F486253
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 372 | 1876 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300025903|Ga0207680_10164443|Ga0207680_101644432 |
| Length | 398 |
| Sequence | MKAVRLHEFHSQPVIDDVPEPTISGPLDVIVKIGGAGVCRTDLHIIEGQWDAAMGTPLPYILGHENAGWVHEVGSAVTNVAVGDTVILHPTPTDGLCHACRAGDDMHCENSEFPGLSRDGGMAEYLLTSARACIKLNPETQPKDVAALADAGITAYHAVRKALPLLYPGTTAVIIGAGGLGHIGIQCLAELTGTTIIVVDRNPDALKLASELGAHHTVVGDGSQVDAVKDLTGGQGAHVVLDFVAEQGAEMDGWNMTRPAGSYYVIGYGGTLEIPTLGIISTERNIIGNIVGTYNELAELMVLAQNGKVTLHTKAYPLDAAPDAFADLDAGRVRGRAGQAKRLLQVRHRPGVLTAPQGEEPGDCLGVRHAGGVDWSAKKARSRRSVSLSSRRSTMRSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 125 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 257 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 258 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 368 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 369 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 370 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 371 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 372 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.95 |
| Metatranscriptomes | 3.52 |
| Isolates | 0.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 5.86 |
| Rhizosphere | 90.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207680_10164443 | 3300025903 | Bacteria | 1490 |
| 2 | JGI24739J22299_10015173 | 3300001989 | Bacteria | 2799 |
| 3 | JGI24737J22298_10002884 | 3300001990 | Bacteria | 6100 |
| 4 | JGI24738J21930_10004422 | 3300002075 | Bacteria | 3446 |
| 5 | JGI24751J29686_10008716 | 3300002459 | Bacteria | 2077 |
| 6 | JGI25404J52841_10000110 | 3300003659 | Bacteria | 8187 |
| 7 | JGI25405J52794_10022847 | 3300003911 | Bacteria | 1270 |
| 8 | Ga0058863_10057907 | 3300004799 | Bacteria | 2465 |
| 9 | Ga0058861_12076710 | 3300004800 | Bacteria | 1568 |
| 10 | Ga0070676_10063373 | 3300005328 | Bacteria | 2202 |
| 11 | Ga0070683_100006175 | 3300005329 | Bacteria | 10049 |
| 12 | Ga0070683_100008858 | 3300005329 | Bacteria | 8566 |
| 13 | Ga0070683_100023868 | 3300005329 | Bacteria | 5474 |
| 14 | Ga0070683_100128333 | 3300005329 | Bacteria | 2398 |
| 15 | Ga0070683_100153074 | 3300005329 | Bacteria | 2186 |
| 16 | Ga0070690_100053696 | 3300005330 | Bacteria | 2578 |
| 17 | Ga0068869_100016172 | 3300005334 | Bacteria | 5024 |
| 18 | Ga0070666_10003687 | 3300005335 | Bacteria | 9282 |
| 19 | Ga0070680_100130257 | 3300005336 | Bacteria | 2104 |
| 20 | Ga0070682_100001530 | 3300005337 | Bacteria | 12957 |
| 21 | Ga0070682_100028308 | 3300005337 | Bacteria | 3369 |
| 22 | Ga0070682_100112247 | 3300005337 | Bacteria | 1818 |
| 23 | Ga0068868_100016661 | 3300005338 | Bacteria | 5464 |
| 24 | Ga0068868_100056609 | 3300005338 | Bacteria | 3097 |
| 25 | Ga0068868_100298950 | 3300005338 | Bacteria | 1367 |
| 26 | Ga0068868_100400304 | 3300005338 | Bacteria | 1185 |
| 27 | Ga0070660_100291076 | 3300005339 | Bacteria | 1337 |
| 28 | Ga0070689_100007719 | 3300005340 | Bacteria | 7537 |
| 29 | Ga0070691_10039297 | 3300005341 | Bacteria | 2235 |
| 30 | Ga0070687_100002744 | 3300005343 | Bacteria | 6680 |
| 31 | Ga0070687_100045413 | 3300005343 | Bacteria | 2243 |
| 32 | Ga0070687_100059587 | 3300005343 | Bacteria | 2011 |
| 33 | Ga0070661_100052906 | 3300005344 | Bacteria | 2971 |
| 34 | Ga0070661_100128713 | 3300005344 | Bacteria | 1900 |
| 35 | Ga0070692_10001338 | 3300005345 | Bacteria | 8877 |
| 36 | Ga0070692_10006917 | 3300005345 | Bacteria | 4960 |
| 37 | Ga0070668_100069076 | 3300005347 | Bacteria | 2748 |
| 38 | Ga0070668_100102562 | 3300005347 | Bacteria | 2268 |
| 39 | Ga0070668_100222106 | 3300005347 | Bacteria | 1559 |
| 40 | Ga0070669_100379382 | 3300005353 | Bacteria | 1153 |
| 41 | Ga0070675_100019552 | 3300005354 | Bacteria | 5399 |
| 42 | Ga0070675_100042292 | 3300005354 | Bacteria | 3723 |
| 43 | Ga0070675_100098235 | 3300005354 | Bacteria | 2462 |
| 44 | Ga0070671_100098521 | 3300005355 | Bacteria | 2452 |
| 45 | Ga0070673_100058317 | 3300005364 | Bacteria | 3052 |
| 46 | Ga0070673_100123139 | 3300005364 | Bacteria | 2166 |
| 47 | Ga0070688_100086216 | 3300005365 | Bacteria | 2042 |
| 48 | Ga0070688_100123579 | 3300005365 | Bacteria | 1736 |
| 49 | Ga0070659_100028002 | 3300005366 | Bacteria | 4347 |
| 50 | Ga0070667_100294305 | 3300005367 | Bacteria | 1461 |
| 51 | Ga0070709_10001845 | 3300005434 | Bacteria | 11489 |
| 52 | Ga0070709_10004698 | 3300005434 | Bacteria | 7378 |
| 53 | Ga0070709_10012100 | 3300005434 | Bacteria | 4823 |
| 54 | Ga0070709_10104565 | 3300005434 | Bacteria | 1892 |
| 55 | Ga0070714_100014299 | 3300005435 | Bacteria | 6374 |
| 56 | Ga0070714_100031003 | 3300005435 | Bacteria | 4456 |
| 57 | Ga0070714_100081309 | 3300005435 | Bacteria | 2820 |
| 58 | Ga0070714_100094470 | 3300005435 | Bacteria | 2624 |
| 59 | Ga0070714_100099899 | 3300005435 | Bacteria | 2554 |
| 60 | Ga0070714_100106310 | 3300005435 | Bacteria | 2479 |
| 61 | Ga0070714_100135331 | 3300005435 | Bacteria | 2206 |
| 62 | Ga0070714_100360144 | 3300005435 | Bacteria | 1367 |
| 63 | Ga0070713_100001308 | 3300005436 | Bacteria | 15921 |
| 64 | Ga0070713_100013874 | 3300005436 | Bacteria | 5964 |
| 65 | Ga0070713_100078635 | 3300005436 | Bacteria | 2808 |
| 66 | Ga0070713_100084260 | 3300005436 | Bacteria | 2719 |
| 67 | Ga0070713_100097261 | 3300005436 | Bacteria | 2543 |
| 68 | Ga0070713_100105288 | 3300005436 | Bacteria | 2450 |
| 69 | Ga0070713_100198755 | 3300005436 | Bacteria | 1809 |
| 70 | Ga0070713_100323171 | 3300005436 | Bacteria | 1425 |
| 71 | Ga0070710_10000547 | 3300005437 | Bacteria | 17763 |
| 72 | Ga0070710_10015217 | 3300005437 | Bacteria | 3890 |
| 73 | Ga0070710_10015577 | 3300005437 | Bacteria | 3851 |
| 74 | Ga0070710_10044290 | 3300005437 | Bacteria | 2469 |
| 75 | Ga0070710_10047328 | 3300005437 | Bacteria | 2398 |
| 76 | Ga0070711_100013257 | 3300005439 | Bacteria | 5173 |
| 77 | Ga0070711_100031143 | 3300005439 | Bacteria | 3538 |
| 78 | Ga0070711_100305464 | 3300005439 | Bacteria | 1266 |
| 79 | Ga0070705_100035968 | 3300005440 | Bacteria | 2780 |
| 80 | Ga0070705_100059923 | 3300005440 | Bacteria | 2256 |
| 81 | Ga0070700_100001333 | 3300005441 | Bacteria | 12262 |
| 82 | Ga0070700_100006893 | 3300005441 | Bacteria | 6101 |
| 83 | Ga0070700_100143285 | 3300005441 | Bacteria | 1626 |
| 84 | Ga0070694_100034606 | 3300005444 | Bacteria | 3332 |
| 85 | Ga0070708_100008323 | 3300005445 | Bacteria | 8329 |
| 86 | Ga0070708_100021238 | 3300005445 | Bacteria | 5486 |
| 87 | Ga0070708_100174560 | 3300005445 | Bacteria | 2007 |
| 88 | Ga0070708_100223433 | 3300005445 | Bacteria | 1766 |
| 89 | Ga0070708_100461179 | 3300005445 | Bacteria | 1199 |
| 90 | Ga0070663_100012026 | 3300005455 | Bacteria | 5461 |
| 91 | Ga0070663_100021451 | 3300005455 | Bacteria | 4297 |
| 92 | Ga0070663_100121042 | 3300005455 | Bacteria | 1977 |
| 93 | Ga0070678_100121963 | 3300005456 | Bacteria | 2057 |
| 94 | Ga0070678_100277217 | 3300005456 | Bacteria | 1416 |
| 95 | Ga0070662_100170815 | 3300005457 | Bacteria | 1707 |
| 96 | Ga0070681_10034274 | 3300005458 | Bacteria | 5098 |
| 97 | Ga0070681_10203892 | 3300005458 | Bacteria | 1895 |
| 98 | Ga0070681_10204750 | 3300005458 | Bacteria | 1891 |
| 99 | Ga0070681_10301669 | 3300005458 | Bacteria | 1511 |
| 100 | Ga0070685_10010463 | 3300005466 | Bacteria | 4822 |
| 101 | Ga0070685_10039298 | 3300005466 | Bacteria | 2687 |
| 102 | Ga0070706_100020034 | 3300005467 | Bacteria | 6166 |
| 103 | Ga0070706_100037288 | 3300005467 | Bacteria | 4490 |
| 104 | Ga0070706_100123253 | 3300005467 | Bacteria | 2417 |
| 105 | Ga0070706_100137874 | 3300005467 | Bacteria | 2276 |
| 106 | Ga0070706_100282995 | 3300005467 | Bacteria | 1548 |
| 107 | Ga0070706_100384709 | 3300005467 | Bacteria | 1306 |
| 108 | Ga0070707_100000160 | 3300005468 | Bacteria | 64063 |
| 109 | Ga0070707_100008664 | 3300005468 | Bacteria | 9438 |
| 110 | Ga0070707_100045463 | 3300005468 | Bacteria | 4202 |
| 111 | Ga0070707_100056840 | 3300005468 | Bacteria | 3753 |
| 112 | Ga0070707_100115064 | 3300005468 | Bacteria | 2610 |
| 113 | Ga0070707_100119699 | 3300005468 | Bacteria | 2556 |
| 114 | Ga0070707_100344183 | 3300005468 | Bacteria | 1448 |
| 115 | Ga0070707_100352832 | 3300005468 | Bacteria | 1428 |
| 116 | Ga0070698_100001469 | 3300005471 | Bacteria | 26165 |
| 117 | Ga0070698_100017508 | 3300005471 | Bacteria | 7551 |
| 118 | Ga0070698_100018408 | 3300005471 | Bacteria | 7355 |
| 119 | Ga0070698_100018701 | 3300005471 | Bacteria | 7294 |
| 120 | Ga0070698_100020972 | 3300005471 | Bacteria | 6846 |
| 121 | Ga0070698_100040643 | 3300005471 | Bacteria | 4778 |
| 122 | Ga0070698_100064192 | 3300005471 | Bacteria | 3700 |
| 123 | Ga0070698_100079808 | 3300005471 | Bacteria | 3268 |
| 124 | Ga0070679_100252394 | 3300005530 | Bacteria | 1720 |
| 125 | Ga0070679_100262987 | 3300005530 | Bacteria | 1680 |
| 126 | Ga0070679_100378871 | 3300005530 | Bacteria | 1361 |
| 127 | Ga0070684_100033201 | 3300005535 | Bacteria | 4404 |
| 128 | Ga0070684_100037560 | 3300005535 | Bacteria | 4156 |
| 129 | Ga0070684_100067262 | 3300005535 | Bacteria | 3146 |
| 130 | Ga0070684_100152141 | 3300005535 | Bacteria | 2096 |
| 131 | Ga0070697_100005308 | 3300005536 | Bacteria | 9903 |
| 132 | Ga0068853_100061872 | 3300005539 | Bacteria | 3238 |
| 133 | Ga0068853_100134809 | 3300005539 | Bacteria | 2213 |
| 134 | Ga0070672_100003525 | 3300005543 | Bacteria | 10140 |
| 135 | Ga0070672_100037372 | 3300005543 | Bacteria | 3704 |
| 136 | Ga0070696_100111280 | 3300005546 | Bacteria | 1972 |
| 137 | Ga0070693_100022094 | 3300005547 | Bacteria | 3377 |
| 138 | Ga0070693_100081175 | 3300005547 | Bacteria | 1933 |
| 139 | Ga0070693_100136975 | 3300005547 | Bacteria | 1537 |
| 140 | Ga0070665_100112224 | 3300005548 | Bacteria | 2729 |
| 141 | Ga0070665_100185375 | 3300005548 | Bacteria | 2082 |
| 142 | Ga0070665_100464171 | 3300005548 | Bacteria | 1276 |
| 143 | Ga0068855_100166485 | 3300005563 | Bacteria | 2498 |
| 144 | Ga0068855_100261283 | 3300005563 | Bacteria | 1928 |
| 145 | Ga0070664_100009450 | 3300005564 | Bacteria | 7904 |
| 146 | Ga0070664_100072800 | 3300005564 | Bacteria | 2947 |
| 147 | Ga0070664_100106180 | 3300005564 | Bacteria | 2446 |
| 148 | Ga0068857_100021495 | 3300005577 | Bacteria | 5678 |
| 149 | Ga0068857_100054923 | 3300005577 | Bacteria | 3535 |
| 150 | Ga0068857_100075790 | 3300005577 | Bacteria | 2999 |
| 151 | Ga0068857_100148902 | 3300005577 | Bacteria | 2119 |
| 152 | Ga0068857_100387612 | 3300005577 | Bacteria | 1298 |
| 153 | Ga0068857_100394657 | 3300005577 | Bacteria | 1287 |
| 154 | Ga0068854_100036737 | 3300005578 | Bacteria | 3436 |
| 155 | Ga0068854_100040277 | 3300005578 | Bacteria | 3296 |
| 156 | Ga0068856_100064463 | 3300005614 | Bacteria | 3620 |
| 157 | Ga0068856_100168302 | 3300005614 | Bacteria | 2203 |
| 158 | Ga0068856_100229591 | 3300005614 | Bacteria | 1871 |
| 159 | Ga0070702_100002665 | 3300005615 | Bacteria | 7793 |
| 160 | Ga0070702_100038969 | 3300005615 | Bacteria | 2650 |
| 161 | Ga0068852_100041522 | 3300005616 | Bacteria | 3888 |
| 162 | Ga0068852_100055553 | 3300005616 | Bacteria | 3418 |
| 163 | Ga0068864_100069147 | 3300005618 | Bacteria | 3070 |
| 164 | Ga0068866_10042209 | 3300005718 | Bacteria | 2269 |
| 165 | Ga0068861_100001645 | 3300005719 | Bacteria | 14262 |
| 166 | Ga0068861_100066517 | 3300005719 | Bacteria | 2779 |
| 167 | Ga0068851_10003583 | 3300005834 | Bacteria | 6922 |
| 168 | Ga0068870_10003040 | 3300005840 | Bacteria | 7070 |
| 169 | Ga0068870_10024595 | 3300005840 | Bacteria | 2981 |
| 170 | Ga0068863_100257253 | 3300005841 | Bacteria | 1687 |
| 171 | Ga0068863_100276366 | 3300005841 | Bacteria | 1626 |
| 172 | Ga0068863_100373612 | 3300005841 | Bacteria | 1391 |
| 173 | Ga0068858_100045820 | 3300005842 | Bacteria | 4054 |
| 174 | Ga0068860_100023866 | 3300005843 | Bacteria | 5911 |
| 175 | Ga0068860_100046507 | 3300005843 | Bacteria | 4137 |
| 176 | Ga0068860_100357268 | 3300005843 | Bacteria | 1439 |
| 177 | Ga0068862_100130519 | 3300005844 | Bacteria | 2222 |
| 178 | Ga0081455_10004246 | 3300005937 | Bacteria | 16156 |
| 179 | Ga0081455_10068353 | 3300005937 | Bacteria | 2958 |
| 180 | Ga0081538_10007127 | 3300005981 | Bacteria | 9713 |
| 181 | Ga0081538_10017739 | 3300005981 | Bacteria | 5385 |
| 182 | Ga0081538_10073813 | 3300005981 | Bacteria | 1861 |
| 183 | Ga0081540_1000120 | 3300005983 | Bacteria | 83032 |
| 184 | Ga0081540_1000151 | 3300005983 | Bacteria | 71183 |
| 185 | Ga0081540_1009731 | 3300005983 | Bacteria | 6592 |
| 186 | Ga0081540_1090542 | 3300005983 | Bacteria | 1347 |
| 187 | Ga0081539_10000088 | 3300005985 | Bacteria | 212765 |
| 188 | Ga0081539_10019620 | 3300005985 | Bacteria | 4617 |
| 189 | Ga0081539_10031233 | 3300005985 | Bacteria | 3288 |
| 190 | Ga0070717_10017009 | 3300006028 | Bacteria | 5648 |
| 191 | Ga0070717_10020504 | 3300006028 | Bacteria | 5200 |
| 192 | Ga0070717_10157207 | 3300006028 | Bacteria | 1970 |
| 193 | Ga0070717_10168002 | 3300006028 | Bacteria | 1906 |
| 194 | Ga0070717_10267198 | 3300006028 | Bacteria | 1514 |
| 195 | Ga0070717_10314877 | 3300006028 | Bacteria | 1393 |
| 196 | Ga0070717_10445640 | 3300006028 | Bacteria | 1166 |
| 197 | Ga0075432_10003181 | 3300006058 | Bacteria | 5538 |
| 198 | Ga0075432_10024624 | 3300006058 | Bacteria | 2063 |
| 199 | Ga0070715_10089936 | 3300006163 | Bacteria | 1410 |
| 200 | Ga0070716_100000463 | 3300006173 | Bacteria | 16758 |
| 201 | Ga0070716_100001656 | 3300006173 | Bacteria | 10048 |
| 202 | Ga0070716_100041072 | 3300006173 | Bacteria | 2575 |
| 203 | Ga0070716_100060795 | 3300006173 | Bacteria | 2184 |
| 204 | Ga0070716_100180160 | 3300006173 | Bacteria | 1386 |
| 205 | Ga0070712_100016067 | 3300006175 | Bacteria | 4830 |
| 206 | Ga0070712_100030983 | 3300006175 | Bacteria | 3600 |
| 207 | Ga0070712_100038697 | 3300006175 | Bacteria | 3261 |
| 208 | Ga0070712_100048694 | 3300006175 | Bacteria | 2939 |
| 209 | Ga0070712_100098642 | 3300006175 | Bacteria | 2155 |
| 210 | Ga0068871_100015128 | 3300006358 | Bacteria | 5768 |
| 211 | Ga0068871_100227547 | 3300006358 | Bacteria | 1618 |
| 212 | Ga0075428_100016092 | 3300006844 | Bacteria | 8270 |
| 213 | Ga0075428_100141187 | 3300006844 | Bacteria | 2619 |
| 214 | Ga0075428_100175309 | 3300006844 | Bacteria | 2322 |
| 215 | Ga0075430_100015969 | 3300006846 | Bacteria | 6394 |
| 216 | Ga0075430_100050093 | 3300006846 | Bacteria | 3524 |
| 217 | Ga0075431_100005042 | 3300006847 | Bacteria | 12993 |
| 218 | Ga0075431_100204215 | 3300006847 | Bacteria | 2021 |
| 219 | Ga0075431_100438901 | 3300006847 | Bacteria | 1302 |
| 220 | Ga0075433_10012569 | 3300006852 | Bacteria | 6846 |
| 221 | Ga0075433_10034987 | 3300006852 | Bacteria | 4317 |
| 222 | Ga0075433_10210959 | 3300006852 | Bacteria | 1726 |
| 223 | Ga0075434_100024769 | 3300006871 | Bacteria | 5867 |
| 224 | Ga0075434_100027569 | 3300006871 | Bacteria | 5578 |
| 225 | Ga0075434_100100357 | 3300006871 | Bacteria | 2900 |
| 226 | Ga0075434_100153407 | 3300006871 | Bacteria | 2323 |
| 227 | Ga0075429_100000523 | 3300006880 | Bacteria | 29137 |
| 228 | Ga0075429_100064950 | 3300006880 | Bacteria | 3177 |
| 229 | Ga0075429_100068612 | 3300006880 | Bacteria | 3086 |
| 230 | Ga0068865_100002913 | 3300006881 | Bacteria | 10206 |
| 231 | Ga0075436_100030844 | 3300006914 | Bacteria | 3689 |
| 232 | Ga0075436_100039047 | 3300006914 | Bacteria | 3275 |
| 233 | Ga0075436_100081511 | 3300006914 | Bacteria | 2243 |
| 234 | Ga0075436_100172432 | 3300006914 | Bacteria | 1527 |
| 235 | Ga0075435_100016706 | 3300007076 | Bacteria | 5536 |
| 236 | Ga0075435_100029014 | 3300007076 | Bacteria | 4341 |
| 237 | Ga0075435_100042523 | 3300007076 | Bacteria | 3635 |
| 238 | Ga0075435_100158369 | 3300007076 | Bacteria | 1907 |
| 239 | Ga0075435_100209861 | 3300007076 | Bacteria | 1652 |
| 240 | Ga0099794_10157742 | 3300007265 | Bacteria | 1153 |
| 241 | Ga0105251_10007024 | 3300009011 | Bacteria | 7024 |
| 242 | Ga0105251_10028522 | 3300009011 | Bacteria | 2820 |
| 243 | Ga0105240_10168020 | 3300009093 | Bacteria | 2600 |
| 244 | Ga0105240_10231463 | 3300009093 | Bacteria | 2147 |
| 245 | Ga0111539_10005398 | 3300009094 | Bacteria | 16536 |
| 246 | Ga0111539_10096068 | 3300009094 | Bacteria | 3481 |
| 247 | Ga0111539_10167769 | 3300009094 | Bacteria | 2565 |
| 248 | Ga0105245_10010656 | 3300009098 | Bacteria | 7996 |
| 249 | Ga0105245_10024069 | 3300009098 | Bacteria | 5346 |
| 250 | Ga0105245_10054090 | 3300009098 | Bacteria | 3605 |
| 251 | Ga0105247_10124515 | 3300009101 | Bacteria | 1674 |
| 252 | Ga0114129_10008192 | 3300009147 | Bacteria | 14898 |
| 253 | Ga0114129_10259716 | 3300009147 | Bacteria | 2329 |
| 254 | Ga0114129_10341052 | 3300009147 | Bacteria | 1987 |
| 255 | Ga0105243_10002407 | 3300009148 | Bacteria | 15669 |
| 256 | Ga0105243_10056508 | 3300009148 | Bacteria | 3122 |
| 257 | Ga0105243_10088166 | 3300009148 | Bacteria | 2549 |
| 258 | Ga0105243_10155164 | 3300009148 | Bacteria | 1968 |
| 259 | Ga0105241_10079210 | 3300009174 | Bacteria | 2568 |
| 260 | Ga0105241_10092516 | 3300009174 | Bacteria | 2388 |
| 261 | Ga0105248_10013191 | 3300009177 | Bacteria | 9097 |
| 262 | Ga0105248_10125373 | 3300009177 | Bacteria | 2897 |
| 263 | Ga0105237_10119773 | 3300009545 | Bacteria | 2626 |
| 264 | Ga0105238_10011060 | 3300009551 | Bacteria | 9070 |
| 265 | Ga0105238_10118337 | 3300009551 | Bacteria | 2629 |
| 266 | Ga0105249_10005142 | 3300009553 | Bacteria | 11289 |
| 267 | Ga0105249_10275602 | 3300009553 | Bacteria | 1677 |
| 268 | Ga0105239_10251867 | 3300010375 | Bacteria | 1983 |
| 269 | Ga0105239_10278877 | 3300010375 | Bacteria | 1881 |
| 270 | Ga0105246_10064614 | 3300011119 | Bacteria | 2557 |
| 271 | Ga0105246_10094692 | 3300011119 | Bacteria | 2160 |
| 272 | Ga0105246_10109161 | 3300011119 | Bacteria | 2029 |
| 273 | Ga0157326_1006018 | 3300012513 | Bacteria | 1291 |
| 274 | Ga0157371_10099447 | 3300013102 | Bacteria | 2063 |
| 275 | Ga0157371_10160338 | 3300013102 | Bacteria | 1606 |
| 276 | Ga0157370_10169223 | 3300013104 | Bacteria | 2032 |
| 277 | Ga0157369_10025837 | 3300013105 | Bacteria | 6514 |
| 278 | Ga0157369_10066064 | 3300013105 | Bacteria | 3892 |
| 279 | Ga0157374_10110540 | 3300013296 | Bacteria | 2643 |
| 280 | Ga0157374_10268006 | 3300013296 | Bacteria | 1683 |
| 281 | Ga0157378_10125781 | 3300013297 | Bacteria | 2368 |
| 282 | Ga0163162_10180036 | 3300013306 | Bacteria | 2240 |
| 283 | Ga0157372_10048110 | 3300013307 | Bacteria | 4740 |
| 284 | Ga0157372_10151578 | 3300013307 | Bacteria | 2676 |
| 285 | Ga0157372_10163633 | 3300013307 | Bacteria | 2572 |
| 286 | Ga0157372_10299674 | 3300013307 | Bacteria | 1870 |
| 287 | Ga0157375_10084612 | 3300013308 | Bacteria | 3221 |
| 288 | Ga0157375_10364080 | 3300013308 | Bacteria | 1612 |
| 289 | Ga0157375_10658329 | 3300013308 | Bacteria | 1203 |
| 290 | Ga0163163_10033952 | 3300014325 | Bacteria | 4938 |
| 291 | Ga0163163_10112154 | 3300014325 | Bacteria | 2756 |
| 292 | Ga0163163_10172600 | 3300014325 | Bacteria | 2209 |
| 293 | Ga0163163_10266266 | 3300014325 | Bacteria | 1765 |
| 294 | Ga0157380_10017676 | 3300014326 | Bacteria | 5280 |
| 295 | Ga0157380_10135123 | 3300014326 | Bacteria | 2110 |
| 296 | Ga0182008_10015075 | 3300014497 | Bacteria | 4041 |
| 297 | Ga0157377_10002600 | 3300014745 | Bacteria | 8017 |
| 298 | Ga0157377_10013024 | 3300014745 | Bacteria | 4199 |
| 299 | Ga0157379_10083516 | 3300014968 | Bacteria | 2863 |
| 300 | Ga0157379_10299057 | 3300014968 | Bacteria | 1466 |
| 301 | Ga0197907_10163216 | 3300020069 | Bacteria | 2081 |
| 302 | Ga0197907_10622897 | 3300020069 | Bacteria | 3622 |
| 303 | Ga0197907_11334031 | 3300020069 | Bacteria | 3250 |
| 304 | Ga0206356_10944960 | 3300020070 | Bacteria | 2347 |
| 305 | Ga0206356_11103474 | 3300020070 | Bacteria | 6562 |
| 306 | Ga0206356_11265883 | 3300020070 | Bacteria | 3457 |
| 307 | Ga0206349_1015767 | 3300020075 | Bacteria | 1884 |
| 308 | Ga0206349_1048544 | 3300020075 | Bacteria | 2491 |
| 309 | Ga0206349_1920315 | 3300020075 | Bacteria | 1473 |
| 310 | Ga0206355_1227207 | 3300020076 | Bacteria | 1594 |
| 311 | Ga0206351_10398476 | 3300020077 | Bacteria | 3042 |
| 312 | Ga0206352_10632914 | 3300020078 | Bacteria | 3712 |
| 313 | Ga0206352_11332995 | 3300020078 | Bacteria | 1444 |
| 314 | Ga0206350_10871958 | 3300020080 | Bacteria | 1553 |
| 315 | Ga0206354_10921791 | 3300020081 | Bacteria | 1777 |
| 316 | Ga0206353_11114840 | 3300020082 | Bacteria | 1133 |
| 317 | Ga0206353_11985371 | 3300020082 | Bacteria | 5341 |
| 318 | Ga0213873_10048281 | 3300021358 | Bacteria | 1119 |
| 319 | Ga0213876_10015660 | 3300021384 | Bacteria | 4013 |
| 320 | Ga0213875_10000369 | 3300021388 | Bacteria | 41386 |
| 321 | Ga0213875_10001208 | 3300021388 | Bacteria | 17598 |
| 322 | Ga0213875_10023643 | 3300021388 | Bacteria | 2934 |
| 323 | Ga0213875_10036111 | 3300021388 | Bacteria | 2330 |
| 324 | Ga0224712_10001286 | 3300022467 | Bacteria | 5695 |
| 325 | Ga0224712_10027858 | 3300022467 | Bacteria | 2014 |
| 326 | Ga0224712_10052709 | 3300022467 | Bacteria | 1590 |
| 327 | Ga0224572_1003707 | 3300024225 | Bacteria | 2601 |
| 328 | Ga0207656_10044371 | 3300025321 | Bacteria | 1898 |
| 329 | Ga0207653_10004343 | 3300025885 | Bacteria | 4454 |
| 330 | Ga0207692_10001169 | 3300025898 | Bacteria | 9699 |
| 331 | Ga0207692_10001923 | 3300025898 | Bacteria | 7911 |
| 332 | Ga0207692_10002346 | 3300025898 | Bacteria | 7262 |
| 333 | Ga0207692_10013014 | 3300025898 | Bacteria | 3595 |
| 334 | Ga0207692_10038571 | 3300025898 | Bacteria | 2344 |
| 335 | Ga0207710_10073656 | 3300025900 | Bacteria | 1571 |
| 336 | Ga0207688_10002367 | 3300025901 | Bacteria | 10146 |
| 337 | Ga0207688_10048571 | 3300025901 | Bacteria | 2371 |
| 338 | Ga0207688_10158150 | 3300025901 | Bacteria | 1342 |
| 339 | Ga0207647_10050610 | 3300025904 | Bacteria | 2571 |
| 340 | Ga0207647_10054467 | 3300025904 | Bacteria | 2461 |
| 341 | Ga0207699_10002039 | 3300025906 | Bacteria | 9541 |
| 342 | Ga0207699_10007248 | 3300025906 | Bacteria | 5415 |
| 343 | Ga0207699_10017119 | 3300025906 | Bacteria | 3806 |
| 344 | Ga0207699_10301285 | 3300025906 | Bacteria | 1119 |
| 345 | Ga0207645_10047084 | 3300025907 | Bacteria | 2754 |
| 346 | Ga0207643_10000047 | 3300025908 | Bacteria | 79590 |
| 347 | Ga0207643_10001968 | 3300025908 | Bacteria | 11336 |
| 348 | Ga0207705_10016674 | 3300025909 | Bacteria | 5261 |
| 349 | Ga0207705_10072054 | 3300025909 | Bacteria | 2505 |
| 350 | Ga0207684_10004439 | 3300025910 | Bacteria | 13225 |
| 351 | Ga0207684_10008143 | 3300025910 | Bacteria | 9347 |
| 352 | Ga0207684_10064723 | 3300025910 | Bacteria | 3104 |
| 353 | Ga0207684_10179885 | 3300025910 | Bacteria | 1823 |
| 354 | Ga0207684_10227637 | 3300025910 | Bacteria | 1609 |
| 355 | Ga0207654_10190239 | 3300025911 | Bacteria | 1345 |
| 356 | Ga0207707_10005779 | 3300025912 | Bacteria | 10814 |
| 357 | Ga0207695_10165807 | 3300025913 | Bacteria | 2137 |
| 358 | Ga0207671_10232063 | 3300025914 | Bacteria | 1448 |
| 359 | Ga0207693_10017053 | 3300025915 | Bacteria | 5797 |
| 360 | Ga0207693_10031061 | 3300025915 | Bacteria | 4220 |
| 361 | Ga0207693_10120882 | 3300025915 | Bacteria | 2057 |
| 362 | Ga0207693_10126582 | 3300025915 | Bacteria | 2008 |
| 363 | Ga0207693_10133772 | 3300025915 | Bacteria | 1949 |
| 364 | Ga0207693_10144608 | 3300025915 | Bacteria | 1870 |
| 365 | Ga0207693_10192006 | 3300025915 | Bacteria | 1607 |
| 366 | Ga0207663_10003284 | 3300025916 | Bacteria | 7889 |
| 367 | Ga0207663_10044124 | 3300025916 | Bacteria | 2735 |
| 368 | Ga0207663_10047414 | 3300025916 | Bacteria | 2652 |
| 369 | Ga0207663_10217526 | 3300025916 | Bacteria | 1388 |
| 370 | Ga0207660_10006197 | 3300025917 | Bacteria | 7772 |
| 371 | Ga0207662_10003528 | 3300025918 | Bacteria | 8063 |
| 372 | Ga0207662_10067944 | 3300025918 | Bacteria | 2151 |
| 373 | Ga0207657_10010443 | 3300025919 | Bacteria | 9267 |
| 374 | Ga0207657_10026802 | 3300025919 | Bacteria | 5287 |
| 375 | Ga0207649_10030950 | 3300025920 | Bacteria | 3175 |
| 376 | Ga0207652_10160973 | 3300025921 | Bacteria | 2012 |
| 377 | Ga0207646_10000202 | 3300025922 | Bacteria | 80937 |
| 378 | Ga0207646_10009346 | 3300025922 | Bacteria | 9691 |
| 379 | Ga0207646_10012343 | 3300025922 | Bacteria | 8216 |
| 380 | Ga0207646_10059544 | 3300025922 | Bacteria | 3411 |
| 381 | Ga0207646_10195762 | 3300025922 | Bacteria | 1825 |
| 382 | Ga0207694_10209061 | 3300025924 | Bacteria | 1589 |
| 383 | Ga0207694_10273430 | 3300025924 | Bacteria | 1386 |
| 384 | Ga0207650_10003706 | 3300025925 | Bacteria | 10447 |
| 385 | Ga0207659_10006605 | 3300025926 | Bacteria | 7123 |
| 386 | Ga0207659_10052872 | 3300025926 | Bacteria | 2895 |
| 387 | Ga0207687_10008057 | 3300025927 | Bacteria | 6894 |
| 388 | Ga0207700_10000802 | 3300025928 | Bacteria | 18122 |
| 389 | Ga0207700_10002718 | 3300025928 | Bacteria | 10198 |
| 390 | Ga0207700_10003348 | 3300025928 | Bacteria | 9297 |
| 391 | Ga0207700_10003872 | 3300025928 | Bacteria | 8745 |
| 392 | Ga0207700_10015980 | 3300025928 | Bacteria | 4973 |
| 393 | Ga0207700_10031504 | 3300025928 | Bacteria | 3768 |
| 394 | Ga0207700_10061022 | 3300025928 | Bacteria | 2858 |
| 395 | Ga0207700_10075878 | 3300025928 | Bacteria | 2606 |
| 396 | Ga0207700_10076603 | 3300025928 | Bacteria | 2596 |
| 397 | Ga0207700_10162415 | 3300025928 | Bacteria | 1856 |
| 398 | Ga0207700_10278937 | 3300025928 | Bacteria | 1437 |
| 399 | Ga0207700_10301169 | 3300025928 | Bacteria | 1384 |
| 400 | Ga0207664_10000434 | 3300025929 | Bacteria | 29862 |
| 401 | Ga0207664_10003595 | 3300025929 | Bacteria | 10369 |
| 402 | Ga0207664_10004776 | 3300025929 | Bacteria | 9211 |
| 403 | Ga0207664_10010630 | 3300025929 | Bacteria | 6505 |
| 404 | Ga0207664_10019852 | 3300025929 | Bacteria | 4974 |
| 405 | Ga0207664_10055160 | 3300025929 | Bacteria | 3153 |
| 406 | Ga0207664_10086870 | 3300025929 | Bacteria | 2556 |
| 407 | Ga0207664_10126895 | 3300025929 | Bacteria | 2143 |
| 408 | Ga0207664_10141270 | 3300025929 | Bacteria | 2037 |
| 409 | Ga0207664_10212546 | 3300025929 | Bacteria | 1674 |
| 410 | Ga0207664_10279625 | 3300025929 | Bacteria | 1464 |
| 411 | Ga0207664_10305498 | 3300025929 | Bacteria | 1400 |
| 412 | Ga0207664_10368877 | 3300025929 | Bacteria | 1273 |
| 413 | Ga0207644_10021893 | 3300025931 | Bacteria | 4359 |
| 414 | Ga0207690_10039496 | 3300025932 | Bacteria | 3080 |
| 415 | Ga0207690_10171174 | 3300025932 | Bacteria | 1627 |
| 416 | Ga0207706_10018761 | 3300025933 | Bacteria | 6222 |
| 417 | Ga0207709_10013687 | 3300025935 | Bacteria | 4475 |
| 418 | Ga0207709_10133946 | 3300025935 | Bacteria | 1693 |
| 419 | Ga0207669_10197500 | 3300025937 | Bacteria | 1457 |
| 420 | Ga0207704_10039080 | 3300025938 | Bacteria | 2759 |
| 421 | Ga0207665_10001204 | 3300025939 | Bacteria | 17440 |
| 422 | Ga0207665_10001322 | 3300025939 | Bacteria | 16709 |
| 423 | Ga0207665_10003578 | 3300025939 | Bacteria | 10383 |
| 424 | Ga0207665_10049975 | 3300025939 | Bacteria | 2811 |
| 425 | Ga0207665_10053760 | 3300025939 | Bacteria | 2714 |
| 426 | Ga0207665_10096257 | 3300025939 | Bacteria | 2059 |
| 427 | Ga0207665_10119269 | 3300025939 | Bacteria | 1862 |
| 428 | Ga0207691_10006524 | 3300025940 | Bacteria | 11260 |
| 429 | Ga0207691_10017101 | 3300025940 | Bacteria | 6881 |
| 430 | Ga0207691_10053583 | 3300025940 | Bacteria | 3683 |
| 431 | Ga0207711_10022453 | 3300025941 | Bacteria | 5276 |
| 432 | Ga0207711_10089182 | 3300025941 | Bacteria | 2709 |
| 433 | Ga0207711_10145181 | 3300025941 | Bacteria | 2137 |
| 434 | Ga0207689_10007643 | 3300025942 | Bacteria | 9464 |
| 435 | Ga0207689_10010182 | 3300025942 | Bacteria | 8102 |
| 436 | Ga0207661_10001927 | 3300025944 | Bacteria | 14263 |
| 437 | Ga0207661_10006171 | 3300025944 | Bacteria | 8470 |
| 438 | Ga0207661_10009958 | 3300025944 | Bacteria | 6828 |
| 439 | Ga0207661_10061703 | 3300025944 | Bacteria | 3030 |
| 440 | Ga0207661_10158806 | 3300025944 | Bacteria | 1960 |
| 441 | Ga0207661_10198120 | 3300025944 | Bacteria | 1764 |
| 442 | Ga0207679_10020736 | 3300025945 | Bacteria | 4440 |
| 443 | Ga0207679_10039648 | 3300025945 | Bacteria | 3366 |
| 444 | Ga0207667_10051312 | 3300025949 | Bacteria | 4350 |
| 445 | Ga0207667_10360948 | 3300025949 | Bacteria | 1481 |
| 446 | Ga0207651_10004430 | 3300025960 | Bacteria | 7074 |
| 447 | Ga0207651_10179406 | 3300025960 | Bacteria | 1678 |
| 448 | Ga0207712_10092290 | 3300025961 | Bacteria | 2232 |
| 449 | Ga0207712_10200918 | 3300025961 | Bacteria | 1581 |
| 450 | Ga0207668_10251220 | 3300025972 | Bacteria | 1436 |
| 451 | Ga0207668_10290289 | 3300025972 | Bacteria | 1345 |
| 452 | Ga0207640_10120096 | 3300025981 | Bacteria | 1881 |
| 453 | Ga0207658_10126879 | 3300025986 | Bacteria | 2044 |
| 454 | Ga0207677_10013596 | 3300026023 | Bacteria | 4723 |
| 455 | Ga0207703_10077606 | 3300026035 | Bacteria | 2758 |
| 456 | Ga0207639_10207109 | 3300026041 | Bacteria | 1686 |
| 457 | Ga0207678_10001230 | 3300026067 | Bacteria | 23573 |
| 458 | Ga0207678_10003674 | 3300026067 | Bacteria | 13795 |
| 459 | Ga0207678_10006155 | 3300026067 | Bacteria | 10674 |
| 460 | Ga0207678_10008769 | 3300026067 | Bacteria | 8896 |
| 461 | Ga0207678_10051684 | 3300026067 | Bacteria | 3547 |
| 462 | Ga0207678_10080795 | 3300026067 | Bacteria | 2783 |
| 463 | Ga0207708_10000794 | 3300026075 | Bacteria | 23829 |
| 464 | Ga0207708_10018360 | 3300026075 | Bacteria | 5268 |
| 465 | Ga0207708_10046783 | 3300026075 | Bacteria | 3295 |
| 466 | Ga0207702_10003167 | 3300026078 | Bacteria | 15221 |
| 467 | Ga0207702_10106816 | 3300026078 | Bacteria | 2481 |
| 468 | Ga0207702_10118392 | 3300026078 | Bacteria | 2366 |
| 469 | Ga0207702_10191778 | 3300026078 | Bacteria | 1889 |
| 470 | Ga0207702_10241478 | 3300026078 | Bacteria | 1693 |
| 471 | Ga0207641_10193282 | 3300026088 | Bacteria | 1872 |
| 472 | Ga0207641_10309097 | 3300026088 | Bacteria | 1495 |
| 473 | Ga0207648_10003416 | 3300026089 | Bacteria | 16672 |
| 474 | Ga0207676_10002675 | 3300026095 | Bacteria | 12662 |
| 475 | Ga0207676_10056869 | 3300026095 | Bacteria | 3078 |
| 476 | Ga0207676_10071311 | 3300026095 | Bacteria | 2789 |
| 477 | Ga0207674_10050696 | 3300026116 | Bacteria | 4239 |
| 478 | Ga0207674_10054297 | 3300026116 | Bacteria | 4079 |
| 479 | Ga0207674_10121191 | 3300026116 | Bacteria | 2583 |
| 480 | Ga0207675_100005946 | 3300026118 | Bacteria | 11635 |
| 481 | Ga0207675_100052984 | 3300026118 | Bacteria | 3786 |
| 482 | Ga0207683_10001863 | 3300026121 | Bacteria | 18643 |
| 483 | Ga0207683_10002655 | 3300026121 | Bacteria | 15618 |
| 484 | Ga0207683_10148111 | 3300026121 | Bacteria | 2118 |
| 485 | Ga0207698_10002277 | 3300026142 | Bacteria | 11364 |
| 486 | Ga0207428_10141506 | 3300027907 | Bacteria | 1836 |
| 487 | Ga0268266_10056963 | 3300028379 | Bacteria | 3362 |
| 488 | Ga0268266_10077834 | 3300028379 | Bacteria | 2884 |
| 489 | Ga0268265_10017611 | 3300028380 | Bacteria | 4935 |
| 490 | Ga0268264_10019690 | 3300028381 | Bacteria | 5513 |
| 491 | Ga0265337_1002887 | 3300028556 | Bacteria | 7666 |
| 492 | Ga0265319_1000732 | 3300028563 | Bacteria | 21379 |
| 493 | Ga0265334_10000486 | 3300028573 | Bacteria | 20557 |
| 494 | Ga0265323_10004471 | 3300028653 | Bacteria | 6029 |
| 495 | Ga0265322_10005894 | 3300028654 | Bacteria | 3612 |
| 496 | Ga0265336_10002354 | 3300028666 | Bacteria | 7855 |
| 497 | Ga0307515_10145062 | 3300028794 | Bacteria | 2520 |
| 498 | Ga0265338_10000761 | 3300028800 | Bacteria | 54973 |
| 499 | Ga0265338_10002109 | 3300028800 | Bacteria | 30668 |
| 500 | Ga0265338_10013681 | 3300028800 | Bacteria | 9132 |
| 501 | Ga0265338_10047411 | 3300028800 | Bacteria | 3924 |
| 502 | Ga0307512_10004240 | 3300030522 | Bacteria | 15844 |
| 503 | Ga0307512_10129700 | 3300030522 | Bacteria | 1586 |
| 504 | Ga0265332_10001578 | 3300031238 | Bacteria | 12485 |
| 505 | Ga0265320_10001637 | 3300031240 | Bacteria | 15996 |
| 506 | Ga0265325_10021857 | 3300031241 | Bacteria | 3508 |
| 507 | Ga0265340_10006866 | 3300031247 | Bacteria | 6225 |
| 508 | Ga0265339_10016782 | 3300031249 | Bacteria | 4356 |
| 509 | Ga0307513_10145083 | 3300031456 | Bacteria | 2293 |
| 510 | Ga0307509_10208241 | 3300031507 | Bacteria | 1784 |
| 511 | Ga0307508_10165042 | 3300031616 | Bacteria | 1818 |
| 512 | Ga0265314_10050177 | 3300031711 | Bacteria | 2916 |
| 513 | Ga0265342_10007626 | 3300031712 | Bacteria | 7891 |
| 514 | Ga0307406_10041672 | 3300031901 | Bacteria | 2862 |
| 515 | Ga0307406_10200546 | 3300031901 | Bacteria | 1468 |
| 516 | Ga0307409_100361037 | 3300031995 | Bacteria | 1374 |
| 517 | Ga0307416_100107807 | 3300032002 | Bacteria | 2446 |
| 518 | Ga0307415_100049064 | 3300032126 | Bacteria | 2852 |
| 519 | Ga0307415_100065727 | 3300032126 | Bacteria | 2528 |
| 520 | Ga0307415_100167500 | 3300032126 | Bacteria | 1710 |
| 521 | Ga0373948_0014379 | 3300034817 | Bacteria | 1441 |
| 522 | Ga0373958_0003018 | 3300034819 | Bacteria | 2406 |
| 523 | Ga0373926_0002431 | 3300035083 | Bacteria | 5901 |
| 524 | Ga0373926_0007272 | 3300035083 | Bacteria | 3691 |
| 525 | Ga0373926_0028332 | 3300035083 | Bacteria | 1965 |
| 526 | Ga0373926_0051080 | 3300035083 | Bacteria | 1491 |
| 527 | Ga0373928_0008796 | 3300035084 | Bacteria | 1965 |
| 528 | Ga0373934_0000099 | 3300035086 | Bacteria | 30256 |
| 529 | Ga0373934_0035628 | 3300035086 | Bacteria | 1958 |
| 530 | Ga0373934_0061038 | 3300035086 | Bacteria | 1501 |
| 531 | Ga0373951_0000016 | 3300035091 | Bacteria | 66469 |
| 532 | Ga0373923_0001426 | 3300035111 | Bacteria | 6846 |
| 533 | Ga0373923_0018329 | 3300035111 | Bacteria | 2692 |
| 534 | Ga0373923_0026084 | 3300035111 | Bacteria | 2322 |
| 535 | Ga0373936_0001273 | 3300035113 | Bacteria | 9116 |
| 536 | Ga0373936_0026630 | 3300035113 | Bacteria | 2264 |
| 537 | Ga0373936_0064291 | 3300035113 | Bacteria | 1503 |
| 538 | Ga0373939_0020738 | 3300035114 | Bacteria | 1790 |
| 539 | Ga0373945_0005462 | 3300035116 | Bacteria | 4068 |
| 540 | Ga0373945_0023887 | 3300035116 | Bacteria | 2114 |
| 541 | Ga0373953_0000124 | 3300035117 | Bacteria | 18926 |
| 542 | Ga0373953_0011785 | 3300035117 | Bacteria | 3079 |
| 543 | Ga0373953_0031266 | 3300035117 | Bacteria | 2069 |
| 544 | Ga0373954_0007559 | 3300035118 | Bacteria | 4756 |
| 545 | Ga0373954_0028198 | 3300035118 | Bacteria | 2580 |
| 546 | Ga0373954_0031824 | 3300035118 | Bacteria | 2437 |
| 547 | Ga0373954_0034235 | 3300035118 | Bacteria | 2352 |
| 548 | Ga0373956_0058824 | 3300035119 | Bacteria | 1738 |
| 549 | Ga0373957_0000241 | 3300035120 | Bacteria | 13672 |
| 550 | Ga0373957_0000381 | 3300035120 | Bacteria | 11266 |
| 551 | Ga0373957_0019936 | 3300035120 | Bacteria | 2365 |
| 552 | Ga0373943_0000572 | 3300035170 | Bacteria | 15968 |
| 553 | Ga0373943_0007492 | 3300035170 | Bacteria | 4903 |
| 554 | Ga0373943_0127384 | 3300035170 | Bacteria | 1359 |
| 555 | Ga0373946_0001505 | 3300035171 | Bacteria | 8092 |
| 556 | Ga0373946_0004228 | 3300035171 | Bacteria | 5122 |
| 557 | Ga0373946_0041390 | 3300035171 | Bacteria | 1889 |
| 558 | Ga0373955_0000055 | 3300035172 | Bacteria | 44447 |
| 559 | Ga0373955_0012456 | 3300035172 | Bacteria | 4086 |
| 560 | Ga0373955_0032736 | 3300035172 | Bacteria | 2732 |
| 561 | Ga0373942_0000635 | 3300035207 | Bacteria | 9862 |
| 562 | Ga0373961_0017066 | 3300035241 | Bacteria | 1877 |
| 563 | Ga0373962_0038660 | 3300035242 | Bacteria | 1336 |
| 564 | Ga0373924_0003857 | 3300035410 | Bacteria | 5191 |
| 565 | Ga0373924_0011757 | 3300035410 | Bacteria | 3256 |
| 566 | Ga0373924_0014582 | 3300035410 | Bacteria | 2973 |
| 567 | Ga0373924_0020488 | 3300035410 | Bacteria | 2571 |
| 568 | Ga0373924_0028372 | 3300035410 | Bacteria | 2230 |
| 569 | Ga0373924_0062605 | 3300035410 | Bacteria | 1558 |
| 570 | Ga0373931_0013318 | 3300035691 | Bacteria | 4002 |
| 571 | Ga0373931_0039660 | 3300035691 | Bacteria | 2467 |
| 572 | Ga0373935_0014904 | 3300035692 | Bacteria | 4694 |
| 573 | Ga0373935_0027567 | 3300035692 | Bacteria | 3511 |
| 574 | Ga0373935_0096091 | 3300035692 | Bacteria | 1946 |
| 575 | Ga0373927_0001709 | 3300035695 | Bacteria | 16400 |
| 576 | Ga0373927_0227440 | 3300035695 | Bacteria | 1225 |
| 577 | Ga0373933_0000067 | 3300035724 | Bacteria | 63675 |
| 578 | Ga0373933_0005380 | 3300035724 | Bacteria | 6970 |
| 579 | Ga0373933_0005970 | 3300035724 | Bacteria | 6624 |
| 580 | Ga0373933_0006466 | 3300035724 | Bacteria | 6385 |
| 581 | Ga0373933_0019951 | 3300035724 | Bacteria | 3795 |
| 582 | Ga0373933_0025783 | 3300035724 | Bacteria | 3373 |
| 583 | Ga0373933_0054704 | 3300035724 | Bacteria | 2392 |
| 584 | Ga0373933_0071243 | 3300035724 | Bacteria | 2115 |
| 585 | Ga0373947_0000014 | 3300035725 | Bacteria | 135749 |
| 586 | Ga0373947_0000863 | 3300035725 | Bacteria | 18313 |
| 587 | Ga0373947_0045457 | 3300035725 | Bacteria | 2627 |
| 588 | Ga0373947_0144890 | 3300035725 | Bacteria | 1526 |
| 589 | Ga0373947_0233329 | 3300035725 | Bacteria | 1212 |
| 590 | Ga0373937_0028736 | 3300036401 | Bacteria | 5033 |
| 591 | Ga0373937_0042408 | 3300036401 | Bacteria | 4151 |
| 592 | Ga0373937_0281832 | 3300036401 | Bacteria | 1569 |
| 593 | Ga0373925_0000098 | 3300037068 | Bacteria | 94011 |
| 594 | Ga0373925_0001067 | 3300037068 | Bacteria | 24761 |
| 595 | Ga0373925_0009743 | 3300037068 | Bacteria | 6979 |
| 596 | Ga0373925_0025768 | 3300037068 | Bacteria | 4299 |
| 597 | Ga0373925_0031917 | 3300037068 | Bacteria | 3874 |
| 598 | Ga0373925_0133217 | 3300037068 | Bacteria | 1939 |
| 599 | Ga0373925_0236906 | 3300037068 | Bacteria | 1460 |
| 600 | Ga0395900_0133845 | 3300037418 | Bacteria | 2539 |
| 601 | Ga0395900_0217114 | 3300037418 | Bacteria | 1929 |
| 602 | Ga0395905_0019581 | 3300037471 | Bacteria | 6415 |
| 603 | Ga0436364_0077046 | 3300037853 | Bacteria | 111992 |
| 604 | Ga0436364_0431205 | 3300037853 | Bacteria | 3312 |
| 605 | Ga0436364_0516238 | 3300037853 | Bacteria | 122645 |
| 606 | Ga0436364_0814106 | 3300037853 | Bacteria | 79026 |
| 607 | Ga0436364_0944859 | 3300037853 | Bacteria | 2524 |
| 608 | Ga0436364_0950844 | 3300037853 | Bacteria | 2234 |
| 609 | Ga0436364_1528828 | 3300037853 | Bacteria | 2099 |
| 610 | Ga0395901_0015829 | 3300038443 | Bacteria | 7686 |
| 611 | Ga0395901_0276136 | 3300038443 | Bacteria | 1747 |
| 612 | Ga0436365_0415357 | 3300039437 | Bacteria | 3590 |
| 613 | Ga0436365_1347536 | 3300039437 | Bacteria | 7553 |
| 614 | Ga0436363_0003318 | 3300039450 | Bacteria | 2220 |
| 615 | Ga0436363_0194878 | 3300039450 | Bacteria | 1108 |
| 616 | Ga0436363_0371418 | 3300039450 | Bacteria | 1657 |
| 617 | Ga0436362_1050135 | 3300039453 | Bacteria | 3863 |
| 618 | Ga0439448_0046634 | 3300042005 | Bacteria | 1412 |
| 619 | Ga0439458_0014043 | 3300042157 | Bacteria | 1806 |
| 620 | Ga0466965_0126568 | 3300044683 | Bacteria | 1322 |
| 621 | Ga0466966_0001861 | 3300044684 | Bacteria | 13690 |
| 622 | Ga0466966_0199357 | 3300044684 | Bacteria | 1211 |
| 623 | Ga0466963_0000579 | 3300044694 | Bacteria | 17367 |
| 624 | Ga0466963_0042202 | 3300044694 | Bacteria | 2994 |
| 625 | Ga0466964_0068868 | 3300044706 | Bacteria | 1491 |
| 626 | Ga0466971_0017409 | 3300044719 | Bacteria | 3179 |
| 627 | Ga0466970_0145287 | 3300044765 | Bacteria | 1308 |
| 628 | Ga0466957_0010430 | 3300044842 | Bacteria | 5335 |
| 629 | Ga0466957_0308686 | 3300044842 | Bacteria | 1065 |
| 630 | Ga0466959_0002767 | 3300045049 | Bacteria | 11294 |
| 631 | Ga0466959_0142076 | 3300045049 | Bacteria | 1696 |
| 632 | Ga0466958_0000011 | 3300045836 | Bacteria | 57675 |
| 633 | Ga0466958_0094881 | 3300045836 | Bacteria | 1849 |
| 634 | Ga0466967_0107090 | 3300045976 | Bacteria | 2564 |
| 635 | Ga0466967_0253317 | 3300045976 | Bacteria | 1682 |
| 636 | Ga0466967_0431828 | 3300045976 | Bacteria | 1285 |
| 637 | Ga0495592_0000041 | 3300046454 | Bacteria | 123431 |
| 638 | Ga0495592_0006194 | 3300046454 | Bacteria | 8894 |
| 639 | Ga0495592_0048918 | 3300046454 | Bacteria | 3143 |
| 640 | Ga0495592_0049507 | 3300046454 | Bacteria | 3124 |
| 641 | Ga0495592_0162824 | 3300046454 | Bacteria | 1533 |
| 642 | Ga0495603_0057783 | 3300046455 | Bacteria | 2294 |
| 643 | Ga0495603_0096208 | 3300046455 | Bacteria | 1730 |
| 644 | Ga0495629_0083956 | 3300046459 | Bacteria | 2222 |
| 645 | Ga0495629_0290849 | 3300046459 | Bacteria | 1120 |
| 646 | Ga0495641_0057030 | 3300046461 | Bacteria | 1769 |
| 647 | Ga0495641_0060153 | 3300046461 | Bacteria | 1716 |
| 648 | Ga0495651_0000018 | 3300046462 | Bacteria | 123195 |
| 649 | Ga0495651_0013924 | 3300046462 | Bacteria | 6219 |
| 650 | Ga0495651_0015224 | 3300046462 | Bacteria | 5944 |
| 651 | Ga0495651_0024775 | 3300046462 | Bacteria | 4668 |
| 652 | Ga0495651_0025147 | 3300046462 | Bacteria | 4633 |
| 653 | Ga0495651_0031827 | 3300046462 | Bacteria | 4112 |
| 654 | Ga0495651_0049212 | 3300046462 | Bacteria | 3253 |
| 655 | Ga0495651_0100191 | 3300046462 | Bacteria | 2158 |
| 656 | Ga0495653_0003374 | 3300046463 | Bacteria | 12842 |
| 657 | Ga0495653_0033876 | 3300046463 | Bacteria | 4044 |
| 658 | Ga0495653_0039049 | 3300046463 | Bacteria | 3721 |
| 659 | Ga0495653_0063611 | 3300046463 | Bacteria | 2783 |
| 660 | Ga0495653_0112527 | 3300046463 | Bacteria | 1953 |
| 661 | Ga0495580_0060395 | 3300046472 | Bacteria | 2663 |
| 662 | Ga0495582_0001366 | 3300046473 | Bacteria | 13732 |
| 663 | Ga0495582_0003779 | 3300046473 | Bacteria | 8535 |
| 664 | Ga0495582_0008576 | 3300046473 | Bacteria | 5636 |
| 665 | Ga0495639_0001907 | 3300046475 | Bacteria | 9248 |
| 666 | Ga0495639_0030120 | 3300046475 | Bacteria | 2411 |
| 667 | Ga0495662_0000323 | 3300046476 | Bacteria | 20764 |
| 668 | Ga0495662_0016058 | 3300046476 | Bacteria | 3631 |
| 669 | Ga0495664_0003915 | 3300046477 | Bacteria | 8124 |
| 670 | Ga0495664_0019900 | 3300046477 | Bacteria | 3865 |
| 671 | Ga0495664_0056282 | 3300046477 | Bacteria | 2339 |
| 672 | Ga0495664_0130640 | 3300046477 | Bacteria | 1520 |
| 673 | Ga0495664_0178354 | 3300046477 | Bacteria | 1288 |
| 674 | Ga0495594_0050606 | 3300046499 | Bacteria | 2285 |
| 675 | Ga0495608_0000039 | 3300046511 | Bacteria | 123195 |
| 676 | Ga0495608_0000792 | 3300046511 | Bacteria | 22187 |
| 677 | Ga0495608_0014699 | 3300046511 | Bacteria | 5432 |
| 678 | Ga0495608_0016427 | 3300046511 | Bacteria | 5122 |
| 679 | Ga0495608_0043536 | 3300046511 | Bacteria | 2999 |
| 680 | Ga0495618_0013419 | 3300046514 | Bacteria | 4984 |
| 681 | Ga0495618_0013910 | 3300046514 | Bacteria | 4898 |
| 682 | Ga0495628_0011804 | 3300046516 | Bacteria | 7372 |
| 683 | Ga0495628_0065959 | 3300046516 | Bacteria | 2830 |
| 684 | Ga0495628_0074840 | 3300046516 | Bacteria | 2637 |
| 685 | Ga0495628_0154569 | 3300046516 | Bacteria | 1746 |
| 686 | Ga0495630_0000896 | 3300046517 | Bacteria | 20817 |
| 687 | Ga0495630_0043362 | 3300046517 | Bacteria | 3360 |
| 688 | Ga0495630_0055620 | 3300046517 | Bacteria | 2965 |
| 689 | Ga0495630_0181480 | 3300046517 | Bacteria | 1605 |
| 690 | Ga0495648_0001410 | 3300046524 | Bacteria | 23498 |
| 691 | Ga0495652_0000092 | 3300046529 | Bacteria | 96258 |
| 692 | Ga0495652_0012269 | 3300046529 | Bacteria | 7735 |
| 693 | Ga0495652_0029773 | 3300046529 | Bacteria | 4793 |
| 694 | Ga0495652_0090911 | 3300046529 | Bacteria | 2496 |
| 695 | Ga0495652_0166531 | 3300046529 | Bacteria | 1705 |
| 696 | Ga0495665_0008007 | 3300046531 | Bacteria | 5733 |
| 697 | Ga0495665_0045010 | 3300046531 | Bacteria | 2344 |
| 698 | Ga0495665_0093249 | 3300046531 | Bacteria | 1582 |
| 699 | Ga0495640_0018148 | 3300046533 | Bacteria | 5227 |
| 700 | Ga0495640_0035132 | 3300046533 | Bacteria | 3549 |
| 701 | Ga0495640_0052974 | 3300046533 | Bacteria | 2783 |
| 702 | Ga0495640_0057070 | 3300046533 | Bacteria | 2665 |
| 703 | Ga0495586_0011918 | 3300046535 | Bacteria | 4618 |
| 704 | Ga0495587_0000034 | 3300046536 | Bacteria | 123432 |
| 705 | Ga0495587_0009139 | 3300046536 | Bacteria | 6357 |
| 706 | Ga0495587_0020626 | 3300046536 | Bacteria | 4065 |
| 707 | Ga0495587_0023913 | 3300046536 | Bacteria | 3750 |
| 708 | Ga0495587_0037206 | 3300046536 | Bacteria | 2923 |
| 709 | Ga0495587_0068912 | 3300046536 | Bacteria | 2060 |
| 710 | Ga0495645_0005327 | 3300046543 | Bacteria | 8812 |
| 711 | Ga0495645_0016393 | 3300046543 | Bacteria | 5288 |
| 712 | Ga0495645_0063519 | 3300046543 | Bacteria | 2673 |
| 713 | Ga0495622_0020308 | 3300046557 | Bacteria | 3093 |
| 714 | Ga0495667_0000095 | 3300046559 | Bacteria | 63648 |
| 715 | Ga0495667_0007511 | 3300046559 | Bacteria | 7396 |
| 716 | Ga0495667_0014933 | 3300046559 | Bacteria | 5247 |
| 717 | Ga0495667_0098838 | 3300046559 | Bacteria | 1889 |
| 718 | Ga0495667_0104763 | 3300046559 | Bacteria | 1828 |
| 719 | Ga0495634_0019677 | 3300046642 | Bacteria | 4794 |
| 720 | Ga0495634_0043952 | 3300046642 | Bacteria | 3026 |
| 721 | Ga0495634_0054893 | 3300046642 | Bacteria | 2665 |
| 722 | Ga0495634_0089447 | 3300046642 | Bacteria | 2001 |
| 723 | Ga0495611_0029525 | 3300046648 | Bacteria | 2405 |
| 724 | Ga0495635_0007354 | 3300046663 | Bacteria | 7687 |
| 725 | Ga0495635_0013253 | 3300046663 | Bacteria | 5770 |
| 726 | Ga0495635_0033618 | 3300046663 | Bacteria | 3556 |
| 727 | Ga0495635_0042046 | 3300046663 | Bacteria | 3157 |
| 728 | Ga0495635_0043188 | 3300046663 | Bacteria | 3111 |
| 729 | Ga0495635_0080411 | 3300046663 | Bacteria | 2230 |
| 730 | Ga0495635_0151563 | 3300046663 | Bacteria | 1578 |
| 731 | Ga0495588_0033326 | 3300046674 | Bacteria | 2600 |
| 732 | Ga0495588_0128642 | 3300046674 | Bacteria | 1336 |
| 733 | Ga0495657_0002131 | 3300046675 | Bacteria | 16805 |
| 734 | Ga0495657_0012327 | 3300046675 | Bacteria | 6353 |
| 735 | Ga0495657_0017361 | 3300046675 | Bacteria | 5226 |
| 736 | Ga0495657_0018566 | 3300046675 | Bacteria | 5027 |
| 737 | Ga0495657_0025382 | 3300046675 | Bacteria | 4208 |
| 738 | Ga0495657_0058797 | 3300046675 | Bacteria | 2551 |
| 739 | Ga0495657_0059200 | 3300046675 | Bacteria | 2541 |
| 740 | Ga0495657_0068607 | 3300046675 | Bacteria | 2322 |
| 741 | Ga0495657_0093482 | 3300046675 | Bacteria | 1924 |
| 742 | Ga0495599_0000079 | 3300046678 | Bacteria | 67315 |
| 743 | Ga0495599_0013573 | 3300046678 | Bacteria | 5034 |
| 744 | Ga0495599_0067731 | 3300046678 | Bacteria | 2229 |
| 745 | Ga0495599_0071360 | 3300046678 | Bacteria | 2167 |
| 746 | Ga0495599_0105168 | 3300046678 | Bacteria | 1758 |
| 747 | Ga0495623_0003739 | 3300046679 | Bacteria | 10038 |
| 748 | Ga0495623_0069041 | 3300046679 | Bacteria | 2203 |
| 749 | Ga0495623_0137252 | 3300046679 | Bacteria | 1458 |
| 750 | Ga0495647_0002446 | 3300046681 | Bacteria | 5856 |
| 751 | Ga0495658_0020999 | 3300046683 | Bacteria | 3436 |
| 752 | Ga0495658_0128841 | 3300046683 | Bacteria | 1538 |
| 753 | Ga0495658_0149920 | 3300046683 | Bacteria | 1432 |
| 754 | Ga0495613_0001028 | 3300046689 | Bacteria | 21269 |
| 755 | Ga0495624_0018109 | 3300046690 | Bacteria | 4714 |
| 756 | Ga0495624_0024004 | 3300046690 | Bacteria | 4016 |
| 757 | Ga0495624_0040782 | 3300046690 | Bacteria | 2972 |
| 758 | Ga0495624_0154207 | 3300046690 | Bacteria | 1404 |
| 759 | Ga0495600_0013528 | 3300046809 | Bacteria | 5130 |
| 760 | Ga0495600_0047867 | 3300046809 | Bacteria | 2789 |
| 761 | Ga0495600_0092304 | 3300046809 | Bacteria | 1974 |
| 762 | Ga0495581_0011872 | 3300047315 | Bacteria | 5041 |
| 763 | Ga0495581_0047659 | 3300047315 | Bacteria | 2476 |
| 764 | Ga0495581_0052996 | 3300047315 | Bacteria | 2343 |
| 765 | Ga0495581_0056829 | 3300047315 | Bacteria | 2258 |
| 766 | Ga0495581_0063776 | 3300047315 | Bacteria | 2128 |
| 767 | Ga0495604_0000039 | 3300047317 | Bacteria | 123431 |
| 768 | Ga0495604_0048742 | 3300047317 | Bacteria | 3294 |
| 769 | Ga0495604_0074440 | 3300047317 | Bacteria | 2559 |
| 770 | Ga0495604_0091529 | 3300047317 | Bacteria | 2255 |
| 771 | Ga0495674_0004472 | 3300047319 | Bacteria | 13454 |
| 772 | Ga0495674_0006519 | 3300047319 | Bacteria | 11198 |
| 773 | Ga0495674_0010815 | 3300047319 | Bacteria | 8632 |
| 774 | Ga0495674_0024703 | 3300047319 | Bacteria | 5515 |
| 775 | Ga0495674_0045898 | 3300047319 | Bacteria | 3879 |
| 776 | Ga0495674_0056567 | 3300047319 | Bacteria | 3434 |
| 777 | Ga0495674_0093454 | 3300047319 | Bacteria | 2566 |
| 778 | Ga0495674_0147620 | 3300047319 | Bacteria | 1973 |
| 779 | Ga0495674_0196407 | 3300047319 | Bacteria | 1675 |
| 780 | Ga0495674_0269796 | 3300047319 | Bacteria | 1396 |
| 781 | Ga0495676_0002873 | 3300047321 | Bacteria | 15536 |
| 782 | Ga0495680_0000028 | 3300047322 | Bacteria | 112865 |
| 783 | Ga0495680_0002589 | 3300047322 | Bacteria | 18416 |
| 784 | Ga0495680_0011463 | 3300047322 | Bacteria | 7848 |
| 785 | Ga0495680_0014737 | 3300047322 | Bacteria | 6758 |
| 786 | Ga0495680_0028323 | 3300047322 | Bacteria | 4594 |
| 787 | Ga0495680_0032047 | 3300047322 | Bacteria | 4271 |
| 788 | Ga0495680_0096729 | 3300047322 | Bacteria | 2204 |
| 789 | Ga0495680_0101464 | 3300047322 | Bacteria | 2143 |
| 790 | Ga0495675_0001400 | 3300047444 | Bacteria | 14602 |
| 791 | Ga0495675_0007204 | 3300047444 | Bacteria | 6849 |
| 792 | Ga0495675_0009661 | 3300047444 | Bacteria | 6009 |
| 793 | Ga0495684_0003210 | 3300047471 | Bacteria | 12824 |
| 794 | Ga0495684_0011328 | 3300047471 | Bacteria | 6884 |
| 795 | Ga0495684_0014614 | 3300047471 | Bacteria | 6041 |
| 796 | Ga0495684_0021455 | 3300047471 | Bacteria | 4973 |
| 797 | Ga0495684_0026257 | 3300047471 | Bacteria | 4474 |
| 798 | Ga0495684_0062858 | 3300047471 | Bacteria | 2824 |
| 799 | Ga0495684_0219504 | 3300047471 | Bacteria | 1394 |
| 800 | Ga0495684_0245445 | 3300047471 | Bacteria | 1304 |
| 801 | Ga0495684_0278255 | 3300047471 | Bacteria | 1208 |
| 802 | Ga0495593_0006382 | 3300047673 | Bacteria | 6916 |
| 803 | Ga0495593_0009521 | 3300047673 | Bacteria | 5636 |
| 804 | Ga0495593_0073232 | 3300047673 | Bacteria | 1777 |
| 805 | Ga0495602_0000043 | 3300048088 | Bacteria | 123431 |
| 806 | Ga0495602_0025532 | 3300048088 | Bacteria | 5716 |
| 807 | Ga0495602_0031454 | 3300048088 | Bacteria | 5017 |
| 808 | Ga0495602_0057152 | 3300048088 | Bacteria | 3425 |
| 809 | Ga0495602_0194084 | 3300048088 | Bacteria | 1554 |
| 810 | Ga0495602_0233423 | 3300048088 | Bacteria | 1380 |
| 811 | Ga0495614_0061516 | 3300048089 | Bacteria | 1613 |
| 812 | Ga0496100_0069029 | 3300048903 | Bacteria | 2352 |
| 813 | Ga0496101_0061619 | 3300048904 | Bacteria | 2725 |
| 814 | Ga0496101_0185729 | 3300048904 | Bacteria | 1602 |
| 815 | Ga0496101_0262810 | 3300048904 | Bacteria | 1346 |
| 816 | Ga0496102_0016560 | 3300048905 | Bacteria | 6443 |
| 817 | Ga0496102_0069522 | 3300048905 | Bacteria | 3232 |
| 818 | Ga0496102_0102988 | 3300048905 | Bacteria | 2654 |
| 819 | Ga0496103_0048563 | 3300048906 | Bacteria | 2622 |
| 820 | Ga0496103_0251044 | 3300048906 | Bacteria | 1138 |
| 821 | Ga0496104_0008746 | 3300048907 | Bacteria | 9002 |
| 822 | Ga0496104_0017242 | 3300048907 | Bacteria | 6572 |
| 823 | Ga0496104_0029512 | 3300048907 | Bacteria | 5088 |
| 824 | Ga0496104_0051025 | 3300048907 | Bacteria | 3903 |
| 825 | Ga0496105_0000867 | 3300048908 | Bacteria | 20689 |
| 826 | Ga0496105_0007329 | 3300048908 | Bacteria | 8524 |
| 827 | Ga0496105_0017432 | 3300048908 | Bacteria | 5758 |
| 828 | Ga0496105_0096956 | 3300048908 | Bacteria | 2435 |
| 829 | Ga0496105_0259830 | 3300048908 | Bacteria | 1404 |
| 830 | Ga0496106_0027164 | 3300048909 | Bacteria | 4262 |
| 831 | Ga0496106_0080285 | 3300048909 | Bacteria | 2505 |
| 832 | Ga0496106_0116252 | 3300048909 | Bacteria | 2086 |
| 833 | Ga0496107_0005550 | 3300048910 | Bacteria | 8639 |
| 834 | Ga0496107_0020298 | 3300048910 | Bacteria | 4691 |
| 835 | Ga0496108_0036618 | 3300048911 | Bacteria | 4083 |
| 836 | Ga0496108_0077149 | 3300048911 | Bacteria | 2817 |
| 837 | Ga0496108_0169025 | 3300048911 | Bacteria | 1891 |
| 838 | Ga0496108_0171849 | 3300048911 | Bacteria | 1875 |
| 839 | Ga0496108_0212366 | 3300048911 | Bacteria | 1680 |
| 840 | Ga0496108_0251848 | 3300048911 | Bacteria | 1536 |
| 841 | Ga0496108_0258695 | 3300048911 | Bacteria | 1515 |
| 842 | Ga0496109_0007682 | 3300048912 | Bacteria | 9141 |
| 843 | Ga0496109_0042456 | 3300048912 | Bacteria | 4119 |
| 844 | Ga0496109_0059927 | 3300048912 | Bacteria | 3477 |
| 845 | Ga0496109_0083065 | 3300048912 | Bacteria | 2954 |
| 846 | Ga0496109_0437302 | 3300048912 | Bacteria | 1236 |
| 847 | Ga0496110_0032843 | 3300048913 | Bacteria | 4486 |
| 848 | Ga0496110_0040715 | 3300048913 | Bacteria | 4050 |
| 849 | Ga0496110_0100784 | 3300048913 | Bacteria | 2589 |
| 850 | Ga0496111_0135253 | 3300048914 | Bacteria | 1825 |
| 851 | Ga0496112_0000776 | 3300048915 | Bacteria | 22480 |
| 852 | Ga0496112_0051893 | 3300048915 | Bacteria | 4023 |
| 853 | Ga0496112_0093175 | 3300048915 | Bacteria | 2983 |
| 854 | Ga0496112_0119584 | 3300048915 | Bacteria | 2604 |
| 855 | Ga0496112_0253291 | 3300048915 | Bacteria | 1711 |
| 856 | Ga0496113_0134340 | 3300048916 | Bacteria | 1943 |
| 857 | Ga0496113_0197190 | 3300048916 | Bacteria | 1599 |
| 858 | Ga0496113_0202061 | 3300048916 | Bacteria | 1579 |
| 859 | Ga0496114_0011016 | 3300048917 | Bacteria | 7210 |
| 860 | Ga0496114_0050302 | 3300048917 | Bacteria | 3469 |
| 861 | Ga0496114_0062546 | 3300048917 | Bacteria | 3115 |
| 862 | Ga0496114_0161655 | 3300048917 | Bacteria | 1948 |
| 863 | Ga0496115_0000561 | 3300048918 | Bacteria | 28823 |
| 864 | Ga0496115_0003046 | 3300048918 | Bacteria | 12028 |
| 865 | Ga0496115_0066274 | 3300048918 | Bacteria | 2918 |
| 866 | Ga0496115_0143760 | 3300048918 | Bacteria | 1968 |
| 867 | Ga0496119_0065714 | 3300048922 | Bacteria | 2147 |
| 868 | Ga0496121_0083825 | 3300048924 | Bacteria | 2515 |
| 869 | Ga0496124_0084426 | 3300048927 | Bacteria | 2604 |
| 870 | Ga0496126_0060184 | 3300048929 | Bacteria | 3417 |
| 871 | Ga0496126_0090211 | 3300048929 | Bacteria | 2697 |
| 872 | Ga0496126_0115226 | 3300048929 | Bacteria | 2337 |
| 873 | Ga0496126_0194423 | 3300048929 | Bacteria | 1716 |
| 874 | Ga0501036_0098742 | 3300049572 | Bacteria | 2469 |
| 875 | Ga0501039_0026986 | 3300049575 | Bacteria | 4415 |
| 876 | Ga0501041_0035247 | 3300049577 | Bacteria | 3032 |
| 877 | Ga0501041_0051541 | 3300049577 | Bacteria | 2508 |
| 878 | Ga0501042_0289267 | 3300049578 | Bacteria | 1184 |
| 879 | Ga0501035_0125821 | 3300049822 | Bacteria | 2237 |
| 880 | nmdc:mga05p37_11179_c1 | 3300050507 | Bacteria | 10669 |
| 881 | nmdc:mga05p37_22626_c1 | 3300050507 | Bacteria | 7622 |
| 882 | nmdc:mga05p37_2523_c1 | 3300050507 | Bacteria | 21280 |
| 883 | nmdc:mga05p37_269656_c1 | 3300050507 | Bacteria | 2034 |
| 884 | nmdc:mga09592_36734_c1 | 3300050508 | Bacteria | 4105 |
| 885 | nmdc:mga09592_79367_c1 | 3300050508 | Bacteria | 2794 |
| 886 | nmdc:mga0qj67_19010_c1 | 3300050509 | Bacteria | 5245 |
| 887 | nmdc:mga06r32_1163_c2 | 3300050510 | Bacteria | 6275 |
| 888 | nmdc:mga06r32_44229_c1 | 3300050510 | Bacteria | 4240 |
| 889 | nmdc:mga08y16_13231_c1 | 3300050511 | Bacteria | 8677 |
| 890 | nmdc:mga08y16_142984_c1 | 3300050511 | Bacteria | 2487 |
| 891 | nmdc:mga08y16_147441_c1 | 3300050511 | Bacteria | 2446 |
| 892 | nmdc:mga0n895_151041_c1 | 3300050512 | Bacteria | 2353 |
| 893 | nmdc:mga0n895_151509_c1 | 3300050512 | Bacteria | 2349 |
| 894 | nmdc:mga0n895_229883_c1 | 3300050512 | Bacteria | 1883 |
| 895 | nmdc:mga0n895_26038_c1 | 3300050512 | Bacteria | 5533 |
| 896 | nmdc:mga0n895_403998_c1 | 3300050512 | Bacteria | 1381 |
| 897 | nmdc:mga0n895_99738_c1 | 3300050512 | Bacteria | 2913 |
| 898 | nmdc:mga0rr50_131443_c1 | 3300050513 | Bacteria | 2005 |
| 899 | nmdc:mga0rr50_219629_c1 | 3300050513 | Bacteria | 1569 |
| 900 | nmdc:mga0rr50_34496_c1 | 3300050513 | Bacteria | 3624 |
| 901 | nmdc:mga08x19_20175_c1 | 3300050514 | Bacteria | 4103 |
| 902 | nmdc:mga08x19_59388_c1 | 3300050514 | Bacteria | 2476 |
| 903 | nmdc:mga0a205_28564_c1 | 3300050515 | Bacteria | 3867 |
| 904 | Ga0495601_0005115 | 3300053077 | Bacteria | 7618 |
| 905 | Ga0495601_0017476 | 3300053077 | Bacteria | 4354 |
| 906 | Ga0495601_0055666 | 3300053077 | Bacteria | 2504 |
| 907 | Ga0495601_0066440 | 3300053077 | Bacteria | 2295 |
| 908 | Ga0495612_0027468 | 3300053078 | Bacteria | 2289 |
| 909 | Ga0495595_0001127 | 3300053084 | Bacteria | 10340 |
| 910 | Ga0495595_0002342 | 3300053084 | Bacteria | 7379 |
| 911 | Ga0495595_0011263 | 3300053084 | Bacteria | 3735 |
| 912 | Ga0495595_0038361 | 3300053084 | Bacteria | 2182 |
| 913 | Ga0495595_0111972 | 3300053084 | Bacteria | 1324 |
| 914 | Ga0495619_0002498 | 3300053085 | Bacteria | 12040 |
| 915 | Ga0495619_0004190 | 3300053085 | Bacteria | 9201 |
| 916 | Ga0495619_0091419 | 3300053085 | Bacteria | 2060 |
| 917 | Ga0495619_0196464 | 3300053085 | Bacteria | 1397 |
| 918 | Ga0495619_0211778 | 3300053085 | Bacteria | 1342 |
| 919 | Ga0500594_0044935 | 3300053118 | Bacteria | 1223 |
| 920 | Ga0501084_0073795 | 3300054114 | Bacteria | 2857 |
| 921 | Ga0587084_006149 | 3300059477 | Bacteria | 1446 |
| 922 | Ga0587077_013254 | 3300059493 | Bacteria | 1334 |
| 923 | Ga0587080_008906 | 3300059503 | Bacteria | 1448 |
| 924 | Ga0587082_005514 | 3300059504 | Bacteria | 1648 |
| 925 | Ga0587082_009715 | 3300059504 | Bacteria | 1370 |
| 926 | Ga0587083_0002177 | 3300059505 | Bacteria | 2390 |
| 927 | Ga0587085_005247 | 3300059506 | Bacteria | 1518 |
| 928 | Ga0587067_008933 | 3300059640 | Bacteria | 1480 |
| 929 | Ga0587072_010019 | 3300059643 | Bacteria | 1524 |
| 930 | Ga0587079_012556 | 3300059647 | Bacteria | 1387 |
| 931 | Ga0587107_005676 | 3300059652 | Bacteria | 1331 |
| 932 | Ga0466962_0004303 | 3300061719 | Bacteria | 6826 |
| 933 | Ga0530510_0193782 | 3300061734 | Bacteria | 1509 |
| 934 | 2676485579 | 2675903059 | Bacteria | 8644972 |
| 935 | 2753271375 | 2751185782 | Bacteria | 11227053 |
| 936 | 2816424236 | 2816332119 | Bacteria | 8120218 |
| 937 | 2866553888 | 2866552031 | Bacteria | 5824618 |
| 938 | 2895435969 | 2895427314 | Bacteria | 13147766 |
| 939 | Ga0207680_10164443 | |||
| 940 | JGI24739J22299_10015173 | |||
| 941 | JGI24737J22298_10002884 | |||
| 942 | JGI24738J21930_10004422 | |||
| 943 | JGI24751J29686_10008716 | |||
| 944 | JGI25404J52841_10000110 | |||
| 945 | JGI25405J52794_10022847 | |||
| 946 | Ga0058863_10057907 | |||
| 947 | Ga0058861_12076710 | |||
| 948 | Ga0070676_10063373 | |||
| 949 | Ga0070683_100006175 | |||
| 950 | Ga0070683_100008858 | |||
| 951 | Ga0070683_100023868 | |||
| 952 | Ga0070683_100128333 | |||
| 953 | Ga0070683_100153074 | |||
| 954 | Ga0070690_100053696 | |||
| 955 | Ga0068869_100016172 | |||
| 956 | Ga0070666_10003687 | |||
| 957 | Ga0070680_100130257 | |||
| 958 | Ga0070682_100001530 | |||
| 959 | Ga0070682_100028308 | |||
| 960 | Ga0070682_100112247 | |||
| 961 | Ga0068868_100016661 | |||
| 962 | Ga0068868_100056609 | |||
| 963 | Ga0068868_100298950 | |||
| 964 | Ga0068868_100400304 | |||
| 965 | Ga0070660_100291076 | |||
| 966 | Ga0070689_100007719 | |||
| 967 | Ga0070691_10039297 | |||
| 968 | Ga0070687_100002744 | |||
| 969 | Ga0070687_100045413 | |||
| 970 | Ga0070687_100059587 | |||
| 971 | Ga0070661_100052906 | |||
| 972 | Ga0070661_100128713 | |||
| 973 | Ga0070692_10001338 | |||
| 974 | Ga0070692_10006917 | |||
| 975 | Ga0070668_100069076 | |||
| 976 | Ga0070668_100102562 | |||
| 977 | Ga0070668_100222106 | |||
| 978 | Ga0070669_100379382 | |||
| 979 | Ga0070675_100019552 | |||
| 980 | Ga0070675_100042292 | |||
| 981 | Ga0070675_100098235 | |||
| 982 | Ga0070671_100098521 | |||
| 983 | Ga0070673_100058317 | |||
| 984 | Ga0070673_100123139 | |||
| 985 | Ga0070688_100086216 | |||
| 986 | Ga0070688_100123579 | |||
| 987 | Ga0070659_100028002 | |||
| 988 | Ga0070667_100294305 | |||
| 989 | Ga0070709_10001845 | |||
| 990 | Ga0070709_10004698 | |||
| 991 | Ga0070709_10012100 | |||
| 992 | Ga0070709_10104565 | |||
| 993 | Ga0070714_100014299 | |||
| 994 | Ga0070714_100031003 | |||
| 995 | Ga0070714_100081309 | |||
| 996 | Ga0070714_100094470 | |||
| 997 | Ga0070714_100099899 | |||
| 998 | Ga0070714_100106310 | |||
| 999 | Ga0070714_100135331 | |||
| 1000 | Ga0070714_100360144 | |||
| 1001 | Ga0070713_100001308 | |||
| 1002 | Ga0070713_100013874 | |||
| 1003 | Ga0070713_100078635 | |||
| 1004 | Ga0070713_100084260 | |||
| 1005 | Ga0070713_100097261 | |||
| 1006 | Ga0070713_100105288 | |||
| 1007 | Ga0070713_100198755 | |||
| 1008 | Ga0070713_100323171 | |||
| 1009 | Ga0070710_10000547 | |||
| 1010 | Ga0070710_10015217 | |||
| 1011 | Ga0070710_10015577 | |||
| 1012 | Ga0070710_10044290 | |||
| 1013 | Ga0070710_10047328 | |||
| 1014 | Ga0070711_100013257 | |||
| 1015 | Ga0070711_100031143 | |||
| 1016 | Ga0070711_100305464 | |||
| 1017 | Ga0070705_100035968 | |||
| 1018 | Ga0070705_100059923 | |||
| 1019 | Ga0070700_100001333 | |||
| 1020 | Ga0070700_100006893 | |||
| 1021 | Ga0070700_100143285 | |||
| 1022 | Ga0070694_100034606 | |||
| 1023 | Ga0070708_100008323 | |||
| 1024 | Ga0070708_100021238 | |||
| 1025 | Ga0070708_100174560 | |||
| 1026 | Ga0070708_100223433 | |||
| 1027 | Ga0070708_100461179 | |||
| 1028 | Ga0070663_100012026 | |||
| 1029 | Ga0070663_100021451 | |||
| 1030 | Ga0070663_100121042 | |||
| 1031 | Ga0070678_100121963 | |||
| 1032 | Ga0070678_100277217 | |||
| 1033 | Ga0070662_100170815 | |||
| 1034 | Ga0070681_10034274 | |||
| 1035 | Ga0070681_10203892 | |||
| 1036 | Ga0070681_10204750 | |||
| 1037 | Ga0070681_10301669 | |||
| 1038 | Ga0070685_10010463 | |||
| 1039 | Ga0070685_10039298 | |||
| 1040 | Ga0070706_100020034 | |||
| 1041 | Ga0070706_100037288 | |||
| 1042 | Ga0070706_100123253 | |||
| 1043 | Ga0070706_100137874 | |||
| 1044 | Ga0070706_100282995 | |||
| 1045 | Ga0070706_100384709 | |||
| 1046 | Ga0070707_100000160 | |||
| 1047 | Ga0070707_100008664 | |||
| 1048 | Ga0070707_100045463 | |||
| 1049 | Ga0070707_100056840 | |||
| 1050 | Ga0070707_100115064 | |||
| 1051 | Ga0070707_100119699 | |||
| 1052 | Ga0070707_100344183 | |||
| 1053 | Ga0070707_100352832 | |||
| 1054 | Ga0070698_100001469 | |||
| 1055 | Ga0070698_100017508 | |||
| 1056 | Ga0070698_100018408 | |||
| 1057 | Ga0070698_100018701 | |||
| 1058 | Ga0070698_100020972 | |||
| 1059 | Ga0070698_100040643 | |||
| 1060 | Ga0070698_100064192 | |||
| 1061 | Ga0070698_100079808 | |||
| 1062 | Ga0070679_100252394 | |||
| 1063 | Ga0070679_100262987 | |||
| 1064 | Ga0070679_100378871 | |||
| 1065 | Ga0070684_100033201 | |||
| 1066 | Ga0070684_100037560 | |||
| 1067 | Ga0070684_100067262 | |||
| 1068 | Ga0070684_100152141 | |||
| 1069 | Ga0070697_100005308 | |||
| 1070 | Ga0068853_100061872 | |||
| 1071 | Ga0068853_100134809 | |||
| 1072 | Ga0070672_100003525 | |||
| 1073 | Ga0070672_100037372 | |||
| 1074 | Ga0070696_100111280 | |||
| 1075 | Ga0070693_100022094 | |||
| 1076 | Ga0070693_100081175 | |||
| 1077 | Ga0070693_100136975 | |||
| 1078 | Ga0070665_100112224 | |||
| 1079 | Ga0070665_100185375 | |||
| 1080 | Ga0070665_100464171 | |||
| 1081 | Ga0068855_100166485 | |||
| 1082 | Ga0068855_100261283 | |||
| 1083 | Ga0070664_100009450 | |||
| 1084 | Ga0070664_100072800 | |||
| 1085 | Ga0070664_100106180 | |||
| 1086 | Ga0068857_100021495 | |||
| 1087 | Ga0068857_100054923 | |||
| 1088 | Ga0068857_100075790 | |||
| 1089 | Ga0068857_100148902 | |||
| 1090 | Ga0068857_100387612 | |||
| 1091 | Ga0068857_100394657 | |||
| 1092 | Ga0068854_100036737 | |||
| 1093 | Ga0068854_100040277 | |||
| 1094 | Ga0068856_100064463 | |||
| 1095 | Ga0068856_100168302 | |||
| 1096 | Ga0068856_100229591 | |||
| 1097 | Ga0070702_100002665 | |||
| 1098 | Ga0070702_100038969 | |||
| 1099 | Ga0068852_100041522 | |||
| 1100 | Ga0068852_100055553 | |||
| 1101 | Ga0068864_100069147 | |||
| 1102 | Ga0068866_10042209 | |||
| 1103 | Ga0068861_100001645 | |||
| 1104 | Ga0068861_100066517 | |||
| 1105 | Ga0068851_10003583 | |||
| 1106 | Ga0068870_10003040 | |||
| 1107 | Ga0068870_10024595 | |||
| 1108 | Ga0068863_100257253 | |||
| 1109 | Ga0068863_100276366 | |||
| 1110 | Ga0068863_100373612 | |||
| 1111 | Ga0068858_100045820 | |||
| 1112 | Ga0068860_100023866 | |||
| 1113 | Ga0068860_100046507 | |||
| 1114 | Ga0068860_100357268 | |||
| 1115 | Ga0068862_100130519 | |||
| 1116 | Ga0081455_10004246 | |||
| 1117 | Ga0081455_10068353 | |||
| 1118 | Ga0081538_10007127 | |||
| 1119 | Ga0081538_10017739 | |||
| 1120 | Ga0081538_10073813 | |||
| 1121 | Ga0081540_1000120 | |||
| 1122 | Ga0081540_1000151 | |||
| 1123 | Ga0081540_1009731 | |||
| 1124 | Ga0081540_1090542 | |||
| 1125 | Ga0081539_10000088 | |||
| 1126 | Ga0081539_10019620 | |||
| 1127 | Ga0081539_10031233 | |||
| 1128 | Ga0070717_10017009 | |||
| 1129 | Ga0070717_10020504 | |||
| 1130 | Ga0070717_10157207 | |||
| 1131 | Ga0070717_10168002 | |||
| 1132 | Ga0070717_10267198 | |||
| 1133 | Ga0070717_10314877 | |||
| 1134 | Ga0070717_10445640 | |||
| 1135 | Ga0075432_10003181 | |||
| 1136 | Ga0075432_10024624 | |||
| 1137 | Ga0070715_10089936 | |||
| 1138 | Ga0070716_100000463 | |||
| 1139 | Ga0070716_100001656 | |||
| 1140 | Ga0070716_100041072 | |||
| 1141 | Ga0070716_100060795 | |||
| 1142 | Ga0070716_100180160 | |||
| 1143 | Ga0070712_100016067 | |||
| 1144 | Ga0070712_100030983 | |||
| 1145 | Ga0070712_100038697 | |||
| 1146 | Ga0070712_100048694 | |||
| 1147 | Ga0070712_100098642 | |||
| 1148 | Ga0068871_100015128 | |||
| 1149 | Ga0068871_100227547 | |||
| 1150 | Ga0075428_100016092 | |||
| 1151 | Ga0075428_100141187 | |||
| 1152 | Ga0075428_100175309 | |||
| 1153 | Ga0075430_100015969 | |||
| 1154 | Ga0075430_100050093 | |||
| 1155 | Ga0075431_100005042 | |||
| 1156 | Ga0075431_100204215 | |||
| 1157 | Ga0075431_100438901 | |||
| 1158 | Ga0075433_10012569 | |||
| 1159 | Ga0075433_10034987 | |||
| 1160 | Ga0075433_10210959 | |||
| 1161 | Ga0075434_100024769 | |||
| 1162 | Ga0075434_100027569 | |||
| 1163 | Ga0075434_100100357 | |||
| 1164 | Ga0075434_100153407 | |||
| 1165 | Ga0075429_100000523 | |||
| 1166 | Ga0075429_100064950 | |||
| 1167 | Ga0075429_100068612 | |||
| 1168 | Ga0068865_100002913 | |||
| 1169 | Ga0075436_100030844 | |||
| 1170 | Ga0075436_100039047 | |||
| 1171 | Ga0075436_100081511 | |||
| 1172 | Ga0075436_100172432 | |||
| 1173 | Ga0075435_100016706 | |||
| 1174 | Ga0075435_100029014 | |||
| 1175 | Ga0075435_100042523 | |||
| 1176 | Ga0075435_100158369 | |||
| 1177 | Ga0075435_100209861 | |||
| 1178 | Ga0099794_10157742 | |||
| 1179 | Ga0105251_10007024 | |||
| 1180 | Ga0105251_10028522 | |||
| 1181 | Ga0105240_10168020 | |||
| 1182 | Ga0105240_10231463 | |||
| 1183 | Ga0111539_10005398 | |||
| 1184 | Ga0111539_10096068 | |||
| 1185 | Ga0111539_10167769 | |||
| 1186 | Ga0105245_10010656 | |||
| 1187 | Ga0105245_10024069 | |||
| 1188 | Ga0105245_10054090 | |||
| 1189 | Ga0105247_10124515 | |||
| 1190 | Ga0114129_10008192 | |||
| 1191 | Ga0114129_10259716 | |||
| 1192 | Ga0114129_10341052 | |||
| 1193 | Ga0105243_10002407 | |||
| 1194 | Ga0105243_10056508 | |||
| 1195 | Ga0105243_10088166 | |||
| 1196 | Ga0105243_10155164 | |||
| 1197 | Ga0105241_10079210 | |||
| 1198 | Ga0105241_10092516 | |||
| 1199 | Ga0105248_10013191 | |||
| 1200 | Ga0105248_10125373 | |||
| 1201 | Ga0105237_10119773 | |||
| 1202 | Ga0105238_10011060 | |||
| 1203 | Ga0105238_10118337 | |||
| 1204 | Ga0105249_10005142 | |||
| 1205 | Ga0105249_10275602 | |||
| 1206 | Ga0105239_10251867 | |||
| 1207 | Ga0105239_10278877 | |||
| 1208 | Ga0105246_10064614 | |||
| 1209 | Ga0105246_10094692 | |||
| 1210 | Ga0105246_10109161 | |||
| 1211 | Ga0157326_1006018 | |||
| 1212 | Ga0157371_10099447 | |||
| 1213 | Ga0157371_10160338 | |||
| 1214 | Ga0157370_10169223 | |||
| 1215 | Ga0157369_10025837 | |||
| 1216 | Ga0157369_10066064 | |||
| 1217 | Ga0157374_10110540 | |||
| 1218 | Ga0157374_10268006 | |||
| 1219 | Ga0157378_10125781 | |||
| 1220 | Ga0163162_10180036 | |||
| 1221 | Ga0157372_10048110 | |||
| 1222 | Ga0157372_10151578 | |||
| 1223 | Ga0157372_10163633 | |||
| 1224 | Ga0157372_10299674 | |||
| 1225 | Ga0157375_10084612 | |||
| 1226 | Ga0157375_10364080 | |||
| 1227 | Ga0157375_10658329 | |||
| 1228 | Ga0163163_10033952 | |||
| 1229 | Ga0163163_10112154 | |||
| 1230 | Ga0163163_10172600 | |||
| 1231 | Ga0163163_10266266 | |||
| 1232 | Ga0157380_10017676 | |||
| 1233 | Ga0157380_10135123 | |||
| 1234 | Ga0182008_10015075 | |||
| 1235 | Ga0157377_10002600 | |||
| 1236 | Ga0157377_10013024 | |||
| 1237 | Ga0157379_10083516 | |||
| 1238 | Ga0157379_10299057 | |||
| 1239 | Ga0197907_10163216 | |||
| 1240 | Ga0197907_10622897 | |||
| 1241 | Ga0197907_11334031 | |||
| 1242 | Ga0206356_10944960 | |||
| 1243 | Ga0206356_11103474 | |||
| 1244 | Ga0206356_11265883 | |||
| 1245 | Ga0206349_1015767 | |||
| 1246 | Ga0206349_1048544 | |||
| 1247 | Ga0206349_1920315 | |||
| 1248 | Ga0206355_1227207 | |||
| 1249 | Ga0206351_10398476 | |||
| 1250 | Ga0206352_10632914 | |||
| 1251 | Ga0206352_11332995 | |||
| 1252 | Ga0206350_10871958 | |||
| 1253 | Ga0206354_10921791 | |||
| 1254 | Ga0206353_11114840 | |||
| 1255 | Ga0206353_11985371 | |||
| 1256 | Ga0213873_10048281 | |||
| 1257 | Ga0213876_10015660 | |||
| 1258 | Ga0213875_10000369 | |||
| 1259 | Ga0213875_10001208 | |||
| 1260 | Ga0213875_10023643 | |||
| 1261 | Ga0213875_10036111 | |||
| 1262 | Ga0224712_10001286 | |||
| 1263 | Ga0224712_10027858 | |||
| 1264 | Ga0224712_10052709 | |||
| 1265 | Ga0224572_1003707 | |||
| 1266 | Ga0207656_10044371 | |||
| 1267 | Ga0207653_10004343 | |||
| 1268 | Ga0207692_10001169 | |||
| 1269 | Ga0207692_10001923 | |||
| 1270 | Ga0207692_10002346 | |||
| 1271 | Ga0207692_10013014 | |||
| 1272 | Ga0207692_10038571 | |||
| 1273 | Ga0207710_10073656 | |||
| 1274 | Ga0207688_10002367 | |||
| 1275 | Ga0207688_10048571 | |||
| 1276 | Ga0207688_10158150 | |||
| 1277 | Ga0207647_10050610 | |||
| 1278 | Ga0207647_10054467 | |||
| 1279 | Ga0207699_10002039 | |||
| 1280 | Ga0207699_10007248 | |||
| 1281 | Ga0207699_10017119 | |||
| 1282 | Ga0207699_10301285 | |||
| 1283 | Ga0207645_10047084 | |||
| 1284 | Ga0207643_10000047 | |||
| 1285 | Ga0207643_10001968 | |||
| 1286 | Ga0207705_10016674 | |||
| 1287 | Ga0207705_10072054 | |||
| 1288 | Ga0207684_10004439 | |||
| 1289 | Ga0207684_10008143 | |||
| 1290 | Ga0207684_10064723 | |||
| 1291 | Ga0207684_10179885 | |||
| 1292 | Ga0207684_10227637 | |||
| 1293 | Ga0207654_10190239 | |||
| 1294 | Ga0207707_10005779 | |||
| 1295 | Ga0207695_10165807 | |||
| 1296 | Ga0207671_10232063 | |||
| 1297 | Ga0207693_10017053 | |||
| 1298 | Ga0207693_10031061 | |||
| 1299 | Ga0207693_10120882 | |||
| 1300 | Ga0207693_10126582 | |||
| 1301 | Ga0207693_10133772 | |||
| 1302 | Ga0207693_10144608 | |||
| 1303 | Ga0207693_10192006 | |||
| 1304 | Ga0207663_10003284 | |||
| 1305 | Ga0207663_10044124 | |||
| 1306 | Ga0207663_10047414 | |||
| 1307 | Ga0207663_10217526 | |||
| 1308 | Ga0207660_10006197 | |||
| 1309 | Ga0207662_10003528 | |||
| 1310 | Ga0207662_10067944 | |||
| 1311 | Ga0207657_10010443 | |||
| 1312 | Ga0207657_10026802 | |||
| 1313 | Ga0207649_10030950 | |||
| 1314 | Ga0207652_10160973 | |||
| 1315 | Ga0207646_10000202 | |||
| 1316 | Ga0207646_10009346 | |||
| 1317 | Ga0207646_10012343 | |||
| 1318 | Ga0207646_10059544 | |||
| 1319 | Ga0207646_10195762 | |||
| 1320 | Ga0207694_10209061 | |||
| 1321 | Ga0207694_10273430 | |||
| 1322 | Ga0207650_10003706 | |||
| 1323 | Ga0207659_10006605 | |||
| 1324 | Ga0207659_10052872 | |||
| 1325 | Ga0207687_10008057 | |||
| 1326 | Ga0207700_10000802 | |||
| 1327 | Ga0207700_10002718 | |||
| 1328 | Ga0207700_10003348 | |||
| 1329 | Ga0207700_10003872 | |||
| 1330 | Ga0207700_10015980 | |||
| 1331 | Ga0207700_10031504 | |||
| 1332 | Ga0207700_10061022 | |||
| 1333 | Ga0207700_10075878 | |||
| 1334 | Ga0207700_10076603 | |||
| 1335 | Ga0207700_10162415 | |||
| 1336 | Ga0207700_10278937 | |||
| 1337 | Ga0207700_10301169 | |||
| 1338 | Ga0207664_10000434 | |||
| 1339 | Ga0207664_10003595 | |||
| 1340 | Ga0207664_10004776 | |||
| 1341 | Ga0207664_10010630 | |||
| 1342 | Ga0207664_10019852 | |||
| 1343 | Ga0207664_10055160 | |||
| 1344 | Ga0207664_10086870 | |||
| 1345 | Ga0207664_10126895 | |||
| 1346 | Ga0207664_10141270 | |||
| 1347 | Ga0207664_10212546 | |||
| 1348 | Ga0207664_10279625 | |||
| 1349 | Ga0207664_10305498 | |||
| 1350 | Ga0207664_10368877 | |||
| 1351 | Ga0207644_10021893 | |||
| 1352 | Ga0207690_10039496 | |||
| 1353 | Ga0207690_10171174 | |||
| 1354 | Ga0207706_10018761 | |||
| 1355 | Ga0207709_10013687 | |||
| 1356 | Ga0207709_10133946 | |||
| 1357 | Ga0207669_10197500 | |||
| 1358 | Ga0207704_10039080 | |||
| 1359 | Ga0207665_10001204 | |||
| 1360 | Ga0207665_10001322 | |||
| 1361 | Ga0207665_10003578 | |||
| 1362 | Ga0207665_10049975 | |||
| 1363 | Ga0207665_10053760 | |||
| 1364 | Ga0207665_10096257 | |||
| 1365 | Ga0207665_10119269 | |||
| 1366 | Ga0207691_10006524 | |||
| 1367 | Ga0207691_10017101 | |||
| 1368 | Ga0207691_10053583 | |||
| 1369 | Ga0207711_10022453 | |||
| 1370 | Ga0207711_10089182 | |||
| 1371 | Ga0207711_10145181 | |||
| 1372 | Ga0207689_10007643 | |||
| 1373 | Ga0207689_10010182 | |||
| 1374 | Ga0207661_10001927 | |||
| 1375 | Ga0207661_10006171 | |||
| 1376 | Ga0207661_10009958 | |||
| 1377 | Ga0207661_10061703 | |||
| 1378 | Ga0207661_10158806 | |||
| 1379 | Ga0207661_10198120 | |||
| 1380 | Ga0207679_10020736 | |||
| 1381 | Ga0207679_10039648 | |||
| 1382 | Ga0207667_10051312 | |||
| 1383 | Ga0207667_10360948 | |||
| 1384 | Ga0207651_10004430 | |||
| 1385 | Ga0207651_10179406 | |||
| 1386 | Ga0207712_10092290 | |||
| 1387 | Ga0207712_10200918 | |||
| 1388 | Ga0207668_10251220 | |||
| 1389 | Ga0207668_10290289 | |||
| 1390 | Ga0207640_10120096 | |||
| 1391 | Ga0207658_10126879 | |||
| 1392 | Ga0207677_10013596 | |||
| 1393 | Ga0207703_10077606 | |||
| 1394 | Ga0207639_10207109 | |||
| 1395 | Ga0207678_10001230 | |||
| 1396 | Ga0207678_10003674 | |||
| 1397 | Ga0207678_10006155 | |||
| 1398 | Ga0207678_10008769 | |||
| 1399 | Ga0207678_10051684 | |||
| 1400 | Ga0207678_10080795 | |||
| 1401 | Ga0207708_10000794 | |||
| 1402 | Ga0207708_10018360 | |||
| 1403 | Ga0207708_10046783 | |||
| 1404 | Ga0207702_10003167 | |||
| 1405 | Ga0207702_10106816 | |||
| 1406 | Ga0207702_10118392 | |||
| 1407 | Ga0207702_10191778 | |||
| 1408 | Ga0207702_10241478 | |||
| 1409 | Ga0207641_10193282 | |||
| 1410 | Ga0207641_10309097 | |||
| 1411 | Ga0207648_10003416 | |||
| 1412 | Ga0207676_10002675 | |||
| 1413 | Ga0207676_10056869 | |||
| 1414 | Ga0207676_10071311 | |||
| 1415 | Ga0207674_10050696 | |||
| 1416 | Ga0207674_10054297 | |||
| 1417 | Ga0207674_10121191 | |||
| 1418 | Ga0207675_100005946 | |||
| 1419 | Ga0207675_100052984 | |||
| 1420 | Ga0207683_10001863 | |||
| 1421 | Ga0207683_10002655 | |||
| 1422 | Ga0207683_10148111 | |||
| 1423 | Ga0207698_10002277 | |||
| 1424 | Ga0207428_10141506 | |||
| 1425 | Ga0268266_10056963 | |||
| 1426 | Ga0268266_10077834 | |||
| 1427 | Ga0268265_10017611 | |||
| 1428 | Ga0268264_10019690 | |||
| 1429 | Ga0265337_1002887 | |||
| 1430 | Ga0265319_1000732 | |||
| 1431 | Ga0265334_10000486 | |||
| 1432 | Ga0265323_10004471 | |||
| 1433 | Ga0265322_10005894 | |||
| 1434 | Ga0265336_10002354 | |||
| 1435 | Ga0307515_10145062 | |||
| 1436 | Ga0265338_10000761 | |||
| 1437 | Ga0265338_10002109 | |||
| 1438 | Ga0265338_10013681 | |||
| 1439 | Ga0265338_10047411 | |||
| 1440 | Ga0307512_10004240 | |||
| 1441 | Ga0307512_10129700 | |||
| 1442 | Ga0265332_10001578 | |||
| 1443 | Ga0265320_10001637 | |||
| 1444 | Ga0265325_10021857 | |||
| 1445 | Ga0265340_10006866 | |||
| 1446 | Ga0265339_10016782 | |||
| 1447 | Ga0307513_10145083 | |||
| 1448 | Ga0307509_10208241 | |||
| 1449 | Ga0307508_10165042 | |||
| 1450 | Ga0265314_10050177 | |||
| 1451 | Ga0265342_10007626 | |||
| 1452 | Ga0307406_10041672 | |||
| 1453 | Ga0307406_10200546 | |||
| 1454 | Ga0307409_100361037 | |||
| 1455 | Ga0307416_100107807 | |||
| 1456 | Ga0307415_100049064 | |||
| 1457 | Ga0307415_100065727 | |||
| 1458 | Ga0307415_100167500 | |||
| 1459 | Ga0373948_0014379 | |||
| 1460 | Ga0373958_0003018 | |||
| 1461 | Ga0373926_0002431 | |||
| 1462 | Ga0373926_0007272 | |||
| 1463 | Ga0373926_0028332 | |||
| 1464 | Ga0373926_0051080 | |||
| 1465 | Ga0373928_0008796 | |||
| 1466 | Ga0373934_0000099 | |||
| 1467 | Ga0373934_0035628 | |||
| 1468 | Ga0373934_0061038 | |||
| 1469 | Ga0373951_0000016 | |||
| 1470 | Ga0373923_0001426 | |||
| 1471 | Ga0373923_0018329 | |||
| 1472 | Ga0373923_0026084 | |||
| 1473 | Ga0373936_0001273 | |||
| 1474 | Ga0373936_0026630 | |||
| 1475 | Ga0373936_0064291 | |||
| 1476 | Ga0373939_0020738 | |||
| 1477 | Ga0373945_0005462 | |||
| 1478 | Ga0373945_0023887 | |||
| 1479 | Ga0373953_0000124 | |||
| 1480 | Ga0373953_0011785 | |||
| 1481 | Ga0373953_0031266 | |||
| 1482 | Ga0373954_0007559 | |||
| 1483 | Ga0373954_0028198 | |||
| 1484 | Ga0373954_0031824 | |||
| 1485 | Ga0373954_0034235 | |||
| 1486 | Ga0373956_0058824 | |||
| 1487 | Ga0373957_0000241 | |||
| 1488 | Ga0373957_0000381 | |||
| 1489 | Ga0373957_0019936 | |||
| 1490 | Ga0373943_0000572 | |||
| 1491 | Ga0373943_0007492 | |||
| 1492 | Ga0373943_0127384 | |||
| 1493 | Ga0373946_0001505 | |||
| 1494 | Ga0373946_0004228 | |||
| 1495 | Ga0373946_0041390 | |||
| 1496 | Ga0373955_0000055 | |||
| 1497 | Ga0373955_0012456 | |||
| 1498 | Ga0373955_0032736 | |||
| 1499 | Ga0373942_0000635 | |||
| 1500 | Ga0373961_0017066 | |||
| 1501 | Ga0373962_0038660 | |||
| 1502 | Ga0373924_0003857 | |||
| 1503 | Ga0373924_0011757 | |||
| 1504 | Ga0373924_0014582 | |||
| 1505 | Ga0373924_0020488 | |||
| 1506 | Ga0373924_0028372 | |||
| 1507 | Ga0373924_0062605 | |||
| 1508 | Ga0373931_0013318 | |||
| 1509 | Ga0373931_0039660 | |||
| 1510 | Ga0373935_0014904 | |||
| 1511 | Ga0373935_0027567 | |||
| 1512 | Ga0373935_0096091 | |||
| 1513 | Ga0373927_0001709 | |||
| 1514 | Ga0373927_0227440 | |||
| 1515 | Ga0373933_0000067 | |||
| 1516 | Ga0373933_0005380 | |||
| 1517 | Ga0373933_0005970 | |||
| 1518 | Ga0373933_0006466 | |||
| 1519 | Ga0373933_0019951 | |||
| 1520 | Ga0373933_0025783 | |||
| 1521 | Ga0373933_0054704 | |||
| 1522 | Ga0373933_0071243 | |||
| 1523 | Ga0373947_0000014 | |||
| 1524 | Ga0373947_0000863 | |||
| 1525 | Ga0373947_0045457 | |||
| 1526 | Ga0373947_0144890 | |||
| 1527 | Ga0373947_0233329 | |||
| 1528 | Ga0373937_0028736 | |||
| 1529 | Ga0373937_0042408 | |||
| 1530 | Ga0373937_0281832 | |||
| 1531 | Ga0373925_0000098 | |||
| 1532 | Ga0373925_0001067 | |||
| 1533 | Ga0373925_0009743 | |||
| 1534 | Ga0373925_0025768 | |||
| 1535 | Ga0373925_0031917 | |||
| 1536 | Ga0373925_0133217 | |||
| 1537 | Ga0373925_0236906 | |||
| 1538 | Ga0395900_0133845 | |||
| 1539 | Ga0395900_0217114 | |||
| 1540 | Ga0395905_0019581 | |||
| 1541 | Ga0436364_0077046 | |||
| 1542 | Ga0436364_0431205 | |||
| 1543 | Ga0436364_0516238 | |||
| 1544 | Ga0436364_0814106 | |||
| 1545 | Ga0436364_0944859 | |||
| 1546 | Ga0436364_0950844 | |||
| 1547 | Ga0436364_1528828 | |||
| 1548 | Ga0395901_0015829 | |||
| 1549 | Ga0395901_0276136 | |||
| 1550 | Ga0436365_0415357 | |||
| 1551 | Ga0436365_1347536 | |||
| 1552 | Ga0436363_0003318 | |||
| 1553 | Ga0436363_0194878 | |||
| 1554 | Ga0436363_0371418 | |||
| 1555 | Ga0436362_1050135 | |||
| 1556 | Ga0439448_0046634 | |||
| 1557 | Ga0439458_0014043 | |||
| 1558 | Ga0466965_0126568 | |||
| 1559 | Ga0466966_0001861 | |||
| 1560 | Ga0466966_0199357 | |||
| 1561 | Ga0466963_0000579 | |||
| 1562 | Ga0466963_0042202 | |||
| 1563 | Ga0466964_0068868 | |||
| 1564 | Ga0466971_0017409 | |||
| 1565 | Ga0466970_0145287 | |||
| 1566 | Ga0466957_0010430 | |||
| 1567 | Ga0466957_0308686 | |||
| 1568 | Ga0466959_0002767 | |||
| 1569 | Ga0466959_0142076 | |||
| 1570 | Ga0466958_0000011 | |||
| 1571 | Ga0466958_0094881 | |||
| 1572 | Ga0466967_0107090 | |||
| 1573 | Ga0466967_0253317 | |||
| 1574 | Ga0466967_0431828 | |||
| 1575 | Ga0495592_0000041 | |||
| 1576 | Ga0495592_0006194 | |||
| 1577 | Ga0495592_0048918 | |||
| 1578 | Ga0495592_0049507 | |||
| 1579 | Ga0495592_0162824 | |||
| 1580 | Ga0495603_0057783 | |||
| 1581 | Ga0495603_0096208 | |||
| 1582 | Ga0495629_0083956 | |||
| 1583 | Ga0495629_0290849 | |||
| 1584 | Ga0495641_0057030 | |||
| 1585 | Ga0495641_0060153 | |||
| 1586 | Ga0495651_0000018 | |||
| 1587 | Ga0495651_0013924 | |||
| 1588 | Ga0495651_0015224 | |||
| 1589 | Ga0495651_0024775 | |||
| 1590 | Ga0495651_0025147 | |||
| 1591 | Ga0495651_0031827 | |||
| 1592 | Ga0495651_0049212 | |||
| 1593 | Ga0495651_0100191 | |||
| 1594 | Ga0495653_0003374 | |||
| 1595 | Ga0495653_0033876 | |||
| 1596 | Ga0495653_0039049 | |||
| 1597 | Ga0495653_0063611 | |||
| 1598 | Ga0495653_0112527 | |||
| 1599 | Ga0495580_0060395 | |||
| 1600 | Ga0495582_0001366 | |||
| 1601 | Ga0495582_0003779 | |||
| 1602 | Ga0495582_0008576 | |||
| 1603 | Ga0495639_0001907 | |||
| 1604 | Ga0495639_0030120 | |||
| 1605 | Ga0495662_0000323 | |||
| 1606 | Ga0495662_0016058 | |||
| 1607 | Ga0495664_0003915 | |||
| 1608 | Ga0495664_0019900 | |||
| 1609 | Ga0495664_0056282 | |||
| 1610 | Ga0495664_0130640 | |||
| 1611 | Ga0495664_0178354 | |||
| 1612 | Ga0495594_0050606 | |||
| 1613 | Ga0495608_0000039 | |||
| 1614 | Ga0495608_0000792 | |||
| 1615 | Ga0495608_0014699 | |||
| 1616 | Ga0495608_0016427 | |||
| 1617 | Ga0495608_0043536 | |||
| 1618 | Ga0495618_0013419 | |||
| 1619 | Ga0495618_0013910 | |||
| 1620 | Ga0495628_0011804 | |||
| 1621 | Ga0495628_0065959 | |||
| 1622 | Ga0495628_0074840 | |||
| 1623 | Ga0495628_0154569 | |||
| 1624 | Ga0495630_0000896 | |||
| 1625 | Ga0495630_0043362 | |||
| 1626 | Ga0495630_0055620 | |||
| 1627 | Ga0495630_0181480 | |||
| 1628 | Ga0495648_0001410 | |||
| 1629 | Ga0495652_0000092 | |||
| 1630 | Ga0495652_0012269 | |||
| 1631 | Ga0495652_0029773 | |||
| 1632 | Ga0495652_0090911 | |||
| 1633 | Ga0495652_0166531 | |||
| 1634 | Ga0495665_0008007 | |||
| 1635 | Ga0495665_0045010 | |||
| 1636 | Ga0495665_0093249 | |||
| 1637 | Ga0495640_0018148 | |||
| 1638 | Ga0495640_0035132 | |||
| 1639 | Ga0495640_0052974 | |||
| 1640 | Ga0495640_0057070 | |||
| 1641 | Ga0495586_0011918 | |||
| 1642 | Ga0495587_0000034 | |||
| 1643 | Ga0495587_0009139 | |||
| 1644 | Ga0495587_0020626 | |||
| 1645 | Ga0495587_0023913 | |||
| 1646 | Ga0495587_0037206 | |||
| 1647 | Ga0495587_0068912 | |||
| 1648 | Ga0495645_0005327 | |||
| 1649 | Ga0495645_0016393 | |||
| 1650 | Ga0495645_0063519 | |||
| 1651 | Ga0495622_0020308 | |||
| 1652 | Ga0495667_0000095 | |||
| 1653 | Ga0495667_0007511 | |||
| 1654 | Ga0495667_0014933 | |||
| 1655 | Ga0495667_0098838 | |||
| 1656 | Ga0495667_0104763 | |||
| 1657 | Ga0495634_0019677 | |||
| 1658 | Ga0495634_0043952 | |||
| 1659 | Ga0495634_0054893 | |||
| 1660 | Ga0495634_0089447 | |||
| 1661 | Ga0495611_0029525 | |||
| 1662 | Ga0495635_0007354 | |||
| 1663 | Ga0495635_0013253 | |||
| 1664 | Ga0495635_0033618 | |||
| 1665 | Ga0495635_0042046 | |||
| 1666 | Ga0495635_0043188 | |||
| 1667 | Ga0495635_0080411 | |||
| 1668 | Ga0495635_0151563 | |||
| 1669 | Ga0495588_0033326 | |||
| 1670 | Ga0495588_0128642 | |||
| 1671 | Ga0495657_0002131 | |||
| 1672 | Ga0495657_0012327 | |||
| 1673 | Ga0495657_0017361 | |||
| 1674 | Ga0495657_0018566 | |||
| 1675 | Ga0495657_0025382 | |||
| 1676 | Ga0495657_0058797 | |||
| 1677 | Ga0495657_0059200 | |||
| 1678 | Ga0495657_0068607 | |||
| 1679 | Ga0495657_0093482 | |||
| 1680 | Ga0495599_0000079 | |||
| 1681 | Ga0495599_0013573 | |||
| 1682 | Ga0495599_0067731 | |||
| 1683 | Ga0495599_0071360 | |||
| 1684 | Ga0495599_0105168 | |||
| 1685 | Ga0495623_0003739 | |||
| 1686 | Ga0495623_0069041 | |||
| 1687 | Ga0495623_0137252 | |||
| 1688 | Ga0495647_0002446 | |||
| 1689 | Ga0495658_0020999 | |||
| 1690 | Ga0495658_0128841 | |||
| 1691 | Ga0495658_0149920 | |||
| 1692 | Ga0495613_0001028 | |||
| 1693 | Ga0495624_0018109 | |||
| 1694 | Ga0495624_0024004 | |||
| 1695 | Ga0495624_0040782 | |||
| 1696 | Ga0495624_0154207 | |||
| 1697 | Ga0495600_0013528 | |||
| 1698 | Ga0495600_0047867 | |||
| 1699 | Ga0495600_0092304 | |||
| 1700 | Ga0495581_0011872 | |||
| 1701 | Ga0495581_0047659 | |||
| 1702 | Ga0495581_0052996 | |||
| 1703 | Ga0495581_0056829 | |||
| 1704 | Ga0495581_0063776 | |||
| 1705 | Ga0495604_0000039 | |||
| 1706 | Ga0495604_0048742 | |||
| 1707 | Ga0495604_0074440 | |||
| 1708 | Ga0495604_0091529 | |||
| 1709 | Ga0495674_0004472 | |||
| 1710 | Ga0495674_0006519 | |||
| 1711 | Ga0495674_0010815 | |||
| 1712 | Ga0495674_0024703 | |||
| 1713 | Ga0495674_0045898 | |||
| 1714 | Ga0495674_0056567 | |||
| 1715 | Ga0495674_0093454 | |||
| 1716 | Ga0495674_0147620 | |||
| 1717 | Ga0495674_0196407 | |||
| 1718 | Ga0495674_0269796 | |||
| 1719 | Ga0495676_0002873 | |||
| 1720 | Ga0495680_0000028 | |||
| 1721 | Ga0495680_0002589 | |||
| 1722 | Ga0495680_0011463 | |||
| 1723 | Ga0495680_0014737 | |||
| 1724 | Ga0495680_0028323 | |||
| 1725 | Ga0495680_0032047 | |||
| 1726 | Ga0495680_0096729 | |||
| 1727 | Ga0495680_0101464 | |||
| 1728 | Ga0495675_0001400 | |||
| 1729 | Ga0495675_0007204 | |||
| 1730 | Ga0495675_0009661 | |||
| 1731 | Ga0495684_0003210 | |||
| 1732 | Ga0495684_0011328 | |||
| 1733 | Ga0495684_0014614 | |||
| 1734 | Ga0495684_0021455 | |||
| 1735 | Ga0495684_0026257 | |||
| 1736 | Ga0495684_0062858 | |||
| 1737 | Ga0495684_0219504 | |||
| 1738 | Ga0495684_0245445 | |||
| 1739 | Ga0495684_0278255 | |||
| 1740 | Ga0495593_0006382 | |||
| 1741 | Ga0495593_0009521 | |||
| 1742 | Ga0495593_0073232 | |||
| 1743 | Ga0495602_0000043 | |||
| 1744 | Ga0495602_0025532 | |||
| 1745 | Ga0495602_0031454 | |||
| 1746 | Ga0495602_0057152 | |||
| 1747 | Ga0495602_0194084 | |||
| 1748 | Ga0495602_0233423 | |||
| 1749 | Ga0495614_0061516 | |||
| 1750 | Ga0496100_0069029 | |||
| 1751 | Ga0496101_0061619 | |||
| 1752 | Ga0496101_0185729 | |||
| 1753 | Ga0496101_0262810 | |||
| 1754 | Ga0496102_0016560 | |||
| 1755 | Ga0496102_0069522 | |||
| 1756 | Ga0496102_0102988 | |||
| 1757 | Ga0496103_0048563 | |||
| 1758 | Ga0496103_0251044 | |||
| 1759 | Ga0496104_0008746 | |||
| 1760 | Ga0496104_0017242 | |||
| 1761 | Ga0496104_0029512 | |||
| 1762 | Ga0496104_0051025 | |||
| 1763 | Ga0496105_0000867 | |||
| 1764 | Ga0496105_0007329 | |||
| 1765 | Ga0496105_0017432 | |||
| 1766 | Ga0496105_0096956 | |||
| 1767 | Ga0496105_0259830 | |||
| 1768 | Ga0496106_0027164 | |||
| 1769 | Ga0496106_0080285 | |||
| 1770 | Ga0496106_0116252 | |||
| 1771 | Ga0496107_0005550 | |||
| 1772 | Ga0496107_0020298 | |||
| 1773 | Ga0496108_0036618 | |||
| 1774 | Ga0496108_0077149 | |||
| 1775 | Ga0496108_0169025 | |||
| 1776 | Ga0496108_0171849 | |||
| 1777 | Ga0496108_0212366 | |||
| 1778 | Ga0496108_0251848 | |||
| 1779 | Ga0496108_0258695 | |||
| 1780 | Ga0496109_0007682 | |||
| 1781 | Ga0496109_0042456 | |||
| 1782 | Ga0496109_0059927 | |||
| 1783 | Ga0496109_0083065 | |||
| 1784 | Ga0496109_0437302 | |||
| 1785 | Ga0496110_0032843 | |||
| 1786 | Ga0496110_0040715 | |||
| 1787 | Ga0496110_0100784 | |||
| 1788 | Ga0496111_0135253 | |||
| 1789 | Ga0496112_0000776 | |||
| 1790 | Ga0496112_0051893 | |||
| 1791 | Ga0496112_0093175 | |||
| 1792 | Ga0496112_0119584 | |||
| 1793 | Ga0496112_0253291 | |||
| 1794 | Ga0496113_0134340 | |||
| 1795 | Ga0496113_0197190 | |||
| 1796 | Ga0496113_0202061 | |||
| 1797 | Ga0496114_0011016 | |||
| 1798 | Ga0496114_0050302 | |||
| 1799 | Ga0496114_0062546 | |||
| 1800 | Ga0496114_0161655 | |||
| 1801 | Ga0496115_0000561 | |||
| 1802 | Ga0496115_0003046 | |||
| 1803 | Ga0496115_0066274 | |||
| 1804 | Ga0496115_0143760 | |||
| 1805 | Ga0496119_0065714 | |||
| 1806 | Ga0496121_0083825 | |||
| 1807 | Ga0496124_0084426 | |||
| 1808 | Ga0496126_0060184 | |||
| 1809 | Ga0496126_0090211 | |||
| 1810 | Ga0496126_0115226 | |||
| 1811 | Ga0496126_0194423 | |||
| 1812 | Ga0501036_0098742 | |||
| 1813 | Ga0501039_0026986 | |||
| 1814 | Ga0501041_0035247 | |||
| 1815 | Ga0501041_0051541 | |||
| 1816 | Ga0501042_0289267 | |||
| 1817 | Ga0501035_0125821 | |||
| 1818 | nmdc:mga05p37_11179_c1 | |||
| 1819 | nmdc:mga05p37_22626_c1 | |||
| 1820 | nmdc:mga05p37_2523_c1 | |||
| 1821 | nmdc:mga05p37_269656_c1 | |||
| 1822 | nmdc:mga09592_36734_c1 | |||
| 1823 | nmdc:mga09592_79367_c1 | |||
| 1824 | nmdc:mga0qj67_19010_c1 | |||
| 1825 | nmdc:mga06r32_1163_c2 | |||
| 1826 | nmdc:mga06r32_44229_c1 | |||
| 1827 | nmdc:mga08y16_13231_c1 | |||
| 1828 | nmdc:mga08y16_142984_c1 | |||
| 1829 | nmdc:mga08y16_147441_c1 | |||
| 1830 | nmdc:mga0n895_151041_c1 | |||
| 1831 | nmdc:mga0n895_151509_c1 | |||
| 1832 | nmdc:mga0n895_229883_c1 | |||
| 1833 | nmdc:mga0n895_26038_c1 | |||
| 1834 | nmdc:mga0n895_403998_c1 | |||
| 1835 | nmdc:mga0n895_99738_c1 | |||
| 1836 | nmdc:mga0rr50_131443_c1 | |||
| 1837 | nmdc:mga0rr50_219629_c1 | |||
| 1838 | nmdc:mga0rr50_34496_c1 | |||
| 1839 | nmdc:mga08x19_20175_c1 | |||
| 1840 | nmdc:mga08x19_59388_c1 | |||
| 1841 | nmdc:mga0a205_28564_c1 | |||
| 1842 | Ga0495601_0005115 | |||
| 1843 | Ga0495601_0017476 | |||
| 1844 | Ga0495601_0055666 | |||
| 1845 | Ga0495601_0066440 | |||
| 1846 | Ga0495612_0027468 | |||
| 1847 | Ga0495595_0001127 | |||
| 1848 | Ga0495595_0002342 | |||
| 1849 | Ga0495595_0011263 | |||
| 1850 | Ga0495595_0038361 | |||
| 1851 | Ga0495595_0111972 | |||
| 1852 | Ga0495619_0002498 | |||
| 1853 | Ga0495619_0004190 | |||
| 1854 | Ga0495619_0091419 | |||
| 1855 | Ga0495619_0196464 | |||
| 1856 | Ga0495619_0211778 | |||
| 1857 | Ga0500594_0044935 | |||
| 1858 | Ga0501084_0073795 | |||
| 1859 | Ga0587084_006149 | |||
| 1860 | Ga0587077_013254 | |||
| 1861 | Ga0587080_008906 | |||
| 1862 | Ga0587082_005514 | |||
| 1863 | Ga0587082_009715 | |||
| 1864 | Ga0587083_0002177 | |||
| 1865 | Ga0587085_005247 | |||
| 1866 | Ga0587067_008933 | |||
| 1867 | Ga0587072_010019 | |||
| 1868 | Ga0587079_012556 | |||
| 1869 | Ga0587107_005676 | |||
| 1870 | Ga0466962_0004303 | |||
| 1871 | Ga0530510_0193782 | |||
| 1872 | 2676485579 | |||
| 1873 | 2753271375 | |||
| 1874 | 2816424236 | |||
| 1875 | 2866553888 | |||
| 1876 | 2895435969 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h2b-assembly1.cif.gz_B | crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution | 0.984 | 1 | 341 |
| 1h2b-assembly1.cif.gz_B | crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution | 0.9811 | 1 | 341 |
| 2eer-assembly1.cif.gz_B | structural study of project id st2577 from sulfolobus tokodaii strain7 | 0.9408 | 1 | 341 |
| 3s2i-assembly2.cif.gz_H | crystal structure of furx nadh+:furfuryl alcohol ii | 0.9403 | 1 | 341 |
| 2eer-assembly1.cif.gz_B | structural study of project id st2577 from sulfolobus tokodaii strain7 | 0.9382 | 1 | 341 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1h2bB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9834 | 152 | 290 | 3.40.50.720 |
| 1h2bB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9697 | 152 | 290 | 3.40.50.720 |
| 1ntoA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9346 | 156 | 288 | 3.40.50.720 |
| af_Q17334_7_156_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.929 | 2 | 143 | 3.90.180.10 |
| af_Q0JDV3_9_115_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9183 | 1 | 87 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350JDE9-F1-model_v4 | deleted | 0.9936 | 186 | 341 |
|
| AF-A0A2U9IIF3-F1-model_v4 | Alcohol dehydrogenase | 0.9873 | 1 | 341 |
GO:0008270
GO:0016491 |
| AF-A0A177ET13-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9859 | 1 | 340 |
GO:0008270
GO:0016491 GO:0043231 |
| AF-A0A2U9IIF3-F1-model_v4 | Alcohol dehydrogenase | 0.9845 | 1 | 341 |
GO:0008270
GO:0016491 |
| AF-A0A848DDF5-F1-model_v4 | alcohol dehydrogenase (EC 1.1.1.1) | 0.9833 | 1 | 341 |
GO:0008270
GO:0016491 |