F486240

General Info

Members Datasets Scaffolds Average Seq Length
938 369 1874 111

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100765984|Ga0070683_1007659842
Length 128
Sequence MDYAGLRGTFPALVRIIRQPMGKNDLLPGTLDMMVLKTLARGTLHGYAIAQLLRQVSEDILQVEEGSLYPALQRLELNGWIEGEWGLSSNNRRARFYRLTAEGRKQLVSETARYRQMTAAIARVMGLA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
236 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
237 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
240 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
241 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
248 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
249 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
250 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
251 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
252 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
272 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
362 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
363 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
369 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.04
Nodule 0
Rhizoplane 2.56
Rhizosphere 89.23
Stem 0
Stem Tuber 0
Unclassified 35.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100765984 3300005329 Bacteria 925
2 JGI24742J22300_10110604 3300002244 Unclassified 537
3 Ga0065704_10137469 3300005289 Bacteria 1554
4 Ga0065712_10079161 3300005290 Bacteria 3252
5 Ga0065712_10170858 3300005290 Bacteria 1245
6 Ga0065715_10253384 3300005293 Bacteria 1160
7 Ga0065715_10373111 3300005293 Unclassified 918
8 Ga0065707_10230169 3300005295 Bacteria 1192
9 Ga0065707_10814352 3300005295 Bacteria 594
10 Ga0070658_10006071 3300005327 Bacteria 9796
11 Ga0070658_10128207 3300005327 Bacteria 2113
12 Ga0070676_10074722 3300005328 Bacteria 2042
13 Ga0070676_10248976 3300005328 Unclassified 1185
14 Ga0070676_11399792 3300005328 Unclassified 536
15 Ga0070683_100141890 3300005329 Unclassified 2276
16 Ga0070683_100150806 3300005329 Bacteria 2204
17 Ga0070683_100542286 3300005329 Bacteria 1112
18 Ga0070683_100706019 3300005329 Bacteria 966
19 Ga0070683_101293211 3300005329 Unclassified 701
20 Ga0070690_101087776 3300005330 Bacteria 634
21 Ga0070690_101603190 3300005330 Unclassified 528
22 Ga0070670_100902288 3300005331 Bacteria 801
23 Ga0070670_101425779 3300005331 Unclassified 635
24 Ga0070670_101577163 3300005331 Unclassified 603
25 Ga0070677_10678410 3300005333 Unclassified 578
26 Ga0068869_100268308 3300005334 Bacteria 1369
27 Ga0070666_10589914 3300005335 Bacteria 810
28 Ga0070666_10861878 3300005335 Bacteria 669
29 Ga0070680_100131775 3300005336 Bacteria 2092
30 Ga0070680_100462965 3300005336 Bacteria 1083
31 Ga0070680_100714578 3300005336 Unclassified 862
32 Ga0070682_100920652 3300005337 Bacteria 720
33 Ga0068868_100036868 3300005338 Bacteria 3787
34 Ga0068868_100365500 3300005338 Bacteria 1239
35 Ga0068868_100468717 3300005338 Bacteria 1098
36 Ga0070660_100153085 3300005339 Bacteria 1855
37 Ga0070660_100232298 3300005339 Bacteria 1501
38 Ga0070660_100294327 3300005339 Bacteria 1330
39 Ga0070660_100971896 3300005339 Unclassified 717
40 Ga0070689_100945264 3300005340 Unclassified 764
41 Ga0070689_101000494 3300005340 Unclassified 744
42 Ga0070689_101033658 3300005340 Unclassified 732
43 Ga0070687_100519472 3300005343 Bacteria 805
44 Ga0070692_10048530 3300005345 Bacteria 2200
45 Ga0070675_100001182 3300005354 Bacteria 18959
46 Ga0070675_100112846 3300005354 Bacteria 2302
47 Ga0070675_100322712 3300005354 Unclassified 1364
48 Ga0070675_100461709 3300005354 Unclassified 1140
49 Ga0070671_101134327 3300005355 Unclassified 687
50 Ga0070674_100019948 3300005356 Bacteria 4271
51 Ga0070674_100261710 3300005356 Unclassified 1363
52 Ga0070673_100172965 3300005364 Bacteria 1844
53 Ga0070673_101417031 3300005364 Unclassified 654
54 Ga0070673_102250055 3300005364 Unclassified 518
55 Ga0070688_100064814 3300005365 Bacteria 2320
56 Ga0070688_100186602 3300005365 Bacteria 1442
57 Ga0070688_100359990 3300005365 Unclassified 1067
58 Ga0070659_100126199 3300005366 Bacteria 2076
59 Ga0070659_100204341 3300005366 Bacteria 1627
60 Ga0070659_100256139 3300005366 Bacteria 1451
61 Ga0070659_100354312 3300005366 Bacteria 1232
62 Ga0070667_100250297 3300005367 Bacteria 1584
63 Ga0070667_101184875 3300005367 Unclassified 715
64 Ga0070703_10160870 3300005406 Bacteria 852
65 Ga0070709_10003649 3300005434 Bacteria 8259
66 Ga0070709_10095968 3300005434 Bacteria 1965
67 Ga0070709_11352279 3300005434 Bacteria 575
68 Ga0070714_100036690 3300005435 Bacteria 4113
69 Ga0070714_100547838 3300005435 Unclassified 1107
70 Ga0070714_100703740 3300005435 Bacteria 975
71 Ga0070713_100027377 3300005436 Bacteria 4487
72 Ga0070713_100466633 3300005436 Unclassified 1188
73 Ga0070710_11069465 3300005437 Bacteria 591
74 Ga0070701_10657040 3300005438 Bacteria 700
75 Ga0070701_10831853 3300005438 Unclassified 632
76 Ga0070711_100043490 3300005439 Unclassified 3042
77 Ga0070711_100455456 3300005439 Unclassified 1048
78 Ga0070711_101672062 3300005439 Unclassified 557
79 Ga0070705_100082509 3300005440 Bacteria 1978
80 Ga0070705_101116449 3300005440 Bacteria 646
81 Ga0070700_100215087 3300005441 Bacteria 1358
82 Ga0070694_100002871 3300005444 Bacteria 10242
83 Ga0070694_101289308 3300005444 Bacteria 614
84 Ga0070694_101415009 3300005444 Bacteria 587
85 Ga0070708_100501641 3300005445 Unclassified 1145
86 Ga0070708_101019557 3300005445 Bacteria 776
87 Ga0070663_101653291 3300005455 Bacteria 572
88 Ga0070678_100075559 3300005456 Bacteria 2535
89 Ga0070678_101261145 3300005456 Bacteria 687
90 Ga0070662_100486679 3300005457 Bacteria 1028
91 Ga0070681_10184236 3300005458 Bacteria 2009
92 Ga0070681_10204881 3300005458 Bacteria 1890
93 Ga0070681_10920301 3300005458 Bacteria 793
94 Ga0070681_11851771 3300005458 Bacteria 531
95 Ga0070681_11965037 3300005458 Bacteria 513
96 Ga0068867_100008313 3300005459 Bacteria 7326
97 Ga0068867_100408287 3300005459 Unclassified 1147
98 Ga0068867_101029932 3300005459 Bacteria 748
99 Ga0070685_10682579 3300005466 Bacteria 747
100 Ga0070685_10968914 3300005466 Unclassified 636
101 Ga0070706_101239770 3300005467 Bacteria 685
102 Ga0070698_100339450 3300005471 Unclassified 1434
103 Ga0070699_100509756 3300005518 Bacteria 1093
104 Ga0070699_100989477 3300005518 Bacteria 771
105 Ga0070679_100275258 3300005530 Bacteria 1636
106 Ga0070679_100438235 3300005530 Unclassified 1251
107 Ga0070679_100655225 3300005530 Bacteria 993
108 Ga0070684_100062416 3300005535 Unclassified 3264
109 Ga0070684_100097665 3300005535 Bacteria 2620
110 Ga0070684_100511859 3300005535 Bacteria 1112
111 Ga0070684_101488849 3300005535 Unclassified 638
112 Ga0070697_100311526 3300005536 Bacteria 1354
113 Ga0068853_100009148 3300005539 Bacteria 7978
114 Ga0068853_101359404 3300005539 Bacteria 687
115 Ga0068853_101406467 3300005539 Unclassified 675
116 Ga0068853_101965692 3300005539 Unclassified 567
117 Ga0070672_100966254 3300005543 Bacteria 754
118 Ga0070672_101738113 3300005543 Unclassified 560
119 Ga0070686_100024502 3300005544 Bacteria 3617
120 Ga0070686_100276160 3300005544 Unclassified 1237
121 Ga0070686_100656896 3300005544 Bacteria 832
122 Ga0070695_100049739 3300005545 Bacteria 2684
123 Ga0070695_100066572 3300005545 Bacteria 2348
124 Ga0070695_100082852 3300005545 Bacteria 2124
125 Ga0070696_100023850 3300005546 Bacteria 4157
126 Ga0070696_100059296 3300005546 Bacteria 2675
127 Ga0070693_100084885 3300005547 Bacteria 1896
128 Ga0070693_100586721 3300005547 Bacteria 803
129 Ga0070665_100164274 3300005548 Unclassified 2223
130 Ga0070665_100244495 3300005548 Bacteria 1795
131 Ga0070665_100310607 3300005548 Bacteria 1580
132 Ga0070665_100593731 3300005548 Bacteria 1120
133 Ga0070665_100996628 3300005548 Bacteria 850
134 Ga0070665_101026351 3300005548 Bacteria 837
135 Ga0070665_101062462 3300005548 Bacteria 821
136 Ga0070665_101099342 3300005548 Unclassified 806
137 Ga0070704_100215994 3300005549 Unclassified 1556
138 Ga0068855_100015939 3300005563 Bacteria 9040
139 Ga0068855_100032412 3300005563 Bacteria 6239
140 Ga0068855_100048115 3300005563 Bacteria 5035
141 Ga0068855_100123856 3300005563 Bacteria 2957
142 Ga0068855_100148006 3300005563 Bacteria 2672
143 Ga0068855_100269877 3300005563 Bacteria 1892
144 Ga0068855_101134188 3300005563 Bacteria 816
145 Ga0070664_100120450 3300005564 Bacteria 2297
146 Ga0070664_100273864 3300005564 Bacteria 1521
147 Ga0070664_102362656 3300005564 Unclassified 504
148 Ga0068857_100063837 3300005577 Bacteria 3274
149 Ga0068857_100191331 3300005577 Bacteria 1863
150 Ga0068857_101401149 3300005577 Unclassified 680
151 Ga0068857_102281812 3300005577 Unclassified 531
152 Ga0068854_100117449 3300005578 Bacteria 2014
153 Ga0068856_100042886 3300005614 Bacteria 4452
154 Ga0068856_100049790 3300005614 Unclassified 4130
155 Ga0068856_100207354 3300005614 Unclassified 1974
156 Ga0068856_100236027 3300005614 Bacteria 1844
157 Ga0068856_100310648 3300005614 Bacteria 1594
158 Ga0068856_101204013 3300005614 Unclassified 774
159 Ga0068856_101311596 3300005614 Unclassified 739
160 Ga0068852_100119943 3300005616 Bacteria 2406
161 Ga0068852_100290882 3300005616 Unclassified 1578
162 Ga0068852_100404385 3300005616 Bacteria 1344
163 Ga0068859_100556060 3300005617 Bacteria 1242
164 Ga0068859_101082834 3300005617 Unclassified 881
165 Ga0068859_101137696 3300005617 Unclassified 859
166 Ga0068859_102196788 3300005617 Unclassified 609
167 Ga0068864_100771817 3300005618 Bacteria 943
168 Ga0068861_100314467 3300005719 Bacteria 1362
169 Ga0068861_101296422 3300005719 Bacteria 708
170 Ga0068870_11140194 3300005840 Unclassified 562
171 Ga0068863_100088679 3300005841 Unclassified 2932
172 Ga0068863_100169501 3300005841 Bacteria 2094
173 Ga0068863_100304905 3300005841 Unclassified 1545
174 Ga0068863_100630928 3300005841 Unclassified 1062
175 Ga0068863_100687779 3300005841 Bacteria 1016
176 Ga0068863_101248653 3300005841 Bacteria 749
177 Ga0068863_101984258 3300005841 Unclassified 592
178 Ga0068858_100046850 3300005842 Bacteria 4008
179 Ga0068858_100048278 3300005842 Bacteria 3945
180 Ga0068858_100119375 3300005842 Bacteria 2465
181 Ga0068858_100868802 3300005842 Unclassified 881
182 Ga0068858_100956922 3300005842 Bacteria 838
183 Ga0068858_102247019 3300005842 Unclassified 539
184 Ga0068860_100018684 3300005843 Bacteria 6741
185 Ga0068860_100611289 3300005843 Unclassified 1096
186 Ga0068860_101914978 3300005843 Unclassified 614
187 Ga0068862_100248450 3300005844 Bacteria 1620
188 Ga0068862_100775353 3300005844 Bacteria 935
189 Ga0068862_101420249 3300005844 Bacteria 698
190 Ga0081455_10604489 3300005937 Bacteria 714
191 Ga0070717_10046373 3300006028 Bacteria 3556
192 Ga0070717_10048204 3300006028 Unclassified 3493
193 Ga0070717_10109813 3300006028 Bacteria 2351
194 Ga0075365_10007884 3300006038 Bacteria 5999
195 Ga0075368_10007157 3300006042 Bacteria 3930
196 Ga0075368_10012601 3300006042 Bacteria 3094
197 Ga0075368_10045199 3300006042 Bacteria 1739
198 Ga0075368_10219952 3300006042 Unclassified 807
199 Ga0075363_100025311 3300006048 Bacteria 3025
200 Ga0075363_100262959 3300006048 Bacteria 996
201 Ga0075364_10020939 3300006051 Bacteria 4118
202 Ga0075364_10047219 3300006051 Bacteria 2804
203 Ga0075364_10058219 3300006051 Bacteria 2532
204 Ga0075364_10157200 3300006051 Bacteria 1533
205 Ga0075364_10263130 3300006051 Bacteria 1172
206 Ga0070716_100007878 3300006173 Bacteria 5271
207 Ga0070716_100261681 3300006173 Unclassified 1184
208 Ga0070716_100729477 3300006173 Unclassified 760
209 Ga0070712_100911623 3300006175 Bacteria 758
210 Ga0070712_101120490 3300006175 Bacteria 683
211 Ga0070712_101713518 3300006175 Unclassified 550
212 Ga0070712_101904149 3300006175 Unclassified 521
213 Ga0075367_10011769 3300006178 Bacteria 4643
214 Ga0075367_10022483 3300006178 Unclassified 3537
215 Ga0075367_10025530 3300006178 Bacteria 3342
216 Ga0075367_10091155 3300006178 Bacteria 1854
217 Ga0075367_10282376 3300006178 Unclassified 1044
218 Ga0075367_10872812 3300006178 Bacteria 573
219 Ga0075369_10080203 3300006186 Bacteria 1446
220 Ga0075366_10018970 3300006195 Bacteria 3975
221 Ga0075366_10026345 3300006195 Bacteria 3405
222 Ga0075366_10027116 3300006195 Bacteria 3360
223 Ga0075366_10090703 3300006195 Bacteria 1830
224 Ga0097621_100330739 3300006237 Unclassified 1351
225 Ga0097621_100449857 3300006237 Bacteria 1160
226 Ga0097621_100527177 3300006237 Bacteria 1073
227 Ga0097621_102076350 3300006237 Unclassified 543
228 Ga0097621_102244017 3300006237 Unclassified 522
229 Ga0075370_10058966 3300006353 Bacteria 2184
230 Ga0075370_10071981 3300006353 Bacteria 1978
231 Ga0075370_10116756 3300006353 Bacteria 1551
232 Ga0068871_100206876 3300006358 Unclassified 1696
233 Ga0068871_101768333 3300006358 Unclassified 587
234 Ga0068871_102019376 3300006358 Unclassified 549
235 Ga0068871_102032934 3300006358 Bacteria 547
236 Ga0075428_101091131 3300006844 Bacteria 843
237 Ga0075428_101196347 3300006844 Unclassified 801
238 Ga0075430_100069517 3300006846 Unclassified 2954
239 Ga0075430_101732658 3300006846 Bacteria 513
240 Ga0075431_100043722 3300006847 Bacteria 4621
241 Ga0075431_100190571 3300006847 Bacteria 2101
242 Ga0075431_100762253 3300006847 Unclassified 943
243 Ga0075431_100860162 3300006847 Bacteria 878
244 Ga0075431_100954192 3300006847 Bacteria 826
245 Ga0075433_10004200 3300006852 Bacteria 11176
246 Ga0075433_10006492 3300006852 Bacteria 9248
247 Ga0075433_10106482 3300006852 Bacteria 2485
248 Ga0075433_10554068 3300006852 Unclassified 1010
249 Ga0075433_10679591 3300006852 Bacteria 902
250 Ga0075433_11258444 3300006852 Unclassified 641
251 Ga0075433_11284583 3300006852 Bacteria 634
252 Ga0075434_100449273 3300006871 Bacteria 1310
253 Ga0075434_100687433 3300006871 Bacteria 1041
254 Ga0075434_101552791 3300006871 Unclassified 671
255 Ga0075434_101571334 3300006871 Unclassified 666
256 Ga0075434_102439510 3300006871 Bacteria 525
257 Ga0075429_101217512 3300006880 Unclassified 657
258 Ga0068865_100364689 3300006881 Unclassified 1174
259 Ga0068865_100756299 3300006881 Unclassified 835
260 Ga0068865_101428745 3300006881 Unclassified 618
261 Ga0075436_100478416 3300006914 Unclassified 909
262 Ga0097620_100556096 3300006931 Bacteria 1242
263 Ga0097620_101082824 3300006931 Unclassified 881
264 Ga0097620_101137420 3300006931 Unclassified 859
265 Ga0097620_102196348 3300006931 Unclassified 609
266 Ga0099794_10004862 3300007265 Bacteria 5335
267 Ga0099794_10010820 3300007265 Bacteria 3886
268 Ga0099794_10121061 3300007265 Bacteria 1316
269 Ga0099795_10268904 3300007788 Unclassified 740
270 Ga0105240_10001491 3300009093 Bacteria 39868
271 Ga0105240_10028587 3300009093 Bacteria 7279
272 Ga0105240_10031609 3300009093 Bacteria 6861
273 Ga0105240_10086749 3300009093 Unclassified 3833
274 Ga0105240_10130393 3300009093 Bacteria 3016
275 Ga0105240_10196874 3300009093 Bacteria 2365
276 Ga0105240_10351266 3300009093 Bacteria 1673
277 Ga0105240_10635130 3300009093 Bacteria 1172
278 Ga0105240_10643959 3300009093 Bacteria 1162
279 Ga0105240_10960098 3300009093 Unclassified 916
280 Ga0105240_11389961 3300009093 Unclassified 738
281 Ga0111539_10383356 3300009094 Bacteria 1637
282 Ga0111539_10752500 3300009094 Bacteria 1134
283 Ga0111539_12932688 3300009094 Unclassified 552
284 Ga0105245_10859488 3300009098 Unclassified 947
285 Ga0105247_11832891 3300009101 Bacteria 506
286 Ga0114129_10023624 3300009147 Bacteria 8713
287 Ga0114129_10148291 3300009147 Bacteria 3212
288 Ga0114129_10265584 3300009147 Bacteria 2298
289 Ga0114129_10432691 3300009147 Bacteria 1728
290 Ga0114129_11221163 3300009147 Unclassified 935
291 Ga0114129_11889903 3300009147 Bacteria 724
292 Ga0114129_11923721 3300009147 Unclassified 717
293 Ga0114129_12032608 3300009147 Bacteria 694
294 Ga0105243_10041747 3300009148 Bacteria 3587
295 Ga0105243_10200441 3300009148 Bacteria 1750
296 Ga0105243_11040468 3300009148 Bacteria 824
297 Ga0105241_10086593 3300009174 Bacteria 2464
298 Ga0105241_10378538 3300009174 Bacteria 1236
299 Ga0105241_10678706 3300009174 Bacteria 938
300 Ga0105241_10868584 3300009174 Unclassified 835
301 Ga0105241_11123360 3300009174 Unclassified 741
302 Ga0105241_11217342 3300009174 Unclassified 714
303 Ga0105241_11998308 3300009174 Bacteria 571
304 Ga0105241_12378254 3300009174 Unclassified 528
305 Ga0105242_10151833 3300009176 Bacteria 2020
306 Ga0105242_10272668 3300009176 Unclassified 1533
307 Ga0105242_10694028 3300009176 Unclassified 995
308 Ga0105242_12556962 3300009176 Unclassified 559
309 Ga0105248_10057326 3300009177 Bacteria 4372
310 Ga0105248_10161532 3300009177 Bacteria 2527
311 Ga0105248_10172041 3300009177 Unclassified 2441
312 Ga0105248_10394276 3300009177 Unclassified 1559
313 Ga0105248_10482383 3300009177 Bacteria 1397
314 Ga0105248_11145532 3300009177 Bacteria 879
315 Ga0105248_11934380 3300009177 Unclassified 669
316 Ga0105248_12207181 3300009177 Bacteria 626
317 Ga0105248_12404936 3300009177 Unclassified 600
318 Ga0105237_10002663 3300009545 Bacteria 21945
319 Ga0105237_10025303 3300009545 Bacteria 6072
320 Ga0105237_10086081 3300009545 Bacteria 3133
321 Ga0105237_10152528 3300009545 Bacteria 2307
322 Ga0105237_10385504 3300009545 Bacteria 1406
323 Ga0105237_10837469 3300009545 Bacteria 927
324 Ga0105237_11068756 3300009545 Unclassified 814
325 Ga0105238_10028614 3300009551 Bacteria 5677
326 Ga0105238_10183231 3300009551 Bacteria 2071
327 Ga0105238_12347110 3300009551 Bacteria 569
328 Ga0105249_10015211 3300009553 Bacteria 6809
329 Ga0105249_10031511 3300009553 Bacteria 4796
330 Ga0105249_10403156 3300009553 Bacteria 1398
331 Ga0105249_10543748 3300009553 Bacteria 1211
332 Ga0105249_11059046 3300009553 Unclassified 881
333 Ga0105249_11133229 3300009553 Bacteria 853
334 Ga0105249_12083124 3300009553 Bacteria 640
335 Ga0105249_12083600 3300009553 Unclassified 640
336 Ga0105249_13002889 3300009553 Unclassified 542
337 Ga0105239_10038320 3300010375 Bacteria 5253
338 Ga0105239_10060236 3300010375 Bacteria 4166
339 Ga0105239_10100774 3300010375 Bacteria 3195
340 Ga0105239_10242073 3300010375 Bacteria 2025
341 Ga0105239_10311559 3300010375 Bacteria 1774
342 Ga0105239_11204129 3300010375 Unclassified 873
343 Ga0105239_11911963 3300010375 Unclassified 688
344 Ga0105246_12004141 3300011119 Unclassified 559
345 Ga0157373_10318809 3300013100 Unclassified 1105
346 Ga0157373_10358231 3300013100 Unclassified 1041
347 Ga0157371_10684664 3300013102 Bacteria 767
348 Ga0157370_10000275 3300013104 Bacteria 65248
349 Ga0157370_10002439 3300013104 Bacteria 22420
350 Ga0157370_10251740 3300013104 Bacteria 1634
351 Ga0157370_10258939 3300013104 Bacteria 1608
352 Ga0157370_10276112 3300013104 Bacteria 1553
353 Ga0157370_10626429 3300013104 Bacteria 984
354 Ga0157370_11145583 3300013104 Bacteria 702
355 Ga0157370_11211991 3300013104 Bacteria 681
356 Ga0157370_11421269 3300013104 Bacteria 624
357 Ga0157369_10001633 3300013105 Bacteria 27410
358 Ga0157369_10003218 3300013105 Bacteria 19470
359 Ga0157369_10012038 3300013105 Bacteria 9823
360 Ga0157369_10022247 3300013105 Bacteria 7080
361 Ga0157369_10076948 3300013105 Bacteria 3577
362 Ga0157369_10086718 3300013105 Unclassified 3343
363 Ga0157369_10252545 3300013105 Bacteria 1840
364 Ga0157369_10634944 3300013105 Bacteria 1102
365 Ga0157369_10657273 3300013105 Unclassified 1081
366 Ga0157369_11631684 3300013105 Unclassified 655
367 Ga0157369_12115429 3300013105 Bacteria 571
368 Ga0157369_12390084 3300013105 Unclassified 535
369 Ga0157374_10003406 3300013296 Bacteria 13354
370 Ga0157374_10006174 3300013296 Bacteria 10156
371 Ga0157374_10036331 3300013296 Bacteria 4511
372 Ga0157374_10042130 3300013296 Unclassified 4211
373 Ga0157374_10047465 3300013296 Bacteria 3982
374 Ga0157374_10068546 3300013296 Unclassified 3338
375 Ga0157374_11777018 3300013296 Bacteria 642
376 Ga0157378_10000441 3300013297 Bacteria 40161
377 Ga0157378_11381503 3300013297 Bacteria 747
378 Ga0157378_12224909 3300013297 Bacteria 599
379 Ga0163162_10200718 3300013306 Bacteria 2123
380 Ga0163162_10377660 3300013306 Bacteria 1550
381 Ga0163162_10523313 3300013306 Bacteria 1315
382 Ga0163162_10576080 3300013306 Bacteria 1253
383 Ga0157372_10012625 3300013307 Bacteria 8998
384 Ga0157372_10113671 3300013307 Unclassified 3103
385 Ga0157372_10123880 3300013307 Bacteria 2971
386 Ga0157372_10170373 3300013307 Unclassified 2519
387 Ga0157372_10230718 3300013307 Bacteria 2146
388 Ga0157372_10260639 3300013307 Bacteria 2013
389 Ga0157372_10978946 3300013307 Unclassified 980
390 Ga0157372_11548850 3300013307 Bacteria 763
391 Ga0157375_10564854 3300013308 Bacteria 1299
392 Ga0157375_10576745 3300013308 Unclassified 1285
393 Ga0157375_10582337 3300013308 Bacteria 1279
394 Ga0157375_13547770 3300013308 Bacteria 519
395 Ga0157375_13683165 3300013308 Bacteria 510
396 Ga0163163_10022794 3300014325 Bacteria 5934
397 Ga0163163_10042021 3300014325 Bacteria 4474
398 Ga0163163_10045759 3300014325 Unclassified 4297
399 Ga0163163_10098278 3300014325 Bacteria 2948
400 Ga0163163_10434452 3300014325 Bacteria 1372
401 Ga0163163_10617091 3300014325 Bacteria 1148
402 Ga0163163_10629493 3300014325 Unclassified 1136
403 Ga0163163_10839690 3300014325 Unclassified 982
404 Ga0163163_11045850 3300014325 Unclassified 880
405 Ga0163163_11982608 3300014325 Unclassified 642
406 Ga0163163_13242908 3300014325 Unclassified 507
407 Ga0157380_10024916 3300014326 Bacteria 4532
408 Ga0157380_10295037 3300014326 Bacteria 1490
409 Ga0157380_10355428 3300014326 Bacteria 1373
410 Ga0157380_10446951 3300014326 Bacteria 1240
411 Ga0157380_12935567 3300014326 Bacteria 543
412 Ga0157377_10011072 3300014745 Bacteria 4489
413 Ga0157377_10735393 3300014745 Bacteria 720
414 Ga0157377_11408642 3300014745 Bacteria 550
415 Ga0157379_10015279 3300014968 Bacteria 6733
416 Ga0157379_10156879 3300014968 Bacteria 2054
417 Ga0157379_10553068 3300014968 Unclassified 1071
418 Ga0157379_11319336 3300014968 Bacteria 697
419 Ga0157379_11796600 3300014968 Unclassified 602
420 Ga0157376_10095784 3300014969 Bacteria 2582
421 Ga0157376_10990681 3300014969 Bacteria 863
422 Ga0157376_11702406 3300014969 Unclassified 666
423 Ga0157376_12035472 3300014969 Unclassified 612
424 Ga0157376_12138968 3300014969 Bacteria 598
425 Ga0157376_12337243 3300014969 Unclassified 574
426 Ga0157376_12520006 3300014969 Bacteria 554
427 Ga0163161_10433030 3300017792 Unclassified 1060
428 Ga0206356_11518449 3300020070 Bacteria 1144
429 Ga0213876_10381130 3300021384 Unclassified 750
430 Ga0207697_10038236 3300025315 Bacteria 1967
431 Ga0207682_10122016 3300025893 Unclassified 1156
432 Ga0207692_10501848 3300025898 Unclassified 770
433 Ga0207688_10031557 3300025901 Bacteria 2925
434 Ga0207688_10581958 3300025901 Unclassified 705
435 Ga0207680_10161339 3300025903 Unclassified 1503
436 Ga0207680_10750438 3300025903 Bacteria 700
437 Ga0207680_10857832 3300025903 Unclassified 651
438 Ga0207699_10193527 3300025906 Bacteria 1374
439 Ga0207699_10288593 3300025906 Bacteria 1142
440 Ga0207699_10775510 3300025906 Unclassified 704
441 Ga0207645_10040860 3300025907 Bacteria 2970
442 Ga0207645_10775760 3300025907 Unclassified 652
443 Ga0207705_10019177 3300025909 Bacteria 4892
444 Ga0207705_10347819 3300025909 Bacteria 1142
445 Ga0207707_10113771 3300025912 Unclassified 2365
446 Ga0207707_10140044 3300025912 Bacteria 2115
447 Ga0207707_10415062 3300025912 Bacteria 1155
448 Ga0207707_11369761 3300025912 Bacteria 566
449 Ga0207695_10002639 3300025913 Bacteria 26224
450 Ga0207695_10093049 3300025913 Bacteria 3024
451 Ga0207695_10854057 3300025913 Bacteria 790
452 Ga0207671_10009929 3300025914 Bacteria 7911
453 Ga0207671_10040729 3300025914 Bacteria 3438
454 Ga0207671_10350351 3300025914 Unclassified 1171
455 Ga0207671_10518901 3300025914 Bacteria 950
456 Ga0207693_10028857 3300025915 Bacteria 4385
457 Ga0207693_10700829 3300025915 Unclassified 784
458 Ga0207693_10774480 3300025915 Unclassified 740
459 Ga0207693_10812089 3300025915 Bacteria 720
460 Ga0207693_11150847 3300025915 Bacteria 587
461 Ga0207663_10714966 3300025916 Unclassified 794
462 Ga0207663_10844554 3300025916 Unclassified 731
463 Ga0207663_11307580 3300025916 Unclassified 584
464 Ga0207660_10428855 3300025917 Bacteria 1067
465 Ga0207662_10008440 3300025918 Bacteria 5639
466 Ga0207657_10069879 3300025919 Bacteria 2977
467 Ga0207657_10369127 3300025919 Bacteria 1131
468 Ga0207652_10634672 3300025921 Bacteria 956
469 Ga0207652_10717213 3300025921 Unclassified 892
470 Ga0207652_11038051 3300025921 Unclassified 719
471 Ga0207646_11137716 3300025922 Bacteria 686
472 Ga0207681_11484514 3300025923 Unclassified 568
473 Ga0207694_10093608 3300025924 Bacteria 2374
474 Ga0207694_11534699 3300025924 Bacteria 562
475 Ga0207650_10111147 3300025925 Bacteria 2122
476 Ga0207650_10724462 3300025925 Bacteria 841
477 Ga0207650_11319483 3300025925 Bacteria 614
478 Ga0207650_11667424 3300025925 Unclassified 541
479 Ga0207659_10005643 3300025926 Bacteria 7611
480 Ga0207659_10223900 3300025926 Unclassified 1514
481 Ga0207687_10575493 3300025927 Unclassified 947
482 Ga0207700_10101999 3300025928 Unclassified 2291
483 Ga0207700_11185143 3300025928 Unclassified 682
484 Ga0207664_10053289 3300025929 Bacteria 3201
485 Ga0207664_10483795 3300025929 Unclassified 1107
486 Ga0207690_10159894 3300025932 Unclassified 1678
487 Ga0207690_10327312 3300025932 Bacteria 1206
488 Ga0207706_10021143 3300025933 Bacteria 5846
489 Ga0207686_10440990 3300025934 Unclassified 1000
490 Ga0207709_10010725 3300025935 Bacteria 5047
491 Ga0207709_10078963 3300025935 Bacteria 2114
492 Ga0207709_11126449 3300025935 Bacteria 645
493 Ga0207670_10676066 3300025936 Unclassified 853
494 Ga0207670_10951483 3300025936 Unclassified 721
495 Ga0207669_10003697 3300025937 Bacteria 6653
496 Ga0207669_10148066 3300025937 Bacteria 1640
497 Ga0207669_10475102 3300025937 Unclassified 995
498 Ga0207704_10671197 3300025938 Unclassified 855
499 Ga0207665_10007810 3300025939 Bacteria 7059
500 Ga0207665_10553274 3300025939 Bacteria 894
501 Ga0207665_10770055 3300025939 Unclassified 759
502 Ga0207691_10005849 3300025940 Bacteria 11895
503 Ga0207691_10230875 3300025940 Bacteria 1602
504 Ga0207711_10016342 3300025941 Bacteria 6167
505 Ga0207711_10039002 3300025941 Unclassified 4039
506 Ga0207711_10285103 3300025941 Unclassified 1521
507 Ga0207711_10343347 3300025941 Unclassified 1382
508 Ga0207711_11564053 3300025941 Unclassified 603
509 Ga0207711_11668345 3300025941 Bacteria 581
510 Ga0207689_10154641 3300025942 Bacteria 1891
511 Ga0207689_10227389 3300025942 Bacteria 1542
512 Ga0207689_10311764 3300025942 Unclassified 1305
513 Ga0207689_10387293 3300025942 Unclassified 1164
514 Ga0207689_10419069 3300025942 Bacteria 1117
515 Ga0207661_10041437 3300025944 Unclassified 3625
516 Ga0207661_10153674 3300025944 Bacteria 1991
517 Ga0207661_11383961 3300025944 Unclassified 646
518 Ga0207661_11612703 3300025944 Unclassified 594
519 Ga0207679_10169180 3300025945 Bacteria 1797
520 Ga0207679_10231685 3300025945 Bacteria 1560
521 Ga0207679_10678096 3300025945 Unclassified 934
522 Ga0207679_12148693 3300025945 Unclassified 507
523 Ga0207667_10033770 3300025949 Bacteria 5497
524 Ga0207667_10114403 3300025949 Bacteria 2781
525 Ga0207667_10127358 3300025949 Bacteria 2623
526 Ga0207667_10178187 3300025949 Bacteria 2183
527 Ga0207667_10776657 3300025949 Unclassified 956
528 Ga0207651_10034089 3300025960 Bacteria 3292
529 Ga0207651_10354810 3300025960 Unclassified 1236
530 Ga0207651_10411313 3300025960 Bacteria 1153
531 Ga0207712_10023969 3300025961 Bacteria 4034
532 Ga0207712_10106993 3300025961 Bacteria 2090
533 Ga0207712_10375541 3300025961 Bacteria 1188
534 Ga0207712_11575303 3300025961 Unclassified 589
535 Ga0207640_11413943 3300025981 Bacteria 623
536 Ga0207658_10111594 3300025986 Bacteria 2163
537 Ga0207658_10155195 3300025986 Unclassified 1870
538 Ga0207677_10182388 3300026023 Bacteria 1652
539 Ga0207703_10033858 3300026035 Bacteria 4052
540 Ga0207703_10139863 3300026035 Bacteria 2100
541 Ga0207639_10006836 3300026041 Bacteria 7768
542 Ga0207639_10549652 3300026041 Bacteria 1060
543 Ga0207639_10732528 3300026041 Bacteria 919
544 Ga0207678_10210150 3300026067 Bacteria 1664
545 Ga0207708_10001957 3300026075 Bacteria 15193
546 Ga0207702_10035794 3300026078 Unclassified 4151
547 Ga0207702_10215281 3300026078 Unclassified 1788
548 Ga0207702_10242608 3300026078 Bacteria 1689
549 Ga0207702_10541642 3300026078 Bacteria 1138
550 Ga0207702_10659870 3300026078 Unclassified 1029
551 Ga0207702_10867828 3300026078 Bacteria 894
552 Ga0207702_11756863 3300026078 Unclassified 613
553 Ga0207641_10032489 3300026088 Bacteria 4332
554 Ga0207641_10085799 3300026088 Bacteria 2744
555 Ga0207641_10127022 3300026088 Unclassified 2284
556 Ga0207641_11606145 3300026088 Unclassified 652
557 Ga0207641_12178475 3300026088 Unclassified 555
558 Ga0207648_10071237 3300026089 Bacteria 3029
559 Ga0207648_10649160 3300026089 Unclassified 975
560 Ga0207676_10733475 3300026095 Bacteria 960
561 Ga0207676_11568817 3300026095 Bacteria 656
562 Ga0207674_10050092 3300026116 Bacteria 4268
563 Ga0207674_10130313 3300026116 Bacteria 2479
564 Ga0207674_10225897 3300026116 Bacteria 1820
565 Ga0207674_10710934 3300026116 Bacteria 970
566 Ga0207675_100340784 3300026118 Bacteria 1467
567 Ga0207675_100512056 3300026118 Bacteria 1195
568 Ga0207675_101138796 3300026118 Bacteria 800
569 Ga0207683_11241543 3300026121 Bacteria 690
570 Ga0207683_12096858 3300026121 Unclassified 514
571 Ga0207698_10142754 3300026142 Bacteria 2066
572 Ga0207698_10366701 3300026142 Unclassified 1366
573 Ga0207698_11924620 3300026142 Bacteria 606
574 Ga0209981_1046288 3300027378 Unclassified 655
575 Ga0209588_1017898 3300027671 Bacteria 2202
576 Ga0209588_1041201 3300027671 Bacteria 1491
577 Ga0209588_1076234 3300027671 Unclassified 1084
578 Ga0209966_1031370 3300027695 Unclassified 1078
579 Ga0209998_10045355 3300027717 Unclassified 1007
580 Ga0209813_10033409 3300027866 Bacteria 1529
581 Ga0209813_10037949 3300027866 Bacteria 1454
582 Ga0209813_10095295 3300027866 Bacteria 1005
583 Ga0209813_10102129 3300027866 Bacteria 977
584 Ga0209974_10086927 3300027876 Bacteria 1081
585 Ga0209974_10253281 3300027876 Bacteria 663
586 Ga0207428_10031661 3300027907 Unclassified 4360
587 Ga0265357_1022456 3300028023 Bacteria 696
588 Ga0268266_10100166 3300028379 Bacteria 2552
589 Ga0268266_10326691 3300028379 Bacteria 1437
590 Ga0268266_10327778 3300028379 Bacteria 1434
591 Ga0268266_10568124 3300028379 Bacteria 1088
592 Ga0268266_10629365 3300028379 Bacteria 1032
593 Ga0268266_10869182 3300028379 Bacteria 872
594 Ga0268266_11333847 3300028379 Unclassified 693
595 Ga0268266_11408835 3300028379 Unclassified 672
596 Ga0268265_10046339 3300028380 Bacteria 3249
597 Ga0268265_11724808 3300028380 Unclassified 632
598 Ga0268264_10072965 3300028381 Bacteria 2911
599 Ga0268264_10501694 3300028381 Bacteria 1184
600 Ga0268264_11567986 3300028381 Unclassified 669
601 Ga0265338_10588571 3300028800 Bacteria 776
602 Ga0265770_1032367 3300030878 Bacteria 882
603 Ga0265328_10034603 3300031239 Bacteria 1870
604 Ga0265325_10211568 3300031241 Unclassified 890
605 Ga0265339_10000799 3300031249 Bacteria 24271
606 Ga0265327_10231069 3300031251 Bacteria 829
607 Ga0265316_10011395 3300031344 Bacteria 8023
608 Ga0265316_10089431 3300031344 Unclassified 2350
609 Ga0265314_10008447 3300031711 Bacteria 8822
610 Ga0265342_10089185 3300031712 Bacteria 1770
611 Ga0265342_10715670 3300031712 Unclassified 500
612 Ga0307405_10459966 3300031731 Bacteria 1011
613 Ga0307413_10572297 3300031824 Bacteria 920
614 Ga0307410_11526666 3300031852 Unclassified 589
615 Ga0307407_10276644 3300031903 Bacteria 1161
616 Ga0307407_10356111 3300031903 Bacteria 1038
617 Ga0307409_100488783 3300031995 Unclassified 1196
618 Ga0307416_100181685 3300032002 Bacteria 1972
619 Ga0307416_100200194 3300032002 Bacteria 1894
620 Ga0307416_101666129 3300032002 Unclassified 743
621 Ga0307416_101807093 3300032002 Bacteria 715
622 Ga0307411_10097589 3300032005 Bacteria 2069
623 Ga0307415_101003029 3300032126 Bacteria 776
624 Ga0373926_0002737 3300035083 Bacteria 5620
625 Ga0373926_0301540 3300035083 Bacteria 625
626 Ga0373926_0397682 3300035083 Unclassified 544
627 Ga0373934_0311117 3300035086 Unclassified 654
628 Ga0373944_0333434 3300035089 Unclassified 574
629 Ga0373944_0436083 3300035089 Bacteria 509
630 Ga0373949_0228359 3300035090 Bacteria 568
631 Ga0373923_0001065 3300035111 Bacteria 7514
632 Ga0373923_0425827 3300035111 Unclassified 641
633 Ga0373923_0672590 3300035111 Unclassified 513
634 Ga0373945_0002156 3300035116 Bacteria 6142
635 Ga0373946_0047283 3300035171 Bacteria 1787
636 Ga0373962_0093140 3300035242 Bacteria 931
637 Ga0373924_0010056 3300035410 Bacteria 3482
638 Ga0373931_0349151 3300035691 Bacteria 926
639 Ga0373935_0004904 3300035692 Bacteria 7861
640 Ga0373935_0023860 3300035692 Bacteria 3758
641 Ga0373935_1241977 3300035692 Unclassified 556
642 Ga0373927_0032397 3300035695 Unclassified 3405
643 Ga0373927_0117760 3300035695 Unclassified 1733
644 Ga0373927_0289720 3300035695 Bacteria 1077
645 Ga0373933_0322016 3300035724 Bacteria 1003
646 Ga0373947_0301092 3300035725 Bacteria 1069
647 Ga0373947_0423867 3300035725 Unclassified 899
648 Ga0373937_0138920 3300036401 Bacteria 2273
649 Ga0373937_2036543 3300036401 Bacteria 520
650 Ga0373925_0020170 3300037068 Unclassified 4851
651 Ga0373925_0025584 3300037068 Unclassified 4313
652 Ga0373925_0062558 3300037068 Unclassified 2799
653 Ga0373925_0156347 3300037068 Bacteria 1794
654 Ga0373925_0253289 3300037068 Bacteria 1412
655 Ga0373925_0784092 3300037068 Bacteria 786
656 Ga0395900_1422033 3300037418 Unclassified 606
657 Ga0395900_1604579 3300037418 Unclassified 562
658 Ga0436364_0011168 3300037853 Unclassified 746
659 Ga0436364_0292186 3300037853 Unclassified 964
660 Ga0395901_0834350 3300038443 Bacteria 908
661 Ga0436365_0192005 3300039437 Bacteria 1709
662 Ga0436365_0364484 3300039437 Bacteria 1661
663 Ga0436365_1482532 3300039437 Bacteria 2927
664 Ga0436363_0679652 3300039450 Unclassified 876
665 Ga0439461_0041567 3300041410 Unclassified 995
666 Ga0451793_1061829 3300041452 Bacteria 858
667 Ga0451802_0514694 3300041460 Bacteria 574
668 Ga0451804_0836850 3300041463 Bacteria 504
669 Ga0451807_2677791 3300041486 Unclassified 634
670 Ga0451835_1066438 3300041492 Unclassified 537
671 Ga0451837_1816888 3300041494 Bacteria 741
672 Ga0451849_1285460 3300041505 Unclassified 670
673 Ga0451853_3825130 3300041512 Bacteria 881
674 Ga0439431_0007685 3300041997 Bacteria 2407
675 Ga0439433_0149630 3300041999 Bacteria 600
676 Ga0439445_0022379 3300042004 Unclassified 1594
677 Ga0439448_0123817 3300042005 Bacteria 888
678 Ga0439448_0349072 3300042005 Bacteria 527
679 Ga0439456_087054 3300042013 Unclassified 700
680 Ga0439462_0245493 3300042015 Bacteria 514
681 Ga0450920_057499 3300042122 Bacteria 784
682 Ga0450923_024079 3300042125 Bacteria 1205
683 Ga0450896_056325 3300042133 Bacteria 634
684 Ga0450900_008954 3300042136 Unclassified 1261
685 Ga0439446_0070651 3300042156 Unclassified 1068
686 Ga0439446_0104045 3300042156 Unclassified 900
687 Ga0439434_0012676 3300042435 Bacteria 2496
688 Ga0439435_0031108 3300042436 Unclassified 1449
689 Ga0439444_0024636 3300042437 Bacteria 1089
690 Ga0451577_0866738 3300042876 Bacteria 814
691 Ga0466965_0882289 3300044683 Bacteria 521
692 Ga0466963_0105926 3300044694 Bacteria 1928
693 Ga0466963_0186443 3300044694 Unclassified 1449
694 Ga0466963_0750730 3300044694 Bacteria 688
695 Ga0466957_0110326 3300044842 Bacteria 1744
696 Ga0466957_1274244 3300044842 Bacteria 533
697 Ga0466960_0065225 3300044901 Bacteria 1798
698 Ga0466959_0520080 3300045049 Unclassified 804
699 Ga0466959_0639086 3300045049 Bacteria 715
700 Ga0466958_0773779 3300045836 Unclassified 626
701 Ga0466967_0141142 3300045976 Bacteria 2244
702 Ga0466967_1093976 3300045976 Bacteria 794
703 Ga0466967_2024265 3300045976 Bacteria 572
704 Ga0495629_0720638 3300046459 Unclassified 661
705 Ga0495629_0937494 3300046459 Bacteria 566
706 Ga0495651_0110445 3300046462 Bacteria 2034
707 Ga0495651_0320777 3300046462 Unclassified 1033
708 Ga0495651_0985880 3300046462 Bacteria 512
709 Ga0495651_0993223 3300046462 Unclassified 510
710 Ga0495653_0048953 3300046463 Unclassified 3259
711 Ga0495580_0003125 3300046472 Bacteria 14188
712 Ga0495580_0240460 3300046472 Unclassified 1241
713 Ga0495580_0429509 3300046472 Unclassified 888
714 Ga0495582_0205508 3300046473 Bacteria 1125
715 Ga0495582_0433268 3300046473 Unclassified 759
716 Ga0495664_0585213 3300046477 Bacteria 664
717 Ga0495664_0637571 3300046477 Unclassified 632
718 Ga0495664_0671983 3300046477 Bacteria 613
719 Ga0495594_0655778 3300046499 Bacteria 594
720 Ga0495608_0170641 3300046511 Unclassified 1380
721 Ga0495608_0333378 3300046511 Bacteria 936
722 Ga0495628_0119499 3300046516 Unclassified 2023
723 Ga0495628_0120031 3300046516 Unclassified 2018
724 Ga0495628_1246106 3300046516 Unclassified 503
725 Ga0495630_0053540 3300046517 Unclassified 3022
726 Ga0495630_0715809 3300046517 Unclassified 766
727 Ga0495663_0381737 3300046525 Unclassified 516
728 Ga0495666_0429481 3300046526 Unclassified 593
729 Ga0495652_0254604 3300046529 Bacteria 1299
730 Ga0495652_0489495 3300046529 Unclassified 855
731 Ga0495652_1117613 3300046529 Unclassified 511
732 Ga0495665_0053680 3300046531 Unclassified 2130
733 Ga0495665_0097091 3300046531 Bacteria 1547
734 Ga0495665_0439319 3300046531 Unclassified 660
735 Ga0495640_0557207 3300046533 Unclassified 694
736 Ga0495586_0359421 3300046535 Unclassified 837
737 Ga0495587_0751339 3300046536 Unclassified 534
738 Ga0495598_0078711 3300046537 Unclassified 1053
739 Ga0495645_0103518 3300046543 Bacteria 2022
740 Ga0495633_0061096 3300046558 Bacteria 1765
741 Ga0495633_0144281 3300046558 Bacteria 1100
742 Ga0495667_0270357 3300046559 Unclassified 1080
743 Ga0495656_0056014 3300046615 Bacteria 1702
744 Ga0495634_0196839 3300046642 Unclassified 1254
745 Ga0495634_0729663 3300046642 Unclassified 568
746 Ga0495635_0043167 3300046663 Bacteria 3111
747 Ga0495635_0343788 3300046663 Unclassified 996
748 Ga0495635_0432457 3300046663 Unclassified 871
749 Ga0495635_0666689 3300046663 Unclassified 676
750 Ga0495659_0054117 3300046664 Bacteria 1468
751 Ga0495599_0279552 3300046678 Unclassified 1011
752 Ga0495599_0744750 3300046678 Bacteria 562
753 Ga0495623_0211380 3300046679 Unclassified 1110
754 Ga0495646_0375500 3300046680 Unclassified 742
755 Ga0495658_0440113 3300046683 Bacteria 832
756 Ga0495658_0663334 3300046683 Unclassified 668
757 Ga0495658_1085113 3300046683 Unclassified 510
758 Ga0495669_0362444 3300046684 Unclassified 701
759 Ga0495613_0258345 3300046689 Bacteria 1214
760 Ga0495613_0757645 3300046689 Unclassified 636
761 Ga0495613_1078397 3300046689 Unclassified 513
762 Ga0495670_0086104 3300046691 Bacteria 1604
763 Ga0495670_0843901 3300046691 Unclassified 500
764 Ga0495600_0142326 3300046809 Unclassified 1556
765 Ga0495581_0455349 3300047315 Bacteria 745
766 Ga0495581_0796553 3300047315 Bacteria 542
767 Ga0495604_0338937 3300047317 Bacteria 1001
768 Ga0495604_0485600 3300047317 Unclassified 803
769 Ga0495674_0023516 3300047319 Bacteria 5678
770 Ga0495674_0084565 3300047319 Unclassified 2719
771 Ga0495674_0440699 3300047319 Unclassified 1048
772 Ga0495674_0496643 3300047319 Bacteria 976
773 Ga0495674_0653218 3300047319 Unclassified 829
774 Ga0495674_0802501 3300047319 Bacteria 732
775 Ga0495675_0075670 3300047444 Unclassified 2122
776 Ga0495677_0263280 3300047445 Unclassified 675
777 Ga0495684_0007683 3300047471 Bacteria 8343
778 Ga0495684_0045666 3300047471 Bacteria 3352
779 Ga0495684_0509761 3300047471 Unclassified 826
780 Ga0495684_0692522 3300047471 Unclassified 677
781 Ga0495593_0268331 3300047673 Unclassified 854
782 Ga0495602_0386243 3300048088 Unclassified 1002
783 Ga0495602_0877674 3300048088 Unclassified 598
784 Ga0496102_1133857 3300048905 Bacteria 702
785 Ga0496103_0188587 3300048906 Bacteria 1326
786 Ga0496104_0241180 3300048907 Unclassified 1720
787 Ga0496105_0147557 3300048908 Bacteria 1934
788 Ga0496105_0660791 3300048908 Unclassified 806
789 Ga0496105_0986288 3300048908 Unclassified 631
790 Ga0496107_0311918 3300048910 Bacteria 1171
791 Ga0496107_1317243 3300048910 Unclassified 516
792 Ga0496109_0000029 3300048912 Bacteria 164675
793 Ga0496110_1245055 3300048913 Unclassified 653
794 Ga0496112_0090209 3300048915 Unclassified 3034
795 Ga0496112_0097964 3300048915 Bacteria 2902
796 Ga0496112_0404975 3300048915 Bacteria 1304
797 Ga0496112_0563499 3300048915 Unclassified 1073
798 Ga0496112_1469779 3300048915 Unclassified 596
799 Ga0496113_0016830 3300048916 Bacteria 5059
800 Ga0496113_0264096 3300048916 Unclassified 1375
801 Ga0496113_0456590 3300048916 Bacteria 1027
802 Ga0496113_0550061 3300048916 Unclassified 926
803 Ga0496115_0467382 3300048918 Bacteria 1017
804 Ga0501033_0355527 3300049570 Bacteria 1026
805 Ga0501033_0420425 3300049570 Bacteria 931
806 Ga0501034_0004512 3300049571 Bacteria 15476
807 Ga0501034_0036561 3300049571 Bacteria 4974
808 Ga0501034_1718114 3300049571 Unclassified 500
809 Ga0501036_0642151 3300049572 Unclassified 879
810 Ga0501040_0095848 3300049576 Unclassified 2065
811 Ga0501040_0660511 3300049576 Bacteria 756
812 Ga0501040_1373641 3300049576 Bacteria 513
813 Ga0501042_0734248 3300049578 Bacteria 718
814 Ga0501043_0106051 3300049579 Bacteria 2207
815 Ga0501046_0316429 3300049580 Bacteria 1138
816 Ga0501047_0014774 3300049581 Bacteria 7431
817 Ga0501047_0736987 3300049581 Bacteria 802
818 Ga0501048_0016155 3300049582 Bacteria 5503
819 Ga0501048_0201139 3300049582 Unclassified 1412
820 Ga0501067_0038877 3300049583 Bacteria 2642
821 Ga0501069_0103568 3300049585 Bacteria 1617
822 Ga0501070_0049375 3300049586 Bacteria 3494
823 Ga0501071_0100267 3300049587 Bacteria 2134
824 Ga0501072_0222755 3300049588 Bacteria 1503
825 Ga0501073_0399136 3300049589 Bacteria 950
826 Ga0501075_0202697 3300049591 Bacteria 1513
827 Ga0501075_0209707 3300049591 Bacteria 1486
828 Ga0501075_0562242 3300049591 Bacteria 870
829 Ga0501076_0015648 3300049592 Bacteria 5736
830 Ga0501076_1259577 3300049592 Bacteria 608
831 Ga0501077_0758601 3300049593 Bacteria 624
832 Ga0501206_075728 3300049653 Bacteria 577
833 Ga0501079_0155646 3300049741 Unclassified 1782
834 Ga0501079_0621628 3300049741 Bacteria 850
835 Ga0501079_1112216 3300049741 Bacteria 623
836 Ga0501080_0136269 3300049742 Unclassified 2272
837 Ga0501080_0406250 3300049742 Unclassified 1225
838 Ga0501083_0000176 3300049744 Bacteria 41234
839 Ga0501083_0213229 3300049744 Bacteria 1259
840 Ga0501083_0626515 3300049744 Unclassified 700
841 Ga0501265_041854 3300049762 Unclassified 695
842 Ga0501035_0004937 3300049822 Bacteria 12652
843 Ga0501035_0212618 3300049822 Bacteria 1654
844 Ga0501035_0862624 3300049822 Unclassified 719
845 Ga0501044_0108956 3300049823 Bacteria 2779
846 Ga0501045_0268990 3300049824 Bacteria 1269
847 Ga0501045_0307145 3300049824 Bacteria 1181
848 Ga0501045_0598872 3300049824 Bacteria 816
849 Ga0501045_0860739 3300049824 Bacteria 667
850 Ga0501045_0973538 3300049824 Unclassified 622
851 nmdc:mga03n38_141217_c1 3300050490 Bacteria 1203
852 nmdc:mga03n38_155322_c1 3300050490 Bacteria 1154
853 nmdc:mga00v17_232084_c1 3300050491 Bacteria 1196
854 nmdc:mga00v17_35173_c1 3300050491 Bacteria 2979
855 nmdc:mga00v17_427696_c1 3300050491 Bacteria 860
856 nmdc:mga00v17_6367_c1 3300050491 Bacteria 6262
857 nmdc:mga00v17_64876_c1 3300050491 Bacteria 2251
858 nmdc:mga00v17_8235_c1 3300050491 Bacteria 5305
859 nmdc:mga0yw44_31582_c1 3300050492 Bacteria 3081
860 nmdc:mga0k408_102986_c1 3300050493 Unclassified 1684
861 nmdc:mga0k408_18772_c1 3300050493 Bacteria 3862
862 nmdc:mga0k408_222154_c1 3300050493 Unclassified 1128
863 nmdc:mga0k408_383063_c1 3300050493 Bacteria 838
864 nmdc:mga0k408_6295_c1 3300050493 Bacteria 6332
865 nmdc:mga06z11_210415_c1 3300050494 Unclassified 1133
866 nmdc:mga06z11_316930_c1 3300050494 Bacteria 930
867 nmdc:mga06z11_865696_c1 3300050494 Bacteria 551
868 nmdc:mga06z11_97277_c1 3300050494 Bacteria 1609
869 nmdc:mga06z11_982072_c1 3300050494 Unclassified 515
870 nmdc:mga04h51_110242_c1 3300050495 Bacteria 1014
871 nmdc:mga04h51_45387_c1 3300050495 Bacteria 1453
872 nmdc:mga04h51_75998_c1 3300050495 Bacteria 1183
873 nmdc:mga04h51_80027_c1 3300050495 Bacteria 1158
874 nmdc:mga07m45_21273_c1 3300050496 Bacteria 3530
875 nmdc:mga07m45_6433_c1 3300050496 Bacteria 5936
876 nmdc:mga07m45_7105_c1 3300050496 Bacteria 5702
877 nmdc:mga07m45_88934_c1 3300050496 Bacteria 1768
878 nmdc:mga07m45_9204_c1 3300050496 Bacteria 5110
879 nmdc:mga05p37_1127174_c1 3300050507 Bacteria 819
880 nmdc:mga05p37_1768244_c1 3300050507 Unclassified 598
881 nmdc:mga05p37_17826_c1 3300050507 Bacteria 8571
882 nmdc:mga05p37_345269_c1 3300050507 Bacteria 1754
883 nmdc:mga05p37_54761_c1 3300050507 Bacteria 4907
884 nmdc:mga05p37_566040_c1 3300050507 Bacteria 1290
885 nmdc:mga05p37_7651_c1 3300050507 Bacteria 12750
886 nmdc:mga09592_1031405_c1 3300050508 Bacteria 686
887 nmdc:mga0qj67_1178963_c1 3300050509 Bacteria 596
888 nmdc:mga0qj67_762971_c1 3300050509 Unclassified 767
889 nmdc:mga06r32_107528_c1 3300050510 Bacteria 2741
890 nmdc:mga06r32_1139642_c1 3300050510 Bacteria 728
891 nmdc:mga06r32_1173492_c1 3300050510 Bacteria 715
892 nmdc:mga06r32_131676_c1 3300050510 Bacteria 2473
893 nmdc:mga06r32_194049_c1 3300050510 Bacteria 2018
894 nmdc:mga06r32_35620_c1 3300050510 Bacteria 4696
895 nmdc:mga06r32_387623_c1 3300050510 Bacteria 1380
896 nmdc:mga06r32_670392_c1 3300050510 Unclassified 1004
897 nmdc:mga06r32_778132_c1 3300050510 Bacteria 919
898 nmdc:mga08y16_1505406_c1 3300050511 Bacteria 633
899 nmdc:mga08y16_1929942_c1 3300050511 Unclassified 541
900 nmdc:mga08y16_435461_c1 3300050511 Bacteria 1339
901 nmdc:mga08y16_6052_c1 3300050511 Bacteria 12680
902 nmdc:mga08y16_606326_c1 3300050511 Bacteria 1103
903 nmdc:mga08y16_778488_c1 3300050511 Bacteria 951
904 nmdc:mga0n895_1648284_c1 3300050512 Bacteria 605
905 nmdc:mga0n895_30208_c1 3300050512 Bacteria 5176
906 nmdc:mga0n895_384620_c1 3300050512 Unclassified 1420
907 nmdc:mga0n895_466660_c1 3300050512 Bacteria 1274
908 nmdc:mga0n895_734774_c1 3300050512 Bacteria 981
909 nmdc:mga0rr50_1468126_c1 3300050513 Bacteria 577
910 nmdc:mga0rr50_29939_c1 3300050513 Bacteria 3847
911 nmdc:mga0rr50_780551_c1 3300050513 Unclassified 815
912 nmdc:mga08x19_352370_c1 3300050514 Unclassified 1028
913 nmdc:mga08x19_354758_c1 3300050514 Bacteria 1024
914 nmdc:mga0a205_16161_c1 3300050515 Bacteria 6988
915 nmdc:mga0a205_4096_c1 3300050515 Bacteria 13043
916 nmdc:mga0a205_427155_c1 3300050515 Unclassified 1187
917 nmdc:mga0a205_611602_c1 3300050515 Bacteria 942
918 nmdc:mga0a205_805851_c1 3300050515 Unclassified 787
919 nmdc:mga0sz30_42221_c1 3300050516 Bacteria 1918
920 Ga0495655_0354498 3300053083 Unclassified 514
921 Ga0495619_0664290 3300053085 Unclassified 710
922 Ga0500555_020268 3300053103 Bacteria 1916
923 Ga0500555_073000 3300053103 Bacteria 903
924 Ga0500555_084740 3300053103 Unclassified 820
925 Ga0500562_083010 3300053108 Bacteria 868
926 Ga0500592_090881 3300053116 Bacteria 512
927 Ga0500645_000233 3300053730 Bacteria 42370
928 Ga0501084_0090610 3300054114 Unclassified 2567
929 Ga0501084_0165943 3300054114 Bacteria 1864
930 Ga0501084_0583307 3300054114 Bacteria 945
931 Ga0590075_062371 3300059424 Bacteria 961
932 Ga0501082_0010848 3300060353 Bacteria 7847
933 Ga0501082_0372912 3300060353 Bacteria 1245
934 Ga0501082_0821849 3300060353 Bacteria 813
935 Ga0501082_1596181 3300060353 Unclassified 570
936 Ga0466962_0281964 3300061719 Unclassified 820
937 Ga0530510_0123246 3300061734 Bacteria 1904
938 Ga0070683_100765984
939 JGI24742J22300_10110604
940 Ga0065704_10137469
941 Ga0065712_10079161
942 Ga0065712_10170858
943 Ga0065715_10253384
944 Ga0065715_10373111
945 Ga0065707_10230169
946 Ga0065707_10814352
947 Ga0070658_10006071
948 Ga0070658_10128207
949 Ga0070676_10074722
950 Ga0070676_10248976
951 Ga0070676_11399792
952 Ga0070683_100141890
953 Ga0070683_100150806
954 Ga0070683_100542286
955 Ga0070683_100706019
956 Ga0070683_101293211
957 Ga0070690_101087776
958 Ga0070690_101603190
959 Ga0070670_100902288
960 Ga0070670_101425779
961 Ga0070670_101577163
962 Ga0070677_10678410
963 Ga0068869_100268308
964 Ga0070666_10589914
965 Ga0070666_10861878
966 Ga0070680_100131775
967 Ga0070680_100462965
968 Ga0070680_100714578
969 Ga0070682_100920652
970 Ga0068868_100036868
971 Ga0068868_100365500
972 Ga0068868_100468717
973 Ga0070660_100153085
974 Ga0070660_100232298
975 Ga0070660_100294327
976 Ga0070660_100971896
977 Ga0070689_100945264
978 Ga0070689_101000494
979 Ga0070689_101033658
980 Ga0070687_100519472
981 Ga0070692_10048530
982 Ga0070675_100001182
983 Ga0070675_100112846
984 Ga0070675_100322712
985 Ga0070675_100461709
986 Ga0070671_101134327
987 Ga0070674_100019948
988 Ga0070674_100261710
989 Ga0070673_100172965
990 Ga0070673_101417031
991 Ga0070673_102250055
992 Ga0070688_100064814
993 Ga0070688_100186602
994 Ga0070688_100359990
995 Ga0070659_100126199
996 Ga0070659_100204341
997 Ga0070659_100256139
998 Ga0070659_100354312
999 Ga0070667_100250297
1000 Ga0070667_101184875
1001 Ga0070703_10160870
1002 Ga0070709_10003649
1003 Ga0070709_10095968
1004 Ga0070709_11352279
1005 Ga0070714_100036690
1006 Ga0070714_100547838
1007 Ga0070714_100703740
1008 Ga0070713_100027377
1009 Ga0070713_100466633
1010 Ga0070710_11069465
1011 Ga0070701_10657040
1012 Ga0070701_10831853
1013 Ga0070711_100043490
1014 Ga0070711_100455456
1015 Ga0070711_101672062
1016 Ga0070705_100082509
1017 Ga0070705_101116449
1018 Ga0070700_100215087
1019 Ga0070694_100002871
1020 Ga0070694_101289308
1021 Ga0070694_101415009
1022 Ga0070708_100501641
1023 Ga0070708_101019557
1024 Ga0070663_101653291
1025 Ga0070678_100075559
1026 Ga0070678_101261145
1027 Ga0070662_100486679
1028 Ga0070681_10184236
1029 Ga0070681_10204881
1030 Ga0070681_10920301
1031 Ga0070681_11851771
1032 Ga0070681_11965037
1033 Ga0068867_100008313
1034 Ga0068867_100408287
1035 Ga0068867_101029932
1036 Ga0070685_10682579
1037 Ga0070685_10968914
1038 Ga0070706_101239770
1039 Ga0070698_100339450
1040 Ga0070699_100509756
1041 Ga0070699_100989477
1042 Ga0070679_100275258
1043 Ga0070679_100438235
1044 Ga0070679_100655225
1045 Ga0070684_100062416
1046 Ga0070684_100097665
1047 Ga0070684_100511859
1048 Ga0070684_101488849
1049 Ga0070697_100311526
1050 Ga0068853_100009148
1051 Ga0068853_101359404
1052 Ga0068853_101406467
1053 Ga0068853_101965692
1054 Ga0070672_100966254
1055 Ga0070672_101738113
1056 Ga0070686_100024502
1057 Ga0070686_100276160
1058 Ga0070686_100656896
1059 Ga0070695_100049739
1060 Ga0070695_100066572
1061 Ga0070695_100082852
1062 Ga0070696_100023850
1063 Ga0070696_100059296
1064 Ga0070693_100084885
1065 Ga0070693_100586721
1066 Ga0070665_100164274
1067 Ga0070665_100244495
1068 Ga0070665_100310607
1069 Ga0070665_100593731
1070 Ga0070665_100996628
1071 Ga0070665_101026351
1072 Ga0070665_101062462
1073 Ga0070665_101099342
1074 Ga0070704_100215994
1075 Ga0068855_100015939
1076 Ga0068855_100032412
1077 Ga0068855_100048115
1078 Ga0068855_100123856
1079 Ga0068855_100148006
1080 Ga0068855_100269877
1081 Ga0068855_101134188
1082 Ga0070664_100120450
1083 Ga0070664_100273864
1084 Ga0070664_102362656
1085 Ga0068857_100063837
1086 Ga0068857_100191331
1087 Ga0068857_101401149
1088 Ga0068857_102281812
1089 Ga0068854_100117449
1090 Ga0068856_100042886
1091 Ga0068856_100049790
1092 Ga0068856_100207354
1093 Ga0068856_100236027
1094 Ga0068856_100310648
1095 Ga0068856_101204013
1096 Ga0068856_101311596
1097 Ga0068852_100119943
1098 Ga0068852_100290882
1099 Ga0068852_100404385
1100 Ga0068859_100556060
1101 Ga0068859_101082834
1102 Ga0068859_101137696
1103 Ga0068859_102196788
1104 Ga0068864_100771817
1105 Ga0068861_100314467
1106 Ga0068861_101296422
1107 Ga0068870_11140194
1108 Ga0068863_100088679
1109 Ga0068863_100169501
1110 Ga0068863_100304905
1111 Ga0068863_100630928
1112 Ga0068863_100687779
1113 Ga0068863_101248653
1114 Ga0068863_101984258
1115 Ga0068858_100046850
1116 Ga0068858_100048278
1117 Ga0068858_100119375
1118 Ga0068858_100868802
1119 Ga0068858_100956922
1120 Ga0068858_102247019
1121 Ga0068860_100018684
1122 Ga0068860_100611289
1123 Ga0068860_101914978
1124 Ga0068862_100248450
1125 Ga0068862_100775353
1126 Ga0068862_101420249
1127 Ga0081455_10604489
1128 Ga0070717_10046373
1129 Ga0070717_10048204
1130 Ga0070717_10109813
1131 Ga0075365_10007884
1132 Ga0075368_10007157
1133 Ga0075368_10012601
1134 Ga0075368_10045199
1135 Ga0075368_10219952
1136 Ga0075363_100025311
1137 Ga0075363_100262959
1138 Ga0075364_10020939
1139 Ga0075364_10047219
1140 Ga0075364_10058219
1141 Ga0075364_10157200
1142 Ga0075364_10263130
1143 Ga0070716_100007878
1144 Ga0070716_100261681
1145 Ga0070716_100729477
1146 Ga0070712_100911623
1147 Ga0070712_101120490
1148 Ga0070712_101713518
1149 Ga0070712_101904149
1150 Ga0075367_10011769
1151 Ga0075367_10022483
1152 Ga0075367_10025530
1153 Ga0075367_10091155
1154 Ga0075367_10282376
1155 Ga0075367_10872812
1156 Ga0075369_10080203
1157 Ga0075366_10018970
1158 Ga0075366_10026345
1159 Ga0075366_10027116
1160 Ga0075366_10090703
1161 Ga0097621_100330739
1162 Ga0097621_100449857
1163 Ga0097621_100527177
1164 Ga0097621_102076350
1165 Ga0097621_102244017
1166 Ga0075370_10058966
1167 Ga0075370_10071981
1168 Ga0075370_10116756
1169 Ga0068871_100206876
1170 Ga0068871_101768333
1171 Ga0068871_102019376
1172 Ga0068871_102032934
1173 Ga0075428_101091131
1174 Ga0075428_101196347
1175 Ga0075430_100069517
1176 Ga0075430_101732658
1177 Ga0075431_100043722
1178 Ga0075431_100190571
1179 Ga0075431_100762253
1180 Ga0075431_100860162
1181 Ga0075431_100954192
1182 Ga0075433_10004200
1183 Ga0075433_10006492
1184 Ga0075433_10106482
1185 Ga0075433_10554068
1186 Ga0075433_10679591
1187 Ga0075433_11258444
1188 Ga0075433_11284583
1189 Ga0075434_100449273
1190 Ga0075434_100687433
1191 Ga0075434_101552791
1192 Ga0075434_101571334
1193 Ga0075434_102439510
1194 Ga0075429_101217512
1195 Ga0068865_100364689
1196 Ga0068865_100756299
1197 Ga0068865_101428745
1198 Ga0075436_100478416
1199 Ga0097620_100556096
1200 Ga0097620_101082824
1201 Ga0097620_101137420
1202 Ga0097620_102196348
1203 Ga0099794_10004862
1204 Ga0099794_10010820
1205 Ga0099794_10121061
1206 Ga0099795_10268904
1207 Ga0105240_10001491
1208 Ga0105240_10028587
1209 Ga0105240_10031609
1210 Ga0105240_10086749
1211 Ga0105240_10130393
1212 Ga0105240_10196874
1213 Ga0105240_10351266
1214 Ga0105240_10635130
1215 Ga0105240_10643959
1216 Ga0105240_10960098
1217 Ga0105240_11389961
1218 Ga0111539_10383356
1219 Ga0111539_10752500
1220 Ga0111539_12932688
1221 Ga0105245_10859488
1222 Ga0105247_11832891
1223 Ga0114129_10023624
1224 Ga0114129_10148291
1225 Ga0114129_10265584
1226 Ga0114129_10432691
1227 Ga0114129_11221163
1228 Ga0114129_11889903
1229 Ga0114129_11923721
1230 Ga0114129_12032608
1231 Ga0105243_10041747
1232 Ga0105243_10200441
1233 Ga0105243_11040468
1234 Ga0105241_10086593
1235 Ga0105241_10378538
1236 Ga0105241_10678706
1237 Ga0105241_10868584
1238 Ga0105241_11123360
1239 Ga0105241_11217342
1240 Ga0105241_11998308
1241 Ga0105241_12378254
1242 Ga0105242_10151833
1243 Ga0105242_10272668
1244 Ga0105242_10694028
1245 Ga0105242_12556962
1246 Ga0105248_10057326
1247 Ga0105248_10161532
1248 Ga0105248_10172041
1249 Ga0105248_10394276
1250 Ga0105248_10482383
1251 Ga0105248_11145532
1252 Ga0105248_11934380
1253 Ga0105248_12207181
1254 Ga0105248_12404936
1255 Ga0105237_10002663
1256 Ga0105237_10025303
1257 Ga0105237_10086081
1258 Ga0105237_10152528
1259 Ga0105237_10385504
1260 Ga0105237_10837469
1261 Ga0105237_11068756
1262 Ga0105238_10028614
1263 Ga0105238_10183231
1264 Ga0105238_12347110
1265 Ga0105249_10015211
1266 Ga0105249_10031511
1267 Ga0105249_10403156
1268 Ga0105249_10543748
1269 Ga0105249_11059046
1270 Ga0105249_11133229
1271 Ga0105249_12083124
1272 Ga0105249_12083600
1273 Ga0105249_13002889
1274 Ga0105239_10038320
1275 Ga0105239_10060236
1276 Ga0105239_10100774
1277 Ga0105239_10242073
1278 Ga0105239_10311559
1279 Ga0105239_11204129
1280 Ga0105239_11911963
1281 Ga0105246_12004141
1282 Ga0157373_10318809
1283 Ga0157373_10358231
1284 Ga0157371_10684664
1285 Ga0157370_10000275
1286 Ga0157370_10002439
1287 Ga0157370_10251740
1288 Ga0157370_10258939
1289 Ga0157370_10276112
1290 Ga0157370_10626429
1291 Ga0157370_11145583
1292 Ga0157370_11211991
1293 Ga0157370_11421269
1294 Ga0157369_10001633
1295 Ga0157369_10003218
1296 Ga0157369_10012038
1297 Ga0157369_10022247
1298 Ga0157369_10076948
1299 Ga0157369_10086718
1300 Ga0157369_10252545
1301 Ga0157369_10634944
1302 Ga0157369_10657273
1303 Ga0157369_11631684
1304 Ga0157369_12115429
1305 Ga0157369_12390084
1306 Ga0157374_10003406
1307 Ga0157374_10006174
1308 Ga0157374_10036331
1309 Ga0157374_10042130
1310 Ga0157374_10047465
1311 Ga0157374_10068546
1312 Ga0157374_11777018
1313 Ga0157378_10000441
1314 Ga0157378_11381503
1315 Ga0157378_12224909
1316 Ga0163162_10200718
1317 Ga0163162_10377660
1318 Ga0163162_10523313
1319 Ga0163162_10576080
1320 Ga0157372_10012625
1321 Ga0157372_10113671
1322 Ga0157372_10123880
1323 Ga0157372_10170373
1324 Ga0157372_10230718
1325 Ga0157372_10260639
1326 Ga0157372_10978946
1327 Ga0157372_11548850
1328 Ga0157375_10564854
1329 Ga0157375_10576745
1330 Ga0157375_10582337
1331 Ga0157375_13547770
1332 Ga0157375_13683165
1333 Ga0163163_10022794
1334 Ga0163163_10042021
1335 Ga0163163_10045759
1336 Ga0163163_10098278
1337 Ga0163163_10434452
1338 Ga0163163_10617091
1339 Ga0163163_10629493
1340 Ga0163163_10839690
1341 Ga0163163_11045850
1342 Ga0163163_11982608
1343 Ga0163163_13242908
1344 Ga0157380_10024916
1345 Ga0157380_10295037
1346 Ga0157380_10355428
1347 Ga0157380_10446951
1348 Ga0157380_12935567
1349 Ga0157377_10011072
1350 Ga0157377_10735393
1351 Ga0157377_11408642
1352 Ga0157379_10015279
1353 Ga0157379_10156879
1354 Ga0157379_10553068
1355 Ga0157379_11319336
1356 Ga0157379_11796600
1357 Ga0157376_10095784
1358 Ga0157376_10990681
1359 Ga0157376_11702406
1360 Ga0157376_12035472
1361 Ga0157376_12138968
1362 Ga0157376_12337243
1363 Ga0157376_12520006
1364 Ga0163161_10433030
1365 Ga0206356_11518449
1366 Ga0213876_10381130
1367 Ga0207697_10038236
1368 Ga0207682_10122016
1369 Ga0207692_10501848
1370 Ga0207688_10031557
1371 Ga0207688_10581958
1372 Ga0207680_10161339
1373 Ga0207680_10750438
1374 Ga0207680_10857832
1375 Ga0207699_10193527
1376 Ga0207699_10288593
1377 Ga0207699_10775510
1378 Ga0207645_10040860
1379 Ga0207645_10775760
1380 Ga0207705_10019177
1381 Ga0207705_10347819
1382 Ga0207707_10113771
1383 Ga0207707_10140044
1384 Ga0207707_10415062
1385 Ga0207707_11369761
1386 Ga0207695_10002639
1387 Ga0207695_10093049
1388 Ga0207695_10854057
1389 Ga0207671_10009929
1390 Ga0207671_10040729
1391 Ga0207671_10350351
1392 Ga0207671_10518901
1393 Ga0207693_10028857
1394 Ga0207693_10700829
1395 Ga0207693_10774480
1396 Ga0207693_10812089
1397 Ga0207693_11150847
1398 Ga0207663_10714966
1399 Ga0207663_10844554
1400 Ga0207663_11307580
1401 Ga0207660_10428855
1402 Ga0207662_10008440
1403 Ga0207657_10069879
1404 Ga0207657_10369127
1405 Ga0207652_10634672
1406 Ga0207652_10717213
1407 Ga0207652_11038051
1408 Ga0207646_11137716
1409 Ga0207681_11484514
1410 Ga0207694_10093608
1411 Ga0207694_11534699
1412 Ga0207650_10111147
1413 Ga0207650_10724462
1414 Ga0207650_11319483
1415 Ga0207650_11667424
1416 Ga0207659_10005643
1417 Ga0207659_10223900
1418 Ga0207687_10575493
1419 Ga0207700_10101999
1420 Ga0207700_11185143
1421 Ga0207664_10053289
1422 Ga0207664_10483795
1423 Ga0207690_10159894
1424 Ga0207690_10327312
1425 Ga0207706_10021143
1426 Ga0207686_10440990
1427 Ga0207709_10010725
1428 Ga0207709_10078963
1429 Ga0207709_11126449
1430 Ga0207670_10676066
1431 Ga0207670_10951483
1432 Ga0207669_10003697
1433 Ga0207669_10148066
1434 Ga0207669_10475102
1435 Ga0207704_10671197
1436 Ga0207665_10007810
1437 Ga0207665_10553274
1438 Ga0207665_10770055
1439 Ga0207691_10005849
1440 Ga0207691_10230875
1441 Ga0207711_10016342
1442 Ga0207711_10039002
1443 Ga0207711_10285103
1444 Ga0207711_10343347
1445 Ga0207711_11564053
1446 Ga0207711_11668345
1447 Ga0207689_10154641
1448 Ga0207689_10227389
1449 Ga0207689_10311764
1450 Ga0207689_10387293
1451 Ga0207689_10419069
1452 Ga0207661_10041437
1453 Ga0207661_10153674
1454 Ga0207661_11383961
1455 Ga0207661_11612703
1456 Ga0207679_10169180
1457 Ga0207679_10231685
1458 Ga0207679_10678096
1459 Ga0207679_12148693
1460 Ga0207667_10033770
1461 Ga0207667_10114403
1462 Ga0207667_10127358
1463 Ga0207667_10178187
1464 Ga0207667_10776657
1465 Ga0207651_10034089
1466 Ga0207651_10354810
1467 Ga0207651_10411313
1468 Ga0207712_10023969
1469 Ga0207712_10106993
1470 Ga0207712_10375541
1471 Ga0207712_11575303
1472 Ga0207640_11413943
1473 Ga0207658_10111594
1474 Ga0207658_10155195
1475 Ga0207677_10182388
1476 Ga0207703_10033858
1477 Ga0207703_10139863
1478 Ga0207639_10006836
1479 Ga0207639_10549652
1480 Ga0207639_10732528
1481 Ga0207678_10210150
1482 Ga0207708_10001957
1483 Ga0207702_10035794
1484 Ga0207702_10215281
1485 Ga0207702_10242608
1486 Ga0207702_10541642
1487 Ga0207702_10659870
1488 Ga0207702_10867828
1489 Ga0207702_11756863
1490 Ga0207641_10032489
1491 Ga0207641_10085799
1492 Ga0207641_10127022
1493 Ga0207641_11606145
1494 Ga0207641_12178475
1495 Ga0207648_10071237
1496 Ga0207648_10649160
1497 Ga0207676_10733475
1498 Ga0207676_11568817
1499 Ga0207674_10050092
1500 Ga0207674_10130313
1501 Ga0207674_10225897
1502 Ga0207674_10710934
1503 Ga0207675_100340784
1504 Ga0207675_100512056
1505 Ga0207675_101138796
1506 Ga0207683_11241543
1507 Ga0207683_12096858
1508 Ga0207698_10142754
1509 Ga0207698_10366701
1510 Ga0207698_11924620
1511 Ga0209981_1046288
1512 Ga0209588_1017898
1513 Ga0209588_1041201
1514 Ga0209588_1076234
1515 Ga0209966_1031370
1516 Ga0209998_10045355
1517 Ga0209813_10033409
1518 Ga0209813_10037949
1519 Ga0209813_10095295
1520 Ga0209813_10102129
1521 Ga0209974_10086927
1522 Ga0209974_10253281
1523 Ga0207428_10031661
1524 Ga0265357_1022456
1525 Ga0268266_10100166
1526 Ga0268266_10326691
1527 Ga0268266_10327778
1528 Ga0268266_10568124
1529 Ga0268266_10629365
1530 Ga0268266_10869182
1531 Ga0268266_11333847
1532 Ga0268266_11408835
1533 Ga0268265_10046339
1534 Ga0268265_11724808
1535 Ga0268264_10072965
1536 Ga0268264_10501694
1537 Ga0268264_11567986
1538 Ga0265338_10588571
1539 Ga0265770_1032367
1540 Ga0265328_10034603
1541 Ga0265325_10211568
1542 Ga0265339_10000799
1543 Ga0265327_10231069
1544 Ga0265316_10011395
1545 Ga0265316_10089431
1546 Ga0265314_10008447
1547 Ga0265342_10089185
1548 Ga0265342_10715670
1549 Ga0307405_10459966
1550 Ga0307413_10572297
1551 Ga0307410_11526666
1552 Ga0307407_10276644
1553 Ga0307407_10356111
1554 Ga0307409_100488783
1555 Ga0307416_100181685
1556 Ga0307416_100200194
1557 Ga0307416_101666129
1558 Ga0307416_101807093
1559 Ga0307411_10097589
1560 Ga0307415_101003029
1561 Ga0373926_0002737
1562 Ga0373926_0301540
1563 Ga0373926_0397682
1564 Ga0373934_0311117
1565 Ga0373944_0333434
1566 Ga0373944_0436083
1567 Ga0373949_0228359
1568 Ga0373923_0001065
1569 Ga0373923_0425827
1570 Ga0373923_0672590
1571 Ga0373945_0002156
1572 Ga0373946_0047283
1573 Ga0373962_0093140
1574 Ga0373924_0010056
1575 Ga0373931_0349151
1576 Ga0373935_0004904
1577 Ga0373935_0023860
1578 Ga0373935_1241977
1579 Ga0373927_0032397
1580 Ga0373927_0117760
1581 Ga0373927_0289720
1582 Ga0373933_0322016
1583 Ga0373947_0301092
1584 Ga0373947_0423867
1585 Ga0373937_0138920
1586 Ga0373937_2036543
1587 Ga0373925_0020170
1588 Ga0373925_0025584
1589 Ga0373925_0062558
1590 Ga0373925_0156347
1591 Ga0373925_0253289
1592 Ga0373925_0784092
1593 Ga0395900_1422033
1594 Ga0395900_1604579
1595 Ga0436364_0011168
1596 Ga0436364_0292186
1597 Ga0395901_0834350
1598 Ga0436365_0192005
1599 Ga0436365_0364484
1600 Ga0436365_1482532
1601 Ga0436363_0679652
1602 Ga0439461_0041567
1603 Ga0451793_1061829
1604 Ga0451802_0514694
1605 Ga0451804_0836850
1606 Ga0451807_2677791
1607 Ga0451835_1066438
1608 Ga0451837_1816888
1609 Ga0451849_1285460
1610 Ga0451853_3825130
1611 Ga0439431_0007685
1612 Ga0439433_0149630
1613 Ga0439445_0022379
1614 Ga0439448_0123817
1615 Ga0439448_0349072
1616 Ga0439456_087054
1617 Ga0439462_0245493
1618 Ga0450920_057499
1619 Ga0450923_024079
1620 Ga0450896_056325
1621 Ga0450900_008954
1622 Ga0439446_0070651
1623 Ga0439446_0104045
1624 Ga0439434_0012676
1625 Ga0439435_0031108
1626 Ga0439444_0024636
1627 Ga0451577_0866738
1628 Ga0466965_0882289
1629 Ga0466963_0105926
1630 Ga0466963_0186443
1631 Ga0466963_0750730
1632 Ga0466957_0110326
1633 Ga0466957_1274244
1634 Ga0466960_0065225
1635 Ga0466959_0520080
1636 Ga0466959_0639086
1637 Ga0466958_0773779
1638 Ga0466967_0141142
1639 Ga0466967_1093976
1640 Ga0466967_2024265
1641 Ga0495629_0720638
1642 Ga0495629_0937494
1643 Ga0495651_0110445
1644 Ga0495651_0320777
1645 Ga0495651_0985880
1646 Ga0495651_0993223
1647 Ga0495653_0048953
1648 Ga0495580_0003125
1649 Ga0495580_0240460
1650 Ga0495580_0429509
1651 Ga0495582_0205508
1652 Ga0495582_0433268
1653 Ga0495664_0585213
1654 Ga0495664_0637571
1655 Ga0495664_0671983
1656 Ga0495594_0655778
1657 Ga0495608_0170641
1658 Ga0495608_0333378
1659 Ga0495628_0119499
1660 Ga0495628_0120031
1661 Ga0495628_1246106
1662 Ga0495630_0053540
1663 Ga0495630_0715809
1664 Ga0495663_0381737
1665 Ga0495666_0429481
1666 Ga0495652_0254604
1667 Ga0495652_0489495
1668 Ga0495652_1117613
1669 Ga0495665_0053680
1670 Ga0495665_0097091
1671 Ga0495665_0439319
1672 Ga0495640_0557207
1673 Ga0495586_0359421
1674 Ga0495587_0751339
1675 Ga0495598_0078711
1676 Ga0495645_0103518
1677 Ga0495633_0061096
1678 Ga0495633_0144281
1679 Ga0495667_0270357
1680 Ga0495656_0056014
1681 Ga0495634_0196839
1682 Ga0495634_0729663
1683 Ga0495635_0043167
1684 Ga0495635_0343788
1685 Ga0495635_0432457
1686 Ga0495635_0666689
1687 Ga0495659_0054117
1688 Ga0495599_0279552
1689 Ga0495599_0744750
1690 Ga0495623_0211380
1691 Ga0495646_0375500
1692 Ga0495658_0440113
1693 Ga0495658_0663334
1694 Ga0495658_1085113
1695 Ga0495669_0362444
1696 Ga0495613_0258345
1697 Ga0495613_0757645
1698 Ga0495613_1078397
1699 Ga0495670_0086104
1700 Ga0495670_0843901
1701 Ga0495600_0142326
1702 Ga0495581_0455349
1703 Ga0495581_0796553
1704 Ga0495604_0338937
1705 Ga0495604_0485600
1706 Ga0495674_0023516
1707 Ga0495674_0084565
1708 Ga0495674_0440699
1709 Ga0495674_0496643
1710 Ga0495674_0653218
1711 Ga0495674_0802501
1712 Ga0495675_0075670
1713 Ga0495677_0263280
1714 Ga0495684_0007683
1715 Ga0495684_0045666
1716 Ga0495684_0509761
1717 Ga0495684_0692522
1718 Ga0495593_0268331
1719 Ga0495602_0386243
1720 Ga0495602_0877674
1721 Ga0496102_1133857
1722 Ga0496103_0188587
1723 Ga0496104_0241180
1724 Ga0496105_0147557
1725 Ga0496105_0660791
1726 Ga0496105_0986288
1727 Ga0496107_0311918
1728 Ga0496107_1317243
1729 Ga0496109_0000029
1730 Ga0496110_1245055
1731 Ga0496112_0090209
1732 Ga0496112_0097964
1733 Ga0496112_0404975
1734 Ga0496112_0563499
1735 Ga0496112_1469779
1736 Ga0496113_0016830
1737 Ga0496113_0264096
1738 Ga0496113_0456590
1739 Ga0496113_0550061
1740 Ga0496115_0467382
1741 Ga0501033_0355527
1742 Ga0501033_0420425
1743 Ga0501034_0004512
1744 Ga0501034_0036561
1745 Ga0501034_1718114
1746 Ga0501036_0642151
1747 Ga0501040_0095848
1748 Ga0501040_0660511
1749 Ga0501040_1373641
1750 Ga0501042_0734248
1751 Ga0501043_0106051
1752 Ga0501046_0316429
1753 Ga0501047_0014774
1754 Ga0501047_0736987
1755 Ga0501048_0016155
1756 Ga0501048_0201139
1757 Ga0501067_0038877
1758 Ga0501069_0103568
1759 Ga0501070_0049375
1760 Ga0501071_0100267
1761 Ga0501072_0222755
1762 Ga0501073_0399136
1763 Ga0501075_0202697
1764 Ga0501075_0209707
1765 Ga0501075_0562242
1766 Ga0501076_0015648
1767 Ga0501076_1259577
1768 Ga0501077_0758601
1769 Ga0501206_075728
1770 Ga0501079_0155646
1771 Ga0501079_0621628
1772 Ga0501079_1112216
1773 Ga0501080_0136269
1774 Ga0501080_0406250
1775 Ga0501083_0000176
1776 Ga0501083_0213229
1777 Ga0501083_0626515
1778 Ga0501265_041854
1779 Ga0501035_0004937
1780 Ga0501035_0212618
1781 Ga0501035_0862624
1782 Ga0501044_0108956
1783 Ga0501045_0268990
1784 Ga0501045_0307145
1785 Ga0501045_0598872
1786 Ga0501045_0860739
1787 Ga0501045_0973538
1788 nmdc:mga03n38_141217_c1
1789 nmdc:mga03n38_155322_c1
1790 nmdc:mga00v17_232084_c1
1791 nmdc:mga00v17_35173_c1
1792 nmdc:mga00v17_427696_c1
1793 nmdc:mga00v17_6367_c1
1794 nmdc:mga00v17_64876_c1
1795 nmdc:mga00v17_8235_c1
1796 nmdc:mga0yw44_31582_c1
1797 nmdc:mga0k408_102986_c1
1798 nmdc:mga0k408_18772_c1
1799 nmdc:mga0k408_222154_c1
1800 nmdc:mga0k408_383063_c1
1801 nmdc:mga0k408_6295_c1
1802 nmdc:mga06z11_210415_c1
1803 nmdc:mga06z11_316930_c1
1804 nmdc:mga06z11_865696_c1
1805 nmdc:mga06z11_97277_c1
1806 nmdc:mga06z11_982072_c1
1807 nmdc:mga04h51_110242_c1
1808 nmdc:mga04h51_45387_c1
1809 nmdc:mga04h51_75998_c1
1810 nmdc:mga04h51_80027_c1
1811 nmdc:mga07m45_21273_c1
1812 nmdc:mga07m45_6433_c1
1813 nmdc:mga07m45_7105_c1
1814 nmdc:mga07m45_88934_c1
1815 nmdc:mga07m45_9204_c1
1816 nmdc:mga05p37_1127174_c1
1817 nmdc:mga05p37_1768244_c1
1818 nmdc:mga05p37_17826_c1
1819 nmdc:mga05p37_345269_c1
1820 nmdc:mga05p37_54761_c1
1821 nmdc:mga05p37_566040_c1
1822 nmdc:mga05p37_7651_c1
1823 nmdc:mga09592_1031405_c1
1824 nmdc:mga0qj67_1178963_c1
1825 nmdc:mga0qj67_762971_c1
1826 nmdc:mga06r32_107528_c1
1827 nmdc:mga06r32_1139642_c1
1828 nmdc:mga06r32_1173492_c1
1829 nmdc:mga06r32_131676_c1
1830 nmdc:mga06r32_194049_c1
1831 nmdc:mga06r32_35620_c1
1832 nmdc:mga06r32_387623_c1
1833 nmdc:mga06r32_670392_c1
1834 nmdc:mga06r32_778132_c1
1835 nmdc:mga08y16_1505406_c1
1836 nmdc:mga08y16_1929942_c1
1837 nmdc:mga08y16_435461_c1
1838 nmdc:mga08y16_6052_c1
1839 nmdc:mga08y16_606326_c1
1840 nmdc:mga08y16_778488_c1
1841 nmdc:mga0n895_1648284_c1
1842 nmdc:mga0n895_30208_c1
1843 nmdc:mga0n895_384620_c1
1844 nmdc:mga0n895_466660_c1
1845 nmdc:mga0n895_734774_c1
1846 nmdc:mga0rr50_1468126_c1
1847 nmdc:mga0rr50_29939_c1
1848 nmdc:mga0rr50_780551_c1
1849 nmdc:mga08x19_352370_c1
1850 nmdc:mga08x19_354758_c1
1851 nmdc:mga0a205_16161_c1
1852 nmdc:mga0a205_4096_c1
1853 nmdc:mga0a205_427155_c1
1854 nmdc:mga0a205_611602_c1
1855 nmdc:mga0a205_805851_c1
1856 nmdc:mga0sz30_42221_c1
1857 Ga0495655_0354498
1858 Ga0495619_0664290
1859 Ga0500555_020268
1860 Ga0500555_073000
1861 Ga0500555_084740
1862 Ga0500562_083010
1863 Ga0500592_090881
1864 Ga0500645_000233
1865 Ga0501084_0090610
1866 Ga0501084_0165943
1867 Ga0501084_0583307
1868 Ga0590075_062371
1869 Ga0501082_0010848
1870 Ga0501082_0372912
1871 Ga0501082_0821849
1872 Ga0501082_1596181
1873 Ga0466962_0281964
1874 Ga0530510_0123246

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

35

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9163 4 105
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.906 5 104
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9034 1 107
7cbv-assembly1.cif.gz_A-3 crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32) 0.9009 12 90
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8976 5 104
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9012 10 108 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8976 5 104 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8826 12 92 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8792 12 90 1.10.10.10
af_Q57738_133_209_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8778 12 96 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0S7Z938-F1-model_v4 PadR family transcriptional regulator 0.9999 6 113
AF-A0A7G8BQN0-F1-model_v4 PadR family transcriptional regulator 0.9925 15 113
AF-A0A143PJ72-F1-model_v4 Lineage-specific thermal regulator protein 0.9885 4 113
AF-A0A1G6WVS3-F1-model_v4 Transcriptional regulator, PadR family 0.9861 7 113
AF-A0A2T4VRD1-F1-model_v4 PadR family transcriptional regulator 0.9861 7 109

Map