F486240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 369 | 1874 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100765984|Ga0070683_1007659842 |
| Length | 128 |
| Sequence | MDYAGLRGTFPALVRIIRQPMGKNDLLPGTLDMMVLKTLARGTLHGYAIAQLLRQVSEDILQVEEGSLYPALQRLELNGWIEGEWGLSSNNRRARFYRLTAEGRKQLVSETARYRQMTAAIARVMGLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 240 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 241 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 244 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 245 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 246 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 247 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 248 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 249 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 250 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 251 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 252 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 256 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 257 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 346 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 363 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 369 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.04 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 89.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100765984 | 3300005329 | Bacteria | 925 |
| 2 | JGI24742J22300_10110604 | 3300002244 | Unclassified | 537 |
| 3 | Ga0065704_10137469 | 3300005289 | Bacteria | 1554 |
| 4 | Ga0065712_10079161 | 3300005290 | Bacteria | 3252 |
| 5 | Ga0065712_10170858 | 3300005290 | Bacteria | 1245 |
| 6 | Ga0065715_10253384 | 3300005293 | Bacteria | 1160 |
| 7 | Ga0065715_10373111 | 3300005293 | Unclassified | 918 |
| 8 | Ga0065707_10230169 | 3300005295 | Bacteria | 1192 |
| 9 | Ga0065707_10814352 | 3300005295 | Bacteria | 594 |
| 10 | Ga0070658_10006071 | 3300005327 | Bacteria | 9796 |
| 11 | Ga0070658_10128207 | 3300005327 | Bacteria | 2113 |
| 12 | Ga0070676_10074722 | 3300005328 | Bacteria | 2042 |
| 13 | Ga0070676_10248976 | 3300005328 | Unclassified | 1185 |
| 14 | Ga0070676_11399792 | 3300005328 | Unclassified | 536 |
| 15 | Ga0070683_100141890 | 3300005329 | Unclassified | 2276 |
| 16 | Ga0070683_100150806 | 3300005329 | Bacteria | 2204 |
| 17 | Ga0070683_100542286 | 3300005329 | Bacteria | 1112 |
| 18 | Ga0070683_100706019 | 3300005329 | Bacteria | 966 |
| 19 | Ga0070683_101293211 | 3300005329 | Unclassified | 701 |
| 20 | Ga0070690_101087776 | 3300005330 | Bacteria | 634 |
| 21 | Ga0070690_101603190 | 3300005330 | Unclassified | 528 |
| 22 | Ga0070670_100902288 | 3300005331 | Bacteria | 801 |
| 23 | Ga0070670_101425779 | 3300005331 | Unclassified | 635 |
| 24 | Ga0070670_101577163 | 3300005331 | Unclassified | 603 |
| 25 | Ga0070677_10678410 | 3300005333 | Unclassified | 578 |
| 26 | Ga0068869_100268308 | 3300005334 | Bacteria | 1369 |
| 27 | Ga0070666_10589914 | 3300005335 | Bacteria | 810 |
| 28 | Ga0070666_10861878 | 3300005335 | Bacteria | 669 |
| 29 | Ga0070680_100131775 | 3300005336 | Bacteria | 2092 |
| 30 | Ga0070680_100462965 | 3300005336 | Bacteria | 1083 |
| 31 | Ga0070680_100714578 | 3300005336 | Unclassified | 862 |
| 32 | Ga0070682_100920652 | 3300005337 | Bacteria | 720 |
| 33 | Ga0068868_100036868 | 3300005338 | Bacteria | 3787 |
| 34 | Ga0068868_100365500 | 3300005338 | Bacteria | 1239 |
| 35 | Ga0068868_100468717 | 3300005338 | Bacteria | 1098 |
| 36 | Ga0070660_100153085 | 3300005339 | Bacteria | 1855 |
| 37 | Ga0070660_100232298 | 3300005339 | Bacteria | 1501 |
| 38 | Ga0070660_100294327 | 3300005339 | Bacteria | 1330 |
| 39 | Ga0070660_100971896 | 3300005339 | Unclassified | 717 |
| 40 | Ga0070689_100945264 | 3300005340 | Unclassified | 764 |
| 41 | Ga0070689_101000494 | 3300005340 | Unclassified | 744 |
| 42 | Ga0070689_101033658 | 3300005340 | Unclassified | 732 |
| 43 | Ga0070687_100519472 | 3300005343 | Bacteria | 805 |
| 44 | Ga0070692_10048530 | 3300005345 | Bacteria | 2200 |
| 45 | Ga0070675_100001182 | 3300005354 | Bacteria | 18959 |
| 46 | Ga0070675_100112846 | 3300005354 | Bacteria | 2302 |
| 47 | Ga0070675_100322712 | 3300005354 | Unclassified | 1364 |
| 48 | Ga0070675_100461709 | 3300005354 | Unclassified | 1140 |
| 49 | Ga0070671_101134327 | 3300005355 | Unclassified | 687 |
| 50 | Ga0070674_100019948 | 3300005356 | Bacteria | 4271 |
| 51 | Ga0070674_100261710 | 3300005356 | Unclassified | 1363 |
| 52 | Ga0070673_100172965 | 3300005364 | Bacteria | 1844 |
| 53 | Ga0070673_101417031 | 3300005364 | Unclassified | 654 |
| 54 | Ga0070673_102250055 | 3300005364 | Unclassified | 518 |
| 55 | Ga0070688_100064814 | 3300005365 | Bacteria | 2320 |
| 56 | Ga0070688_100186602 | 3300005365 | Bacteria | 1442 |
| 57 | Ga0070688_100359990 | 3300005365 | Unclassified | 1067 |
| 58 | Ga0070659_100126199 | 3300005366 | Bacteria | 2076 |
| 59 | Ga0070659_100204341 | 3300005366 | Bacteria | 1627 |
| 60 | Ga0070659_100256139 | 3300005366 | Bacteria | 1451 |
| 61 | Ga0070659_100354312 | 3300005366 | Bacteria | 1232 |
| 62 | Ga0070667_100250297 | 3300005367 | Bacteria | 1584 |
| 63 | Ga0070667_101184875 | 3300005367 | Unclassified | 715 |
| 64 | Ga0070703_10160870 | 3300005406 | Bacteria | 852 |
| 65 | Ga0070709_10003649 | 3300005434 | Bacteria | 8259 |
| 66 | Ga0070709_10095968 | 3300005434 | Bacteria | 1965 |
| 67 | Ga0070709_11352279 | 3300005434 | Bacteria | 575 |
| 68 | Ga0070714_100036690 | 3300005435 | Bacteria | 4113 |
| 69 | Ga0070714_100547838 | 3300005435 | Unclassified | 1107 |
| 70 | Ga0070714_100703740 | 3300005435 | Bacteria | 975 |
| 71 | Ga0070713_100027377 | 3300005436 | Bacteria | 4487 |
| 72 | Ga0070713_100466633 | 3300005436 | Unclassified | 1188 |
| 73 | Ga0070710_11069465 | 3300005437 | Bacteria | 591 |
| 74 | Ga0070701_10657040 | 3300005438 | Bacteria | 700 |
| 75 | Ga0070701_10831853 | 3300005438 | Unclassified | 632 |
| 76 | Ga0070711_100043490 | 3300005439 | Unclassified | 3042 |
| 77 | Ga0070711_100455456 | 3300005439 | Unclassified | 1048 |
| 78 | Ga0070711_101672062 | 3300005439 | Unclassified | 557 |
| 79 | Ga0070705_100082509 | 3300005440 | Bacteria | 1978 |
| 80 | Ga0070705_101116449 | 3300005440 | Bacteria | 646 |
| 81 | Ga0070700_100215087 | 3300005441 | Bacteria | 1358 |
| 82 | Ga0070694_100002871 | 3300005444 | Bacteria | 10242 |
| 83 | Ga0070694_101289308 | 3300005444 | Bacteria | 614 |
| 84 | Ga0070694_101415009 | 3300005444 | Bacteria | 587 |
| 85 | Ga0070708_100501641 | 3300005445 | Unclassified | 1145 |
| 86 | Ga0070708_101019557 | 3300005445 | Bacteria | 776 |
| 87 | Ga0070663_101653291 | 3300005455 | Bacteria | 572 |
| 88 | Ga0070678_100075559 | 3300005456 | Bacteria | 2535 |
| 89 | Ga0070678_101261145 | 3300005456 | Bacteria | 687 |
| 90 | Ga0070662_100486679 | 3300005457 | Bacteria | 1028 |
| 91 | Ga0070681_10184236 | 3300005458 | Bacteria | 2009 |
| 92 | Ga0070681_10204881 | 3300005458 | Bacteria | 1890 |
| 93 | Ga0070681_10920301 | 3300005458 | Bacteria | 793 |
| 94 | Ga0070681_11851771 | 3300005458 | Bacteria | 531 |
| 95 | Ga0070681_11965037 | 3300005458 | Bacteria | 513 |
| 96 | Ga0068867_100008313 | 3300005459 | Bacteria | 7326 |
| 97 | Ga0068867_100408287 | 3300005459 | Unclassified | 1147 |
| 98 | Ga0068867_101029932 | 3300005459 | Bacteria | 748 |
| 99 | Ga0070685_10682579 | 3300005466 | Bacteria | 747 |
| 100 | Ga0070685_10968914 | 3300005466 | Unclassified | 636 |
| 101 | Ga0070706_101239770 | 3300005467 | Bacteria | 685 |
| 102 | Ga0070698_100339450 | 3300005471 | Unclassified | 1434 |
| 103 | Ga0070699_100509756 | 3300005518 | Bacteria | 1093 |
| 104 | Ga0070699_100989477 | 3300005518 | Bacteria | 771 |
| 105 | Ga0070679_100275258 | 3300005530 | Bacteria | 1636 |
| 106 | Ga0070679_100438235 | 3300005530 | Unclassified | 1251 |
| 107 | Ga0070679_100655225 | 3300005530 | Bacteria | 993 |
| 108 | Ga0070684_100062416 | 3300005535 | Unclassified | 3264 |
| 109 | Ga0070684_100097665 | 3300005535 | Bacteria | 2620 |
| 110 | Ga0070684_100511859 | 3300005535 | Bacteria | 1112 |
| 111 | Ga0070684_101488849 | 3300005535 | Unclassified | 638 |
| 112 | Ga0070697_100311526 | 3300005536 | Bacteria | 1354 |
| 113 | Ga0068853_100009148 | 3300005539 | Bacteria | 7978 |
| 114 | Ga0068853_101359404 | 3300005539 | Bacteria | 687 |
| 115 | Ga0068853_101406467 | 3300005539 | Unclassified | 675 |
| 116 | Ga0068853_101965692 | 3300005539 | Unclassified | 567 |
| 117 | Ga0070672_100966254 | 3300005543 | Bacteria | 754 |
| 118 | Ga0070672_101738113 | 3300005543 | Unclassified | 560 |
| 119 | Ga0070686_100024502 | 3300005544 | Bacteria | 3617 |
| 120 | Ga0070686_100276160 | 3300005544 | Unclassified | 1237 |
| 121 | Ga0070686_100656896 | 3300005544 | Bacteria | 832 |
| 122 | Ga0070695_100049739 | 3300005545 | Bacteria | 2684 |
| 123 | Ga0070695_100066572 | 3300005545 | Bacteria | 2348 |
| 124 | Ga0070695_100082852 | 3300005545 | Bacteria | 2124 |
| 125 | Ga0070696_100023850 | 3300005546 | Bacteria | 4157 |
| 126 | Ga0070696_100059296 | 3300005546 | Bacteria | 2675 |
| 127 | Ga0070693_100084885 | 3300005547 | Bacteria | 1896 |
| 128 | Ga0070693_100586721 | 3300005547 | Bacteria | 803 |
| 129 | Ga0070665_100164274 | 3300005548 | Unclassified | 2223 |
| 130 | Ga0070665_100244495 | 3300005548 | Bacteria | 1795 |
| 131 | Ga0070665_100310607 | 3300005548 | Bacteria | 1580 |
| 132 | Ga0070665_100593731 | 3300005548 | Bacteria | 1120 |
| 133 | Ga0070665_100996628 | 3300005548 | Bacteria | 850 |
| 134 | Ga0070665_101026351 | 3300005548 | Bacteria | 837 |
| 135 | Ga0070665_101062462 | 3300005548 | Bacteria | 821 |
| 136 | Ga0070665_101099342 | 3300005548 | Unclassified | 806 |
| 137 | Ga0070704_100215994 | 3300005549 | Unclassified | 1556 |
| 138 | Ga0068855_100015939 | 3300005563 | Bacteria | 9040 |
| 139 | Ga0068855_100032412 | 3300005563 | Bacteria | 6239 |
| 140 | Ga0068855_100048115 | 3300005563 | Bacteria | 5035 |
| 141 | Ga0068855_100123856 | 3300005563 | Bacteria | 2957 |
| 142 | Ga0068855_100148006 | 3300005563 | Bacteria | 2672 |
| 143 | Ga0068855_100269877 | 3300005563 | Bacteria | 1892 |
| 144 | Ga0068855_101134188 | 3300005563 | Bacteria | 816 |
| 145 | Ga0070664_100120450 | 3300005564 | Bacteria | 2297 |
| 146 | Ga0070664_100273864 | 3300005564 | Bacteria | 1521 |
| 147 | Ga0070664_102362656 | 3300005564 | Unclassified | 504 |
| 148 | Ga0068857_100063837 | 3300005577 | Bacteria | 3274 |
| 149 | Ga0068857_100191331 | 3300005577 | Bacteria | 1863 |
| 150 | Ga0068857_101401149 | 3300005577 | Unclassified | 680 |
| 151 | Ga0068857_102281812 | 3300005577 | Unclassified | 531 |
| 152 | Ga0068854_100117449 | 3300005578 | Bacteria | 2014 |
| 153 | Ga0068856_100042886 | 3300005614 | Bacteria | 4452 |
| 154 | Ga0068856_100049790 | 3300005614 | Unclassified | 4130 |
| 155 | Ga0068856_100207354 | 3300005614 | Unclassified | 1974 |
| 156 | Ga0068856_100236027 | 3300005614 | Bacteria | 1844 |
| 157 | Ga0068856_100310648 | 3300005614 | Bacteria | 1594 |
| 158 | Ga0068856_101204013 | 3300005614 | Unclassified | 774 |
| 159 | Ga0068856_101311596 | 3300005614 | Unclassified | 739 |
| 160 | Ga0068852_100119943 | 3300005616 | Bacteria | 2406 |
| 161 | Ga0068852_100290882 | 3300005616 | Unclassified | 1578 |
| 162 | Ga0068852_100404385 | 3300005616 | Bacteria | 1344 |
| 163 | Ga0068859_100556060 | 3300005617 | Bacteria | 1242 |
| 164 | Ga0068859_101082834 | 3300005617 | Unclassified | 881 |
| 165 | Ga0068859_101137696 | 3300005617 | Unclassified | 859 |
| 166 | Ga0068859_102196788 | 3300005617 | Unclassified | 609 |
| 167 | Ga0068864_100771817 | 3300005618 | Bacteria | 943 |
| 168 | Ga0068861_100314467 | 3300005719 | Bacteria | 1362 |
| 169 | Ga0068861_101296422 | 3300005719 | Bacteria | 708 |
| 170 | Ga0068870_11140194 | 3300005840 | Unclassified | 562 |
| 171 | Ga0068863_100088679 | 3300005841 | Unclassified | 2932 |
| 172 | Ga0068863_100169501 | 3300005841 | Bacteria | 2094 |
| 173 | Ga0068863_100304905 | 3300005841 | Unclassified | 1545 |
| 174 | Ga0068863_100630928 | 3300005841 | Unclassified | 1062 |
| 175 | Ga0068863_100687779 | 3300005841 | Bacteria | 1016 |
| 176 | Ga0068863_101248653 | 3300005841 | Bacteria | 749 |
| 177 | Ga0068863_101984258 | 3300005841 | Unclassified | 592 |
| 178 | Ga0068858_100046850 | 3300005842 | Bacteria | 4008 |
| 179 | Ga0068858_100048278 | 3300005842 | Bacteria | 3945 |
| 180 | Ga0068858_100119375 | 3300005842 | Bacteria | 2465 |
| 181 | Ga0068858_100868802 | 3300005842 | Unclassified | 881 |
| 182 | Ga0068858_100956922 | 3300005842 | Bacteria | 838 |
| 183 | Ga0068858_102247019 | 3300005842 | Unclassified | 539 |
| 184 | Ga0068860_100018684 | 3300005843 | Bacteria | 6741 |
| 185 | Ga0068860_100611289 | 3300005843 | Unclassified | 1096 |
| 186 | Ga0068860_101914978 | 3300005843 | Unclassified | 614 |
| 187 | Ga0068862_100248450 | 3300005844 | Bacteria | 1620 |
| 188 | Ga0068862_100775353 | 3300005844 | Bacteria | 935 |
| 189 | Ga0068862_101420249 | 3300005844 | Bacteria | 698 |
| 190 | Ga0081455_10604489 | 3300005937 | Bacteria | 714 |
| 191 | Ga0070717_10046373 | 3300006028 | Bacteria | 3556 |
| 192 | Ga0070717_10048204 | 3300006028 | Unclassified | 3493 |
| 193 | Ga0070717_10109813 | 3300006028 | Bacteria | 2351 |
| 194 | Ga0075365_10007884 | 3300006038 | Bacteria | 5999 |
| 195 | Ga0075368_10007157 | 3300006042 | Bacteria | 3930 |
| 196 | Ga0075368_10012601 | 3300006042 | Bacteria | 3094 |
| 197 | Ga0075368_10045199 | 3300006042 | Bacteria | 1739 |
| 198 | Ga0075368_10219952 | 3300006042 | Unclassified | 807 |
| 199 | Ga0075363_100025311 | 3300006048 | Bacteria | 3025 |
| 200 | Ga0075363_100262959 | 3300006048 | Bacteria | 996 |
| 201 | Ga0075364_10020939 | 3300006051 | Bacteria | 4118 |
| 202 | Ga0075364_10047219 | 3300006051 | Bacteria | 2804 |
| 203 | Ga0075364_10058219 | 3300006051 | Bacteria | 2532 |
| 204 | Ga0075364_10157200 | 3300006051 | Bacteria | 1533 |
| 205 | Ga0075364_10263130 | 3300006051 | Bacteria | 1172 |
| 206 | Ga0070716_100007878 | 3300006173 | Bacteria | 5271 |
| 207 | Ga0070716_100261681 | 3300006173 | Unclassified | 1184 |
| 208 | Ga0070716_100729477 | 3300006173 | Unclassified | 760 |
| 209 | Ga0070712_100911623 | 3300006175 | Bacteria | 758 |
| 210 | Ga0070712_101120490 | 3300006175 | Bacteria | 683 |
| 211 | Ga0070712_101713518 | 3300006175 | Unclassified | 550 |
| 212 | Ga0070712_101904149 | 3300006175 | Unclassified | 521 |
| 213 | Ga0075367_10011769 | 3300006178 | Bacteria | 4643 |
| 214 | Ga0075367_10022483 | 3300006178 | Unclassified | 3537 |
| 215 | Ga0075367_10025530 | 3300006178 | Bacteria | 3342 |
| 216 | Ga0075367_10091155 | 3300006178 | Bacteria | 1854 |
| 217 | Ga0075367_10282376 | 3300006178 | Unclassified | 1044 |
| 218 | Ga0075367_10872812 | 3300006178 | Bacteria | 573 |
| 219 | Ga0075369_10080203 | 3300006186 | Bacteria | 1446 |
| 220 | Ga0075366_10018970 | 3300006195 | Bacteria | 3975 |
| 221 | Ga0075366_10026345 | 3300006195 | Bacteria | 3405 |
| 222 | Ga0075366_10027116 | 3300006195 | Bacteria | 3360 |
| 223 | Ga0075366_10090703 | 3300006195 | Bacteria | 1830 |
| 224 | Ga0097621_100330739 | 3300006237 | Unclassified | 1351 |
| 225 | Ga0097621_100449857 | 3300006237 | Bacteria | 1160 |
| 226 | Ga0097621_100527177 | 3300006237 | Bacteria | 1073 |
| 227 | Ga0097621_102076350 | 3300006237 | Unclassified | 543 |
| 228 | Ga0097621_102244017 | 3300006237 | Unclassified | 522 |
| 229 | Ga0075370_10058966 | 3300006353 | Bacteria | 2184 |
| 230 | Ga0075370_10071981 | 3300006353 | Bacteria | 1978 |
| 231 | Ga0075370_10116756 | 3300006353 | Bacteria | 1551 |
| 232 | Ga0068871_100206876 | 3300006358 | Unclassified | 1696 |
| 233 | Ga0068871_101768333 | 3300006358 | Unclassified | 587 |
| 234 | Ga0068871_102019376 | 3300006358 | Unclassified | 549 |
| 235 | Ga0068871_102032934 | 3300006358 | Bacteria | 547 |
| 236 | Ga0075428_101091131 | 3300006844 | Bacteria | 843 |
| 237 | Ga0075428_101196347 | 3300006844 | Unclassified | 801 |
| 238 | Ga0075430_100069517 | 3300006846 | Unclassified | 2954 |
| 239 | Ga0075430_101732658 | 3300006846 | Bacteria | 513 |
| 240 | Ga0075431_100043722 | 3300006847 | Bacteria | 4621 |
| 241 | Ga0075431_100190571 | 3300006847 | Bacteria | 2101 |
| 242 | Ga0075431_100762253 | 3300006847 | Unclassified | 943 |
| 243 | Ga0075431_100860162 | 3300006847 | Bacteria | 878 |
| 244 | Ga0075431_100954192 | 3300006847 | Bacteria | 826 |
| 245 | Ga0075433_10004200 | 3300006852 | Bacteria | 11176 |
| 246 | Ga0075433_10006492 | 3300006852 | Bacteria | 9248 |
| 247 | Ga0075433_10106482 | 3300006852 | Bacteria | 2485 |
| 248 | Ga0075433_10554068 | 3300006852 | Unclassified | 1010 |
| 249 | Ga0075433_10679591 | 3300006852 | Bacteria | 902 |
| 250 | Ga0075433_11258444 | 3300006852 | Unclassified | 641 |
| 251 | Ga0075433_11284583 | 3300006852 | Bacteria | 634 |
| 252 | Ga0075434_100449273 | 3300006871 | Bacteria | 1310 |
| 253 | Ga0075434_100687433 | 3300006871 | Bacteria | 1041 |
| 254 | Ga0075434_101552791 | 3300006871 | Unclassified | 671 |
| 255 | Ga0075434_101571334 | 3300006871 | Unclassified | 666 |
| 256 | Ga0075434_102439510 | 3300006871 | Bacteria | 525 |
| 257 | Ga0075429_101217512 | 3300006880 | Unclassified | 657 |
| 258 | Ga0068865_100364689 | 3300006881 | Unclassified | 1174 |
| 259 | Ga0068865_100756299 | 3300006881 | Unclassified | 835 |
| 260 | Ga0068865_101428745 | 3300006881 | Unclassified | 618 |
| 261 | Ga0075436_100478416 | 3300006914 | Unclassified | 909 |
| 262 | Ga0097620_100556096 | 3300006931 | Bacteria | 1242 |
| 263 | Ga0097620_101082824 | 3300006931 | Unclassified | 881 |
| 264 | Ga0097620_101137420 | 3300006931 | Unclassified | 859 |
| 265 | Ga0097620_102196348 | 3300006931 | Unclassified | 609 |
| 266 | Ga0099794_10004862 | 3300007265 | Bacteria | 5335 |
| 267 | Ga0099794_10010820 | 3300007265 | Bacteria | 3886 |
| 268 | Ga0099794_10121061 | 3300007265 | Bacteria | 1316 |
| 269 | Ga0099795_10268904 | 3300007788 | Unclassified | 740 |
| 270 | Ga0105240_10001491 | 3300009093 | Bacteria | 39868 |
| 271 | Ga0105240_10028587 | 3300009093 | Bacteria | 7279 |
| 272 | Ga0105240_10031609 | 3300009093 | Bacteria | 6861 |
| 273 | Ga0105240_10086749 | 3300009093 | Unclassified | 3833 |
| 274 | Ga0105240_10130393 | 3300009093 | Bacteria | 3016 |
| 275 | Ga0105240_10196874 | 3300009093 | Bacteria | 2365 |
| 276 | Ga0105240_10351266 | 3300009093 | Bacteria | 1673 |
| 277 | Ga0105240_10635130 | 3300009093 | Bacteria | 1172 |
| 278 | Ga0105240_10643959 | 3300009093 | Bacteria | 1162 |
| 279 | Ga0105240_10960098 | 3300009093 | Unclassified | 916 |
| 280 | Ga0105240_11389961 | 3300009093 | Unclassified | 738 |
| 281 | Ga0111539_10383356 | 3300009094 | Bacteria | 1637 |
| 282 | Ga0111539_10752500 | 3300009094 | Bacteria | 1134 |
| 283 | Ga0111539_12932688 | 3300009094 | Unclassified | 552 |
| 284 | Ga0105245_10859488 | 3300009098 | Unclassified | 947 |
| 285 | Ga0105247_11832891 | 3300009101 | Bacteria | 506 |
| 286 | Ga0114129_10023624 | 3300009147 | Bacteria | 8713 |
| 287 | Ga0114129_10148291 | 3300009147 | Bacteria | 3212 |
| 288 | Ga0114129_10265584 | 3300009147 | Bacteria | 2298 |
| 289 | Ga0114129_10432691 | 3300009147 | Bacteria | 1728 |
| 290 | Ga0114129_11221163 | 3300009147 | Unclassified | 935 |
| 291 | Ga0114129_11889903 | 3300009147 | Bacteria | 724 |
| 292 | Ga0114129_11923721 | 3300009147 | Unclassified | 717 |
| 293 | Ga0114129_12032608 | 3300009147 | Bacteria | 694 |
| 294 | Ga0105243_10041747 | 3300009148 | Bacteria | 3587 |
| 295 | Ga0105243_10200441 | 3300009148 | Bacteria | 1750 |
| 296 | Ga0105243_11040468 | 3300009148 | Bacteria | 824 |
| 297 | Ga0105241_10086593 | 3300009174 | Bacteria | 2464 |
| 298 | Ga0105241_10378538 | 3300009174 | Bacteria | 1236 |
| 299 | Ga0105241_10678706 | 3300009174 | Bacteria | 938 |
| 300 | Ga0105241_10868584 | 3300009174 | Unclassified | 835 |
| 301 | Ga0105241_11123360 | 3300009174 | Unclassified | 741 |
| 302 | Ga0105241_11217342 | 3300009174 | Unclassified | 714 |
| 303 | Ga0105241_11998308 | 3300009174 | Bacteria | 571 |
| 304 | Ga0105241_12378254 | 3300009174 | Unclassified | 528 |
| 305 | Ga0105242_10151833 | 3300009176 | Bacteria | 2020 |
| 306 | Ga0105242_10272668 | 3300009176 | Unclassified | 1533 |
| 307 | Ga0105242_10694028 | 3300009176 | Unclassified | 995 |
| 308 | Ga0105242_12556962 | 3300009176 | Unclassified | 559 |
| 309 | Ga0105248_10057326 | 3300009177 | Bacteria | 4372 |
| 310 | Ga0105248_10161532 | 3300009177 | Bacteria | 2527 |
| 311 | Ga0105248_10172041 | 3300009177 | Unclassified | 2441 |
| 312 | Ga0105248_10394276 | 3300009177 | Unclassified | 1559 |
| 313 | Ga0105248_10482383 | 3300009177 | Bacteria | 1397 |
| 314 | Ga0105248_11145532 | 3300009177 | Bacteria | 879 |
| 315 | Ga0105248_11934380 | 3300009177 | Unclassified | 669 |
| 316 | Ga0105248_12207181 | 3300009177 | Bacteria | 626 |
| 317 | Ga0105248_12404936 | 3300009177 | Unclassified | 600 |
| 318 | Ga0105237_10002663 | 3300009545 | Bacteria | 21945 |
| 319 | Ga0105237_10025303 | 3300009545 | Bacteria | 6072 |
| 320 | Ga0105237_10086081 | 3300009545 | Bacteria | 3133 |
| 321 | Ga0105237_10152528 | 3300009545 | Bacteria | 2307 |
| 322 | Ga0105237_10385504 | 3300009545 | Bacteria | 1406 |
| 323 | Ga0105237_10837469 | 3300009545 | Bacteria | 927 |
| 324 | Ga0105237_11068756 | 3300009545 | Unclassified | 814 |
| 325 | Ga0105238_10028614 | 3300009551 | Bacteria | 5677 |
| 326 | Ga0105238_10183231 | 3300009551 | Bacteria | 2071 |
| 327 | Ga0105238_12347110 | 3300009551 | Bacteria | 569 |
| 328 | Ga0105249_10015211 | 3300009553 | Bacteria | 6809 |
| 329 | Ga0105249_10031511 | 3300009553 | Bacteria | 4796 |
| 330 | Ga0105249_10403156 | 3300009553 | Bacteria | 1398 |
| 331 | Ga0105249_10543748 | 3300009553 | Bacteria | 1211 |
| 332 | Ga0105249_11059046 | 3300009553 | Unclassified | 881 |
| 333 | Ga0105249_11133229 | 3300009553 | Bacteria | 853 |
| 334 | Ga0105249_12083124 | 3300009553 | Bacteria | 640 |
| 335 | Ga0105249_12083600 | 3300009553 | Unclassified | 640 |
| 336 | Ga0105249_13002889 | 3300009553 | Unclassified | 542 |
| 337 | Ga0105239_10038320 | 3300010375 | Bacteria | 5253 |
| 338 | Ga0105239_10060236 | 3300010375 | Bacteria | 4166 |
| 339 | Ga0105239_10100774 | 3300010375 | Bacteria | 3195 |
| 340 | Ga0105239_10242073 | 3300010375 | Bacteria | 2025 |
| 341 | Ga0105239_10311559 | 3300010375 | Bacteria | 1774 |
| 342 | Ga0105239_11204129 | 3300010375 | Unclassified | 873 |
| 343 | Ga0105239_11911963 | 3300010375 | Unclassified | 688 |
| 344 | Ga0105246_12004141 | 3300011119 | Unclassified | 559 |
| 345 | Ga0157373_10318809 | 3300013100 | Unclassified | 1105 |
| 346 | Ga0157373_10358231 | 3300013100 | Unclassified | 1041 |
| 347 | Ga0157371_10684664 | 3300013102 | Bacteria | 767 |
| 348 | Ga0157370_10000275 | 3300013104 | Bacteria | 65248 |
| 349 | Ga0157370_10002439 | 3300013104 | Bacteria | 22420 |
| 350 | Ga0157370_10251740 | 3300013104 | Bacteria | 1634 |
| 351 | Ga0157370_10258939 | 3300013104 | Bacteria | 1608 |
| 352 | Ga0157370_10276112 | 3300013104 | Bacteria | 1553 |
| 353 | Ga0157370_10626429 | 3300013104 | Bacteria | 984 |
| 354 | Ga0157370_11145583 | 3300013104 | Bacteria | 702 |
| 355 | Ga0157370_11211991 | 3300013104 | Bacteria | 681 |
| 356 | Ga0157370_11421269 | 3300013104 | Bacteria | 624 |
| 357 | Ga0157369_10001633 | 3300013105 | Bacteria | 27410 |
| 358 | Ga0157369_10003218 | 3300013105 | Bacteria | 19470 |
| 359 | Ga0157369_10012038 | 3300013105 | Bacteria | 9823 |
| 360 | Ga0157369_10022247 | 3300013105 | Bacteria | 7080 |
| 361 | Ga0157369_10076948 | 3300013105 | Bacteria | 3577 |
| 362 | Ga0157369_10086718 | 3300013105 | Unclassified | 3343 |
| 363 | Ga0157369_10252545 | 3300013105 | Bacteria | 1840 |
| 364 | Ga0157369_10634944 | 3300013105 | Bacteria | 1102 |
| 365 | Ga0157369_10657273 | 3300013105 | Unclassified | 1081 |
| 366 | Ga0157369_11631684 | 3300013105 | Unclassified | 655 |
| 367 | Ga0157369_12115429 | 3300013105 | Bacteria | 571 |
| 368 | Ga0157369_12390084 | 3300013105 | Unclassified | 535 |
| 369 | Ga0157374_10003406 | 3300013296 | Bacteria | 13354 |
| 370 | Ga0157374_10006174 | 3300013296 | Bacteria | 10156 |
| 371 | Ga0157374_10036331 | 3300013296 | Bacteria | 4511 |
| 372 | Ga0157374_10042130 | 3300013296 | Unclassified | 4211 |
| 373 | Ga0157374_10047465 | 3300013296 | Bacteria | 3982 |
| 374 | Ga0157374_10068546 | 3300013296 | Unclassified | 3338 |
| 375 | Ga0157374_11777018 | 3300013296 | Bacteria | 642 |
| 376 | Ga0157378_10000441 | 3300013297 | Bacteria | 40161 |
| 377 | Ga0157378_11381503 | 3300013297 | Bacteria | 747 |
| 378 | Ga0157378_12224909 | 3300013297 | Bacteria | 599 |
| 379 | Ga0163162_10200718 | 3300013306 | Bacteria | 2123 |
| 380 | Ga0163162_10377660 | 3300013306 | Bacteria | 1550 |
| 381 | Ga0163162_10523313 | 3300013306 | Bacteria | 1315 |
| 382 | Ga0163162_10576080 | 3300013306 | Bacteria | 1253 |
| 383 | Ga0157372_10012625 | 3300013307 | Bacteria | 8998 |
| 384 | Ga0157372_10113671 | 3300013307 | Unclassified | 3103 |
| 385 | Ga0157372_10123880 | 3300013307 | Bacteria | 2971 |
| 386 | Ga0157372_10170373 | 3300013307 | Unclassified | 2519 |
| 387 | Ga0157372_10230718 | 3300013307 | Bacteria | 2146 |
| 388 | Ga0157372_10260639 | 3300013307 | Bacteria | 2013 |
| 389 | Ga0157372_10978946 | 3300013307 | Unclassified | 980 |
| 390 | Ga0157372_11548850 | 3300013307 | Bacteria | 763 |
| 391 | Ga0157375_10564854 | 3300013308 | Bacteria | 1299 |
| 392 | Ga0157375_10576745 | 3300013308 | Unclassified | 1285 |
| 393 | Ga0157375_10582337 | 3300013308 | Bacteria | 1279 |
| 394 | Ga0157375_13547770 | 3300013308 | Bacteria | 519 |
| 395 | Ga0157375_13683165 | 3300013308 | Bacteria | 510 |
| 396 | Ga0163163_10022794 | 3300014325 | Bacteria | 5934 |
| 397 | Ga0163163_10042021 | 3300014325 | Bacteria | 4474 |
| 398 | Ga0163163_10045759 | 3300014325 | Unclassified | 4297 |
| 399 | Ga0163163_10098278 | 3300014325 | Bacteria | 2948 |
| 400 | Ga0163163_10434452 | 3300014325 | Bacteria | 1372 |
| 401 | Ga0163163_10617091 | 3300014325 | Bacteria | 1148 |
| 402 | Ga0163163_10629493 | 3300014325 | Unclassified | 1136 |
| 403 | Ga0163163_10839690 | 3300014325 | Unclassified | 982 |
| 404 | Ga0163163_11045850 | 3300014325 | Unclassified | 880 |
| 405 | Ga0163163_11982608 | 3300014325 | Unclassified | 642 |
| 406 | Ga0163163_13242908 | 3300014325 | Unclassified | 507 |
| 407 | Ga0157380_10024916 | 3300014326 | Bacteria | 4532 |
| 408 | Ga0157380_10295037 | 3300014326 | Bacteria | 1490 |
| 409 | Ga0157380_10355428 | 3300014326 | Bacteria | 1373 |
| 410 | Ga0157380_10446951 | 3300014326 | Bacteria | 1240 |
| 411 | Ga0157380_12935567 | 3300014326 | Bacteria | 543 |
| 412 | Ga0157377_10011072 | 3300014745 | Bacteria | 4489 |
| 413 | Ga0157377_10735393 | 3300014745 | Bacteria | 720 |
| 414 | Ga0157377_11408642 | 3300014745 | Bacteria | 550 |
| 415 | Ga0157379_10015279 | 3300014968 | Bacteria | 6733 |
| 416 | Ga0157379_10156879 | 3300014968 | Bacteria | 2054 |
| 417 | Ga0157379_10553068 | 3300014968 | Unclassified | 1071 |
| 418 | Ga0157379_11319336 | 3300014968 | Bacteria | 697 |
| 419 | Ga0157379_11796600 | 3300014968 | Unclassified | 602 |
| 420 | Ga0157376_10095784 | 3300014969 | Bacteria | 2582 |
| 421 | Ga0157376_10990681 | 3300014969 | Bacteria | 863 |
| 422 | Ga0157376_11702406 | 3300014969 | Unclassified | 666 |
| 423 | Ga0157376_12035472 | 3300014969 | Unclassified | 612 |
| 424 | Ga0157376_12138968 | 3300014969 | Bacteria | 598 |
| 425 | Ga0157376_12337243 | 3300014969 | Unclassified | 574 |
| 426 | Ga0157376_12520006 | 3300014969 | Bacteria | 554 |
| 427 | Ga0163161_10433030 | 3300017792 | Unclassified | 1060 |
| 428 | Ga0206356_11518449 | 3300020070 | Bacteria | 1144 |
| 429 | Ga0213876_10381130 | 3300021384 | Unclassified | 750 |
| 430 | Ga0207697_10038236 | 3300025315 | Bacteria | 1967 |
| 431 | Ga0207682_10122016 | 3300025893 | Unclassified | 1156 |
| 432 | Ga0207692_10501848 | 3300025898 | Unclassified | 770 |
| 433 | Ga0207688_10031557 | 3300025901 | Bacteria | 2925 |
| 434 | Ga0207688_10581958 | 3300025901 | Unclassified | 705 |
| 435 | Ga0207680_10161339 | 3300025903 | Unclassified | 1503 |
| 436 | Ga0207680_10750438 | 3300025903 | Bacteria | 700 |
| 437 | Ga0207680_10857832 | 3300025903 | Unclassified | 651 |
| 438 | Ga0207699_10193527 | 3300025906 | Bacteria | 1374 |
| 439 | Ga0207699_10288593 | 3300025906 | Bacteria | 1142 |
| 440 | Ga0207699_10775510 | 3300025906 | Unclassified | 704 |
| 441 | Ga0207645_10040860 | 3300025907 | Bacteria | 2970 |
| 442 | Ga0207645_10775760 | 3300025907 | Unclassified | 652 |
| 443 | Ga0207705_10019177 | 3300025909 | Bacteria | 4892 |
| 444 | Ga0207705_10347819 | 3300025909 | Bacteria | 1142 |
| 445 | Ga0207707_10113771 | 3300025912 | Unclassified | 2365 |
| 446 | Ga0207707_10140044 | 3300025912 | Bacteria | 2115 |
| 447 | Ga0207707_10415062 | 3300025912 | Bacteria | 1155 |
| 448 | Ga0207707_11369761 | 3300025912 | Bacteria | 566 |
| 449 | Ga0207695_10002639 | 3300025913 | Bacteria | 26224 |
| 450 | Ga0207695_10093049 | 3300025913 | Bacteria | 3024 |
| 451 | Ga0207695_10854057 | 3300025913 | Bacteria | 790 |
| 452 | Ga0207671_10009929 | 3300025914 | Bacteria | 7911 |
| 453 | Ga0207671_10040729 | 3300025914 | Bacteria | 3438 |
| 454 | Ga0207671_10350351 | 3300025914 | Unclassified | 1171 |
| 455 | Ga0207671_10518901 | 3300025914 | Bacteria | 950 |
| 456 | Ga0207693_10028857 | 3300025915 | Bacteria | 4385 |
| 457 | Ga0207693_10700829 | 3300025915 | Unclassified | 784 |
| 458 | Ga0207693_10774480 | 3300025915 | Unclassified | 740 |
| 459 | Ga0207693_10812089 | 3300025915 | Bacteria | 720 |
| 460 | Ga0207693_11150847 | 3300025915 | Bacteria | 587 |
| 461 | Ga0207663_10714966 | 3300025916 | Unclassified | 794 |
| 462 | Ga0207663_10844554 | 3300025916 | Unclassified | 731 |
| 463 | Ga0207663_11307580 | 3300025916 | Unclassified | 584 |
| 464 | Ga0207660_10428855 | 3300025917 | Bacteria | 1067 |
| 465 | Ga0207662_10008440 | 3300025918 | Bacteria | 5639 |
| 466 | Ga0207657_10069879 | 3300025919 | Bacteria | 2977 |
| 467 | Ga0207657_10369127 | 3300025919 | Bacteria | 1131 |
| 468 | Ga0207652_10634672 | 3300025921 | Bacteria | 956 |
| 469 | Ga0207652_10717213 | 3300025921 | Unclassified | 892 |
| 470 | Ga0207652_11038051 | 3300025921 | Unclassified | 719 |
| 471 | Ga0207646_11137716 | 3300025922 | Bacteria | 686 |
| 472 | Ga0207681_11484514 | 3300025923 | Unclassified | 568 |
| 473 | Ga0207694_10093608 | 3300025924 | Bacteria | 2374 |
| 474 | Ga0207694_11534699 | 3300025924 | Bacteria | 562 |
| 475 | Ga0207650_10111147 | 3300025925 | Bacteria | 2122 |
| 476 | Ga0207650_10724462 | 3300025925 | Bacteria | 841 |
| 477 | Ga0207650_11319483 | 3300025925 | Bacteria | 614 |
| 478 | Ga0207650_11667424 | 3300025925 | Unclassified | 541 |
| 479 | Ga0207659_10005643 | 3300025926 | Bacteria | 7611 |
| 480 | Ga0207659_10223900 | 3300025926 | Unclassified | 1514 |
| 481 | Ga0207687_10575493 | 3300025927 | Unclassified | 947 |
| 482 | Ga0207700_10101999 | 3300025928 | Unclassified | 2291 |
| 483 | Ga0207700_11185143 | 3300025928 | Unclassified | 682 |
| 484 | Ga0207664_10053289 | 3300025929 | Bacteria | 3201 |
| 485 | Ga0207664_10483795 | 3300025929 | Unclassified | 1107 |
| 486 | Ga0207690_10159894 | 3300025932 | Unclassified | 1678 |
| 487 | Ga0207690_10327312 | 3300025932 | Bacteria | 1206 |
| 488 | Ga0207706_10021143 | 3300025933 | Bacteria | 5846 |
| 489 | Ga0207686_10440990 | 3300025934 | Unclassified | 1000 |
| 490 | Ga0207709_10010725 | 3300025935 | Bacteria | 5047 |
| 491 | Ga0207709_10078963 | 3300025935 | Bacteria | 2114 |
| 492 | Ga0207709_11126449 | 3300025935 | Bacteria | 645 |
| 493 | Ga0207670_10676066 | 3300025936 | Unclassified | 853 |
| 494 | Ga0207670_10951483 | 3300025936 | Unclassified | 721 |
| 495 | Ga0207669_10003697 | 3300025937 | Bacteria | 6653 |
| 496 | Ga0207669_10148066 | 3300025937 | Bacteria | 1640 |
| 497 | Ga0207669_10475102 | 3300025937 | Unclassified | 995 |
| 498 | Ga0207704_10671197 | 3300025938 | Unclassified | 855 |
| 499 | Ga0207665_10007810 | 3300025939 | Bacteria | 7059 |
| 500 | Ga0207665_10553274 | 3300025939 | Bacteria | 894 |
| 501 | Ga0207665_10770055 | 3300025939 | Unclassified | 759 |
| 502 | Ga0207691_10005849 | 3300025940 | Bacteria | 11895 |
| 503 | Ga0207691_10230875 | 3300025940 | Bacteria | 1602 |
| 504 | Ga0207711_10016342 | 3300025941 | Bacteria | 6167 |
| 505 | Ga0207711_10039002 | 3300025941 | Unclassified | 4039 |
| 506 | Ga0207711_10285103 | 3300025941 | Unclassified | 1521 |
| 507 | Ga0207711_10343347 | 3300025941 | Unclassified | 1382 |
| 508 | Ga0207711_11564053 | 3300025941 | Unclassified | 603 |
| 509 | Ga0207711_11668345 | 3300025941 | Bacteria | 581 |
| 510 | Ga0207689_10154641 | 3300025942 | Bacteria | 1891 |
| 511 | Ga0207689_10227389 | 3300025942 | Bacteria | 1542 |
| 512 | Ga0207689_10311764 | 3300025942 | Unclassified | 1305 |
| 513 | Ga0207689_10387293 | 3300025942 | Unclassified | 1164 |
| 514 | Ga0207689_10419069 | 3300025942 | Bacteria | 1117 |
| 515 | Ga0207661_10041437 | 3300025944 | Unclassified | 3625 |
| 516 | Ga0207661_10153674 | 3300025944 | Bacteria | 1991 |
| 517 | Ga0207661_11383961 | 3300025944 | Unclassified | 646 |
| 518 | Ga0207661_11612703 | 3300025944 | Unclassified | 594 |
| 519 | Ga0207679_10169180 | 3300025945 | Bacteria | 1797 |
| 520 | Ga0207679_10231685 | 3300025945 | Bacteria | 1560 |
| 521 | Ga0207679_10678096 | 3300025945 | Unclassified | 934 |
| 522 | Ga0207679_12148693 | 3300025945 | Unclassified | 507 |
| 523 | Ga0207667_10033770 | 3300025949 | Bacteria | 5497 |
| 524 | Ga0207667_10114403 | 3300025949 | Bacteria | 2781 |
| 525 | Ga0207667_10127358 | 3300025949 | Bacteria | 2623 |
| 526 | Ga0207667_10178187 | 3300025949 | Bacteria | 2183 |
| 527 | Ga0207667_10776657 | 3300025949 | Unclassified | 956 |
| 528 | Ga0207651_10034089 | 3300025960 | Bacteria | 3292 |
| 529 | Ga0207651_10354810 | 3300025960 | Unclassified | 1236 |
| 530 | Ga0207651_10411313 | 3300025960 | Bacteria | 1153 |
| 531 | Ga0207712_10023969 | 3300025961 | Bacteria | 4034 |
| 532 | Ga0207712_10106993 | 3300025961 | Bacteria | 2090 |
| 533 | Ga0207712_10375541 | 3300025961 | Bacteria | 1188 |
| 534 | Ga0207712_11575303 | 3300025961 | Unclassified | 589 |
| 535 | Ga0207640_11413943 | 3300025981 | Bacteria | 623 |
| 536 | Ga0207658_10111594 | 3300025986 | Bacteria | 2163 |
| 537 | Ga0207658_10155195 | 3300025986 | Unclassified | 1870 |
| 538 | Ga0207677_10182388 | 3300026023 | Bacteria | 1652 |
| 539 | Ga0207703_10033858 | 3300026035 | Bacteria | 4052 |
| 540 | Ga0207703_10139863 | 3300026035 | Bacteria | 2100 |
| 541 | Ga0207639_10006836 | 3300026041 | Bacteria | 7768 |
| 542 | Ga0207639_10549652 | 3300026041 | Bacteria | 1060 |
| 543 | Ga0207639_10732528 | 3300026041 | Bacteria | 919 |
| 544 | Ga0207678_10210150 | 3300026067 | Bacteria | 1664 |
| 545 | Ga0207708_10001957 | 3300026075 | Bacteria | 15193 |
| 546 | Ga0207702_10035794 | 3300026078 | Unclassified | 4151 |
| 547 | Ga0207702_10215281 | 3300026078 | Unclassified | 1788 |
| 548 | Ga0207702_10242608 | 3300026078 | Bacteria | 1689 |
| 549 | Ga0207702_10541642 | 3300026078 | Bacteria | 1138 |
| 550 | Ga0207702_10659870 | 3300026078 | Unclassified | 1029 |
| 551 | Ga0207702_10867828 | 3300026078 | Bacteria | 894 |
| 552 | Ga0207702_11756863 | 3300026078 | Unclassified | 613 |
| 553 | Ga0207641_10032489 | 3300026088 | Bacteria | 4332 |
| 554 | Ga0207641_10085799 | 3300026088 | Bacteria | 2744 |
| 555 | Ga0207641_10127022 | 3300026088 | Unclassified | 2284 |
| 556 | Ga0207641_11606145 | 3300026088 | Unclassified | 652 |
| 557 | Ga0207641_12178475 | 3300026088 | Unclassified | 555 |
| 558 | Ga0207648_10071237 | 3300026089 | Bacteria | 3029 |
| 559 | Ga0207648_10649160 | 3300026089 | Unclassified | 975 |
| 560 | Ga0207676_10733475 | 3300026095 | Bacteria | 960 |
| 561 | Ga0207676_11568817 | 3300026095 | Bacteria | 656 |
| 562 | Ga0207674_10050092 | 3300026116 | Bacteria | 4268 |
| 563 | Ga0207674_10130313 | 3300026116 | Bacteria | 2479 |
| 564 | Ga0207674_10225897 | 3300026116 | Bacteria | 1820 |
| 565 | Ga0207674_10710934 | 3300026116 | Bacteria | 970 |
| 566 | Ga0207675_100340784 | 3300026118 | Bacteria | 1467 |
| 567 | Ga0207675_100512056 | 3300026118 | Bacteria | 1195 |
| 568 | Ga0207675_101138796 | 3300026118 | Bacteria | 800 |
| 569 | Ga0207683_11241543 | 3300026121 | Bacteria | 690 |
| 570 | Ga0207683_12096858 | 3300026121 | Unclassified | 514 |
| 571 | Ga0207698_10142754 | 3300026142 | Bacteria | 2066 |
| 572 | Ga0207698_10366701 | 3300026142 | Unclassified | 1366 |
| 573 | Ga0207698_11924620 | 3300026142 | Bacteria | 606 |
| 574 | Ga0209981_1046288 | 3300027378 | Unclassified | 655 |
| 575 | Ga0209588_1017898 | 3300027671 | Bacteria | 2202 |
| 576 | Ga0209588_1041201 | 3300027671 | Bacteria | 1491 |
| 577 | Ga0209588_1076234 | 3300027671 | Unclassified | 1084 |
| 578 | Ga0209966_1031370 | 3300027695 | Unclassified | 1078 |
| 579 | Ga0209998_10045355 | 3300027717 | Unclassified | 1007 |
| 580 | Ga0209813_10033409 | 3300027866 | Bacteria | 1529 |
| 581 | Ga0209813_10037949 | 3300027866 | Bacteria | 1454 |
| 582 | Ga0209813_10095295 | 3300027866 | Bacteria | 1005 |
| 583 | Ga0209813_10102129 | 3300027866 | Bacteria | 977 |
| 584 | Ga0209974_10086927 | 3300027876 | Bacteria | 1081 |
| 585 | Ga0209974_10253281 | 3300027876 | Bacteria | 663 |
| 586 | Ga0207428_10031661 | 3300027907 | Unclassified | 4360 |
| 587 | Ga0265357_1022456 | 3300028023 | Bacteria | 696 |
| 588 | Ga0268266_10100166 | 3300028379 | Bacteria | 2552 |
| 589 | Ga0268266_10326691 | 3300028379 | Bacteria | 1437 |
| 590 | Ga0268266_10327778 | 3300028379 | Bacteria | 1434 |
| 591 | Ga0268266_10568124 | 3300028379 | Bacteria | 1088 |
| 592 | Ga0268266_10629365 | 3300028379 | Bacteria | 1032 |
| 593 | Ga0268266_10869182 | 3300028379 | Bacteria | 872 |
| 594 | Ga0268266_11333847 | 3300028379 | Unclassified | 693 |
| 595 | Ga0268266_11408835 | 3300028379 | Unclassified | 672 |
| 596 | Ga0268265_10046339 | 3300028380 | Bacteria | 3249 |
| 597 | Ga0268265_11724808 | 3300028380 | Unclassified | 632 |
| 598 | Ga0268264_10072965 | 3300028381 | Bacteria | 2911 |
| 599 | Ga0268264_10501694 | 3300028381 | Bacteria | 1184 |
| 600 | Ga0268264_11567986 | 3300028381 | Unclassified | 669 |
| 601 | Ga0265338_10588571 | 3300028800 | Bacteria | 776 |
| 602 | Ga0265770_1032367 | 3300030878 | Bacteria | 882 |
| 603 | Ga0265328_10034603 | 3300031239 | Bacteria | 1870 |
| 604 | Ga0265325_10211568 | 3300031241 | Unclassified | 890 |
| 605 | Ga0265339_10000799 | 3300031249 | Bacteria | 24271 |
| 606 | Ga0265327_10231069 | 3300031251 | Bacteria | 829 |
| 607 | Ga0265316_10011395 | 3300031344 | Bacteria | 8023 |
| 608 | Ga0265316_10089431 | 3300031344 | Unclassified | 2350 |
| 609 | Ga0265314_10008447 | 3300031711 | Bacteria | 8822 |
| 610 | Ga0265342_10089185 | 3300031712 | Bacteria | 1770 |
| 611 | Ga0265342_10715670 | 3300031712 | Unclassified | 500 |
| 612 | Ga0307405_10459966 | 3300031731 | Bacteria | 1011 |
| 613 | Ga0307413_10572297 | 3300031824 | Bacteria | 920 |
| 614 | Ga0307410_11526666 | 3300031852 | Unclassified | 589 |
| 615 | Ga0307407_10276644 | 3300031903 | Bacteria | 1161 |
| 616 | Ga0307407_10356111 | 3300031903 | Bacteria | 1038 |
| 617 | Ga0307409_100488783 | 3300031995 | Unclassified | 1196 |
| 618 | Ga0307416_100181685 | 3300032002 | Bacteria | 1972 |
| 619 | Ga0307416_100200194 | 3300032002 | Bacteria | 1894 |
| 620 | Ga0307416_101666129 | 3300032002 | Unclassified | 743 |
| 621 | Ga0307416_101807093 | 3300032002 | Bacteria | 715 |
| 622 | Ga0307411_10097589 | 3300032005 | Bacteria | 2069 |
| 623 | Ga0307415_101003029 | 3300032126 | Bacteria | 776 |
| 624 | Ga0373926_0002737 | 3300035083 | Bacteria | 5620 |
| 625 | Ga0373926_0301540 | 3300035083 | Bacteria | 625 |
| 626 | Ga0373926_0397682 | 3300035083 | Unclassified | 544 |
| 627 | Ga0373934_0311117 | 3300035086 | Unclassified | 654 |
| 628 | Ga0373944_0333434 | 3300035089 | Unclassified | 574 |
| 629 | Ga0373944_0436083 | 3300035089 | Bacteria | 509 |
| 630 | Ga0373949_0228359 | 3300035090 | Bacteria | 568 |
| 631 | Ga0373923_0001065 | 3300035111 | Bacteria | 7514 |
| 632 | Ga0373923_0425827 | 3300035111 | Unclassified | 641 |
| 633 | Ga0373923_0672590 | 3300035111 | Unclassified | 513 |
| 634 | Ga0373945_0002156 | 3300035116 | Bacteria | 6142 |
| 635 | Ga0373946_0047283 | 3300035171 | Bacteria | 1787 |
| 636 | Ga0373962_0093140 | 3300035242 | Bacteria | 931 |
| 637 | Ga0373924_0010056 | 3300035410 | Bacteria | 3482 |
| 638 | Ga0373931_0349151 | 3300035691 | Bacteria | 926 |
| 639 | Ga0373935_0004904 | 3300035692 | Bacteria | 7861 |
| 640 | Ga0373935_0023860 | 3300035692 | Bacteria | 3758 |
| 641 | Ga0373935_1241977 | 3300035692 | Unclassified | 556 |
| 642 | Ga0373927_0032397 | 3300035695 | Unclassified | 3405 |
| 643 | Ga0373927_0117760 | 3300035695 | Unclassified | 1733 |
| 644 | Ga0373927_0289720 | 3300035695 | Bacteria | 1077 |
| 645 | Ga0373933_0322016 | 3300035724 | Bacteria | 1003 |
| 646 | Ga0373947_0301092 | 3300035725 | Bacteria | 1069 |
| 647 | Ga0373947_0423867 | 3300035725 | Unclassified | 899 |
| 648 | Ga0373937_0138920 | 3300036401 | Bacteria | 2273 |
| 649 | Ga0373937_2036543 | 3300036401 | Bacteria | 520 |
| 650 | Ga0373925_0020170 | 3300037068 | Unclassified | 4851 |
| 651 | Ga0373925_0025584 | 3300037068 | Unclassified | 4313 |
| 652 | Ga0373925_0062558 | 3300037068 | Unclassified | 2799 |
| 653 | Ga0373925_0156347 | 3300037068 | Bacteria | 1794 |
| 654 | Ga0373925_0253289 | 3300037068 | Bacteria | 1412 |
| 655 | Ga0373925_0784092 | 3300037068 | Bacteria | 786 |
| 656 | Ga0395900_1422033 | 3300037418 | Unclassified | 606 |
| 657 | Ga0395900_1604579 | 3300037418 | Unclassified | 562 |
| 658 | Ga0436364_0011168 | 3300037853 | Unclassified | 746 |
| 659 | Ga0436364_0292186 | 3300037853 | Unclassified | 964 |
| 660 | Ga0395901_0834350 | 3300038443 | Bacteria | 908 |
| 661 | Ga0436365_0192005 | 3300039437 | Bacteria | 1709 |
| 662 | Ga0436365_0364484 | 3300039437 | Bacteria | 1661 |
| 663 | Ga0436365_1482532 | 3300039437 | Bacteria | 2927 |
| 664 | Ga0436363_0679652 | 3300039450 | Unclassified | 876 |
| 665 | Ga0439461_0041567 | 3300041410 | Unclassified | 995 |
| 666 | Ga0451793_1061829 | 3300041452 | Bacteria | 858 |
| 667 | Ga0451802_0514694 | 3300041460 | Bacteria | 574 |
| 668 | Ga0451804_0836850 | 3300041463 | Bacteria | 504 |
| 669 | Ga0451807_2677791 | 3300041486 | Unclassified | 634 |
| 670 | Ga0451835_1066438 | 3300041492 | Unclassified | 537 |
| 671 | Ga0451837_1816888 | 3300041494 | Bacteria | 741 |
| 672 | Ga0451849_1285460 | 3300041505 | Unclassified | 670 |
| 673 | Ga0451853_3825130 | 3300041512 | Bacteria | 881 |
| 674 | Ga0439431_0007685 | 3300041997 | Bacteria | 2407 |
| 675 | Ga0439433_0149630 | 3300041999 | Bacteria | 600 |
| 676 | Ga0439445_0022379 | 3300042004 | Unclassified | 1594 |
| 677 | Ga0439448_0123817 | 3300042005 | Bacteria | 888 |
| 678 | Ga0439448_0349072 | 3300042005 | Bacteria | 527 |
| 679 | Ga0439456_087054 | 3300042013 | Unclassified | 700 |
| 680 | Ga0439462_0245493 | 3300042015 | Bacteria | 514 |
| 681 | Ga0450920_057499 | 3300042122 | Bacteria | 784 |
| 682 | Ga0450923_024079 | 3300042125 | Bacteria | 1205 |
| 683 | Ga0450896_056325 | 3300042133 | Bacteria | 634 |
| 684 | Ga0450900_008954 | 3300042136 | Unclassified | 1261 |
| 685 | Ga0439446_0070651 | 3300042156 | Unclassified | 1068 |
| 686 | Ga0439446_0104045 | 3300042156 | Unclassified | 900 |
| 687 | Ga0439434_0012676 | 3300042435 | Bacteria | 2496 |
| 688 | Ga0439435_0031108 | 3300042436 | Unclassified | 1449 |
| 689 | Ga0439444_0024636 | 3300042437 | Bacteria | 1089 |
| 690 | Ga0451577_0866738 | 3300042876 | Bacteria | 814 |
| 691 | Ga0466965_0882289 | 3300044683 | Bacteria | 521 |
| 692 | Ga0466963_0105926 | 3300044694 | Bacteria | 1928 |
| 693 | Ga0466963_0186443 | 3300044694 | Unclassified | 1449 |
| 694 | Ga0466963_0750730 | 3300044694 | Bacteria | 688 |
| 695 | Ga0466957_0110326 | 3300044842 | Bacteria | 1744 |
| 696 | Ga0466957_1274244 | 3300044842 | Bacteria | 533 |
| 697 | Ga0466960_0065225 | 3300044901 | Bacteria | 1798 |
| 698 | Ga0466959_0520080 | 3300045049 | Unclassified | 804 |
| 699 | Ga0466959_0639086 | 3300045049 | Bacteria | 715 |
| 700 | Ga0466958_0773779 | 3300045836 | Unclassified | 626 |
| 701 | Ga0466967_0141142 | 3300045976 | Bacteria | 2244 |
| 702 | Ga0466967_1093976 | 3300045976 | Bacteria | 794 |
| 703 | Ga0466967_2024265 | 3300045976 | Bacteria | 572 |
| 704 | Ga0495629_0720638 | 3300046459 | Unclassified | 661 |
| 705 | Ga0495629_0937494 | 3300046459 | Bacteria | 566 |
| 706 | Ga0495651_0110445 | 3300046462 | Bacteria | 2034 |
| 707 | Ga0495651_0320777 | 3300046462 | Unclassified | 1033 |
| 708 | Ga0495651_0985880 | 3300046462 | Bacteria | 512 |
| 709 | Ga0495651_0993223 | 3300046462 | Unclassified | 510 |
| 710 | Ga0495653_0048953 | 3300046463 | Unclassified | 3259 |
| 711 | Ga0495580_0003125 | 3300046472 | Bacteria | 14188 |
| 712 | Ga0495580_0240460 | 3300046472 | Unclassified | 1241 |
| 713 | Ga0495580_0429509 | 3300046472 | Unclassified | 888 |
| 714 | Ga0495582_0205508 | 3300046473 | Bacteria | 1125 |
| 715 | Ga0495582_0433268 | 3300046473 | Unclassified | 759 |
| 716 | Ga0495664_0585213 | 3300046477 | Bacteria | 664 |
| 717 | Ga0495664_0637571 | 3300046477 | Unclassified | 632 |
| 718 | Ga0495664_0671983 | 3300046477 | Bacteria | 613 |
| 719 | Ga0495594_0655778 | 3300046499 | Bacteria | 594 |
| 720 | Ga0495608_0170641 | 3300046511 | Unclassified | 1380 |
| 721 | Ga0495608_0333378 | 3300046511 | Bacteria | 936 |
| 722 | Ga0495628_0119499 | 3300046516 | Unclassified | 2023 |
| 723 | Ga0495628_0120031 | 3300046516 | Unclassified | 2018 |
| 724 | Ga0495628_1246106 | 3300046516 | Unclassified | 503 |
| 725 | Ga0495630_0053540 | 3300046517 | Unclassified | 3022 |
| 726 | Ga0495630_0715809 | 3300046517 | Unclassified | 766 |
| 727 | Ga0495663_0381737 | 3300046525 | Unclassified | 516 |
| 728 | Ga0495666_0429481 | 3300046526 | Unclassified | 593 |
| 729 | Ga0495652_0254604 | 3300046529 | Bacteria | 1299 |
| 730 | Ga0495652_0489495 | 3300046529 | Unclassified | 855 |
| 731 | Ga0495652_1117613 | 3300046529 | Unclassified | 511 |
| 732 | Ga0495665_0053680 | 3300046531 | Unclassified | 2130 |
| 733 | Ga0495665_0097091 | 3300046531 | Bacteria | 1547 |
| 734 | Ga0495665_0439319 | 3300046531 | Unclassified | 660 |
| 735 | Ga0495640_0557207 | 3300046533 | Unclassified | 694 |
| 736 | Ga0495586_0359421 | 3300046535 | Unclassified | 837 |
| 737 | Ga0495587_0751339 | 3300046536 | Unclassified | 534 |
| 738 | Ga0495598_0078711 | 3300046537 | Unclassified | 1053 |
| 739 | Ga0495645_0103518 | 3300046543 | Bacteria | 2022 |
| 740 | Ga0495633_0061096 | 3300046558 | Bacteria | 1765 |
| 741 | Ga0495633_0144281 | 3300046558 | Bacteria | 1100 |
| 742 | Ga0495667_0270357 | 3300046559 | Unclassified | 1080 |
| 743 | Ga0495656_0056014 | 3300046615 | Bacteria | 1702 |
| 744 | Ga0495634_0196839 | 3300046642 | Unclassified | 1254 |
| 745 | Ga0495634_0729663 | 3300046642 | Unclassified | 568 |
| 746 | Ga0495635_0043167 | 3300046663 | Bacteria | 3111 |
| 747 | Ga0495635_0343788 | 3300046663 | Unclassified | 996 |
| 748 | Ga0495635_0432457 | 3300046663 | Unclassified | 871 |
| 749 | Ga0495635_0666689 | 3300046663 | Unclassified | 676 |
| 750 | Ga0495659_0054117 | 3300046664 | Bacteria | 1468 |
| 751 | Ga0495599_0279552 | 3300046678 | Unclassified | 1011 |
| 752 | Ga0495599_0744750 | 3300046678 | Bacteria | 562 |
| 753 | Ga0495623_0211380 | 3300046679 | Unclassified | 1110 |
| 754 | Ga0495646_0375500 | 3300046680 | Unclassified | 742 |
| 755 | Ga0495658_0440113 | 3300046683 | Bacteria | 832 |
| 756 | Ga0495658_0663334 | 3300046683 | Unclassified | 668 |
| 757 | Ga0495658_1085113 | 3300046683 | Unclassified | 510 |
| 758 | Ga0495669_0362444 | 3300046684 | Unclassified | 701 |
| 759 | Ga0495613_0258345 | 3300046689 | Bacteria | 1214 |
| 760 | Ga0495613_0757645 | 3300046689 | Unclassified | 636 |
| 761 | Ga0495613_1078397 | 3300046689 | Unclassified | 513 |
| 762 | Ga0495670_0086104 | 3300046691 | Bacteria | 1604 |
| 763 | Ga0495670_0843901 | 3300046691 | Unclassified | 500 |
| 764 | Ga0495600_0142326 | 3300046809 | Unclassified | 1556 |
| 765 | Ga0495581_0455349 | 3300047315 | Bacteria | 745 |
| 766 | Ga0495581_0796553 | 3300047315 | Bacteria | 542 |
| 767 | Ga0495604_0338937 | 3300047317 | Bacteria | 1001 |
| 768 | Ga0495604_0485600 | 3300047317 | Unclassified | 803 |
| 769 | Ga0495674_0023516 | 3300047319 | Bacteria | 5678 |
| 770 | Ga0495674_0084565 | 3300047319 | Unclassified | 2719 |
| 771 | Ga0495674_0440699 | 3300047319 | Unclassified | 1048 |
| 772 | Ga0495674_0496643 | 3300047319 | Bacteria | 976 |
| 773 | Ga0495674_0653218 | 3300047319 | Unclassified | 829 |
| 774 | Ga0495674_0802501 | 3300047319 | Bacteria | 732 |
| 775 | Ga0495675_0075670 | 3300047444 | Unclassified | 2122 |
| 776 | Ga0495677_0263280 | 3300047445 | Unclassified | 675 |
| 777 | Ga0495684_0007683 | 3300047471 | Bacteria | 8343 |
| 778 | Ga0495684_0045666 | 3300047471 | Bacteria | 3352 |
| 779 | Ga0495684_0509761 | 3300047471 | Unclassified | 826 |
| 780 | Ga0495684_0692522 | 3300047471 | Unclassified | 677 |
| 781 | Ga0495593_0268331 | 3300047673 | Unclassified | 854 |
| 782 | Ga0495602_0386243 | 3300048088 | Unclassified | 1002 |
| 783 | Ga0495602_0877674 | 3300048088 | Unclassified | 598 |
| 784 | Ga0496102_1133857 | 3300048905 | Bacteria | 702 |
| 785 | Ga0496103_0188587 | 3300048906 | Bacteria | 1326 |
| 786 | Ga0496104_0241180 | 3300048907 | Unclassified | 1720 |
| 787 | Ga0496105_0147557 | 3300048908 | Bacteria | 1934 |
| 788 | Ga0496105_0660791 | 3300048908 | Unclassified | 806 |
| 789 | Ga0496105_0986288 | 3300048908 | Unclassified | 631 |
| 790 | Ga0496107_0311918 | 3300048910 | Bacteria | 1171 |
| 791 | Ga0496107_1317243 | 3300048910 | Unclassified | 516 |
| 792 | Ga0496109_0000029 | 3300048912 | Bacteria | 164675 |
| 793 | Ga0496110_1245055 | 3300048913 | Unclassified | 653 |
| 794 | Ga0496112_0090209 | 3300048915 | Unclassified | 3034 |
| 795 | Ga0496112_0097964 | 3300048915 | Bacteria | 2902 |
| 796 | Ga0496112_0404975 | 3300048915 | Bacteria | 1304 |
| 797 | Ga0496112_0563499 | 3300048915 | Unclassified | 1073 |
| 798 | Ga0496112_1469779 | 3300048915 | Unclassified | 596 |
| 799 | Ga0496113_0016830 | 3300048916 | Bacteria | 5059 |
| 800 | Ga0496113_0264096 | 3300048916 | Unclassified | 1375 |
| 801 | Ga0496113_0456590 | 3300048916 | Bacteria | 1027 |
| 802 | Ga0496113_0550061 | 3300048916 | Unclassified | 926 |
| 803 | Ga0496115_0467382 | 3300048918 | Bacteria | 1017 |
| 804 | Ga0501033_0355527 | 3300049570 | Bacteria | 1026 |
| 805 | Ga0501033_0420425 | 3300049570 | Bacteria | 931 |
| 806 | Ga0501034_0004512 | 3300049571 | Bacteria | 15476 |
| 807 | Ga0501034_0036561 | 3300049571 | Bacteria | 4974 |
| 808 | Ga0501034_1718114 | 3300049571 | Unclassified | 500 |
| 809 | Ga0501036_0642151 | 3300049572 | Unclassified | 879 |
| 810 | Ga0501040_0095848 | 3300049576 | Unclassified | 2065 |
| 811 | Ga0501040_0660511 | 3300049576 | Bacteria | 756 |
| 812 | Ga0501040_1373641 | 3300049576 | Bacteria | 513 |
| 813 | Ga0501042_0734248 | 3300049578 | Bacteria | 718 |
| 814 | Ga0501043_0106051 | 3300049579 | Bacteria | 2207 |
| 815 | Ga0501046_0316429 | 3300049580 | Bacteria | 1138 |
| 816 | Ga0501047_0014774 | 3300049581 | Bacteria | 7431 |
| 817 | Ga0501047_0736987 | 3300049581 | Bacteria | 802 |
| 818 | Ga0501048_0016155 | 3300049582 | Bacteria | 5503 |
| 819 | Ga0501048_0201139 | 3300049582 | Unclassified | 1412 |
| 820 | Ga0501067_0038877 | 3300049583 | Bacteria | 2642 |
| 821 | Ga0501069_0103568 | 3300049585 | Bacteria | 1617 |
| 822 | Ga0501070_0049375 | 3300049586 | Bacteria | 3494 |
| 823 | Ga0501071_0100267 | 3300049587 | Bacteria | 2134 |
| 824 | Ga0501072_0222755 | 3300049588 | Bacteria | 1503 |
| 825 | Ga0501073_0399136 | 3300049589 | Bacteria | 950 |
| 826 | Ga0501075_0202697 | 3300049591 | Bacteria | 1513 |
| 827 | Ga0501075_0209707 | 3300049591 | Bacteria | 1486 |
| 828 | Ga0501075_0562242 | 3300049591 | Bacteria | 870 |
| 829 | Ga0501076_0015648 | 3300049592 | Bacteria | 5736 |
| 830 | Ga0501076_1259577 | 3300049592 | Bacteria | 608 |
| 831 | Ga0501077_0758601 | 3300049593 | Bacteria | 624 |
| 832 | Ga0501206_075728 | 3300049653 | Bacteria | 577 |
| 833 | Ga0501079_0155646 | 3300049741 | Unclassified | 1782 |
| 834 | Ga0501079_0621628 | 3300049741 | Bacteria | 850 |
| 835 | Ga0501079_1112216 | 3300049741 | Bacteria | 623 |
| 836 | Ga0501080_0136269 | 3300049742 | Unclassified | 2272 |
| 837 | Ga0501080_0406250 | 3300049742 | Unclassified | 1225 |
| 838 | Ga0501083_0000176 | 3300049744 | Bacteria | 41234 |
| 839 | Ga0501083_0213229 | 3300049744 | Bacteria | 1259 |
| 840 | Ga0501083_0626515 | 3300049744 | Unclassified | 700 |
| 841 | Ga0501265_041854 | 3300049762 | Unclassified | 695 |
| 842 | Ga0501035_0004937 | 3300049822 | Bacteria | 12652 |
| 843 | Ga0501035_0212618 | 3300049822 | Bacteria | 1654 |
| 844 | Ga0501035_0862624 | 3300049822 | Unclassified | 719 |
| 845 | Ga0501044_0108956 | 3300049823 | Bacteria | 2779 |
| 846 | Ga0501045_0268990 | 3300049824 | Bacteria | 1269 |
| 847 | Ga0501045_0307145 | 3300049824 | Bacteria | 1181 |
| 848 | Ga0501045_0598872 | 3300049824 | Bacteria | 816 |
| 849 | Ga0501045_0860739 | 3300049824 | Bacteria | 667 |
| 850 | Ga0501045_0973538 | 3300049824 | Unclassified | 622 |
| 851 | nmdc:mga03n38_141217_c1 | 3300050490 | Bacteria | 1203 |
| 852 | nmdc:mga03n38_155322_c1 | 3300050490 | Bacteria | 1154 |
| 853 | nmdc:mga00v17_232084_c1 | 3300050491 | Bacteria | 1196 |
| 854 | nmdc:mga00v17_35173_c1 | 3300050491 | Bacteria | 2979 |
| 855 | nmdc:mga00v17_427696_c1 | 3300050491 | Bacteria | 860 |
| 856 | nmdc:mga00v17_6367_c1 | 3300050491 | Bacteria | 6262 |
| 857 | nmdc:mga00v17_64876_c1 | 3300050491 | Bacteria | 2251 |
| 858 | nmdc:mga00v17_8235_c1 | 3300050491 | Bacteria | 5305 |
| 859 | nmdc:mga0yw44_31582_c1 | 3300050492 | Bacteria | 3081 |
| 860 | nmdc:mga0k408_102986_c1 | 3300050493 | Unclassified | 1684 |
| 861 | nmdc:mga0k408_18772_c1 | 3300050493 | Bacteria | 3862 |
| 862 | nmdc:mga0k408_222154_c1 | 3300050493 | Unclassified | 1128 |
| 863 | nmdc:mga0k408_383063_c1 | 3300050493 | Bacteria | 838 |
| 864 | nmdc:mga0k408_6295_c1 | 3300050493 | Bacteria | 6332 |
| 865 | nmdc:mga06z11_210415_c1 | 3300050494 | Unclassified | 1133 |
| 866 | nmdc:mga06z11_316930_c1 | 3300050494 | Bacteria | 930 |
| 867 | nmdc:mga06z11_865696_c1 | 3300050494 | Bacteria | 551 |
| 868 | nmdc:mga06z11_97277_c1 | 3300050494 | Bacteria | 1609 |
| 869 | nmdc:mga06z11_982072_c1 | 3300050494 | Unclassified | 515 |
| 870 | nmdc:mga04h51_110242_c1 | 3300050495 | Bacteria | 1014 |
| 871 | nmdc:mga04h51_45387_c1 | 3300050495 | Bacteria | 1453 |
| 872 | nmdc:mga04h51_75998_c1 | 3300050495 | Bacteria | 1183 |
| 873 | nmdc:mga04h51_80027_c1 | 3300050495 | Bacteria | 1158 |
| 874 | nmdc:mga07m45_21273_c1 | 3300050496 | Bacteria | 3530 |
| 875 | nmdc:mga07m45_6433_c1 | 3300050496 | Bacteria | 5936 |
| 876 | nmdc:mga07m45_7105_c1 | 3300050496 | Bacteria | 5702 |
| 877 | nmdc:mga07m45_88934_c1 | 3300050496 | Bacteria | 1768 |
| 878 | nmdc:mga07m45_9204_c1 | 3300050496 | Bacteria | 5110 |
| 879 | nmdc:mga05p37_1127174_c1 | 3300050507 | Bacteria | 819 |
| 880 | nmdc:mga05p37_1768244_c1 | 3300050507 | Unclassified | 598 |
| 881 | nmdc:mga05p37_17826_c1 | 3300050507 | Bacteria | 8571 |
| 882 | nmdc:mga05p37_345269_c1 | 3300050507 | Bacteria | 1754 |
| 883 | nmdc:mga05p37_54761_c1 | 3300050507 | Bacteria | 4907 |
| 884 | nmdc:mga05p37_566040_c1 | 3300050507 | Bacteria | 1290 |
| 885 | nmdc:mga05p37_7651_c1 | 3300050507 | Bacteria | 12750 |
| 886 | nmdc:mga09592_1031405_c1 | 3300050508 | Bacteria | 686 |
| 887 | nmdc:mga0qj67_1178963_c1 | 3300050509 | Bacteria | 596 |
| 888 | nmdc:mga0qj67_762971_c1 | 3300050509 | Unclassified | 767 |
| 889 | nmdc:mga06r32_107528_c1 | 3300050510 | Bacteria | 2741 |
| 890 | nmdc:mga06r32_1139642_c1 | 3300050510 | Bacteria | 728 |
| 891 | nmdc:mga06r32_1173492_c1 | 3300050510 | Bacteria | 715 |
| 892 | nmdc:mga06r32_131676_c1 | 3300050510 | Bacteria | 2473 |
| 893 | nmdc:mga06r32_194049_c1 | 3300050510 | Bacteria | 2018 |
| 894 | nmdc:mga06r32_35620_c1 | 3300050510 | Bacteria | 4696 |
| 895 | nmdc:mga06r32_387623_c1 | 3300050510 | Bacteria | 1380 |
| 896 | nmdc:mga06r32_670392_c1 | 3300050510 | Unclassified | 1004 |
| 897 | nmdc:mga06r32_778132_c1 | 3300050510 | Bacteria | 919 |
| 898 | nmdc:mga08y16_1505406_c1 | 3300050511 | Bacteria | 633 |
| 899 | nmdc:mga08y16_1929942_c1 | 3300050511 | Unclassified | 541 |
| 900 | nmdc:mga08y16_435461_c1 | 3300050511 | Bacteria | 1339 |
| 901 | nmdc:mga08y16_6052_c1 | 3300050511 | Bacteria | 12680 |
| 902 | nmdc:mga08y16_606326_c1 | 3300050511 | Bacteria | 1103 |
| 903 | nmdc:mga08y16_778488_c1 | 3300050511 | Bacteria | 951 |
| 904 | nmdc:mga0n895_1648284_c1 | 3300050512 | Bacteria | 605 |
| 905 | nmdc:mga0n895_30208_c1 | 3300050512 | Bacteria | 5176 |
| 906 | nmdc:mga0n895_384620_c1 | 3300050512 | Unclassified | 1420 |
| 907 | nmdc:mga0n895_466660_c1 | 3300050512 | Bacteria | 1274 |
| 908 | nmdc:mga0n895_734774_c1 | 3300050512 | Bacteria | 981 |
| 909 | nmdc:mga0rr50_1468126_c1 | 3300050513 | Bacteria | 577 |
| 910 | nmdc:mga0rr50_29939_c1 | 3300050513 | Bacteria | 3847 |
| 911 | nmdc:mga0rr50_780551_c1 | 3300050513 | Unclassified | 815 |
| 912 | nmdc:mga08x19_352370_c1 | 3300050514 | Unclassified | 1028 |
| 913 | nmdc:mga08x19_354758_c1 | 3300050514 | Bacteria | 1024 |
| 914 | nmdc:mga0a205_16161_c1 | 3300050515 | Bacteria | 6988 |
| 915 | nmdc:mga0a205_4096_c1 | 3300050515 | Bacteria | 13043 |
| 916 | nmdc:mga0a205_427155_c1 | 3300050515 | Unclassified | 1187 |
| 917 | nmdc:mga0a205_611602_c1 | 3300050515 | Bacteria | 942 |
| 918 | nmdc:mga0a205_805851_c1 | 3300050515 | Unclassified | 787 |
| 919 | nmdc:mga0sz30_42221_c1 | 3300050516 | Bacteria | 1918 |
| 920 | Ga0495655_0354498 | 3300053083 | Unclassified | 514 |
| 921 | Ga0495619_0664290 | 3300053085 | Unclassified | 710 |
| 922 | Ga0500555_020268 | 3300053103 | Bacteria | 1916 |
| 923 | Ga0500555_073000 | 3300053103 | Bacteria | 903 |
| 924 | Ga0500555_084740 | 3300053103 | Unclassified | 820 |
| 925 | Ga0500562_083010 | 3300053108 | Bacteria | 868 |
| 926 | Ga0500592_090881 | 3300053116 | Bacteria | 512 |
| 927 | Ga0500645_000233 | 3300053730 | Bacteria | 42370 |
| 928 | Ga0501084_0090610 | 3300054114 | Unclassified | 2567 |
| 929 | Ga0501084_0165943 | 3300054114 | Bacteria | 1864 |
| 930 | Ga0501084_0583307 | 3300054114 | Bacteria | 945 |
| 931 | Ga0590075_062371 | 3300059424 | Bacteria | 961 |
| 932 | Ga0501082_0010848 | 3300060353 | Bacteria | 7847 |
| 933 | Ga0501082_0372912 | 3300060353 | Bacteria | 1245 |
| 934 | Ga0501082_0821849 | 3300060353 | Bacteria | 813 |
| 935 | Ga0501082_1596181 | 3300060353 | Unclassified | 570 |
| 936 | Ga0466962_0281964 | 3300061719 | Unclassified | 820 |
| 937 | Ga0530510_0123246 | 3300061734 | Bacteria | 1904 |
| 938 | Ga0070683_100765984 | |||
| 939 | JGI24742J22300_10110604 | |||
| 940 | Ga0065704_10137469 | |||
| 941 | Ga0065712_10079161 | |||
| 942 | Ga0065712_10170858 | |||
| 943 | Ga0065715_10253384 | |||
| 944 | Ga0065715_10373111 | |||
| 945 | Ga0065707_10230169 | |||
| 946 | Ga0065707_10814352 | |||
| 947 | Ga0070658_10006071 | |||
| 948 | Ga0070658_10128207 | |||
| 949 | Ga0070676_10074722 | |||
| 950 | Ga0070676_10248976 | |||
| 951 | Ga0070676_11399792 | |||
| 952 | Ga0070683_100141890 | |||
| 953 | Ga0070683_100150806 | |||
| 954 | Ga0070683_100542286 | |||
| 955 | Ga0070683_100706019 | |||
| 956 | Ga0070683_101293211 | |||
| 957 | Ga0070690_101087776 | |||
| 958 | Ga0070690_101603190 | |||
| 959 | Ga0070670_100902288 | |||
| 960 | Ga0070670_101425779 | |||
| 961 | Ga0070670_101577163 | |||
| 962 | Ga0070677_10678410 | |||
| 963 | Ga0068869_100268308 | |||
| 964 | Ga0070666_10589914 | |||
| 965 | Ga0070666_10861878 | |||
| 966 | Ga0070680_100131775 | |||
| 967 | Ga0070680_100462965 | |||
| 968 | Ga0070680_100714578 | |||
| 969 | Ga0070682_100920652 | |||
| 970 | Ga0068868_100036868 | |||
| 971 | Ga0068868_100365500 | |||
| 972 | Ga0068868_100468717 | |||
| 973 | Ga0070660_100153085 | |||
| 974 | Ga0070660_100232298 | |||
| 975 | Ga0070660_100294327 | |||
| 976 | Ga0070660_100971896 | |||
| 977 | Ga0070689_100945264 | |||
| 978 | Ga0070689_101000494 | |||
| 979 | Ga0070689_101033658 | |||
| 980 | Ga0070687_100519472 | |||
| 981 | Ga0070692_10048530 | |||
| 982 | Ga0070675_100001182 | |||
| 983 | Ga0070675_100112846 | |||
| 984 | Ga0070675_100322712 | |||
| 985 | Ga0070675_100461709 | |||
| 986 | Ga0070671_101134327 | |||
| 987 | Ga0070674_100019948 | |||
| 988 | Ga0070674_100261710 | |||
| 989 | Ga0070673_100172965 | |||
| 990 | Ga0070673_101417031 | |||
| 991 | Ga0070673_102250055 | |||
| 992 | Ga0070688_100064814 | |||
| 993 | Ga0070688_100186602 | |||
| 994 | Ga0070688_100359990 | |||
| 995 | Ga0070659_100126199 | |||
| 996 | Ga0070659_100204341 | |||
| 997 | Ga0070659_100256139 | |||
| 998 | Ga0070659_100354312 | |||
| 999 | Ga0070667_100250297 | |||
| 1000 | Ga0070667_101184875 | |||
| 1001 | Ga0070703_10160870 | |||
| 1002 | Ga0070709_10003649 | |||
| 1003 | Ga0070709_10095968 | |||
| 1004 | Ga0070709_11352279 | |||
| 1005 | Ga0070714_100036690 | |||
| 1006 | Ga0070714_100547838 | |||
| 1007 | Ga0070714_100703740 | |||
| 1008 | Ga0070713_100027377 | |||
| 1009 | Ga0070713_100466633 | |||
| 1010 | Ga0070710_11069465 | |||
| 1011 | Ga0070701_10657040 | |||
| 1012 | Ga0070701_10831853 | |||
| 1013 | Ga0070711_100043490 | |||
| 1014 | Ga0070711_100455456 | |||
| 1015 | Ga0070711_101672062 | |||
| 1016 | Ga0070705_100082509 | |||
| 1017 | Ga0070705_101116449 | |||
| 1018 | Ga0070700_100215087 | |||
| 1019 | Ga0070694_100002871 | |||
| 1020 | Ga0070694_101289308 | |||
| 1021 | Ga0070694_101415009 | |||
| 1022 | Ga0070708_100501641 | |||
| 1023 | Ga0070708_101019557 | |||
| 1024 | Ga0070663_101653291 | |||
| 1025 | Ga0070678_100075559 | |||
| 1026 | Ga0070678_101261145 | |||
| 1027 | Ga0070662_100486679 | |||
| 1028 | Ga0070681_10184236 | |||
| 1029 | Ga0070681_10204881 | |||
| 1030 | Ga0070681_10920301 | |||
| 1031 | Ga0070681_11851771 | |||
| 1032 | Ga0070681_11965037 | |||
| 1033 | Ga0068867_100008313 | |||
| 1034 | Ga0068867_100408287 | |||
| 1035 | Ga0068867_101029932 | |||
| 1036 | Ga0070685_10682579 | |||
| 1037 | Ga0070685_10968914 | |||
| 1038 | Ga0070706_101239770 | |||
| 1039 | Ga0070698_100339450 | |||
| 1040 | Ga0070699_100509756 | |||
| 1041 | Ga0070699_100989477 | |||
| 1042 | Ga0070679_100275258 | |||
| 1043 | Ga0070679_100438235 | |||
| 1044 | Ga0070679_100655225 | |||
| 1045 | Ga0070684_100062416 | |||
| 1046 | Ga0070684_100097665 | |||
| 1047 | Ga0070684_100511859 | |||
| 1048 | Ga0070684_101488849 | |||
| 1049 | Ga0070697_100311526 | |||
| 1050 | Ga0068853_100009148 | |||
| 1051 | Ga0068853_101359404 | |||
| 1052 | Ga0068853_101406467 | |||
| 1053 | Ga0068853_101965692 | |||
| 1054 | Ga0070672_100966254 | |||
| 1055 | Ga0070672_101738113 | |||
| 1056 | Ga0070686_100024502 | |||
| 1057 | Ga0070686_100276160 | |||
| 1058 | Ga0070686_100656896 | |||
| 1059 | Ga0070695_100049739 | |||
| 1060 | Ga0070695_100066572 | |||
| 1061 | Ga0070695_100082852 | |||
| 1062 | Ga0070696_100023850 | |||
| 1063 | Ga0070696_100059296 | |||
| 1064 | Ga0070693_100084885 | |||
| 1065 | Ga0070693_100586721 | |||
| 1066 | Ga0070665_100164274 | |||
| 1067 | Ga0070665_100244495 | |||
| 1068 | Ga0070665_100310607 | |||
| 1069 | Ga0070665_100593731 | |||
| 1070 | Ga0070665_100996628 | |||
| 1071 | Ga0070665_101026351 | |||
| 1072 | Ga0070665_101062462 | |||
| 1073 | Ga0070665_101099342 | |||
| 1074 | Ga0070704_100215994 | |||
| 1075 | Ga0068855_100015939 | |||
| 1076 | Ga0068855_100032412 | |||
| 1077 | Ga0068855_100048115 | |||
| 1078 | Ga0068855_100123856 | |||
| 1079 | Ga0068855_100148006 | |||
| 1080 | Ga0068855_100269877 | |||
| 1081 | Ga0068855_101134188 | |||
| 1082 | Ga0070664_100120450 | |||
| 1083 | Ga0070664_100273864 | |||
| 1084 | Ga0070664_102362656 | |||
| 1085 | Ga0068857_100063837 | |||
| 1086 | Ga0068857_100191331 | |||
| 1087 | Ga0068857_101401149 | |||
| 1088 | Ga0068857_102281812 | |||
| 1089 | Ga0068854_100117449 | |||
| 1090 | Ga0068856_100042886 | |||
| 1091 | Ga0068856_100049790 | |||
| 1092 | Ga0068856_100207354 | |||
| 1093 | Ga0068856_100236027 | |||
| 1094 | Ga0068856_100310648 | |||
| 1095 | Ga0068856_101204013 | |||
| 1096 | Ga0068856_101311596 | |||
| 1097 | Ga0068852_100119943 | |||
| 1098 | Ga0068852_100290882 | |||
| 1099 | Ga0068852_100404385 | |||
| 1100 | Ga0068859_100556060 | |||
| 1101 | Ga0068859_101082834 | |||
| 1102 | Ga0068859_101137696 | |||
| 1103 | Ga0068859_102196788 | |||
| 1104 | Ga0068864_100771817 | |||
| 1105 | Ga0068861_100314467 | |||
| 1106 | Ga0068861_101296422 | |||
| 1107 | Ga0068870_11140194 | |||
| 1108 | Ga0068863_100088679 | |||
| 1109 | Ga0068863_100169501 | |||
| 1110 | Ga0068863_100304905 | |||
| 1111 | Ga0068863_100630928 | |||
| 1112 | Ga0068863_100687779 | |||
| 1113 | Ga0068863_101248653 | |||
| 1114 | Ga0068863_101984258 | |||
| 1115 | Ga0068858_100046850 | |||
| 1116 | Ga0068858_100048278 | |||
| 1117 | Ga0068858_100119375 | |||
| 1118 | Ga0068858_100868802 | |||
| 1119 | Ga0068858_100956922 | |||
| 1120 | Ga0068858_102247019 | |||
| 1121 | Ga0068860_100018684 | |||
| 1122 | Ga0068860_100611289 | |||
| 1123 | Ga0068860_101914978 | |||
| 1124 | Ga0068862_100248450 | |||
| 1125 | Ga0068862_100775353 | |||
| 1126 | Ga0068862_101420249 | |||
| 1127 | Ga0081455_10604489 | |||
| 1128 | Ga0070717_10046373 | |||
| 1129 | Ga0070717_10048204 | |||
| 1130 | Ga0070717_10109813 | |||
| 1131 | Ga0075365_10007884 | |||
| 1132 | Ga0075368_10007157 | |||
| 1133 | Ga0075368_10012601 | |||
| 1134 | Ga0075368_10045199 | |||
| 1135 | Ga0075368_10219952 | |||
| 1136 | Ga0075363_100025311 | |||
| 1137 | Ga0075363_100262959 | |||
| 1138 | Ga0075364_10020939 | |||
| 1139 | Ga0075364_10047219 | |||
| 1140 | Ga0075364_10058219 | |||
| 1141 | Ga0075364_10157200 | |||
| 1142 | Ga0075364_10263130 | |||
| 1143 | Ga0070716_100007878 | |||
| 1144 | Ga0070716_100261681 | |||
| 1145 | Ga0070716_100729477 | |||
| 1146 | Ga0070712_100911623 | |||
| 1147 | Ga0070712_101120490 | |||
| 1148 | Ga0070712_101713518 | |||
| 1149 | Ga0070712_101904149 | |||
| 1150 | Ga0075367_10011769 | |||
| 1151 | Ga0075367_10022483 | |||
| 1152 | Ga0075367_10025530 | |||
| 1153 | Ga0075367_10091155 | |||
| 1154 | Ga0075367_10282376 | |||
| 1155 | Ga0075367_10872812 | |||
| 1156 | Ga0075369_10080203 | |||
| 1157 | Ga0075366_10018970 | |||
| 1158 | Ga0075366_10026345 | |||
| 1159 | Ga0075366_10027116 | |||
| 1160 | Ga0075366_10090703 | |||
| 1161 | Ga0097621_100330739 | |||
| 1162 | Ga0097621_100449857 | |||
| 1163 | Ga0097621_100527177 | |||
| 1164 | Ga0097621_102076350 | |||
| 1165 | Ga0097621_102244017 | |||
| 1166 | Ga0075370_10058966 | |||
| 1167 | Ga0075370_10071981 | |||
| 1168 | Ga0075370_10116756 | |||
| 1169 | Ga0068871_100206876 | |||
| 1170 | Ga0068871_101768333 | |||
| 1171 | Ga0068871_102019376 | |||
| 1172 | Ga0068871_102032934 | |||
| 1173 | Ga0075428_101091131 | |||
| 1174 | Ga0075428_101196347 | |||
| 1175 | Ga0075430_100069517 | |||
| 1176 | Ga0075430_101732658 | |||
| 1177 | Ga0075431_100043722 | |||
| 1178 | Ga0075431_100190571 | |||
| 1179 | Ga0075431_100762253 | |||
| 1180 | Ga0075431_100860162 | |||
| 1181 | Ga0075431_100954192 | |||
| 1182 | Ga0075433_10004200 | |||
| 1183 | Ga0075433_10006492 | |||
| 1184 | Ga0075433_10106482 | |||
| 1185 | Ga0075433_10554068 | |||
| 1186 | Ga0075433_10679591 | |||
| 1187 | Ga0075433_11258444 | |||
| 1188 | Ga0075433_11284583 | |||
| 1189 | Ga0075434_100449273 | |||
| 1190 | Ga0075434_100687433 | |||
| 1191 | Ga0075434_101552791 | |||
| 1192 | Ga0075434_101571334 | |||
| 1193 | Ga0075434_102439510 | |||
| 1194 | Ga0075429_101217512 | |||
| 1195 | Ga0068865_100364689 | |||
| 1196 | Ga0068865_100756299 | |||
| 1197 | Ga0068865_101428745 | |||
| 1198 | Ga0075436_100478416 | |||
| 1199 | Ga0097620_100556096 | |||
| 1200 | Ga0097620_101082824 | |||
| 1201 | Ga0097620_101137420 | |||
| 1202 | Ga0097620_102196348 | |||
| 1203 | Ga0099794_10004862 | |||
| 1204 | Ga0099794_10010820 | |||
| 1205 | Ga0099794_10121061 | |||
| 1206 | Ga0099795_10268904 | |||
| 1207 | Ga0105240_10001491 | |||
| 1208 | Ga0105240_10028587 | |||
| 1209 | Ga0105240_10031609 | |||
| 1210 | Ga0105240_10086749 | |||
| 1211 | Ga0105240_10130393 | |||
| 1212 | Ga0105240_10196874 | |||
| 1213 | Ga0105240_10351266 | |||
| 1214 | Ga0105240_10635130 | |||
| 1215 | Ga0105240_10643959 | |||
| 1216 | Ga0105240_10960098 | |||
| 1217 | Ga0105240_11389961 | |||
| 1218 | Ga0111539_10383356 | |||
| 1219 | Ga0111539_10752500 | |||
| 1220 | Ga0111539_12932688 | |||
| 1221 | Ga0105245_10859488 | |||
| 1222 | Ga0105247_11832891 | |||
| 1223 | Ga0114129_10023624 | |||
| 1224 | Ga0114129_10148291 | |||
| 1225 | Ga0114129_10265584 | |||
| 1226 | Ga0114129_10432691 | |||
| 1227 | Ga0114129_11221163 | |||
| 1228 | Ga0114129_11889903 | |||
| 1229 | Ga0114129_11923721 | |||
| 1230 | Ga0114129_12032608 | |||
| 1231 | Ga0105243_10041747 | |||
| 1232 | Ga0105243_10200441 | |||
| 1233 | Ga0105243_11040468 | |||
| 1234 | Ga0105241_10086593 | |||
| 1235 | Ga0105241_10378538 | |||
| 1236 | Ga0105241_10678706 | |||
| 1237 | Ga0105241_10868584 | |||
| 1238 | Ga0105241_11123360 | |||
| 1239 | Ga0105241_11217342 | |||
| 1240 | Ga0105241_11998308 | |||
| 1241 | Ga0105241_12378254 | |||
| 1242 | Ga0105242_10151833 | |||
| 1243 | Ga0105242_10272668 | |||
| 1244 | Ga0105242_10694028 | |||
| 1245 | Ga0105242_12556962 | |||
| 1246 | Ga0105248_10057326 | |||
| 1247 | Ga0105248_10161532 | |||
| 1248 | Ga0105248_10172041 | |||
| 1249 | Ga0105248_10394276 | |||
| 1250 | Ga0105248_10482383 | |||
| 1251 | Ga0105248_11145532 | |||
| 1252 | Ga0105248_11934380 | |||
| 1253 | Ga0105248_12207181 | |||
| 1254 | Ga0105248_12404936 | |||
| 1255 | Ga0105237_10002663 | |||
| 1256 | Ga0105237_10025303 | |||
| 1257 | Ga0105237_10086081 | |||
| 1258 | Ga0105237_10152528 | |||
| 1259 | Ga0105237_10385504 | |||
| 1260 | Ga0105237_10837469 | |||
| 1261 | Ga0105237_11068756 | |||
| 1262 | Ga0105238_10028614 | |||
| 1263 | Ga0105238_10183231 | |||
| 1264 | Ga0105238_12347110 | |||
| 1265 | Ga0105249_10015211 | |||
| 1266 | Ga0105249_10031511 | |||
| 1267 | Ga0105249_10403156 | |||
| 1268 | Ga0105249_10543748 | |||
| 1269 | Ga0105249_11059046 | |||
| 1270 | Ga0105249_11133229 | |||
| 1271 | Ga0105249_12083124 | |||
| 1272 | Ga0105249_12083600 | |||
| 1273 | Ga0105249_13002889 | |||
| 1274 | Ga0105239_10038320 | |||
| 1275 | Ga0105239_10060236 | |||
| 1276 | Ga0105239_10100774 | |||
| 1277 | Ga0105239_10242073 | |||
| 1278 | Ga0105239_10311559 | |||
| 1279 | Ga0105239_11204129 | |||
| 1280 | Ga0105239_11911963 | |||
| 1281 | Ga0105246_12004141 | |||
| 1282 | Ga0157373_10318809 | |||
| 1283 | Ga0157373_10358231 | |||
| 1284 | Ga0157371_10684664 | |||
| 1285 | Ga0157370_10000275 | |||
| 1286 | Ga0157370_10002439 | |||
| 1287 | Ga0157370_10251740 | |||
| 1288 | Ga0157370_10258939 | |||
| 1289 | Ga0157370_10276112 | |||
| 1290 | Ga0157370_10626429 | |||
| 1291 | Ga0157370_11145583 | |||
| 1292 | Ga0157370_11211991 | |||
| 1293 | Ga0157370_11421269 | |||
| 1294 | Ga0157369_10001633 | |||
| 1295 | Ga0157369_10003218 | |||
| 1296 | Ga0157369_10012038 | |||
| 1297 | Ga0157369_10022247 | |||
| 1298 | Ga0157369_10076948 | |||
| 1299 | Ga0157369_10086718 | |||
| 1300 | Ga0157369_10252545 | |||
| 1301 | Ga0157369_10634944 | |||
| 1302 | Ga0157369_10657273 | |||
| 1303 | Ga0157369_11631684 | |||
| 1304 | Ga0157369_12115429 | |||
| 1305 | Ga0157369_12390084 | |||
| 1306 | Ga0157374_10003406 | |||
| 1307 | Ga0157374_10006174 | |||
| 1308 | Ga0157374_10036331 | |||
| 1309 | Ga0157374_10042130 | |||
| 1310 | Ga0157374_10047465 | |||
| 1311 | Ga0157374_10068546 | |||
| 1312 | Ga0157374_11777018 | |||
| 1313 | Ga0157378_10000441 | |||
| 1314 | Ga0157378_11381503 | |||
| 1315 | Ga0157378_12224909 | |||
| 1316 | Ga0163162_10200718 | |||
| 1317 | Ga0163162_10377660 | |||
| 1318 | Ga0163162_10523313 | |||
| 1319 | Ga0163162_10576080 | |||
| 1320 | Ga0157372_10012625 | |||
| 1321 | Ga0157372_10113671 | |||
| 1322 | Ga0157372_10123880 | |||
| 1323 | Ga0157372_10170373 | |||
| 1324 | Ga0157372_10230718 | |||
| 1325 | Ga0157372_10260639 | |||
| 1326 | Ga0157372_10978946 | |||
| 1327 | Ga0157372_11548850 | |||
| 1328 | Ga0157375_10564854 | |||
| 1329 | Ga0157375_10576745 | |||
| 1330 | Ga0157375_10582337 | |||
| 1331 | Ga0157375_13547770 | |||
| 1332 | Ga0157375_13683165 | |||
| 1333 | Ga0163163_10022794 | |||
| 1334 | Ga0163163_10042021 | |||
| 1335 | Ga0163163_10045759 | |||
| 1336 | Ga0163163_10098278 | |||
| 1337 | Ga0163163_10434452 | |||
| 1338 | Ga0163163_10617091 | |||
| 1339 | Ga0163163_10629493 | |||
| 1340 | Ga0163163_10839690 | |||
| 1341 | Ga0163163_11045850 | |||
| 1342 | Ga0163163_11982608 | |||
| 1343 | Ga0163163_13242908 | |||
| 1344 | Ga0157380_10024916 | |||
| 1345 | Ga0157380_10295037 | |||
| 1346 | Ga0157380_10355428 | |||
| 1347 | Ga0157380_10446951 | |||
| 1348 | Ga0157380_12935567 | |||
| 1349 | Ga0157377_10011072 | |||
| 1350 | Ga0157377_10735393 | |||
| 1351 | Ga0157377_11408642 | |||
| 1352 | Ga0157379_10015279 | |||
| 1353 | Ga0157379_10156879 | |||
| 1354 | Ga0157379_10553068 | |||
| 1355 | Ga0157379_11319336 | |||
| 1356 | Ga0157379_11796600 | |||
| 1357 | Ga0157376_10095784 | |||
| 1358 | Ga0157376_10990681 | |||
| 1359 | Ga0157376_11702406 | |||
| 1360 | Ga0157376_12035472 | |||
| 1361 | Ga0157376_12138968 | |||
| 1362 | Ga0157376_12337243 | |||
| 1363 | Ga0157376_12520006 | |||
| 1364 | Ga0163161_10433030 | |||
| 1365 | Ga0206356_11518449 | |||
| 1366 | Ga0213876_10381130 | |||
| 1367 | Ga0207697_10038236 | |||
| 1368 | Ga0207682_10122016 | |||
| 1369 | Ga0207692_10501848 | |||
| 1370 | Ga0207688_10031557 | |||
| 1371 | Ga0207688_10581958 | |||
| 1372 | Ga0207680_10161339 | |||
| 1373 | Ga0207680_10750438 | |||
| 1374 | Ga0207680_10857832 | |||
| 1375 | Ga0207699_10193527 | |||
| 1376 | Ga0207699_10288593 | |||
| 1377 | Ga0207699_10775510 | |||
| 1378 | Ga0207645_10040860 | |||
| 1379 | Ga0207645_10775760 | |||
| 1380 | Ga0207705_10019177 | |||
| 1381 | Ga0207705_10347819 | |||
| 1382 | Ga0207707_10113771 | |||
| 1383 | Ga0207707_10140044 | |||
| 1384 | Ga0207707_10415062 | |||
| 1385 | Ga0207707_11369761 | |||
| 1386 | Ga0207695_10002639 | |||
| 1387 | Ga0207695_10093049 | |||
| 1388 | Ga0207695_10854057 | |||
| 1389 | Ga0207671_10009929 | |||
| 1390 | Ga0207671_10040729 | |||
| 1391 | Ga0207671_10350351 | |||
| 1392 | Ga0207671_10518901 | |||
| 1393 | Ga0207693_10028857 | |||
| 1394 | Ga0207693_10700829 | |||
| 1395 | Ga0207693_10774480 | |||
| 1396 | Ga0207693_10812089 | |||
| 1397 | Ga0207693_11150847 | |||
| 1398 | Ga0207663_10714966 | |||
| 1399 | Ga0207663_10844554 | |||
| 1400 | Ga0207663_11307580 | |||
| 1401 | Ga0207660_10428855 | |||
| 1402 | Ga0207662_10008440 | |||
| 1403 | Ga0207657_10069879 | |||
| 1404 | Ga0207657_10369127 | |||
| 1405 | Ga0207652_10634672 | |||
| 1406 | Ga0207652_10717213 | |||
| 1407 | Ga0207652_11038051 | |||
| 1408 | Ga0207646_11137716 | |||
| 1409 | Ga0207681_11484514 | |||
| 1410 | Ga0207694_10093608 | |||
| 1411 | Ga0207694_11534699 | |||
| 1412 | Ga0207650_10111147 | |||
| 1413 | Ga0207650_10724462 | |||
| 1414 | Ga0207650_11319483 | |||
| 1415 | Ga0207650_11667424 | |||
| 1416 | Ga0207659_10005643 | |||
| 1417 | Ga0207659_10223900 | |||
| 1418 | Ga0207687_10575493 | |||
| 1419 | Ga0207700_10101999 | |||
| 1420 | Ga0207700_11185143 | |||
| 1421 | Ga0207664_10053289 | |||
| 1422 | Ga0207664_10483795 | |||
| 1423 | Ga0207690_10159894 | |||
| 1424 | Ga0207690_10327312 | |||
| 1425 | Ga0207706_10021143 | |||
| 1426 | Ga0207686_10440990 | |||
| 1427 | Ga0207709_10010725 | |||
| 1428 | Ga0207709_10078963 | |||
| 1429 | Ga0207709_11126449 | |||
| 1430 | Ga0207670_10676066 | |||
| 1431 | Ga0207670_10951483 | |||
| 1432 | Ga0207669_10003697 | |||
| 1433 | Ga0207669_10148066 | |||
| 1434 | Ga0207669_10475102 | |||
| 1435 | Ga0207704_10671197 | |||
| 1436 | Ga0207665_10007810 | |||
| 1437 | Ga0207665_10553274 | |||
| 1438 | Ga0207665_10770055 | |||
| 1439 | Ga0207691_10005849 | |||
| 1440 | Ga0207691_10230875 | |||
| 1441 | Ga0207711_10016342 | |||
| 1442 | Ga0207711_10039002 | |||
| 1443 | Ga0207711_10285103 | |||
| 1444 | Ga0207711_10343347 | |||
| 1445 | Ga0207711_11564053 | |||
| 1446 | Ga0207711_11668345 | |||
| 1447 | Ga0207689_10154641 | |||
| 1448 | Ga0207689_10227389 | |||
| 1449 | Ga0207689_10311764 | |||
| 1450 | Ga0207689_10387293 | |||
| 1451 | Ga0207689_10419069 | |||
| 1452 | Ga0207661_10041437 | |||
| 1453 | Ga0207661_10153674 | |||
| 1454 | Ga0207661_11383961 | |||
| 1455 | Ga0207661_11612703 | |||
| 1456 | Ga0207679_10169180 | |||
| 1457 | Ga0207679_10231685 | |||
| 1458 | Ga0207679_10678096 | |||
| 1459 | Ga0207679_12148693 | |||
| 1460 | Ga0207667_10033770 | |||
| 1461 | Ga0207667_10114403 | |||
| 1462 | Ga0207667_10127358 | |||
| 1463 | Ga0207667_10178187 | |||
| 1464 | Ga0207667_10776657 | |||
| 1465 | Ga0207651_10034089 | |||
| 1466 | Ga0207651_10354810 | |||
| 1467 | Ga0207651_10411313 | |||
| 1468 | Ga0207712_10023969 | |||
| 1469 | Ga0207712_10106993 | |||
| 1470 | Ga0207712_10375541 | |||
| 1471 | Ga0207712_11575303 | |||
| 1472 | Ga0207640_11413943 | |||
| 1473 | Ga0207658_10111594 | |||
| 1474 | Ga0207658_10155195 | |||
| 1475 | Ga0207677_10182388 | |||
| 1476 | Ga0207703_10033858 | |||
| 1477 | Ga0207703_10139863 | |||
| 1478 | Ga0207639_10006836 | |||
| 1479 | Ga0207639_10549652 | |||
| 1480 | Ga0207639_10732528 | |||
| 1481 | Ga0207678_10210150 | |||
| 1482 | Ga0207708_10001957 | |||
| 1483 | Ga0207702_10035794 | |||
| 1484 | Ga0207702_10215281 | |||
| 1485 | Ga0207702_10242608 | |||
| 1486 | Ga0207702_10541642 | |||
| 1487 | Ga0207702_10659870 | |||
| 1488 | Ga0207702_10867828 | |||
| 1489 | Ga0207702_11756863 | |||
| 1490 | Ga0207641_10032489 | |||
| 1491 | Ga0207641_10085799 | |||
| 1492 | Ga0207641_10127022 | |||
| 1493 | Ga0207641_11606145 | |||
| 1494 | Ga0207641_12178475 | |||
| 1495 | Ga0207648_10071237 | |||
| 1496 | Ga0207648_10649160 | |||
| 1497 | Ga0207676_10733475 | |||
| 1498 | Ga0207676_11568817 | |||
| 1499 | Ga0207674_10050092 | |||
| 1500 | Ga0207674_10130313 | |||
| 1501 | Ga0207674_10225897 | |||
| 1502 | Ga0207674_10710934 | |||
| 1503 | Ga0207675_100340784 | |||
| 1504 | Ga0207675_100512056 | |||
| 1505 | Ga0207675_101138796 | |||
| 1506 | Ga0207683_11241543 | |||
| 1507 | Ga0207683_12096858 | |||
| 1508 | Ga0207698_10142754 | |||
| 1509 | Ga0207698_10366701 | |||
| 1510 | Ga0207698_11924620 | |||
| 1511 | Ga0209981_1046288 | |||
| 1512 | Ga0209588_1017898 | |||
| 1513 | Ga0209588_1041201 | |||
| 1514 | Ga0209588_1076234 | |||
| 1515 | Ga0209966_1031370 | |||
| 1516 | Ga0209998_10045355 | |||
| 1517 | Ga0209813_10033409 | |||
| 1518 | Ga0209813_10037949 | |||
| 1519 | Ga0209813_10095295 | |||
| 1520 | Ga0209813_10102129 | |||
| 1521 | Ga0209974_10086927 | |||
| 1522 | Ga0209974_10253281 | |||
| 1523 | Ga0207428_10031661 | |||
| 1524 | Ga0265357_1022456 | |||
| 1525 | Ga0268266_10100166 | |||
| 1526 | Ga0268266_10326691 | |||
| 1527 | Ga0268266_10327778 | |||
| 1528 | Ga0268266_10568124 | |||
| 1529 | Ga0268266_10629365 | |||
| 1530 | Ga0268266_10869182 | |||
| 1531 | Ga0268266_11333847 | |||
| 1532 | Ga0268266_11408835 | |||
| 1533 | Ga0268265_10046339 | |||
| 1534 | Ga0268265_11724808 | |||
| 1535 | Ga0268264_10072965 | |||
| 1536 | Ga0268264_10501694 | |||
| 1537 | Ga0268264_11567986 | |||
| 1538 | Ga0265338_10588571 | |||
| 1539 | Ga0265770_1032367 | |||
| 1540 | Ga0265328_10034603 | |||
| 1541 | Ga0265325_10211568 | |||
| 1542 | Ga0265339_10000799 | |||
| 1543 | Ga0265327_10231069 | |||
| 1544 | Ga0265316_10011395 | |||
| 1545 | Ga0265316_10089431 | |||
| 1546 | Ga0265314_10008447 | |||
| 1547 | Ga0265342_10089185 | |||
| 1548 | Ga0265342_10715670 | |||
| 1549 | Ga0307405_10459966 | |||
| 1550 | Ga0307413_10572297 | |||
| 1551 | Ga0307410_11526666 | |||
| 1552 | Ga0307407_10276644 | |||
| 1553 | Ga0307407_10356111 | |||
| 1554 | Ga0307409_100488783 | |||
| 1555 | Ga0307416_100181685 | |||
| 1556 | Ga0307416_100200194 | |||
| 1557 | Ga0307416_101666129 | |||
| 1558 | Ga0307416_101807093 | |||
| 1559 | Ga0307411_10097589 | |||
| 1560 | Ga0307415_101003029 | |||
| 1561 | Ga0373926_0002737 | |||
| 1562 | Ga0373926_0301540 | |||
| 1563 | Ga0373926_0397682 | |||
| 1564 | Ga0373934_0311117 | |||
| 1565 | Ga0373944_0333434 | |||
| 1566 | Ga0373944_0436083 | |||
| 1567 | Ga0373949_0228359 | |||
| 1568 | Ga0373923_0001065 | |||
| 1569 | Ga0373923_0425827 | |||
| 1570 | Ga0373923_0672590 | |||
| 1571 | Ga0373945_0002156 | |||
| 1572 | Ga0373946_0047283 | |||
| 1573 | Ga0373962_0093140 | |||
| 1574 | Ga0373924_0010056 | |||
| 1575 | Ga0373931_0349151 | |||
| 1576 | Ga0373935_0004904 | |||
| 1577 | Ga0373935_0023860 | |||
| 1578 | Ga0373935_1241977 | |||
| 1579 | Ga0373927_0032397 | |||
| 1580 | Ga0373927_0117760 | |||
| 1581 | Ga0373927_0289720 | |||
| 1582 | Ga0373933_0322016 | |||
| 1583 | Ga0373947_0301092 | |||
| 1584 | Ga0373947_0423867 | |||
| 1585 | Ga0373937_0138920 | |||
| 1586 | Ga0373937_2036543 | |||
| 1587 | Ga0373925_0020170 | |||
| 1588 | Ga0373925_0025584 | |||
| 1589 | Ga0373925_0062558 | |||
| 1590 | Ga0373925_0156347 | |||
| 1591 | Ga0373925_0253289 | |||
| 1592 | Ga0373925_0784092 | |||
| 1593 | Ga0395900_1422033 | |||
| 1594 | Ga0395900_1604579 | |||
| 1595 | Ga0436364_0011168 | |||
| 1596 | Ga0436364_0292186 | |||
| 1597 | Ga0395901_0834350 | |||
| 1598 | Ga0436365_0192005 | |||
| 1599 | Ga0436365_0364484 | |||
| 1600 | Ga0436365_1482532 | |||
| 1601 | Ga0436363_0679652 | |||
| 1602 | Ga0439461_0041567 | |||
| 1603 | Ga0451793_1061829 | |||
| 1604 | Ga0451802_0514694 | |||
| 1605 | Ga0451804_0836850 | |||
| 1606 | Ga0451807_2677791 | |||
| 1607 | Ga0451835_1066438 | |||
| 1608 | Ga0451837_1816888 | |||
| 1609 | Ga0451849_1285460 | |||
| 1610 | Ga0451853_3825130 | |||
| 1611 | Ga0439431_0007685 | |||
| 1612 | Ga0439433_0149630 | |||
| 1613 | Ga0439445_0022379 | |||
| 1614 | Ga0439448_0123817 | |||
| 1615 | Ga0439448_0349072 | |||
| 1616 | Ga0439456_087054 | |||
| 1617 | Ga0439462_0245493 | |||
| 1618 | Ga0450920_057499 | |||
| 1619 | Ga0450923_024079 | |||
| 1620 | Ga0450896_056325 | |||
| 1621 | Ga0450900_008954 | |||
| 1622 | Ga0439446_0070651 | |||
| 1623 | Ga0439446_0104045 | |||
| 1624 | Ga0439434_0012676 | |||
| 1625 | Ga0439435_0031108 | |||
| 1626 | Ga0439444_0024636 | |||
| 1627 | Ga0451577_0866738 | |||
| 1628 | Ga0466965_0882289 | |||
| 1629 | Ga0466963_0105926 | |||
| 1630 | Ga0466963_0186443 | |||
| 1631 | Ga0466963_0750730 | |||
| 1632 | Ga0466957_0110326 | |||
| 1633 | Ga0466957_1274244 | |||
| 1634 | Ga0466960_0065225 | |||
| 1635 | Ga0466959_0520080 | |||
| 1636 | Ga0466959_0639086 | |||
| 1637 | Ga0466958_0773779 | |||
| 1638 | Ga0466967_0141142 | |||
| 1639 | Ga0466967_1093976 | |||
| 1640 | Ga0466967_2024265 | |||
| 1641 | Ga0495629_0720638 | |||
| 1642 | Ga0495629_0937494 | |||
| 1643 | Ga0495651_0110445 | |||
| 1644 | Ga0495651_0320777 | |||
| 1645 | Ga0495651_0985880 | |||
| 1646 | Ga0495651_0993223 | |||
| 1647 | Ga0495653_0048953 | |||
| 1648 | Ga0495580_0003125 | |||
| 1649 | Ga0495580_0240460 | |||
| 1650 | Ga0495580_0429509 | |||
| 1651 | Ga0495582_0205508 | |||
| 1652 | Ga0495582_0433268 | |||
| 1653 | Ga0495664_0585213 | |||
| 1654 | Ga0495664_0637571 | |||
| 1655 | Ga0495664_0671983 | |||
| 1656 | Ga0495594_0655778 | |||
| 1657 | Ga0495608_0170641 | |||
| 1658 | Ga0495608_0333378 | |||
| 1659 | Ga0495628_0119499 | |||
| 1660 | Ga0495628_0120031 | |||
| 1661 | Ga0495628_1246106 | |||
| 1662 | Ga0495630_0053540 | |||
| 1663 | Ga0495630_0715809 | |||
| 1664 | Ga0495663_0381737 | |||
| 1665 | Ga0495666_0429481 | |||
| 1666 | Ga0495652_0254604 | |||
| 1667 | Ga0495652_0489495 | |||
| 1668 | Ga0495652_1117613 | |||
| 1669 | Ga0495665_0053680 | |||
| 1670 | Ga0495665_0097091 | |||
| 1671 | Ga0495665_0439319 | |||
| 1672 | Ga0495640_0557207 | |||
| 1673 | Ga0495586_0359421 | |||
| 1674 | Ga0495587_0751339 | |||
| 1675 | Ga0495598_0078711 | |||
| 1676 | Ga0495645_0103518 | |||
| 1677 | Ga0495633_0061096 | |||
| 1678 | Ga0495633_0144281 | |||
| 1679 | Ga0495667_0270357 | |||
| 1680 | Ga0495656_0056014 | |||
| 1681 | Ga0495634_0196839 | |||
| 1682 | Ga0495634_0729663 | |||
| 1683 | Ga0495635_0043167 | |||
| 1684 | Ga0495635_0343788 | |||
| 1685 | Ga0495635_0432457 | |||
| 1686 | Ga0495635_0666689 | |||
| 1687 | Ga0495659_0054117 | |||
| 1688 | Ga0495599_0279552 | |||
| 1689 | Ga0495599_0744750 | |||
| 1690 | Ga0495623_0211380 | |||
| 1691 | Ga0495646_0375500 | |||
| 1692 | Ga0495658_0440113 | |||
| 1693 | Ga0495658_0663334 | |||
| 1694 | Ga0495658_1085113 | |||
| 1695 | Ga0495669_0362444 | |||
| 1696 | Ga0495613_0258345 | |||
| 1697 | Ga0495613_0757645 | |||
| 1698 | Ga0495613_1078397 | |||
| 1699 | Ga0495670_0086104 | |||
| 1700 | Ga0495670_0843901 | |||
| 1701 | Ga0495600_0142326 | |||
| 1702 | Ga0495581_0455349 | |||
| 1703 | Ga0495581_0796553 | |||
| 1704 | Ga0495604_0338937 | |||
| 1705 | Ga0495604_0485600 | |||
| 1706 | Ga0495674_0023516 | |||
| 1707 | Ga0495674_0084565 | |||
| 1708 | Ga0495674_0440699 | |||
| 1709 | Ga0495674_0496643 | |||
| 1710 | Ga0495674_0653218 | |||
| 1711 | Ga0495674_0802501 | |||
| 1712 | Ga0495675_0075670 | |||
| 1713 | Ga0495677_0263280 | |||
| 1714 | Ga0495684_0007683 | |||
| 1715 | Ga0495684_0045666 | |||
| 1716 | Ga0495684_0509761 | |||
| 1717 | Ga0495684_0692522 | |||
| 1718 | Ga0495593_0268331 | |||
| 1719 | Ga0495602_0386243 | |||
| 1720 | Ga0495602_0877674 | |||
| 1721 | Ga0496102_1133857 | |||
| 1722 | Ga0496103_0188587 | |||
| 1723 | Ga0496104_0241180 | |||
| 1724 | Ga0496105_0147557 | |||
| 1725 | Ga0496105_0660791 | |||
| 1726 | Ga0496105_0986288 | |||
| 1727 | Ga0496107_0311918 | |||
| 1728 | Ga0496107_1317243 | |||
| 1729 | Ga0496109_0000029 | |||
| 1730 | Ga0496110_1245055 | |||
| 1731 | Ga0496112_0090209 | |||
| 1732 | Ga0496112_0097964 | |||
| 1733 | Ga0496112_0404975 | |||
| 1734 | Ga0496112_0563499 | |||
| 1735 | Ga0496112_1469779 | |||
| 1736 | Ga0496113_0016830 | |||
| 1737 | Ga0496113_0264096 | |||
| 1738 | Ga0496113_0456590 | |||
| 1739 | Ga0496113_0550061 | |||
| 1740 | Ga0496115_0467382 | |||
| 1741 | Ga0501033_0355527 | |||
| 1742 | Ga0501033_0420425 | |||
| 1743 | Ga0501034_0004512 | |||
| 1744 | Ga0501034_0036561 | |||
| 1745 | Ga0501034_1718114 | |||
| 1746 | Ga0501036_0642151 | |||
| 1747 | Ga0501040_0095848 | |||
| 1748 | Ga0501040_0660511 | |||
| 1749 | Ga0501040_1373641 | |||
| 1750 | Ga0501042_0734248 | |||
| 1751 | Ga0501043_0106051 | |||
| 1752 | Ga0501046_0316429 | |||
| 1753 | Ga0501047_0014774 | |||
| 1754 | Ga0501047_0736987 | |||
| 1755 | Ga0501048_0016155 | |||
| 1756 | Ga0501048_0201139 | |||
| 1757 | Ga0501067_0038877 | |||
| 1758 | Ga0501069_0103568 | |||
| 1759 | Ga0501070_0049375 | |||
| 1760 | Ga0501071_0100267 | |||
| 1761 | Ga0501072_0222755 | |||
| 1762 | Ga0501073_0399136 | |||
| 1763 | Ga0501075_0202697 | |||
| 1764 | Ga0501075_0209707 | |||
| 1765 | Ga0501075_0562242 | |||
| 1766 | Ga0501076_0015648 | |||
| 1767 | Ga0501076_1259577 | |||
| 1768 | Ga0501077_0758601 | |||
| 1769 | Ga0501206_075728 | |||
| 1770 | Ga0501079_0155646 | |||
| 1771 | Ga0501079_0621628 | |||
| 1772 | Ga0501079_1112216 | |||
| 1773 | Ga0501080_0136269 | |||
| 1774 | Ga0501080_0406250 | |||
| 1775 | Ga0501083_0000176 | |||
| 1776 | Ga0501083_0213229 | |||
| 1777 | Ga0501083_0626515 | |||
| 1778 | Ga0501265_041854 | |||
| 1779 | Ga0501035_0004937 | |||
| 1780 | Ga0501035_0212618 | |||
| 1781 | Ga0501035_0862624 | |||
| 1782 | Ga0501044_0108956 | |||
| 1783 | Ga0501045_0268990 | |||
| 1784 | Ga0501045_0307145 | |||
| 1785 | Ga0501045_0598872 | |||
| 1786 | Ga0501045_0860739 | |||
| 1787 | Ga0501045_0973538 | |||
| 1788 | nmdc:mga03n38_141217_c1 | |||
| 1789 | nmdc:mga03n38_155322_c1 | |||
| 1790 | nmdc:mga00v17_232084_c1 | |||
| 1791 | nmdc:mga00v17_35173_c1 | |||
| 1792 | nmdc:mga00v17_427696_c1 | |||
| 1793 | nmdc:mga00v17_6367_c1 | |||
| 1794 | nmdc:mga00v17_64876_c1 | |||
| 1795 | nmdc:mga00v17_8235_c1 | |||
| 1796 | nmdc:mga0yw44_31582_c1 | |||
| 1797 | nmdc:mga0k408_102986_c1 | |||
| 1798 | nmdc:mga0k408_18772_c1 | |||
| 1799 | nmdc:mga0k408_222154_c1 | |||
| 1800 | nmdc:mga0k408_383063_c1 | |||
| 1801 | nmdc:mga0k408_6295_c1 | |||
| 1802 | nmdc:mga06z11_210415_c1 | |||
| 1803 | nmdc:mga06z11_316930_c1 | |||
| 1804 | nmdc:mga06z11_865696_c1 | |||
| 1805 | nmdc:mga06z11_97277_c1 | |||
| 1806 | nmdc:mga06z11_982072_c1 | |||
| 1807 | nmdc:mga04h51_110242_c1 | |||
| 1808 | nmdc:mga04h51_45387_c1 | |||
| 1809 | nmdc:mga04h51_75998_c1 | |||
| 1810 | nmdc:mga04h51_80027_c1 | |||
| 1811 | nmdc:mga07m45_21273_c1 | |||
| 1812 | nmdc:mga07m45_6433_c1 | |||
| 1813 | nmdc:mga07m45_7105_c1 | |||
| 1814 | nmdc:mga07m45_88934_c1 | |||
| 1815 | nmdc:mga07m45_9204_c1 | |||
| 1816 | nmdc:mga05p37_1127174_c1 | |||
| 1817 | nmdc:mga05p37_1768244_c1 | |||
| 1818 | nmdc:mga05p37_17826_c1 | |||
| 1819 | nmdc:mga05p37_345269_c1 | |||
| 1820 | nmdc:mga05p37_54761_c1 | |||
| 1821 | nmdc:mga05p37_566040_c1 | |||
| 1822 | nmdc:mga05p37_7651_c1 | |||
| 1823 | nmdc:mga09592_1031405_c1 | |||
| 1824 | nmdc:mga0qj67_1178963_c1 | |||
| 1825 | nmdc:mga0qj67_762971_c1 | |||
| 1826 | nmdc:mga06r32_107528_c1 | |||
| 1827 | nmdc:mga06r32_1139642_c1 | |||
| 1828 | nmdc:mga06r32_1173492_c1 | |||
| 1829 | nmdc:mga06r32_131676_c1 | |||
| 1830 | nmdc:mga06r32_194049_c1 | |||
| 1831 | nmdc:mga06r32_35620_c1 | |||
| 1832 | nmdc:mga06r32_387623_c1 | |||
| 1833 | nmdc:mga06r32_670392_c1 | |||
| 1834 | nmdc:mga06r32_778132_c1 | |||
| 1835 | nmdc:mga08y16_1505406_c1 | |||
| 1836 | nmdc:mga08y16_1929942_c1 | |||
| 1837 | nmdc:mga08y16_435461_c1 | |||
| 1838 | nmdc:mga08y16_6052_c1 | |||
| 1839 | nmdc:mga08y16_606326_c1 | |||
| 1840 | nmdc:mga08y16_778488_c1 | |||
| 1841 | nmdc:mga0n895_1648284_c1 | |||
| 1842 | nmdc:mga0n895_30208_c1 | |||
| 1843 | nmdc:mga0n895_384620_c1 | |||
| 1844 | nmdc:mga0n895_466660_c1 | |||
| 1845 | nmdc:mga0n895_734774_c1 | |||
| 1846 | nmdc:mga0rr50_1468126_c1 | |||
| 1847 | nmdc:mga0rr50_29939_c1 | |||
| 1848 | nmdc:mga0rr50_780551_c1 | |||
| 1849 | nmdc:mga08x19_352370_c1 | |||
| 1850 | nmdc:mga08x19_354758_c1 | |||
| 1851 | nmdc:mga0a205_16161_c1 | |||
| 1852 | nmdc:mga0a205_4096_c1 | |||
| 1853 | nmdc:mga0a205_427155_c1 | |||
| 1854 | nmdc:mga0a205_611602_c1 | |||
| 1855 | nmdc:mga0a205_805851_c1 | |||
| 1856 | nmdc:mga0sz30_42221_c1 | |||
| 1857 | Ga0495655_0354498 | |||
| 1858 | Ga0495619_0664290 | |||
| 1859 | Ga0500555_020268 | |||
| 1860 | Ga0500555_073000 | |||
| 1861 | Ga0500555_084740 | |||
| 1862 | Ga0500562_083010 | |||
| 1863 | Ga0500592_090881 | |||
| 1864 | Ga0500645_000233 | |||
| 1865 | Ga0501084_0090610 | |||
| 1866 | Ga0501084_0165943 | |||
| 1867 | Ga0501084_0583307 | |||
| 1868 | Ga0590075_062371 | |||
| 1869 | Ga0501082_0010848 | |||
| 1870 | Ga0501082_0372912 | |||
| 1871 | Ga0501082_0821849 | |||
| 1872 | Ga0501082_1596181 | |||
| 1873 | Ga0466962_0281964 | |||
| 1874 | Ga0530510_0123246 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9163 | 4 | 105 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.906 | 5 | 104 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.9034 | 1 | 107 |
| 7cbv-assembly1.cif.gz_A-3 | crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32) | 0.9009 | 12 | 90 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.8976 | 5 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9012 | 10 | 108 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8976 | 5 | 104 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8826 | 12 | 92 | 1.10.10.10 |
| 5x11A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8792 | 12 | 90 | 1.10.10.10 |
| af_Q57738_133_209_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8778 | 12 | 96 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S7Z938-F1-model_v4 | PadR family transcriptional regulator | 0.9999 | 6 | 113 |
|
| AF-A0A7G8BQN0-F1-model_v4 | PadR family transcriptional regulator | 0.9925 | 15 | 113 |
|
| AF-A0A143PJ72-F1-model_v4 | Lineage-specific thermal regulator protein | 0.9885 | 4 | 113 |
|
| AF-A0A1G6WVS3-F1-model_v4 | Transcriptional regulator, PadR family | 0.9861 | 7 | 113 |
|
| AF-A0A2T4VRD1-F1-model_v4 | PadR family transcriptional regulator | 0.9861 | 7 | 109 |
|