043362
1626 Ga0495630_0055620
1627 Ga0495630_0181480
1628 Ga0495648_0001410
1629 Ga0495652_0000092
1630 Ga0495652_0012269
1631 Ga0495652_0029773
1632 Ga0495652_0090911
1633 Ga0495652_0166531
1634 Ga0495665_0008007
1635 Ga0495665_0045010
1636 Ga0495665_0093249
1637 Ga0495640_0018148
1638 Ga0495640_0035132
1639 Ga0495640_0052974
1640 Ga0495640_0057070
1641 Ga0495586_0011918
1642 Ga0495587_0000034
1643 Ga0495587_0009139
1644 Ga0495587_0020626
1645 Ga0495587_0023913
1646 Ga0495587_0037206
1647 Ga0495587_0068912
1648 Ga0495645_0005327
1649 Ga0495645_0016393
1650 Ga0495645_0063519
1651 Ga0495622_0020308
1652 Ga0495667_0000095
1653 Ga0495667_0007511
1654 Ga0495667_0014933
1655 Ga0495667_0098838
1656 Ga0495667_0104763
1657 Ga0495634_0019677
1658 Ga0495634_0043952
1659 Ga0495634_0054893
1660 Ga0495634_0089447
1661 Ga0495611_0029525
1662 Ga0495635_0007354
1663 Ga0495635_0013253
1664 Ga0495635_0033618
1665 Ga0495635_0042046
1666 Ga0495635_0043188
1667 Ga0495635_0080411
1668 Ga0495635_0151563
1669 Ga0495588_0033326
1670 Ga0495588_0128642
1671 Ga0495657_0002131
1672 Ga0495657_0012327
1673 Ga0495657_0017361
1674 Ga0495657_0018566
1675 Ga0495657_0025382
1676 Ga0495657_0058797
1677 Ga0495657_0059200
1678 Ga0495657_0068607
1679 Ga0495657_0093482
1680 Ga0495599_0000079
1681 Ga0495599_0013573
1682 Ga0495599_0067731
1683 Ga0495599_0071360
1684 Ga0495599_0105168
1685 Ga0495623_0003739
1686 Ga0495623_0069041
1687 Ga0495623_0137252
1688 Ga0495647_0002446
1689 Ga0495658_0020999
1690 Ga0495658_0128841
1691 Ga0495658_0149920
1692 Ga0495613_0001028
1693 Ga0495624_0018109
1694 Ga0495624_0024004
1695 Ga0495624_0040782
1696 Ga0495624_0154207
1697 Ga0495600_0013528
1698 Ga0495600_0047867
1699 Ga0495600_0092304
1700 Ga0495581_0011872
1701 Ga0495581_0047659
1702 Ga0495581_0052996
1703 Ga0495581_0056829
1704 Ga0495581_0063776
1705 Ga0495604_0000039
1706 Ga0495604_0048742
1707 Ga0495604_0074440
1708 Ga0495604_0091529
1709 Ga0495674_0004472
1710 Ga0495674_0006519
1711 Ga0495674_0010815
1712 Ga0495674_0024703
1713 Ga0495674_0045898
1714 Ga0495674_0056567
1715 Ga0495674_0093454
1716 Ga0495674_0147620
1717 Ga0495674_0196407
1718 Ga0495674_0269796
1719 Ga0495676_0002873
1720 Ga0495680_0000028
1721 Ga0495680_0002589
1722 Ga0495680_0011463
1723 Ga0495680_0014737
1724 Ga0495680_0028323
1725 Ga0495680_0032047
1726 Ga0495680_0096729
1727 Ga0495680_0101464
1728 Ga0495675_0001400
1729 Ga0495675_0007204
1730 Ga0495675_0009661
1731 Ga0495684_0003210
1732 Ga0495684_0011328
1733 Ga0495684_0014614
1734 Ga0495684_0021455
1735 Ga0495684_0026257
1736 Ga0495684_0062858
1737 Ga0495684_0219504
1738 Ga0495684_0245445
1739 Ga0495684_0278255
1740 Ga0495593_0006382
1741 Ga0495593_0009521
1742 Ga0495593_0073232
1743 Ga0495602_0000043
1744 Ga0495602_0025532
1745 Ga0495602_0031454
1746 Ga0495602_0057152
1747 Ga0495602_0194084
1748 Ga0495602_0233423
1749 Ga0495614_0061516
1750 Ga0496100_0069029
1751 Ga0496101_0061619
1752 Ga0496101_0185729
1753 Ga0496101_0262810
1754 Ga0496102_0016560
1755 Ga0496102_0069522
1756 Ga0496102_0102988
1757 Ga0496103_0048563
1758 Ga0496103_0251044
1759 Ga0496104_0008746
1760 Ga0496104_0017242
1761 Ga0496104_0029512
1762 Ga0496104_0051025
1763 Ga0496105_0000867
1764 Ga0496105_0007329
1765 Ga0496105_0017432
1766 Ga0496105_0096956
1767 Ga0496105_0259830
1768 Ga0496106_0027164
1769 Ga0496106_0080285
1770 Ga0496106_0116252
1771 Ga0496107_0005550
1772 Ga0496107_0020298
1773 Ga0496108_0036618
1774 Ga0496108_0077149
1775 Ga0496108_0169025
1776 Ga0496108_0171849
1777 Ga0496108_0212366
1778 Ga0496108_0251848
1779 Ga0496108_0258695
1780 Ga0496109_0007682
1781 Ga0496109_0042456
1782 Ga0496109_0059927
1783 Ga0496109_0083065
1784 Ga0496109_0437302
1785 Ga0496110_0032843
1786 Ga0496110_0040715
1787 Ga0496110_0100784
1788 Ga0496111_0135253
1789 Ga0496112_0000776
1790 Ga0496112_0051893
1791 Ga0496112_0093175
1792 Ga0496112_0119584
1793 Ga0496112_0253291
1794 Ga0496113_0134340
1795 Ga0496113_0197190
1796 Ga0496113_0202061
1797 Ga0496114_0011016
1798 Ga0496114_0050302
1799 Ga0496114_0062546
1800 Ga0496114_0161655
1801 Ga0496115_0000561
1802 Ga0496115_0003046
1803 Ga0496115_0066274
1804 Ga0496115_0143760
1805 Ga0496119_0065714
1806 Ga0496121_0083825
1807 Ga0496124_0084426
1808 Ga0496126_0060184
1809 Ga0496126_0090211
1810 Ga0496126_0115226
1811 Ga0496126_0194423
1812 Ga0501036_0098742
1813 Ga0501039_0026986
1814 Ga0501041_0035247
1815 Ga0501041_0051541
1816 Ga0501042_0289267
1817 Ga0501035_0125821
1818 nmdc:mga05p37_11179_c1
1819 nmdc:mga05p37_22626_c1
1820 nmdc:mga05p37_2523_c1
1821 nmdc:mga05p37_269656_c1
1822 nmdc:mga09592_36734_c1
1823 nmdc:mga09592_79367_c1
1824 nmdc:mga0qj67_19010_c1
1825 nmdc:mga06r32_1163_c2
1826 nmdc:mga06r32_44229_c1
1827 nmdc:mga08y16_13231_c1
1828 nmdc:mga08y16_142984_c1
1829 nmdc:mga08y16_147441_c1
1830 nmdc:mga0n895_151041_c1
1831 nmdc:mga0n895_151509_c1
1832 nmdc:mga0n895_229883_c1
1833 nmdc:mga0n895_26038_c1
1834 nmdc:mga0n895_403998_c1
1835 nmdc:mga0n895_99738_c1
1836 nmdc:mga0rr50_131443_c1
1837 nmdc:mga0rr50_219629_c1
1838 nmdc:mga0rr50_34496_c1
1839 nmdc:mga08x19_20175_c1
1840 nmdc:mga08x19_59388_c1
1841 nmdc:mga0a205_28564_c1
1842 Ga0495601_0005115
1843 Ga0495601_0017476
1844 Ga0495601_0055666
1845 Ga0495601_0066440
1846 Ga0495612_0027468
1847 Ga0495595_0001127
1848 Ga0495595_0002342
1849 Ga0495595_0011263
1850 Ga0495595_0038361
1851 Ga0495595_0111972
1852 Ga0495619_0002498
1853 Ga0495619_0004190
1854 Ga0495619_0091419
1855 Ga0495619_0196464
1856 Ga0495619_0211778
1857 Ga0500594_0044935
1858 Ga0501084_0073795
1859 Ga0587084_006149
1860 Ga0587077_013254
1861 Ga0587080_008906
1862 Ga0587082_005514
1863 Ga0587082_009715
1864 Ga0587083_0002177
1865 Ga0587085_005247
1866 Ga0587067_008933
1867 Ga0587072_010019
1868 Ga0587079_012556
1869 Ga0587107_005676
1870 Ga0466962_0004303
1871 Ga0530510_0193782
1872 2676485579
1873 2753271375
1874 2816424236
1875 2866553888
1876 2895435969

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

25

138

0.96

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

179

306

0.93

PF02254

TrkA_N

TrkA-N domain

172

246

0.84

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

212

337

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h2b-assembly1.cif.gz_B crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution 0.984 1 341
1h2b-assembly1.cif.gz_B crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution 0.9811 1 341
2eer-assembly1.cif.gz_B structural study of project id st2577 from sulfolobus tokodaii strain7 0.9408 1 341
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9403 1 341
2eer-assembly1.cif.gz_B structural study of project id st2577 from sulfolobus tokodaii strain7 0.9382 1 341
ID Description Score Start End Superfamily
1h2bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9834 152 290 3.40.50.720
1h2bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9697 152 290 3.40.50.720
1ntoA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9346 156 288 3.40.50.720
af_Q17334_7_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.929 2 143 3.90.180.10
af_Q0JDV3_9_115_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9183 1 87 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A350JDE9-F1-model_v4 deleted 0.9936 186 341
AF-A0A2U9IIF3-F1-model_v4 Alcohol dehydrogenase 0.9873 1 341 GO:0008270
GO:0016491
AF-A0A177ET13-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9859 1 340 GO:0008270
GO:0016491
GO:0043231
AF-A0A2U9IIF3-F1-model_v4 Alcohol dehydrogenase 0.9845 1 341 GO:0008270
GO:0016491
AF-A0A848DDF5-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9833 1 341 GO:0008270
GO:0016491

Map