F486169

General Info

Members Datasets Scaffolds Average Seq Length
935 360 919 147

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0007199|Ga0495653_0007199_836_1351
Length 171
Sequence LWRFLSLANTKRWRQNACLSGKQTVNMAKKLLLLNGPNLNLLGTREPAVYGATTLADIENAAVAQAQAAGATLACFQSNHEGALIDRIHAARQEGVNAIVINPGGLTHTSVALRDALAGVDIPFVEVHISNIYKREEFRHHSFLSAIAQGTICGLGADGYRFAIDFALKQR

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543030 Massilia sp. GV097 Isolate Unclassified
11 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
12 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
13 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
14 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
15 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
16 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
28 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
162 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
178 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
179 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
203 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
305 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
306 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
320 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
321 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
322 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
325 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
334 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
335 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
338 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
339 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
340 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
360 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.9
Metatranscriptomes 4.39
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 0.11
Rhizoplane 3.96
Rhizosphere 84.81
Stem 0
Stem Tuber 0
Unclassified 4.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001655 3300002739 Bacteria 3836
2 JGI25157J39369_1017589 3300002741 Bacteria 866
3 JGI25152J39213_1000245 3300002773 Bacteria 36283
4 JGI25150J39212_1028710 3300002774 Bacteria 786
5 JGI25159J45721_1005640 3300002987 Bacteria 3896
6 JGI25159J45721_1012666 3300002987 Bacteria 1998
7 Ga0006759J45824_1068122 3300003163 Bacteria 1302
8 JGI25153J46596_10001778 3300003215 Bacteria 12789
9 rootH2_10032765 3300003320 Bacteria 31514
10 rootL2_10002967 3300003322 Bacteria 10018
11 rootL2_10002968 3300003322 Bacteria 4025
12 rootH1_10071921 3300003323 Bacteria 4391
13 JGI25160J50197_1003487 3300003354 Bacteria 7022
14 JGI25161J50226_1003103 3300003374 Bacteria 3958
15 Ga0007409J51694_1013231 3300003575 Bacteria 3960
16 Ga0032354_1046455 3300003693 Bacteria 2324
17 Ga0055526_1000556 3300003771 Bacteria 29488
18 Ga0055526_1024738 3300003771 Bacteria 1951
19 Ga0055537_1000056 3300003773 Bacteria 81623
20 Ga0055524_1003233 3300003775 Bacteria 7979
21 Ga0055534_1000178 3300003784 Bacteria 46872
22 Ga0055534_1009222 3300003784 Bacteria 2162
23 Ga0055528_1000297 3300003790 Bacteria 42261
24 Ga0055528_1003822 3300003790 Bacteria 7410
25 Ga0055530_10013759 3300003791 Bacteria 2741
26 Ga0055531_10012000 3300003794 Bacteria 4115
27 Ga0055543_1001330 3300004625 Bacteria 10091
28 Ga0065165_1000447 3300005262 Bacteria 64800
29 Ga0065165_1000986 3300005262 Bacteria 35247
30 Ga0065165_1041456 3300005262 Bacteria 1367
31 Ga0065714_10008115 3300005288 Bacteria 3585
32 Ga0070658_10245369 3300005327 Bacteria 1519
33 Ga0070658_11467976 3300005327 Bacteria 591
34 Ga0070683_100045537 3300005329 Bacteria 4049
35 Ga0070683_100371247 3300005329 Bacteria 1363
36 Ga0070690_100327819 3300005330 Bacteria 1105
37 Ga0068869_100000016 3300005334 Bacteria 70440
38 Ga0068869_100126435 3300005334 Bacteria 1960
39 Ga0068868_100064487 3300005338 Bacteria 2908
40 Ga0068868_100076914 3300005338 Bacteria 2669
41 Ga0070660_100020896 3300005339 Bacteria 4819
42 Ga0070660_100665185 3300005339 Bacteria 872
43 Ga0070659_100213325 3300005366 Bacteria 1591
44 Ga0070659_101418986 3300005366 Bacteria 617
45 Ga0070663_100285892 3300005455 Bacteria 1316
46 Ga0070678_100787963 3300005456 Bacteria 862
47 Ga0070662_100047427 3300005457 Bacteria 3090
48 Ga0070662_100287705 3300005457 Bacteria 1331
49 Ga0070662_100922971 3300005457 Bacteria 746
50 Ga0068867_100000872 3300005459 Bacteria 20351
51 Ga0070679_100033921 3300005530 Bacteria 5056
52 Ga0070679_100131647 3300005530 Bacteria 2482
53 Ga0070665_100496715 3300005548 Bacteria 1231
54 Ga0068855_100001020 3300005563 Bacteria 34917
55 Ga0068855_100014744 3300005563 Bacteria 9416
56 Ga0068855_100103246 3300005563 Bacteria 3280
57 Ga0070664_100034159 3300005564 Bacteria 4266
58 Ga0070664_100222706 3300005564 Bacteria 1688
59 Ga0068856_100001534 3300005614 Bacteria 24189
60 Ga0068856_100372840 3300005614 Bacteria 1446
61 Ga0068859_102045715 3300005617 Bacteria 632
62 Ga0068862_100596410 3300005844 Bacteria 1060
63 Ga0081538_10001906 3300005981 Bacteria 20950
64 Ga0097621_100206978 3300006237 Bacteria 1705
65 Ga0068871_100005339 3300006358 Bacteria 9008
66 Ga0068871_100566446 3300006358 Bacteria 1030
67 Ga0075433_10000299 3300006852 Bacteria 29738
68 Ga0075433_10011819 3300006852 Bacteria 7031
69 Ga0075434_100059706 3300006871 Bacteria 3791
70 Ga0068865_100019070 3300006881 Bacteria 4436
71 Ga0068865_100813314 3300006881 Bacteria 807
72 Ga0075436_100008751 3300006914 Bacteria 6924
73 Ga0097620_102045415 3300006931 Bacteria 632
74 Ga0075435_100199384 3300007076 Bacteria 1696
75 Ga0105240_10240122 3300009093 Bacteria 2101
76 Ga0105240_10345191 3300009093 Bacteria 1690
77 Ga0105245_10031045 3300009098 Bacteria 4726
78 Ga0105243_10008313 3300009148 Bacteria 7972
79 Ga0105241_10151149 3300009174 Bacteria 1900
80 Ga0105242_10033488 3300009176 Bacteria 4113
81 Ga0105242_10255942 3300009176 Bacteria 1579
82 Ga0105237_10223903 3300009545 Bacteria 1881
83 Ga0105238_10242950 3300009551 Bacteria 1778
84 Ga0105239_10009203 3300010375 Eukaryota 11170
85 Ga0157373_10000208 3300013100 Bacteria 48082
86 Ga0157373_10105984 3300013100 Bacteria 1977
87 Ga0157373_10342570 3300013100 Bacteria 1065
88 Ga0157371_10407012 3300013102 Bacteria 996
89 Ga0157370_10245395 3300013104 Bacteria 1657
90 Ga0157369_10285537 3300013105 Bacteria 1718
91 Ga0157378_10189454 3300013297 Bacteria 1939
92 Ga0157372_10001960 3300013307 Bacteria 22372
93 Ga0157372_11062449 3300013307 Bacteria 937
94 Ga0157372_11143060 3300013307 Bacteria 900
95 Ga0157377_10091734 3300014745 Bacteria 1795
96 Ga0182006_1044792 3300015261 Bacteria 1724
97 Ga0209436_100508 3300025208 Bacteria 17011
98 Ga0209436_100526 3300025208 Bacteria 16661
99 Ga0209563_100015 3300025230 Bacteria 879901
100 Ga0207425_1000006 3300025245 Bacteria 808854
101 Ga0207425_1000310 3300025245 Bacteria 35129
102 Ga0209026_1001421 3300025250 Bacteria 10631
103 Ga0209677_103454 3300025253 Bacteria 5121
104 Ga0209148_1000607 3300025254 Bacteria 32105
105 Ga0209129_1000009 3300025258 Bacteria 633100
106 Ga0209129_1005452 3300025258 Bacteria 4488
107 Ga0209565_1000006 3300025263 Bacteria 897294
108 Ga0209565_1001590 3300025263 Bacteria 9665
109 Ga0209565_1010430 3300025263 Bacteria 2304
110 Ga0209673_1000004 3300025273 Bacteria 896155
111 Ga0209673_1007274 3300025273 Bacteria 5141
112 Ga0209130_1000437 3300025284 Bacteria 44427
113 Ga0209130_1001628 3300025284 Bacteria 13839
114 Ga0209675_1000006 3300025291 Bacteria 732267
115 Ga0209675_1000890 3300025291 Bacteria 19177
116 Ga0209564_1000085 3300025295 Bacteria 251509
117 Ga0209564_1000146 3300025295 Bacteria 174811
118 Ga0209564_1003895 3300025295 Bacteria 9588
119 Ga0209758_1000047 3300025297 Bacteria 360971
120 Ga0209050_1000064 3300025298 Bacteria 314803
121 Ga0209050_1011525 3300025298 Bacteria 4174
122 Ga0209050_1011744 3300025298 Bacteria 4109
123 Ga0209256_1000179 3300025299 Bacteria 123865
124 Ga0209256_1000428 3300025299 Bacteria 66020
125 Ga0209256_1003975 3300025299 Bacteria 9712
126 Ga0209256_1071941 3300025299 Bacteria 775
127 Ga0207426_1002247 3300025302 Bacteria 12823
128 Ga0207426_1003558 3300025302 Bacteria 8300
129 Ga0209257_1000010 3300025304 Bacteria 1158682
130 Ga0209257_1001902 3300025304 Bacteria 22569
131 Ga0209257_1021334 3300025304 Bacteria 2356
132 Ga0207705_10044713 3300025909 Bacteria 3182
133 Ga0207705_10298809 3300025909 Bacteria 1235
134 Ga0207705_10759528 3300025909 Bacteria 753
135 Ga0207654_10001695 3300025911 Bacteria 11514
136 Ga0207671_10138785 3300025914 Eukaryota 1871
137 Ga0207671_10190862 3300025914 Bacteria 1598
138 Ga0207657_10594267 3300025919 Bacteria 864
139 Ga0207649_10009884 3300025920 Bacteria 5229
140 Ga0207649_11117299 3300025920 Bacteria 622
141 Ga0207652_10668107 3300025921 Bacteria 928
142 Ga0207687_10376025 3300025927 Bacteria 1163
143 Ga0207690_10125276 3300025932 Bacteria 1872
144 Ga0207706_10138620 3300025933 Bacteria 2140
145 Ga0207706_10298538 3300025933 Bacteria 1404
146 Ga0207706_10922525 3300025933 Bacteria 737
147 Ga0207686_10147464 3300025934 Bacteria 1634
148 Ga0207709_10010217 3300025935 Bacteria 5170
149 Ga0207704_10004481 3300025938 Bacteria 6383
150 Ga0207704_10607087 3300025938 Bacteria 896
151 Ga0207689_10000241 3300025942 Bacteria 48763
152 Ga0207661_10007731 3300025944 Bacteria 7652
153 Ga0207679_10928085 3300025945 Bacteria 797
154 Ga0207679_11085444 3300025945 Bacteria 734
155 Ga0207667_10000896 3300025949 Bacteria 37967
156 Ga0207667_10019827 3300025949 Bacteria 7495
157 Ga0207667_10531939 3300025949 Bacteria 1190
158 Ga0207667_11124227 3300025949 Eukaryota 768
159 Ga0207677_10045655 3300026023 Bacteria 2927
160 Ga0207639_10554611 3300026041 Bacteria 1055
161 Ga0207678_10061347 3300026067 Bacteria 3234
162 Ga0207702_10001475 3300026078 Bacteria 23342
163 Ga0207702_10723972 3300026078 Bacteria 981
164 Ga0207648_10000756 3300026089 Bacteria 36333
165 Ga0207648_10130406 3300026089 Bacteria 2213
166 Ga0207674_10082515 3300026116 Bacteria 3216
167 Ga0207674_11645664 3300026116 Bacteria 610
168 Ga0207683_10681471 3300026121 Bacteria 953
169 Ga0207698_10150254 3300026142 Bacteria 2020
170 Ga0268266_10484789 3300028379 Bacteria 1179
171 Ga0265337_1006922 3300028556 Bacteria 4304
172 Ga0265337_1007423 3300028556 Bacteria 4103
173 Ga0265337_1021153 3300028556 Bacteria 2031
174 Ga0265337_1131577 3300028556 Bacteria 678
175 Ga0265319_1001015 3300028563 Bacteria 17546
176 Ga0265319_1002638 3300028563 Bacteria 9648
177 Ga0265319_1010821 3300028563 Bacteria 3780
178 Ga0265319_1014782 3300028563 Bacteria 3048
179 Ga0265319_1016186 3300028563 Bacteria 2864
180 Ga0265319_1016890 3300028563 Bacteria 2791
181 Ga0265319_1043748 3300028563 Bacteria 1502
182 Ga0265334_10023332 3300028573 Bacteria 2516
183 Ga0265318_10001407 3300028577 Bacteria 14218
184 Ga0265318_10007120 3300028577 Bacteria 5086
185 Ga0265318_10008469 3300028577 Bacteria 4576
186 Ga0265318_10042058 3300028577 Bacteria 1734
187 Ga0265318_10345107 3300028577 Bacteria 543
188 Ga0265323_10000069 3300028653 Bacteria 56761
189 Ga0265323_10070875 3300028653 Bacteria 1192
190 Ga0265322_10000305 3300028654 Bacteria 20763
191 Ga0265322_10115042 3300028654 Bacteria 766
192 Ga0265322_10153083 3300028654 Bacteria 659
193 Ga0265336_10010984 3300028666 Bacteria 3085
194 Ga0265338_10000329 3300028800 Bacteria 86337
195 Ga0265338_10020776 3300028800 Bacteria 6886
196 Ga0265338_10072963 3300028800 Bacteria 2928
197 Ga0265338_10075568 3300028800 Bacteria 2858
198 Ga0265338_10455523 3300028800 Bacteria 905
199 Ga0265338_10732948 3300028800 Bacteria 680
200 Ga0265324_10003662 3300029957 Bacteria 7211
201 Ga0265324_10017110 3300029957 Bacteria 2638
202 Ga0265324_10063104 3300029957 Bacteria 1265
203 Ga0316182_1277600 3300030745 Bacteria 1057
204 Ga0265330_10095838 3300031235 Bacteria 1272
205 Ga0265330_10109542 3300031235 Unclassified 1180
206 Ga0265332_10049693 3300031238 Bacteria 1803
207 Ga0265328_10055459 3300031239 Bacteria 1454
208 Ga0265320_10000515 3300031240 Bacteria 29979
209 Ga0265320_10000735 3300031240 Bacteria 25059
210 Ga0265320_10001485 3300031240 Bacteria 17124
211 Ga0265320_10002038 3300031240 Bacteria 14226
212 Ga0265320_10017525 3300031240 Bacteria 3973
213 Ga0265320_10022073 3300031240 Bacteria 3412
214 Ga0265320_10030912 3300031240 Bacteria 2755
215 Ga0265325_10024461 3300031241 Bacteria 3286
216 Ga0265340_10014689 3300031247 Bacteria 4084
217 Ga0265339_10051665 3300031249 Bacteria 2242
218 Ga0265339_10061599 3300031249 Bacteria 2019
219 Ga0265331_10042698 3300031250 Bacteria 2199
220 Ga0265331_10043625 3300031250 Bacteria 2171
221 Ga0265327_10019749 3300031251 Bacteria 4131
222 Ga0265327_10066161 3300031251 Bacteria 1825
223 Ga0265316_10002099 3300031344 Bacteria 20962
224 Ga0265316_10037727 3300031344 Bacteria 3898
225 Ga0265316_10106340 3300031344 Bacteria 2128
226 Ga0265316_10150493 3300031344 Bacteria 1743
227 Ga0265316_10223063 3300031344 Bacteria 1390
228 Ga0265316_10320357 3300031344 Bacteria 1126
229 Ga0265316_10338292 3300031344 Bacteria 1091
230 Ga0265316_10858917 3300031344 Bacteria 635
231 Ga0307408_100000032 3300031548 Bacteria 213693
232 Ga0307408_100000311 3300031548 Bacteria 46654
233 Ga0265313_10000228 3300031595 Bacteria 60668
234 Ga0265313_10001658 3300031595 Bacteria 20635
235 Ga0265313_10046645 3300031595 Bacteria 2102
236 Ga0265313_10208918 3300031595 Bacteria 809
237 Ga0265314_10011755 3300031711 Bacteria 7200
238 Ga0265314_10051519 3300031711 Bacteria 2867
239 Ga0265314_10309112 3300031711 Bacteria 884
240 Ga0265342_10007378 3300031712 Bacteria 8060
241 Ga0265342_10060029 3300031712 Bacteria 2244
242 Ga0265342_10068863 3300031712 Bacteria 2067
243 Ga0265342_10129365 3300031712 Bacteria 1416
244 Ga0265342_10470035 3300031712 Bacteria 644
245 Ga0307410_10000013 3300031852 Bacteria 76345
246 Ga0307412_10577980 3300031911 Bacteria 948
247 Ga0307412_11407111 3300031911 Bacteria 631
248 Ga0307409_100000031 3300031995 Bacteria 48910
249 Ga0307416_100000038 3300032002 Bacteria 136704
250 Ga0307416_100014397 3300032002 Bacteria 5419
251 Ga0307414_10230779 3300032004 Bacteria 1526
252 Ga0373934_0078195 3300035086 Bacteria 1327
253 Ga0373940_0031344 3300035088 Bacteria 1419
254 Ga0373951_0016056 3300035091 Bacteria 1688
255 Ga0373931_0838126 3300035691 Bacteria 615
256 Ga0373935_0141726 3300035692 Bacteria 1624
257 Ga0373935_0223992 3300035692 Bacteria 1307
258 Ga0373933_0168616 3300035724 Bacteria 1393
259 Ga0373933_0349542 3300035724 Bacteria 960
260 Ga0373937_0076142 3300036401 Bacteria 3099
261 Ga0373937_1257363 3300036401 Bacteria 688
262 Ga0372808_008597 3300036459 Eukaryota 1417
263 Ga0310109_033945 3300036534 Eukaryota 671
264 Ga0316584_0560662 3300036712 Unclassified 796
265 Ga0395899_0096515 3300037312 Bacteria 2137
266 Ga0395899_0149134 3300037312 Bacteria 1658
267 Ga0395900_0000337 3300037418 Bacteria 69150
268 Ga0395900_0010583 3300037418 Bacteria 9432
269 Ga0395900_0017217 3300037418 Bacteria 7375
270 Ga0395900_0069541 3300037418 Bacteria 3618
271 Ga0395900_0267218 3300037418 Bacteria 1706
272 Ga0395898_0064271 3300037466 Bacteria 3559
273 Ga0395898_0090383 3300037466 Bacteria 2946
274 Ga0395898_0287456 3300037466 Bacteria 1568
275 Ga0395898_1070564 3300037466 Bacteria 740
276 Ga0395905_0000015 3300037471 Bacteria 393880
277 Ga0395905_0095396 3300037471 Bacteria 2791
278 Ga0395905_0190391 3300037471 Bacteria 1924
279 Ga0395905_0470630 3300037471 Bacteria 1155
280 Ga0395905_0511133 3300037471 Bacteria 1101
281 Ga0395905_0659801 3300037471 Bacteria 948
282 Ga0395905_0797259 3300037471 Bacteria 847
283 Ga0395905_0986346 3300037471 Bacteria 745
284 Ga0395901_0000597 3300038443 Bacteria 42057
285 Ga0395901_0094595 3300038443 Bacteria 3130
286 Ga0395901_0146485 3300038443 Bacteria 2481
287 Ga0395901_0195581 3300038443 Bacteria 2120
288 Ga0395901_0278048 3300038443 Bacteria 1740
289 Ga0395901_0710847 3300038443 Bacteria 1001
290 Ga0395901_1081144 3300038443 Bacteria 773
291 Ga0451793_1527940 3300041452 Bacteria 694
292 Ga0451800_0000795 3300041459 Unclassified 746
293 Ga0451837_1317882 3300041494 Unclassified 779
294 Ga0439431_0042404 3300041997 Bacteria 1162
295 Ga0439448_0000340 3300042005 Bacteria 10448
296 Ga0439448_0013508 3300042005 Bacteria 2454
297 Ga0439448_0109091 3300042005 Bacteria 944
298 Ga0439448_0120177 3300042005 Bacteria 901
299 Ga0439449_0027146 3300042007 Bacteria 2137
300 Ga0439450_023368 3300042008 Bacteria 1341
301 Ga0439450_042007 3300042008 Bacteria 1064
302 Ga0439450_096966 3300042008 Bacteria 745
303 Ga0439455_0042334 3300042012 Bacteria 1169
304 Ga0450911_017939 3300042115 Bacteria 930
305 Ga0450898_052173 3300042134 Bacteria 792
306 Ga0450903_018547 3300042138 Bacteria 1083
307 Ga0439458_0004623 3300042157 Bacteria 3143
308 Ga0451577_0035000 3300042876 Bacteria 4525
309 Ga0451577_0232719 3300042876 Bacteria 1667
310 Ga0451577_0790539 3300042876 Bacteria 857
311 Ga0451577_0957872 3300042876 Bacteria 769
312 Ga0466969_0088195 3300044656 Bacteria 1472
313 Ga0466969_0093180 3300044656 Bacteria 1425
314 Ga0466972_0000412 3300044658 Bacteria 22404
315 Ga0466972_0058334 3300044658 Bacteria 1853
316 Ga0453683_0090229 3300044673 Bacteria 1921
317 Ga0466965_0028296 3300044683 Bacteria 2722
318 Ga0466965_0040500 3300044683 Bacteria 2293
319 Ga0466965_0168049 3300044683 Bacteria 1152
320 Ga0466965_0491350 3300044683 Bacteria 687
321 Ga0466966_0011762 3300044684 Bacteria 5801
322 Ga0466966_0068120 3300044684 Bacteria 2234
323 Ga0466966_0950265 3300044684 Bacteria 518
324 Ga0466961_0363837 3300044693 Bacteria 879
325 Ga0466963_0069023 3300044694 Bacteria 2375
326 Ga0466964_0010802 3300044706 Bacteria 3447
327 Ga0466964_0013498 3300044706 Bacteria 3099
328 Ga0466964_0191850 3300044706 Bacteria 975
329 Ga0453684_0000045 3300044712 Bacteria 582917
330 Ga0453684_0011780 3300044712 Bacteria 14574
331 Ga0453684_0400446 3300044712 Bacteria 1537
332 Ga0453684_1647184 3300044712 Bacteria 657
333 Ga0466971_0042616 3300044719 Bacteria 2039
334 Ga0466971_0311304 3300044719 Bacteria 757
335 Ga0466968_0002554 3300044735 Bacteria 6689
336 Ga0466968_0299089 3300044735 Bacteria 773
337 Ga0466970_0184693 3300044765 Bacteria 1157
338 Ga0466970_0306667 3300044765 Bacteria 896
339 Ga0466970_0314634 3300044765 Bacteria 884
340 Ga0466970_0384332 3300044765 Bacteria 799
341 Ga0466957_0000394 3300044842 Bacteria 21306
342 Ga0466957_0016249 3300044842 Bacteria 4352
343 Ga0466957_0042880 3300044842 Bacteria 2738
344 Ga0466957_0222545 3300044842 Bacteria 1246
345 Ga0466957_0448731 3300044842 Bacteria 888
346 Ga0466957_1184236 3300044842 Bacteria 552
347 Ga0466960_0094536 3300044901 Bacteria 1529
348 Ga0466960_0221664 3300044901 Bacteria 1041
349 Ga0466960_0287208 3300044901 Bacteria 923
350 Ga0466960_0485238 3300044901 Bacteria 722
351 Ga0466960_0521380 3300044901 Bacteria 698
352 Ga0451576_0001454 3300045051 Bacteria 40277
353 Ga0451576_0001488 3300045051 Bacteria 39603
354 Ga0451576_0002783 3300045051 Bacteria 25253
355 Ga0451576_0090052 3300045051 Bacteria 3191
356 Ga0466958_0085192 3300045836 Bacteria 1949
357 Ga0466958_0320888 3300045836 Bacteria 995
358 Ga0466958_0365618 3300045836 Bacteria 929
359 Ga0466958_0833524 3300045836 Bacteria 601
360 Ga0466958_0945408 3300045836 Bacteria 562
361 Ga0466967_0001230 3300045976 Bacteria 14462
362 Ga0466967_0032003 3300045976 Bacteria 4437
363 Ga0466967_0078034 3300045976 Bacteria 2982
364 Ga0466967_0555244 3300045976 Bacteria 1130
365 Ga0495617_000002 3300046452 Bacteria 710121
366 Ga0495627_001427 3300046453 Bacteria 14061
367 Ga0495627_003235 3300046453 Bacteria 7311
368 Ga0495603_0035953 3300046455 Bacteria 2974
369 Ga0495590_0000007 3300046457 Bacteria 331108
370 Ga0495590_0000940 3300046457 Bacteria 12897
371 Ga0495590_0006196 3300046457 Bacteria 4683
372 Ga0495590_0097701 3300046457 Bacteria 1042
373 Ga0495590_0204189 3300046457 Bacteria 727
374 Ga0495590_0260230 3300046457 Bacteria 647
375 Ga0495591_004261 3300046458 Bacteria 7078
376 Ga0495591_014849 3300046458 Bacteria 2778
377 Ga0495638_0012534 3300046460 Bacteria 5805
378 Ga0495638_0431375 3300046460 Bacteria 677
379 Ga0495653_0007199 3300046463 Bacteria 9117
380 Ga0495653_0047254 3300046463 Bacteria 3330
381 Ga0495650_0000969 3300046471 Bacteria 32892
382 Ga0495650_0033047 3300046471 Unclassified 2307
383 Ga0495650_0034752 3300046471 Bacteria 2227
384 Ga0495650_0304105 3300046471 Bacteria 533
385 Ga0495580_0070944 3300046472 Bacteria 2433
386 Ga0495582_0001028 3300046473 Bacteria 15630
387 Ga0495582_0017641 3300046473 Bacteria 3905
388 Ga0495605_0001725 3300046474 Bacteria 14004
389 Ga0495605_0002728 3300046474 Bacteria 10777
390 Ga0495605_0019333 3300046474 Bacteria 3640
391 Ga0495605_0031579 3300046474 Bacteria 2705
392 Ga0495605_0033247 3300046474 Bacteria 2619
393 Ga0495605_0039009 3300046474 Bacteria 2380
394 Ga0495605_0055372 3300046474 Bacteria 1916
395 Ga0495605_0106870 3300046474 Bacteria 1280
396 Ga0495605_0147291 3300046474 Bacteria 1052
397 Ga0495639_0037187 3300046475 Bacteria 2182
398 Ga0495664_0074512 3300046477 Bacteria 2031
399 Ga0495584_0002018 3300046491 Bacteria 11672
400 Ga0495584_0003124 3300046491 Bacteria 9197
401 Ga0495584_0004097 3300046491 Bacteria 7866
402 Ga0495584_0004978 3300046491 Bacteria 7077
403 Ga0495584_0008803 3300046491 Bacteria 5219
404 Ga0495584_0029095 3300046491 Bacteria 2800
405 Ga0495584_0029997 3300046491 Bacteria 2756
406 Ga0495584_0032837 3300046491 Bacteria 2626
407 Ga0495584_0043913 3300046491 Bacteria 2256
408 Ga0495584_0202998 3300046491 Bacteria 1007
409 Ga0495585_0000904 3300046492 Bacteria 25136
410 Ga0495585_0007432 3300046492 Bacteria 6709
411 Ga0495585_0012064 3300046492 Bacteria 5099
412 Ga0495585_0014494 3300046492 Bacteria 4591
413 Ga0495585_0029018 3300046492 Bacteria 3152
414 Ga0495585_0031985 3300046492 Bacteria 2983
415 Ga0495585_0034983 3300046492 Bacteria 2840
416 Ga0495585_0045765 3300046492 Bacteria 2441
417 Ga0495585_0072785 3300046492 Bacteria 1871
418 Ga0495585_0138386 3300046492 Bacteria 1276
419 Ga0495585_0256344 3300046492 Bacteria 871
420 Ga0495594_0010644 3300046499 Bacteria 4769
421 Ga0495594_0023395 3300046499 Bacteria 3310
422 Ga0495594_0075294 3300046499 Bacteria 1881
423 Ga0495594_0089879 3300046499 Bacteria 1720
424 Ga0495594_0095601 3300046499 Bacteria 1668
425 Ga0495594_0125443 3300046499 Bacteria 1452
426 Ga0495594_0161693 3300046499 Bacteria 1273
427 Ga0495596_0002563 3300046500 Bacteria 9668
428 Ga0495596_0006747 3300046500 Bacteria 5247
429 Ga0495596_0013962 3300046500 Bacteria 3392
430 Ga0495596_0015276 3300046500 Bacteria 3218
431 Ga0495596_0022377 3300046500 Bacteria 2574
432 Ga0495596_0035315 3300046500 Bacteria 1982
433 Ga0495596_0037999 3300046500 Bacteria 1903
434 Ga0495596_0041037 3300046500 Bacteria 1825
435 Ga0495596_0048534 3300046500 Bacteria 1664
436 Ga0495596_0066072 3300046500 Bacteria 1406
437 Ga0495596_0082437 3300046500 Bacteria 1248
438 Ga0495607_0000834 3300046501 Bacteria 29098
439 Ga0495607_0003363 3300046501 Bacteria 12266
440 Ga0495607_0006325 3300046501 Bacteria 8345
441 Ga0495607_0006614 3300046501 Bacteria 8130
442 Ga0495607_0010586 3300046501 Bacteria 6190
443 Ga0495607_0015612 3300046501 Bacteria 4919
444 Ga0495607_0115391 3300046501 Bacteria 1417
445 Ga0495583_0001085 3300046506 Bacteria 30173
446 Ga0495583_0008146 3300046506 Bacteria 6452
447 Ga0495583_0013210 3300046506 Bacteria 4619
448 Ga0495583_0024181 3300046506 Bacteria 3058
449 Ga0495583_0029225 3300046506 Bacteria 2699
450 Ga0495583_0040025 3300046506 Bacteria 2204
451 Ga0495583_0085548 3300046506 Bacteria 1364
452 Ga0495583_0147558 3300046506 Bacteria 976
453 Ga0495606_0035211 3300046507 Bacteria 3425
454 Ga0495606_0051437 3300046507 Bacteria 2687
455 Ga0495606_0061813 3300046507 Bacteria 2393
456 Ga0495606_0067904 3300046507 Bacteria 2256
457 Ga0495606_0109703 3300046507 Bacteria 1666
458 Ga0495606_0215779 3300046507 Bacteria 1084
459 Ga0495610_0003702 3300046512 Bacteria 11722
460 Ga0495610_0062898 3300046512 Bacteria 1759
461 Ga0495610_0069794 3300046512 Bacteria 1643
462 Ga0495616_0001336 3300046513 Bacteria 17226
463 Ga0495616_0009394 3300046513 Bacteria 5724
464 Ga0495616_0014430 3300046513 Bacteria 4421
465 Ga0495616_0017425 3300046513 Bacteria 3962
466 Ga0495616_0024730 3300046513 Bacteria 3217
467 Ga0495616_0027390 3300046513 Bacteria 3024
468 Ga0495616_0037612 3300046513 Bacteria 2488
469 Ga0495616_0057193 3300046513 Bacteria 1923
470 Ga0495616_0063395 3300046513 Bacteria 1806
471 Ga0495616_0080660 3300046513 Bacteria 1557
472 Ga0495616_0110213 3300046513 Bacteria 1279
473 Ga0495616_0197301 3300046513 Bacteria 886
474 Ga0495616_0222833 3300046513 Bacteria 820
475 Ga0495630_0009746 3300046517 Bacteria 6911
476 Ga0495631_0004761 3300046518 Bacteria 7167
477 Ga0495631_0005028 3300046518 Bacteria 6961
478 Ga0495631_0005442 3300046518 Bacteria 6661
479 Ga0495631_0005524 3300046518 Bacteria 6608
480 Ga0495631_0015732 3300046518 Bacteria 3617
481 Ga0495631_0037288 3300046518 Bacteria 2166
482 Ga0495631_0043721 3300046518 Bacteria 1975
483 Ga0495631_0296950 3300046518 Bacteria 687
484 Ga0495632_0000148 3300046519 Bacteria 72492
485 Ga0495632_0007100 3300046519 Bacteria 7091
486 Ga0495632_0007463 3300046519 Bacteria 6866
487 Ga0495632_0008697 3300046519 Bacteria 6195
488 Ga0495632_0041328 3300046519 Bacteria 2317
489 Ga0495632_0068087 3300046519 Bacteria 1716
490 Ga0495632_0166387 3300046519 Bacteria 1014
491 Ga0495637_0000006 3300046520 Bacteria 435763
492 Ga0495637_0021375 3300046520 Bacteria 2968
493 Ga0495637_0043231 3300046520 Bacteria 1924
494 Ga0495643_0002220 3300046522 Bacteria 15780
495 Ga0495643_0003624 3300046522 Bacteria 11220
496 Ga0495643_0020278 3300046522 Bacteria 3835
497 Ga0495643_0028825 3300046522 Bacteria 3109
498 Ga0495643_0310623 3300046522 Bacteria 715
499 Ga0495643_0358678 3300046522 Bacteria 651
500 Ga0495644_0002343 3300046523 Bacteria 7552
501 Ga0495644_0002779 3300046523 Bacteria 6934
502 Ga0495644_0004141 3300046523 Bacteria 5701
503 Ga0495644_0007340 3300046523 Bacteria 4258
504 Ga0495644_0016303 3300046523 Bacteria 2844
505 Ga0495644_0022329 3300046523 Bacteria 2411
506 Ga0495648_0011970 3300046524 Bacteria 6503
507 Ga0495648_0015757 3300046524 Bacteria 5470
508 Ga0495648_0024170 3300046524 Bacteria 4146
509 Ga0495648_0033135 3300046524 Bacteria 3379
510 Ga0495648_0034375 3300046524 Bacteria 3299
511 Ga0495648_0063736 3300046524 Bacteria 2174
512 Ga0495648_0084832 3300046524 Bacteria 1791
513 Ga0495648_0089969 3300046524 Bacteria 1721
514 Ga0495648_0126998 3300046524 Bacteria 1361
515 Ga0495648_0171750 3300046524 Bacteria 1110
516 Ga0495648_0278196 3300046524 Bacteria 794
517 Ga0495648_0310964 3300046524 Bacteria 734
518 Ga0495663_0107264 3300046525 Bacteria 925
519 Ga0495666_0000744 3300046526 Bacteria 14983
520 Ga0495666_0012484 3300046526 Bacteria 4234
521 Ga0495666_0086650 3300046526 Bacteria 1479
522 Ga0495642_0000569 3300046528 Bacteria 18527
523 Ga0495642_0003114 3300046528 Bacteria 6578
524 Ga0495642_0011383 3300046528 Bacteria 3417
525 Ga0495642_0013582 3300046528 Bacteria 3152
526 Ga0495642_0015875 3300046528 Bacteria 2931
527 Ga0495642_0028613 3300046528 Bacteria 2220
528 Ga0495642_0034709 3300046528 Bacteria 2032
529 Ga0495642_0119075 3300046528 Bacteria 1132
530 Ga0495642_0232852 3300046528 Bacteria 804
531 Ga0495652_0199498 3300046529 Bacteria 1519
532 Ga0495654_0009322 3300046530 Bacteria 5380
533 Ga0495654_0019833 3300046530 Bacteria 3511
534 Ga0495654_0051828 3300046530 Bacteria 2001
535 Ga0495654_0102276 3300046530 Bacteria 1317
536 Ga0495654_0105954 3300046530 Bacteria 1288
537 Ga0495665_0034032 3300046531 Bacteria 2724
538 Ga0495665_0053057 3300046531 Bacteria 2145
539 Ga0495665_0054761 3300046531 Bacteria 2107
540 Ga0495640_0332240 3300046533 Bacteria 940
541 Ga0495586_0030119 3300046535 Bacteria 2904
542 Ga0495586_0094793 3300046535 Bacteria 1651
543 Ga0495586_0114323 3300046535 Bacteria 1504
544 Ga0495586_0527517 3300046535 Bacteria 681
545 Ga0495587_0404604 3300046536 Bacteria 758
546 Ga0495609_0000002 3300046538 Bacteria 739816
547 Ga0495609_0000522 3300046538 Bacteria 30810
548 Ga0495609_0005081 3300046538 Bacteria 7012
549 Ga0495609_0006979 3300046538 Bacteria 5695
550 Ga0495609_0013121 3300046538 Bacteria 3918
551 Ga0495609_0029855 3300046538 Bacteria 2481
552 Ga0495609_0032295 3300046538 Bacteria 2378
553 Ga0495609_0263611 3300046538 Bacteria 707
554 Ga0495609_0325757 3300046538 Bacteria 622
555 Ga0495621_0370772 3300046539 Bacteria 603
556 Ga0495597_0001858 3300046542 Bacteria 14443
557 Ga0495597_0002415 3300046542 Bacteria 11888
558 Ga0495597_0005167 3300046542 Bacteria 6952
559 Ga0495597_0009834 3300046542 Bacteria 4704
560 Ga0495597_0083286 3300046542 Bacteria 1366
561 Ga0495597_0094028 3300046542 Bacteria 1269
562 Ga0495597_0108527 3300046542 Bacteria 1165
563 Ga0495597_0198054 3300046542 Bacteria 805
564 Ga0495597_0350683 3300046542 Bacteria 566
565 Ga0495645_0129125 3300046543 Bacteria 1773
566 Ga0495622_0011709 3300046557 Bacteria 4055
567 Ga0495622_0030966 3300046557 Bacteria 2501
568 Ga0495622_0033569 3300046557 Bacteria 2394
569 Ga0495622_0056631 3300046557 Bacteria 1818
570 Ga0495622_0214449 3300046557 Bacteria 854
571 Ga0495633_0005314 3300046558 Bacteria 7910
572 Ga0495633_0006247 3300046558 Bacteria 7110
573 Ga0495633_0006628 3300046558 Bacteria 6833
574 Ga0495633_0038303 3300046558 Bacteria 2290
575 Ga0495633_0040400 3300046558 Bacteria 2222
576 Ga0495633_0043296 3300046558 Bacteria 2136
577 Ga0495633_0079790 3300046558 Bacteria 1524
578 Ga0495633_0123935 3300046558 Bacteria 1196
579 Ga0495656_0015023 3300046615 Bacteria 2914
580 Ga0495656_0074870 3300046615 Bacteria 1513
581 Ga0495656_0155276 3300046615 Bacteria 1108
582 Ga0495656_0237023 3300046615 Bacteria 917
583 Ga0495656_0245225 3300046615 Bacteria 903
584 Ga0495656_0287665 3300046615 Bacteria 839
585 Ga0495668_0000021 3300046616 Bacteria 381308
586 Ga0495668_0000049 3300046616 Bacteria 217657
587 Ga0495668_0001558 3300046616 Bacteria 21752
588 Ga0495668_0001735 3300046616 Bacteria 20052
589 Ga0495668_0007257 3300046616 Bacteria 7110
590 Ga0495668_0009224 3300046616 Bacteria 6070
591 Ga0495668_0020897 3300046616 Bacteria 3759
592 Ga0495668_0027726 3300046616 Bacteria 3209
593 Ga0495668_0054902 3300046616 Bacteria 2200
594 Ga0495668_0159041 3300046616 Bacteria 1237
595 Ga0495634_0058211 3300046642 Bacteria 2576
596 Ga0495611_0000309 3300046648 Bacteria 33038
597 Ga0495611_0001771 3300046648 Bacteria 10432
598 Ga0495611_0004407 3300046648 Bacteria 6092
599 Ga0495611_0010876 3300046648 Bacteria 3854
600 Ga0495611_0037824 3300046648 Bacteria 2145
601 Ga0495611_0038370 3300046648 Bacteria 2130
602 Ga0495611_0075955 3300046648 Bacteria 1539
603 Ga0495625_0003181 3300046660 Bacteria 16707
604 Ga0495625_0014069 3300046660 Bacteria 6403
605 Ga0495625_0028518 3300046660 Bacteria 4186
606 Ga0495625_0028905 3300046660 Bacteria 4151
607 Ga0495625_0039495 3300046660 Bacteria 3446
608 Ga0495625_0076032 3300046660 Bacteria 2349
609 Ga0495625_0090689 3300046660 Bacteria 2113
610 Ga0495625_0257858 3300046660 Bacteria 1129
611 Ga0495659_0000098 3300046664 Bacteria 38376
612 Ga0495659_0006084 3300046664 Bacteria 3815
613 Ga0495659_0343928 3300046664 Bacteria 636
614 Ga0495661_0011074 3300046665 Bacteria 6124
615 Ga0495661_0014162 3300046665 Bacteria 5342
616 Ga0495661_0023349 3300046665 Bacteria 4015
617 Ga0495661_0031136 3300046665 Bacteria 3389
618 Ga0495661_0032557 3300046665 Bacteria 3294
619 Ga0495661_0033952 3300046665 Bacteria 3213
620 Ga0495661_0041378 3300046665 Bacteria 2851
621 Ga0495661_0042605 3300046665 Bacteria 2797
622 Ga0495661_0043846 3300046665 Bacteria 2746
623 Ga0495661_0046043 3300046665 Bacteria 2664
624 Ga0495661_0060592 3300046665 Bacteria 2247
625 Ga0495661_0067504 3300046665 Bacteria 2100
626 Ga0495661_0078056 3300046665 Bacteria 1916
627 Ga0495661_0094846 3300046665 Bacteria 1690
628 Ga0495661_0100993 3300046665 Bacteria 1623
629 Ga0495661_0102976 3300046665 Bacteria 1603
630 Ga0495661_0232685 3300046665 Bacteria 949
631 Ga0495661_0315704 3300046665 Bacteria 778
632 Ga0495661_0489791 3300046665 Bacteria 587
633 Ga0495588_0000135 3300046674 Bacteria 117387
634 Ga0495588_0017232 3300046674 Bacteria 3503
635 Ga0495588_0021690 3300046674 Bacteria 3168
636 Ga0495588_0027852 3300046674 Bacteria 2825
637 Ga0495588_0028510 3300046674 Bacteria 2794
638 Ga0495588_0101812 3300046674 Bacteria 1509
639 Ga0495588_0109238 3300046674 Bacteria 1456
640 Ga0495588_0124617 3300046674 Bacteria 1358
641 Ga0495588_0387781 3300046674 Bacteria 733
642 Ga0495588_0554448 3300046674 Bacteria 602
643 Ga0495623_0042373 3300046679 Bacteria 2899
644 Ga0495646_0142442 3300046680 Bacteria 1339
645 Ga0495669_0000400 3300046684 Bacteria 21289
646 Ga0495669_0000418 3300046684 Bacteria 20527
647 Ga0495669_0010842 3300046684 Bacteria 3858
648 Ga0495669_0016839 3300046684 Bacteria 3133
649 Ga0495669_0029643 3300046684 Bacteria 2400
650 Ga0495669_0043868 3300046684 Bacteria 1991
651 Ga0495669_0046897 3300046684 Bacteria 1929
652 Ga0495669_0049532 3300046684 Bacteria 1881
653 Ga0495669_0065511 3300046684 Bacteria 1649
654 Ga0495670_0015322 3300046691 Bacteria 3769
655 Ga0495670_0015421 3300046691 Bacteria 3754
656 Ga0495670_0050606 3300046691 Bacteria 2079
657 Ga0495670_0064745 3300046691 Bacteria 1842
658 Ga0495670_0092952 3300046691 Bacteria 1545
659 Ga0495670_0219178 3300046691 Bacteria 1010
660 Ga0495670_0225224 3300046691 Bacteria 996
661 Ga0495670_0246717 3300046691 Bacteria 951
662 Ga0495671_0000522 3300046692 Bacteria 29251
663 Ga0495671_0004896 3300046692 Bacteria 7921
664 Ga0495671_0021644 3300046692 Bacteria 3374
665 Ga0495671_0310795 3300046692 Bacteria 757
666 Ga0495649_0000625 3300046694 Bacteria 29147
667 Ga0495649_0005216 3300046694 Bacteria 8317
668 Ga0495649_0008026 3300046694 Bacteria 6377
669 Ga0495649_0043337 3300046694 Bacteria 2456
670 Ga0495649_0075218 3300046694 Bacteria 1808
671 Ga0495649_0110193 3300046694 Bacteria 1460
672 Ga0495649_0192314 3300046694 Bacteria 1062
673 Ga0495649_0216605 3300046694 Bacteria 991
674 Ga0495589_0000353 3300046794 Bacteria 35738
675 Ga0495589_0001512 3300046794 Bacteria 13375
676 Ga0495589_0002800 3300046794 Bacteria 9643
677 Ga0495589_0004643 3300046794 Bacteria 7301
678 Ga0495589_0004825 3300046794 Bacteria 7164
679 Ga0495589_0008572 3300046794 Bacteria 5330
680 Ga0495589_0012156 3300046794 Bacteria 4463
681 Ga0495589_0048393 3300046794 Bacteria 2105
682 Ga0495589_0083014 3300046794 Bacteria 1557
683 Ga0495589_0119006 3300046794 Bacteria 1272
684 Ga0495589_0180740 3300046794 Bacteria 1000
685 Ga0495589_0191183 3300046794 Bacteria 968
686 Ga0495600_0060647 3300046809 Bacteria 2470
687 Ga0495660_0000103 3300046810 Bacteria 91169
688 Ga0495660_0003819 3300046810 Bacteria 9222
689 Ga0495660_0013708 3300046810 Bacteria 4698
690 Ga0495660_0024276 3300046810 Bacteria 3454
691 Ga0495660_0035176 3300046810 Bacteria 2800
692 Ga0495660_0054077 3300046810 Bacteria 2176
693 Ga0495660_0060435 3300046810 Bacteria 2035
694 Ga0495660_0102345 3300046810 Bacteria 1472
695 Ga0495581_0029213 3300047315 Bacteria 3195
696 Ga0495581_0157034 3300047315 Bacteria 1329
697 Ga0495581_0364854 3300047315 Bacteria 843
698 Ga0495636_0001265 3300047318 Bacteria 9570
699 Ga0495636_0003721 3300047318 Bacteria 5935
700 Ga0495636_0040605 3300047318 Bacteria 1929
701 Ga0495636_0079855 3300047318 Bacteria 1407
702 Ga0495636_0084274 3300047318 Bacteria 1372
703 Ga0495672_0000118 3300047320 Bacteria 124396
704 Ga0495672_0000287 3300047320 Bacteria 69547
705 Ga0495672_0003619 3300047320 Bacteria 13107
706 Ga0495672_0009762 3300047320 Bacteria 6914
707 Ga0495672_0021332 3300047320 Bacteria 4226
708 Ga0495672_0119976 3300047320 Bacteria 1399
709 Ga0495672_0230055 3300047320 Bacteria 910
710 Ga0495676_0000627 3300047321 Bacteria 29238
711 Ga0495676_0083006 3300047321 Bacteria 2423
712 Ga0495676_0403775 3300047321 Bacteria 906
713 Ga0495683_0005242 3300047323 Bacteria 7201
714 Ga0495683_0005405 3300047323 Bacteria 7091
715 Ga0495683_0016184 3300047323 Bacteria 3873
716 Ga0495683_0025633 3300047323 Bacteria 3020
717 Ga0495683_0034591 3300047323 Bacteria 2569
718 Ga0495683_0369765 3300047323 Bacteria 601
719 Ga0495683_0473340 3300047323 Bacteria 511
720 Ga0495687_000047 3300047443 Bacteria 206452
721 Ga0495687_000166 3300047443 Bacteria 98891
722 Ga0495687_000210 3300047443 Bacteria 83884
723 Ga0495687_018829 3300047443 Bacteria 3402
724 Ga0495687_024581 3300047443 Bacteria 2861
725 Ga0495687_041822 3300047443 Bacteria 2007
726 Ga0495687_090705 3300047443 Bacteria 1170
727 Ga0495675_0030262 3300047444 Bacteria 3454
728 Ga0495675_0075202 3300047444 Bacteria 2128
729 Ga0495677_0000074 3300047445 Bacteria 50955
730 Ga0495677_0000920 3300047445 Bacteria 11865
731 Ga0495677_0001632 3300047445 Bacteria 9014
732 Ga0495677_0005519 3300047445 Bacteria 4794
733 Ga0495677_0017567 3300047445 Bacteria 2593
734 Ga0495677_0021851 3300047445 Bacteria 2318
735 Ga0495677_0034368 3300047445 Bacteria 1849
736 Ga0495677_0034631 3300047445 Bacteria 1842
737 Ga0495677_0036892 3300047445 Bacteria 1785
738 Ga0495677_0216899 3300047445 Bacteria 745
739 Ga0495679_007964 3300047446 Bacteria 4358
740 Ga0495679_012140 3300047446 Bacteria 3291
741 Ga0495679_018946 3300047446 Bacteria 2430
742 Ga0495679_052201 3300047446 Bacteria 1224
743 Ga0495679_068310 3300047446 Bacteria 1028
744 Ga0495679_122076 3300047446 Bacteria 711
745 Ga0495685_004856 3300047447 Bacteria 4363
746 Ga0495685_016653 3300047447 Bacteria 2513
747 Ga0495685_152066 3300047447 Bacteria 751
748 Ga0495681_0002867 3300047470 Bacteria 12181
749 Ga0495681_0003198 3300047470 Bacteria 11430
750 Ga0495681_0009476 3300047470 Bacteria 5993
751 Ga0495681_0023512 3300047470 Bacteria 3272
752 Ga0495681_0031160 3300047470 Bacteria 2704
753 Ga0495681_0183766 3300047470 Bacteria 857
754 Ga0495681_0202704 3300047470 Bacteria 804
755 Ga0495686_0000835 3300047472 Bacteria 39592
756 Ga0495686_0006193 3300047472 Bacteria 9231
757 Ga0495686_0006400 3300047472 Bacteria 9025
758 Ga0495686_0029229 3300047472 Bacteria 3586
759 Ga0495686_0078442 3300047472 Bacteria 2021
760 Ga0495686_0089005 3300047472 Bacteria 1876
761 Ga0495686_0133635 3300047472 Bacteria 1469
762 Ga0495593_0051146 3300047673 Bacteria 2187
763 Ga0495602_0042177 3300048088 Bacteria 4160
764 Ga0495602_0179218 3300048088 Bacteria 1636
765 Ga0495614_0020215 3300048089 Bacteria 2880
766 Ga0495614_0075094 3300048089 Bacteria 1460
767 Ga0495626_0000006 3300048091 Bacteria 284977
768 Ga0495626_0000034 3300048091 Bacteria 183391
769 Ga0495626_0005441 3300048091 Bacteria 7453
770 Ga0495626_0006165 3300048091 Bacteria 6859
771 Ga0495626_0006352 3300048091 Bacteria 6738
772 Ga0495626_0010572 3300048091 Bacteria 4913
773 Ga0495626_0017645 3300048091 Bacteria 3598
774 Ga0495626_0019151 3300048091 Bacteria 3425
775 Ga0495626_0029193 3300048091 Bacteria 2670
776 Ga0495626_0043239 3300048091 Bacteria 2114
777 Ga0495626_0053956 3300048091 Bacteria 1847
778 Ga0495626_0137375 3300048091 Bacteria 1038
779 Ga0496100_0424293 3300048903 Bacteria 1016
780 Ga0496101_0118146 3300048904 Bacteria 2002
781 Ga0496101_1405113 3300048904 Bacteria 544
782 Ga0496102_0010040 3300048905 Bacteria 8142
783 Ga0496102_0197528 3300048905 Bacteria 1896
784 Ga0496102_0653733 3300048905 Bacteria 974
785 Ga0496102_0679713 3300048905 Bacteria 952
786 Ga0496102_0759295 3300048905 Bacteria 892
787 Ga0496103_0071730 3300048906 Bacteria 2168
788 Ga0496103_0151577 3300048906 Bacteria 1485
789 Ga0496103_0179680 3300048906 Bacteria 1360
790 Ga0496103_0207447 3300048906 Bacteria 1260
791 Ga0496103_0247560 3300048906 Bacteria 1147
792 Ga0496104_0066589 3300048907 Bacteria 3420
793 Ga0496104_0201582 3300048907 Bacteria 1902
794 Ga0496105_0541225 3300048908 Bacteria 910
795 Ga0496106_0004987 3300048909 Bacteria 9827
796 Ga0496106_0176687 3300048909 Bacteria 1694
797 Ga0496106_0451959 3300048909 Bacteria 1032
798 Ga0496107_0012714 3300048910 Bacteria 5881
799 Ga0496107_0101165 3300048910 Bacteria 2113
800 Ga0496108_0929699 3300048911 Bacteria 745
801 Ga0496109_0034146 3300048912 Bacteria 4579
802 Ga0496109_0339540 3300048912 Bacteria 1418
803 Ga0496109_0402299 3300048912 Bacteria 1293
804 Ga0496109_0724705 3300048912 Bacteria 932
805 Ga0496110_0018489 3300048913 Bacteria 5843
806 Ga0496111_0125865 3300048914 Bacteria 1894
807 Ga0496111_0810019 3300048914 Bacteria 677
808 Ga0496112_0279929 3300048915 Bacteria 1615
809 Ga0496112_0473321 3300048915 Bacteria 1190
810 Ga0496113_0024113 3300048916 Bacteria 4320
811 Ga0496113_0572695 3300048916 Bacteria 905
812 Ga0496114_0178228 3300048917 Bacteria 1855
813 Ga0496115_0406788 3300048918 Bacteria 1104
814 Ga0496116_0331977 3300048919 Bacteria 706
815 Ga0496121_0078704 3300048924 Bacteria 2620
816 Ga0496122_0003245 3300048925 Bacteria 21574
817 Ga0496122_0015414 3300048925 Bacteria 7308
818 Ga0496122_0267307 3300048925 Bacteria 945
819 Ga0496123_0013411 3300048926 Bacteria 6884
820 Ga0496123_0015341 3300048926 Bacteria 6291
821 Ga0496123_0050901 3300048926 Bacteria 2764
822 Ga0496124_0026676 3300048927 Bacteria 5206
823 Ga0496124_0084722 3300048927 Bacteria 2598
824 Ga0496124_0086232 3300048927 Bacteria 2570
825 Ga0496124_0087250 3300048927 Bacteria 2552
826 Ga0496124_0094902 3300048927 Bacteria 2425
827 Ga0496124_0102421 3300048927 Bacteria 2317
828 Ga0496125_0007861 3300048928 Bacteria 11269
829 Ga0496125_0105869 3300048928 Bacteria 2055
830 Ga0496125_0553867 3300048928 Bacteria 637
831 Ga0496126_0145302 3300048929 Bacteria 2038
832 Ga0501306_018117 3300049127 Bacteria 961
833 Ga0501308_000946 3300049128 Bacteria 2147
834 Ga0501308_018674 3300049128 Bacteria 850
835 Ga0501309_004005 3300049129 Bacteria 1698
836 Ga0501304_000167 3300049160 Bacteria 2797
837 Ga0501307_006020 3300049162 Bacteria 1296
838 Ga0501307_007028 3300049162 Bacteria 1232
839 Ga0495678_000113 3300049459 Bacteria 96866
840 Ga0495678_000601 3300049459 Bacteria 33888
841 Ga0495678_010011 3300049459 Bacteria 4636
842 Ga0495678_020985 3300049459 Bacteria 2884
843 Ga0495678_076538 3300049459 Bacteria 1212
844 Ga0495682_0003524 3300049460 Bacteria 6935
845 Ga0495682_0006018 3300049460 Bacteria 4955
846 Ga0495682_0009817 3300049460 Bacteria 3726
847 Ga0495682_0014169 3300049460 Bacteria 3025
848 Ga0495682_0065817 3300049460 Bacteria 1306
849 Ga0501311_004404 3300049527 Bacteria 1497
850 Ga0501313_006175 3300049529 Bacteria 1290
851 Ga0501315_002695 3300049531 Bacteria 1702
852 Ga0501315_006164 3300049531 Bacteria 1326
853 Ga0501315_035017 3300049531 Bacteria 739
854 Ga0501316_004314 3300049532 Bacteria 1422
855 Ga0501316_032082 3300049532 Bacteria 706
856 Ga0501316_075490 3300049532 Bacteria 516
857 Ga0501318_020518 3300049534 Bacteria 833
858 Ga0501323_008593 3300049539 Bacteria 1188
859 Ga0501038_0322239 3300049574 Bacteria 1209
860 Ga0501042_0472253 3300049578 Bacteria 910
861 Ga0501043_0277175 3300049579 Bacteria 1286
862 Ga0501046_0035622 3300049580 Bacteria 4010
863 Ga0501046_0529471 3300049580 Bacteria 842
864 Ga0501047_0031101 3300049581 Bacteria 5148
865 Ga0501067_0708163 3300049583 Bacteria 566
866 Ga0501070_0248645 3300049586 Bacteria 1455
867 Ga0501070_0254639 3300049586 Bacteria 1436
868 Ga0501202_050767 3300049652 Bacteria 918
869 Ga0501207_023247 3300049654 Bacteria 1005
870 Ga0501227_002378 3300049665 Bacteria 4157
871 Ga0501227_021046 3300049665 Bacteria 1501
872 Ga0501243_001360 3300049675 Bacteria 3498
873 Ga0501083_0005756 3300049744 Bacteria 8768
874 Ga0501263_034297 3300049760 Bacteria 727
875 Ga0501263_060529 3300049760 Bacteria 593
876 Ga0501279_003747 3300049775 Bacteria 1988
877 Ga0501279_004114 3300049775 Bacteria 1905
878 Ga0501279_011654 3300049775 Bacteria 1191
879 Ga0501035_0004747 3300049822 Bacteria 12903
880 Ga0501035_0006337 3300049822 Bacteria 11126
881 Ga0501044_0001471 3300049823 Bacteria 27663
882 Ga0501044_1151090 3300049823 Bacteria 644
883 Ga0501226_012002 3300049853 Bacteria 960
884 nmdc:mga0n895_5361_c1 3300050512 Bacteria 10694
885 nmdc:mga0rr50_118422_c1 3300050513 Bacteria 2104
886 nmdc:mga08x19_13862_c1 3300050514 Bacteria 4883
887 nmdc:mga0a205_13293_c1 3300050515 Bacteria 7656
888 Ga0500555_014711 3300053103 Eukaryota 2256
889 Ga0500607_000615 3300053121 Eukaryota 34386
890 Ga0500607_008419 3300053121 Bacteria 6276
891 Ga0500614_039163 3300053123 Bacteria 1197
892 Ga0500559_0226021 3300053136 Bacteria 882
893 Ga0500636_0001052 3300053177 Bacteria 14818
894 Ga0500637_0092525 3300053178 Bacteria 1752
895 Ga0500625_119963 3300053729 Bacteria 1059
896 Ga0587084_014618 3300059477 Bacteria 1097
897 Ga0587066_053972 3300059490 Bacteria 800
898 Ga0587070_070430 3300059491 Bacteria 745
899 Ga0587073_0049366 3300059492 Bacteria 948
900 Ga0587077_057286 3300059493 Bacteria 834
901 Ga0587082_017491 3300059504 Bacteria 1130
902 Ga0587083_0002352 3300059505 Bacteria 2340
903 Ga0587083_0041313 3300059505 Bacteria 967
904 Ga0587088_002623 3300059508 Bacteria 2076
905 Ga0587091_020084 3300059511 Bacteria 1156
906 Ga0587106_001842 3300059605 Bacteria 1973
907 Ga0587106_006419 3300059605 Bacteria 1386
908 Ga0587101_020970 3300059623 Bacteria 940
909 Ga0587068_002833 3300059641 Bacteria 2152
910 Ga0587072_027254 3300059643 Bacteria 1048
911 Ga0587076_051532 3300059645 Bacteria 804
912 Ga0587079_025914 3300059647 Bacteria 1092
913 Ga0587102_005752 3300059649 Bacteria 1105
914 Ga0587105_001963 3300059651 Bacteria 1129
915 Ga0501082_1426855 3300060353 Bacteria 604
916 Ga0466962_0050633 3300061719 Bacteria 1985
917 Ga0466962_0156304 3300061719 Bacteria 1107
918 Ga0466962_0591116 3300061719 Bacteria 565
919 Ga0530510_0523549 3300061734 Bacteria 899

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_0000795 Ga0451800_0000795_213_635 133
2 3300046684 Ga0495669_0029643 Ga0495669_0029643_1650_2087 134
3 3300046542 Ga0495597_0002415 Ga0495597_0002415_1531_2001 135
4 3300046794 Ga0495589_0004643 Ga0495589_0004643_1533_2003 135
5 3300005563 Ga0068855_100001020 Ga0068855_10000102032 136
6 3300025949 Ga0207667_10000896 Ga0207667_1000089618 136
7 3300002741 JGI25157J39369_1017589 JGI25157J39369_10175892 137
8 3300041452 Ga0451793_1527940 Ga0451793_1527940_247_666 137
9 3300046471 Ga0495650_0304105 Ga0495650_0304105_95_514 137
10 3300046492 Ga0495585_0000904 Ga0495585_0000904_24203_24622 137
11 3300046524 Ga0495648_0011970 Ga0495648_0011970_5210_5629 137
12 3300046538 Ga0495609_0013121 Ga0495609_0013121_2933_3352 137
13 3300046557 Ga0495622_0030966 Ga0495622_0030966_2045_2464 137
14 3300046616 Ga0495668_0000021 Ga0495668_0000021_242095_242514 137
15 3300046660 Ga0495625_0003181 Ga0495625_0003181_5162_5581 137
16 3300053123 Ga0500614_039163 Ga0500614_039163_466_885 137
17 3300005288 Ga0065714_10008115 Ga0065714_100081152 138
18 3300005329 Ga0070683_100045537 Ga0070683_1000455375 138
19 3300005614 Ga0068856_100372840 Ga0068856_1003728402 138
20 3300013100 Ga0157373_10000208 Ga0157373_1000020848 138
21 3300013307 Ga0157372_10001960 Ga0157372_1000196012 138
22 3300025250 Ga0209026_1001421 Ga0209026_10014212 138
23 3300025909 Ga0207705_10298809 Ga0207705_102988092 138
24 3300025944 Ga0207661_10007731 Ga0207661_100077312 138
25 3300036712 Ga0316584_0560662 Ga0316584_0560662_266_697 138
26 3300044673 Ga0453683_0090229 Ga0453683_0090229_1037_1468 138
27 3300046474 Ga0495605_0031579 Ga0495605_0031579_250_687 138
28 3300046500 Ga0495596_0002563 Ga0495596_0002563_3204_3641 138
29 3300046524 Ga0495648_0034375 Ga0495648_0034375_620_1057 138
30 3300046538 Ga0495609_0005081 Ga0495609_0005081_1037_1474 138
31 3300046794 Ga0495589_0048393 Ga0495589_0048393_761_1198 138
32 3300047320 Ga0495672_0021332 Ga0495672_0021332_1119_1556 138
33 3300047321 Ga0495676_0403775 Ga0495676_0403775_294_731 138
34 3300047323 Ga0495683_0016184 Ga0495683_0016184_1041_1478 138
35 iso_pu_bacteria 2786546940 2788436509 138
36 3300046491 Ga0495584_0043913 Ga0495584_0043913_1205_1642 139
37 3300046694 Ga0495649_0110193 Ga0495649_0110193_696_1133 139
38 3300005327 Ga0070658_10245369 Ga0070658_102453692 140
39 3300005530 Ga0070679_100131647 Ga0070679_1001316471 140
40 3300009093 Ga0105240_10240122 Ga0105240_102401222 140
41 3300035724 Ga0373933_0349542 Ga0373933_0349542_236_673 140
42 3300036401 Ga0373937_0076142 Ga0373937_0076142_865_1302 140
43 3300044712 Ga0453684_1647184 Ga0453684_1647184_216_641 140
44 3300046539 Ga0495621_0370772 Ga0495621_0370772_131_556 140
45 3300049532 Ga0501316_075490 Ga0501316_075490_83_505 140
46 iso_pu_bacteria 2808606364 2808869378 140
47 3300003320 rootH2_10032765 rootH2_1003276525 141
48 3300003323 rootH1_10071921 rootH1_100719212 141
49 3300005330 Ga0070690_100327819 Ga0070690_1003278192 141
50 3300005334 Ga0068869_100000016 Ga0068869_10000001620 141
51 3300005338 Ga0068868_100064487 Ga0068868_1000644872 141
52 3300005338 Ga0068868_100076914 Ga0068868_1000769142 141
53 3300005459 Ga0068867_100000872 Ga0068867_1000008727 141
54 3300005530 Ga0070679_100033921 Ga0070679_1000339217 141
55 3300005548 Ga0070665_100496715 Ga0070665_1004967153 141
56 3300005614 Ga0068856_100001534 Ga0068856_10000153411 141
57 3300005617 Ga0068859_102045715 Ga0068859_1020457152 141
58 3300005981 Ga0081538_10001906 Ga0081538_1000190618 141
59 3300006237 Ga0097621_100206978 Ga0097621_1002069782 141
60 3300006358 Ga0068871_100005339 Ga0068871_1000053399 141
61 3300006358 Ga0068871_100566446 Ga0068871_1005664462 141
62 3300006852 Ga0075433_10000299 Ga0075433_1000029931 141
63 3300006852 Ga0075433_10011819 Ga0075433_100118197 141
64 3300006871 Ga0075434_100059706 Ga0075434_1000597062 141
65 3300006881 Ga0068865_100019070 Ga0068865_1000190704 141
66 3300006881 Ga0068865_100813314 Ga0068865_1008133142 141
67 3300006914 Ga0075436_100008751 Ga0075436_1000087515 141
68 3300006931 Ga0097620_102045415 Ga0097620_1020454152 141
69 3300007076 Ga0075435_100199384 Ga0075435_1001993843 141
70 3300025921 Ga0207652_10668107 Ga0207652_106681072 141
71 3300025938 Ga0207704_10004481 Ga0207704_100044818 141
72 3300025938 Ga0207704_10607087 Ga0207704_106070872 141
73 3300025942 Ga0207689_10000241 Ga0207689_1000024127 141
74 3300026023 Ga0207677_10045655 Ga0207677_100456554 141
75 3300026078 Ga0207702_10001475 Ga0207702_1000147510 141
76 3300026089 Ga0207648_10000756 Ga0207648_1000075629 141
77 3300026116 Ga0207674_11645664 Ga0207674_116456641 141
78 3300028379 Ga0268266_10484789 Ga0268266_104847891 141
79 3300028556 Ga0265337_1007423 Ga0265337_10074232 141
80 3300028556 Ga0265337_1021153 Ga0265337_10211533 141
81 3300028556 Ga0265337_1131577 Ga0265337_11315771 141
82 3300028563 Ga0265319_1002638 Ga0265319_10026383 141
83 3300028563 Ga0265319_1010821 Ga0265319_10108212 141
84 3300028563 Ga0265319_1016186 Ga0265319_10161865 141
85 3300028573 Ga0265334_10023332 Ga0265334_100233322 141
86 3300028577 Ga0265318_10007120 Ga0265318_100071205 141
87 3300028577 Ga0265318_10008469 Ga0265318_100084696 141
88 3300028577 Ga0265318_10042058 Ga0265318_100420582 141
89 3300028577 Ga0265318_10345107 Ga0265318_103451072 141
90 3300028654 Ga0265322_10115042 Ga0265322_101150422 141
91 3300028654 Ga0265322_10153083 Ga0265322_101530832 141
92 3300028666 Ga0265336_10010984 Ga0265336_100109842 141
93 3300028800 Ga0265338_10000329 Ga0265338_1000032938 141
94 3300028800 Ga0265338_10020776 Ga0265338_100207765 141
95 3300028800 Ga0265338_10072963 Ga0265338_100729632 141
96 3300028800 Ga0265338_10075568 Ga0265338_100755683 141
97 3300028800 Ga0265338_10455523 Ga0265338_104555231 141
98 3300029957 Ga0265324_10003662 Ga0265324_100036627 141
99 3300029957 Ga0265324_10017110 Ga0265324_100171104 141
100 3300029957 Ga0265324_10063104 Ga0265324_100631042 141
101 3300031238 Ga0265332_10049693 Ga0265332_100496932 141
102 3300031239 Ga0265328_10055459 Ga0265328_100554592 141
103 3300031240 Ga0265320_10000735 Ga0265320_1000073515 141
104 3300031240 Ga0265320_10017525 Ga0265320_100175254 141
105 3300031240 Ga0265320_10022073 Ga0265320_100220733 141
106 3300031240 Ga0265320_10030912 Ga0265320_100309122 141
107 3300031241 Ga0265325_10024461 Ga0265325_100244614 141
108 3300031247 Ga0265340_10014689 Ga0265340_100146893 141
109 3300031249 Ga0265339_10051665 Ga0265339_100516652 141
110 3300031249 Ga0265339_10061599 Ga0265339_100615993 141
111 3300031250 Ga0265331_10042698 Ga0265331_100426982 141
112 3300031251 Ga0265327_10019749 Ga0265327_100197492 141
113 3300031251 Ga0265327_10066161 Ga0265327_100661612 141
114 3300031344 Ga0265316_10037727 Ga0265316_100377272 141
115 3300031344 Ga0265316_10106340 Ga0265316_101063401 141
116 3300031344 Ga0265316_10150493 Ga0265316_101504932 141
117 3300031344 Ga0265316_10320357 Ga0265316_103203572 141
118 3300031344 Ga0265316_10338292 Ga0265316_103382922 141
119 3300031548 Ga0307408_100000032 Ga0307408_10000003253 141
120 3300031595 Ga0265313_10000228 Ga0265313_1000022838 141
121 3300031595 Ga0265313_10001658 Ga0265313_1000165819 141
122 3300031711 Ga0265314_10011755 Ga0265314_100117558 141
123 3300031711 Ga0265314_10051519 Ga0265314_100515194 141
124 3300031711 Ga0265314_10309112 Ga0265314_103091121 141
125 3300031712 Ga0265342_10060029 Ga0265342_100600293 141
126 3300031712 Ga0265342_10068863 Ga0265342_100688632 141
127 3300031712 Ga0265342_10129365 Ga0265342_101293652 141
128 3300031852 Ga0307410_10000013 Ga0307410_1000001336 141
129 3300031995 Ga0307409_100000031 Ga0307409_10000003136 141
130 3300032002 Ga0307416_100000038 Ga0307416_1000000388 141
131 3300032004 Ga0307414_10230779 Ga0307414_102307793 141
132 3300035086 Ga0373934_0078195 Ga0373934_0078195_657_1085 141
133 3300035088 Ga0373940_0031344 Ga0373940_0031344_264_704 141
134 3300035091 Ga0373951_0016056 Ga0373951_0016056_16_444 141
135 3300035691 Ga0373931_0838126 Ga0373931_0838126_141_581 141
136 3300035692 Ga0373935_0223992 Ga0373935_0223992_670_1098 141
137 3300035724 Ga0373933_0168616 Ga0373933_0168616_357_785 141
138 3300036401 Ga0373937_1257363 Ga0373937_1257363_154_582 141
139 3300037471 Ga0395905_0000015 Ga0395905_0000015_385975_386403 141
140 3300041494 Ga0451837_1317882 Ga0451837_1317882_191_619 141
141 3300041997 Ga0439431_0042404 Ga0439431_0042404_565_993 141
142 3300042876 Ga0451577_0232719 Ga0451577_0232719_691_1119 141
143 3300042876 Ga0451577_0790539 Ga0451577_0790539_277_717 141
144 3300042876 Ga0451577_0957872 Ga0451577_0957872_133_561 141
145 3300044712 Ga0453684_0011780 Ga0453684_0011780_10833_11261 141
146 3300044712 Ga0453684_0400446 Ga0453684_0400446_181_609 141
147 3300044765 Ga0466970_0306667 Ga0466970_0306667_374_802 141
148 3300045051 Ga0451576_0001454 Ga0451576_0001454_11339_11767 141
149 3300045051 Ga0451576_0001488 Ga0451576_0001488_24304_24765 141
150 3300045051 Ga0451576_0002783 Ga0451576_0002783_13203_13631 141
151 3300045051 Ga0451576_0090052 Ga0451576_0090052_788_1216 141
152 3300046471 Ga0495650_0033047 Ga0495650_0033047_648_1076 141
153 3300049574 Ga0501038_0322239 Ga0501038_0322239_624_1052 141
154 3300049578 Ga0501042_0472253 Ga0501042_0472253_235_663 141
155 3300049579 Ga0501043_0277175 Ga0501043_0277175_498_926 141
156 3300049580 Ga0501046_0035622 Ga0501046_0035622_3401_3829 141
157 3300049580 Ga0501046_0529471 Ga0501046_0529471_379_807 141
158 3300049581 Ga0501047_0031101 Ga0501047_0031101_1238_1666 141
159 3300049583 Ga0501067_0708163 Ga0501067_0708163_13_441 141
160 3300049586 Ga0501070_0248645 Ga0501070_0248645_848_1276 141
161 3300049586 Ga0501070_0254639 Ga0501070_0254639_215_643 141
162 3300049675 Ga0501243_001360 Ga0501243_001360_2688_3116 141
163 3300049744 Ga0501083_0005756 Ga0501083_0005756_8020_8448 141
164 3300049760 Ga0501263_060529 Ga0501263_060529_35_463 141
165 3300049822 Ga0501035_0006337 Ga0501035_0006337_4410_4838 141
166 3300049823 Ga0501044_0001471 Ga0501044_0001471_26540_26968 141
167 3300049823 Ga0501044_1151090 Ga0501044_1151090_65_493 141
168 3300050512 nmdc:mga0n895_5361_c1 nmdc:mga0n895_5361_c1_9173_9613 141
169 3300050513 nmdc:mga0rr50_118422_c1 nmdc:mga0rr50_118422_c1_1035_1475 141
170 3300050514 nmdc:mga08x19_13862_c1 nmdc:mga08x19_13862_c1_1420_1860 141
171 3300050515 nmdc:mga0a205_13293_c1 nmdc:mga0a205_13293_c1_643_1083 141
172 3300060353 Ga0501082_1426855 Ga0501082_1426855_108_536 141
173 3300061719 Ga0466962_0591116 Ga0466962_0591116_48_476 141
174 3300061734 Ga0530510_0523549 Ga0530510_0523549_337_825 141
175 iso_pu_bacteria 2643221554 2643788683 141
176 iso_pu_bacteria 2643221638 2644213296 141
177 iso_pu_bacteria 2643221645 2644249636 141
178 iso_pu_bacteria 2643221664 2644356200 141
179 iso_pu_bacteria 2738541280 2738739147 141
180 iso_pu_bacteria 2738541300 2738846382 141
181 iso_pu_bacteria 2738543018 2739274969 141
182 iso_pu_bacteria 2738543030 2739344013 141
183 iso_pu_bacteria 2765235838 2765567555 141
184 iso_pu_bacteria 2808606418 2809144265 141
185 iso_pu_bacteria 2839094727 2839099499 141
186 iso_pu_bacteria 8047673197 8047679074 141
187 3300028556 Ga0265337_1006922 Ga0265337_10069222 142
188 3300028563 Ga0265319_1043748 Ga0265319_10437482 142
189 3300028653 Ga0265323_10000069 Ga0265323_1000006941 142
190 3300028653 Ga0265323_10070875 Ga0265323_100708751 142
191 3300028654 Ga0265322_10000305 Ga0265322_100003053 142
192 3300028800 Ga0265338_10732948 Ga0265338_107329481 142
193 3300031235 Ga0265330_10095838 Ga0265330_100958382 142
194 3300031235 Ga0265330_10109542 Ga0265330_101095421 142
195 3300031240 Ga0265320_10002038 Ga0265320_1000203813 142
196 3300031250 Ga0265331_10043625 Ga0265331_100436254 142
197 3300031344 Ga0265316_10002099 Ga0265316_100020996 142
198 3300031344 Ga0265316_10223063 Ga0265316_102230632 142
199 3300031344 Ga0265316_10858917 Ga0265316_108589171 142
200 3300031595 Ga0265313_10046645 Ga0265313_100466453 142
201 3300031712 Ga0265342_10007378 Ga0265342_100073784 142
202 3300031712 Ga0265342_10470035 Ga0265342_104700351 142
203 3300028563 Ga0265319_1001015 Ga0265319_10010152 143
204 3300028563 Ga0265319_1014782 Ga0265319_10147823 143
205 3300028563 Ga0265319_1016890 Ga0265319_10168902 143
206 3300028577 Ga0265318_10001407 Ga0265318_1000140713 143
207 3300031240 Ga0265320_10000515 Ga0265320_100005158 143
208 3300031240 Ga0265320_10001485 Ga0265320_100014856 143
209 3300031595 Ga0265313_10208918 Ga0265313_102089182 143
210 3300031911 Ga0307412_11407111 Ga0307412_114071111 143
211 3300042876 Ga0451577_0035000 Ga0451577_0035000_1703_2137 143
212 3300044712 Ga0453684_0000045 Ga0453684_0000045_8041_8475 143
213 3300046473 Ga0495582_0001028 Ga0495582_0001028_11452_11928 143
214 3300046474 Ga0495605_0019333 Ga0495605_0019333_2984_3460 143
215 3300046491 Ga0495584_0202998 Ga0495584_0202998_157_633 143
216 3300046492 Ga0495585_0031985 Ga0495585_0031985_1314_1790 143
217 3300046499 Ga0495594_0075294 Ga0495594_0075294_732_1163 143
218 3300046499 Ga0495594_0095601 Ga0495594_0095601_578_1054 143
219 3300046499 Ga0495594_0161693 Ga0495594_0161693_457_888 143
220 3300046500 Ga0495596_0022377 Ga0495596_0022377_1865_2341 143
221 3300046506 Ga0495583_0147558 Ga0495583_0147558_120_596 143
222 3300046513 Ga0495616_0080660 Ga0495616_0080660_756_1232 143
223 3300046522 Ga0495643_0358678 Ga0495643_0358678_111_587 143
224 3300046523 Ga0495644_0007340 Ga0495644_0007340_2551_3027 143
225 3300046526 Ga0495666_0012484 Ga0495666_0012484_2725_3156 143
226 3300046526 Ga0495666_0086650 Ga0495666_0086650_590_1021 143
227 3300046530 Ga0495654_0105954 Ga0495654_0105954_669_1145 143
228 3300046531 Ga0495665_0034032 Ga0495665_0034032_1667_2098 143
229 3300046531 Ga0495665_0054761 Ga0495665_0054761_1067_1498 143
230 3300046535 Ga0495586_0094793 Ga0495586_0094793_101_532 143
231 3300046535 Ga0495586_0527517 Ga0495586_0527517_223_654 143
232 3300046538 Ga0495609_0029855 Ga0495609_0029855_906_1382 143
233 3300046542 Ga0495597_0108527 Ga0495597_0108527_633_1109 143
234 3300046557 Ga0495622_0011709 Ga0495622_0011709_487_963 143
235 3300046557 Ga0495622_0056631 Ga0495622_0056631_971_1402 143
236 3300046558 Ga0495633_0040400 Ga0495633_0040400_578_1054 143
237 3300046616 Ga0495668_0159041 Ga0495668_0159041_488_964 143
238 3300046648 Ga0495611_0038370 Ga0495611_0038370_1168_1644 143
239 3300046660 Ga0495625_0028905 Ga0495625_0028905_3069_3545 143
240 3300046665 Ga0495661_0046043 Ga0495661_0046043_1975_2451 143
241 3300046674 Ga0495588_0017232 Ga0495588_0017232_2730_3206 143
242 3300046674 Ga0495588_0028510 Ga0495588_0028510_1079_1510 143
243 3300046674 Ga0495588_0101812 Ga0495588_0101812_694_1125 143
244 3300046684 Ga0495669_0000400 Ga0495669_0000400_10731_11207 143
245 3300046691 Ga0495670_0015421 Ga0495670_0015421_2792_3268 143
246 3300046691 Ga0495670_0092952 Ga0495670_0092952_519_950 143
247 3300046694 Ga0495649_0043337 Ga0495649_0043337_176_652 143
248 3300046794 Ga0495589_0083014 Ga0495589_0083014_651_1127 143
249 3300047315 Ga0495581_0029213 Ga0495581_0029213_1527_2003 143
250 3300047315 Ga0495581_0157034 Ga0495581_0157034_571_1002 143
251 3300047318 Ga0495636_0040605 Ga0495636_0040605_244_720 143
252 3300047320 Ga0495672_0009762 Ga0495672_0009762_5410_5841 143
253 3300047321 Ga0495676_0083006 Ga0495676_0083006_711_1142 143
254 3300047323 Ga0495683_0369765 Ga0495683_0369765_54_530 143
255 3300047443 Ga0495687_000210 Ga0495687_000210_12263_12694 143
256 3300047445 Ga0495677_0036892 Ga0495677_0036892_198_674 143
257 3300047446 Ga0495679_052201 Ga0495679_052201_374_850 143
258 3300047447 Ga0495685_152066 Ga0495685_152066_199_675 143
259 3300047470 Ga0495681_0183766 Ga0495681_0183766_163_639 143
260 3300048088 Ga0495602_0179218 Ga0495602_0179218_68_499 143
261 3300048089 Ga0495614_0020215 Ga0495614_0020215_887_1363 143
262 3300048091 Ga0495626_0017645 Ga0495626_0017645_2960_3436 143
263 3300049129 Ga0501309_004005 Ga0501309_004005_97_528 143
264 3300010375 Ga0105239_10009203 Ga0105239_1000920313 144
265 3300013100 Ga0157373_10342570 Ga0157373_103425702 144
266 3300025914 Ga0207671_10138785 Ga0207671_101387851 144
267 3300025949 Ga0207667_11124227 Ga0207667_111242271 144
268 3300042138 Ga0450903_018547 Ga0450903_018547_25_477 144
269 3300002739 JGI25158J39367_1001655 JGI25158J39367_10016555 145
270 3300002773 JGI25152J39213_1000245 JGI25152J39213_10002451 145
271 3300002774 JGI25150J39212_1028710 JGI25150J39212_10287102 145
272 3300002987 JGI25159J45721_1005640 JGI25159J45721_10056405 145
273 3300002987 JGI25159J45721_1012666 JGI25159J45721_10126662 145
274 3300003163 Ga0006759J45824_1068122 Ga0006759J45824_10681222 145
275 3300003215 JGI25153J46596_10001778 JGI25153J46596_100017784 145
276 3300003322 rootL2_10002967 rootL2_100029673 145
277 3300003322 rootL2_10002968 rootL2_100029683 145
278 3300003354 JGI25160J50197_1003487 JGI25160J50197_10034875 145
279 3300003374 JGI25161J50226_1003103 JGI25161J50226_10031032 145
280 3300003575 Ga0007409J51694_1013231 Ga0007409J51694_10132313 145
281 3300003693 Ga0032354_1046455 Ga0032354_10464553 145
282 3300003771 Ga0055526_1000556 Ga0055526_100055622 145
283 3300003771 Ga0055526_1024738 Ga0055526_10247383 145
284 3300003773 Ga0055537_1000056 Ga0055537_100005666 145
285 3300003775 Ga0055524_1003233 Ga0055524_10032335 145
286 3300003784 Ga0055534_1000178 Ga0055534_100017816 145
287 3300003784 Ga0055534_1009222 Ga0055534_10092223 145
288 3300003790 Ga0055528_1000297 Ga0055528_100029723 145
289 3300003790 Ga0055528_1003822 Ga0055528_10038225 145
290 3300003791 Ga0055530_10013759 Ga0055530_100137592 145
291 3300003794 Ga0055531_10012000 Ga0055531_100120002 145
292 3300004625 Ga0055543_1001330 Ga0055543_100133012 145
293 3300005262 Ga0065165_1000447 Ga0065165_100044748 145
294 3300005262 Ga0065165_1000986 Ga0065165_100098611 145
295 3300005262 Ga0065165_1041456 Ga0065165_10414561 145
296 3300005327 Ga0070658_11467976 Ga0070658_114679761 145
297 3300005329 Ga0070683_100371247 Ga0070683_1003712472 145
298 3300005334 Ga0068869_100126435 Ga0068869_1001264353 145
299 3300005339 Ga0070660_100020896 Ga0070660_1000208961 145
300 3300005339 Ga0070660_100665185 Ga0070660_1006651851 145
301 3300005366 Ga0070659_100213325 Ga0070659_1002133251 145
302 3300005366 Ga0070659_101418986 Ga0070659_1014189861 145
303 3300005455 Ga0070663_100285892 Ga0070663_1002858922 145
304 3300005456 Ga0070678_100787963 Ga0070678_1007879632 145
305 3300005457 Ga0070662_100047427 Ga0070662_1000474274 145
306 3300005457 Ga0070662_100287705 Ga0070662_1002877051 145
307 3300005457 Ga0070662_100922971 Ga0070662_1009229711 145
308 3300005563 Ga0068855_100014744 Ga0068855_1000147444 145
309 3300005563 Ga0068855_100103246 Ga0068855_1001032464 145
310 3300005564 Ga0070664_100034159 Ga0070664_1000341595 145
311 3300005564 Ga0070664_100222706 Ga0070664_1002227062 145
312 3300005844 Ga0068862_100596410 Ga0068862_1005964102 145
313 3300009093 Ga0105240_10345191 Ga0105240_103451912 145
314 3300009098 Ga0105245_10031045 Ga0105245_100310453 145
315 3300009148 Ga0105243_10008313 Ga0105243_100083134 145
316 3300009174 Ga0105241_10151149 Ga0105241_101511493 145
317 3300009176 Ga0105242_10033488 Ga0105242_100334884 145
318 3300009176 Ga0105242_10255942 Ga0105242_102559423 145
319 3300009545 Ga0105237_10223903 Ga0105237_102239032 145
320 3300009551 Ga0105238_10242950 Ga0105238_102429502 145
321 3300013100 Ga0157373_10105984 Ga0157373_101059843 145
322 3300013102 Ga0157371_10407012 Ga0157371_104070121 145
323 3300013104 Ga0157370_10245395 Ga0157370_102453951 145
324 3300013105 Ga0157369_10285537 Ga0157369_102855371 145
325 3300013297 Ga0157378_10189454 Ga0157378_101894542 145
326 3300013307 Ga0157372_11062449 Ga0157372_110624492 145
327 3300013307 Ga0157372_11143060 Ga0157372_111430602 145
328 3300014745 Ga0157377_10091734 Ga0157377_100917341 145
329 3300015261 Ga0182006_1044792 Ga0182006_10447922 145
330 3300025208 Ga0209436_100508 Ga0209436_10050815 145
331 3300025208 Ga0209436_100526 Ga0209436_10052615 145
332 3300025230 Ga0209563_100015 Ga0209563_100015448 145
333 3300025245 Ga0207425_1000006 Ga0207425_1000006220 145
334 3300025245 Ga0207425_1000310 Ga0207425_100031025 145
335 3300025253 Ga0209677_103454 Ga0209677_1034543 145
336 3300025254 Ga0209148_1000607 Ga0209148_100060721 145
337 3300025258 Ga0209129_1000009 Ga0209129_100000949 145
338 3300025258 Ga0209129_1005452 Ga0209129_10054522 145
339 3300025263 Ga0209565_1000006 Ga0209565_1000006298 145
340 3300025263 Ga0209565_1001590 Ga0209565_100159012 145
341 3300025263 Ga0209565_1010430 Ga0209565_10104301 145
342 3300025273 Ga0209673_1000004 Ga0209673_1000004531 145
343 3300025273 Ga0209673_1007274 Ga0209673_10072745 145
344 3300025284 Ga0209130_1000437 Ga0209130_100043726 145
345 3300025284 Ga0209130_1001628 Ga0209130_10016282 145
346 3300025291 Ga0209675_1000006 Ga0209675_1000006297 145
347 3300025291 Ga0209675_1000890 Ga0209675_100089018 145
348 3300025295 Ga0209564_1000085 Ga0209564_100008522 145
349 3300025295 Ga0209564_1000146 Ga0209564_100014675 145
350 3300025295 Ga0209564_1003895 Ga0209564_10038951 145
351 3300025297 Ga0209758_1000047 Ga0209758_1000047120 145
352 3300025298 Ga0209050_1000064 Ga0209050_1000064243 145
353 3300025298 Ga0209050_1011525 Ga0209050_10115255 145
354 3300025298 Ga0209050_1011744 Ga0209050_10117442 145
355 3300025299 Ga0209256_1000179 Ga0209256_100017916 145
356 3300025299 Ga0209256_1000428 Ga0209256_100042811 145
357 3300025299 Ga0209256_1003975 Ga0209256_10039751 145
358 3300025299 Ga0209256_1071941 Ga0209256_10719411 145
359 3300025302 Ga0207426_1002247 Ga0207426_10022475 145
360 3300025302 Ga0207426_1003558 Ga0207426_10035584 145
361 3300025304 Ga0209257_1000010 Ga0209257_1000010603 145
362 3300025304 Ga0209257_1001902 Ga0209257_10019028 145
363 3300025304 Ga0209257_1021334 Ga0209257_10213342 145
364 3300025909 Ga0207705_10044713 Ga0207705_100447132 145
365 3300025909 Ga0207705_10759528 Ga0207705_107595282 145
366 3300025911 Ga0207654_10001695 Ga0207654_100016957 145
367 3300025914 Ga0207671_10190862 Ga0207671_101908623 145
368 3300025919 Ga0207657_10594267 Ga0207657_105942672 145
369 3300025920 Ga0207649_10009884 Ga0207649_100098843 145
370 3300025920 Ga0207649_11117299 Ga0207649_111172991 145
371 3300025927 Ga0207687_10376025 Ga0207687_103760252 145
372 3300025932 Ga0207690_10125276 Ga0207690_101252763 145
373 3300025933 Ga0207706_10138620 Ga0207706_101386201 145
374 3300025933 Ga0207706_10298538 Ga0207706_102985383 145
375 3300025933 Ga0207706_10922525 Ga0207706_109225252 145
376 3300025934 Ga0207686_10147464 Ga0207686_101474642 145
377 3300025935 Ga0207709_10010217 Ga0207709_100102172 145
378 3300025945 Ga0207679_10928085 Ga0207679_109280851 145
379 3300025945 Ga0207679_11085444 Ga0207679_110854441 145
380 3300025949 Ga0207667_10019827 Ga0207667_100198274 145
381 3300025949 Ga0207667_10531939 Ga0207667_105319392 145
382 3300026041 Ga0207639_10554611 Ga0207639_105546112 145
383 3300026067 Ga0207678_10061347 Ga0207678_100613473 145
384 3300026078 Ga0207702_10723972 Ga0207702_107239721 145
385 3300026089 Ga0207648_10130406 Ga0207648_101304063 145
386 3300026116 Ga0207674_10082515 Ga0207674_100825154 145
387 3300026121 Ga0207683_10681471 Ga0207683_106814712 145
388 3300026142 Ga0207698_10150254 Ga0207698_101502543 145
389 3300030745 Ga0316182_1277600 Ga0316182_12776002 145
390 3300031548 Ga0307408_100000311 Ga0307408_10000031123 145
391 3300031911 Ga0307412_10577980 Ga0307412_105779802 145
392 3300032002 Ga0307416_100014397 Ga0307416_1000143974 145
393 3300035692 Ga0373935_0141726 Ga0373935_0141726_118_555 145
394 3300036459 Ga0372808_008597 Ga0372808_008597_825_1283 145
395 3300036534 Ga0310109_033945 Ga0310109_033945_167_625 145
396 3300037312 Ga0395899_0096515 Ga0395899_0096515_1262_1699 145
397 3300037312 Ga0395899_0149134 Ga0395899_0149134_1072_1509 145
398 3300037418 Ga0395900_0000337 Ga0395900_0000337_25515_25952 145
399 3300037418 Ga0395900_0010583 Ga0395900_0010583_1207_1644 145
400 3300037418 Ga0395900_0017217 Ga0395900_0017217_5410_5847 145
401 3300037418 Ga0395900_0069541 Ga0395900_0069541_1685_2122 145
402 3300037418 Ga0395900_0267218 Ga0395900_0267218_151_588 145
403 3300037466 Ga0395898_0064271 Ga0395898_0064271_781_1218 145
404 3300037466 Ga0395898_0090383 Ga0395898_0090383_2344_2781 145
405 3300037466 Ga0395898_0287456 Ga0395898_0287456_129_566 145
406 3300037466 Ga0395898_1070564 Ga0395898_1070564_150_587 145
407 3300037471 Ga0395905_0095396 Ga0395905_0095396_868_1305 145
408 3300037471 Ga0395905_0190391 Ga0395905_0190391_147_584 145
409 3300037471 Ga0395905_0470630 Ga0395905_0470630_409_846 145
410 3300037471 Ga0395905_0511133 Ga0395905_0511133_86_523 145
411 3300037471 Ga0395905_0659801 Ga0395905_0659801_346_783 145
412 3300037471 Ga0395905_0797259 Ga0395905_0797259_245_682 145
413 3300037471 Ga0395905_0986346 Ga0395905_0986346_158_595 145
414 3300038443 Ga0395901_0000597 Ga0395901_0000597_18734_19171 145
415 3300038443 Ga0395901_0094595 Ga0395901_0094595_1516_1953 145
416 3300038443 Ga0395901_0146485 Ga0395901_0146485_1189_1626 145
417 3300038443 Ga0395901_0195581 Ga0395901_0195581_150_587 145
418 3300038443 Ga0395901_0278048 Ga0395901_0278048_907_1344 145
419 3300038443 Ga0395901_0710847 Ga0395901_0710847_415_852 145
420 3300038443 Ga0395901_1081144 Ga0395901_1081144_192_629 145
421 3300042005 Ga0439448_0000340 Ga0439448_0000340_8522_8959 145
422 3300042005 Ga0439448_0013508 Ga0439448_0013508_1878_2315 145
423 3300042005 Ga0439448_0109091 Ga0439448_0109091_138_575 145
424 3300042005 Ga0439448_0120177 Ga0439448_0120177_260_697 145
425 3300042007 Ga0439449_0027146 Ga0439449_0027146_1096_1533 145
426 3300042008 Ga0439450_023368 Ga0439450_023368_465_902 145
427 3300042008 Ga0439450_042007 Ga0439450_042007_154_591 145
428 3300042008 Ga0439450_096966 Ga0439450_096966_46_483 145
429 3300042012 Ga0439455_0042334 Ga0439455_0042334_617_1054 145
430 3300042115 Ga0450911_017939 Ga0450911_017939_166_603 145
431 3300042134 Ga0450898_052173 Ga0450898_052173_268_759 145
432 3300042157 Ga0439458_0004623 Ga0439458_0004623_43_480 145
433 3300044656 Ga0466969_0088195 Ga0466969_0088195_28_465 145
434 3300044656 Ga0466969_0093180 Ga0466969_0093180_613_1050 145
435 3300044658 Ga0466972_0000412 Ga0466972_0000412_21374_21811 145
436 3300044658 Ga0466972_0058334 Ga0466972_0058334_549_986 145
437 3300044683 Ga0466965_0028296 Ga0466965_0028296_171_608 145
438 3300044683 Ga0466965_0040500 Ga0466965_0040500_168_605 145
439 3300044683 Ga0466965_0168049 Ga0466965_0168049_332_769 145
440 3300044683 Ga0466965_0491350 Ga0466965_0491350_195_632 145
441 3300044684 Ga0466966_0011762 Ga0466966_0011762_3833_4270 145
442 3300044684 Ga0466966_0068120 Ga0466966_0068120_615_1052 145
443 3300044684 Ga0466966_0950265 Ga0466966_0950265_40_477 145
444 3300044693 Ga0466961_0363837 Ga0466961_0363837_30_467 145
445 3300044694 Ga0466963_0069023 Ga0466963_0069023_793_1230 145
446 3300044706 Ga0466964_0010802 Ga0466964_0010802_1181_1618 145
447 3300044706 Ga0466964_0013498 Ga0466964_0013498_15_452 145
448 3300044706 Ga0466964_0191850 Ga0466964_0191850_35_472 145
449 3300044719 Ga0466971_0042616 Ga0466971_0042616_1115_1552 145
450 3300044719 Ga0466971_0311304 Ga0466971_0311304_34_471 145
451 3300044735 Ga0466968_0002554 Ga0466968_0002554_1005_1442 145
452 3300044735 Ga0466968_0299089 Ga0466968_0299089_238_675 145
453 3300044765 Ga0466970_0184693 Ga0466970_0184693_478_915 145
454 3300044765 Ga0466970_0314634 Ga0466970_0314634_168_605 145
455 3300044765 Ga0466970_0384332 Ga0466970_0384332_193_630 145
456 3300044842 Ga0466957_0000394 Ga0466957_0000394_19665_20102 145
457 3300044842 Ga0466957_0016249 Ga0466957_0016249_171_608 145
458 3300044842 Ga0466957_0042880 Ga0466957_0042880_2161_2598 145
459 3300044842 Ga0466957_0222545 Ga0466957_0222545_504_941 145
460 3300044842 Ga0466957_0448731 Ga0466957_0448731_243_680 145
461 3300044842 Ga0466957_1184236 Ga0466957_1184236_84_521 145
462 3300044901 Ga0466960_0094536 Ga0466960_0094536_979_1416 145
463 3300044901 Ga0466960_0221664 Ga0466960_0221664_309_746 145
464 3300044901 Ga0466960_0287208 Ga0466960_0287208_403_840 145
465 3300044901 Ga0466960_0485238 Ga0466960_0485238_123_560 145
466 3300044901 Ga0466960_0521380 Ga0466960_0521380_35_496 145
467 3300045836 Ga0466958_0085192 Ga0466958_0085192_381_818 145
468 3300045836 Ga0466958_0320888 Ga0466958_0320888_260_697 145
469 3300045836 Ga0466958_0365618 Ga0466958_0365618_119_556 145
470 3300045836 Ga0466958_0833524 Ga0466958_0833524_129_566 145
471 3300045836 Ga0466958_0945408 Ga0466958_0945408_74_511 145
472 3300045976 Ga0466967_0001230 Ga0466967_0001230_13331_13768 145
473 3300045976 Ga0466967_0032003 Ga0466967_0032003_3571_4008 145
474 3300045976 Ga0466967_0078034 Ga0466967_0078034_877_1314 145
475 3300045976 Ga0466967_0555244 Ga0466967_0555244_608_1045 145
476 3300046452 Ga0495617_000002 Ga0495617_000002_223873_224310 145
477 3300046453 Ga0495627_001427 Ga0495627_001427_18_488 145
478 3300046453 Ga0495627_003235 Ga0495627_003235_1464_1901 145
479 3300046455 Ga0495603_0035953 Ga0495603_0035953_1547_1984 145
480 3300046457 Ga0495590_0000007 Ga0495590_0000007_1360_1797 145
481 3300046457 Ga0495590_0000940 Ga0495590_0000940_11274_11711 145
482 3300046457 Ga0495590_0006196 Ga0495590_0006196_1107_1544 145
483 3300046457 Ga0495590_0097701 Ga0495590_0097701_288_725 145
484 3300046457 Ga0495590_0204189 Ga0495590_0204189_239_676 145
485 3300046457 Ga0495590_0260230 Ga0495590_0260230_59_496 145
486 3300046458 Ga0495591_004261 Ga0495591_004261_5305_5742 145
487 3300046458 Ga0495591_014849 Ga0495591_014849_2160_2630 145
488 3300046460 Ga0495638_0012534 Ga0495638_0012534_293_730 145
489 3300046460 Ga0495638_0431375 Ga0495638_0431375_151_588 145
490 3300046463 Ga0495653_0007199 Ga0495653_0007199_836_1351 145
491 3300046463 Ga0495653_0047254 Ga0495653_0047254_2137_2652 145
492 3300046471 Ga0495650_0000969 Ga0495650_0000969_31423_31860 145
493 3300046471 Ga0495650_0034752 Ga0495650_0034752_1740_2177 145
494 3300046472 Ga0495580_0070944 Ga0495580_0070944_1588_2103 145
495 3300046473 Ga0495582_0017641 Ga0495582_0017641_1135_1650 145
496 3300046474 Ga0495605_0001725 Ga0495605_0001725_1350_1787 145
497 3300046474 Ga0495605_0002728 Ga0495605_0002728_143_580 145
498 3300046474 Ga0495605_0033247 Ga0495605_0033247_1032_1502 145
499 3300046474 Ga0495605_0039009 Ga0495605_0039009_318_755 145
500 3300046474 Ga0495605_0055372 Ga0495605_0055372_306_743 145
501 3300046474 Ga0495605_0106870 Ga0495605_0106870_410_847 145
502 3300046474 Ga0495605_0147291 Ga0495605_0147291_29_466 145
503 3300046475 Ga0495639_0037187 Ga0495639_0037187_1424_1939 145
504 3300046477 Ga0495664_0074512 Ga0495664_0074512_664_1101 145
505 3300046491 Ga0495584_0002018 Ga0495584_0002018_1451_1888 145
506 3300046491 Ga0495584_0003124 Ga0495584_0003124_6261_6698 145
507 3300046491 Ga0495584_0004097 Ga0495584_0004097_1967_2437 145
508 3300046491 Ga0495584_0004978 Ga0495584_0004978_5421_5858 145
509 3300046491 Ga0495584_0008803 Ga0495584_0008803_534_971 145
510 3300046491 Ga0495584_0029095 Ga0495584_0029095_2170_2607 145
511 3300046491 Ga0495584_0029997 Ga0495584_0029997_1273_1710 145
512 3300046491 Ga0495584_0032837 Ga0495584_0032837_2037_2474 145
513 3300046492 Ga0495585_0007432 Ga0495585_0007432_5447_5884 145
514 3300046492 Ga0495585_0012064 Ga0495585_0012064_3198_3635 145
515 3300046492 Ga0495585_0014494 Ga0495585_0014494_3568_4005 145
516 3300046492 Ga0495585_0029018 Ga0495585_0029018_1996_2433 145
517 3300046492 Ga0495585_0034983 Ga0495585_0034983_1244_1681 145
518 3300046492 Ga0495585_0045765 Ga0495585_0045765_436_906 145
519 3300046492 Ga0495585_0072785 Ga0495585_0072785_822_1259 145
520 3300046492 Ga0495585_0138386 Ga0495585_0138386_758_1195 145
521 3300046492 Ga0495585_0256344 Ga0495585_0256344_287_724 145
522 3300046499 Ga0495594_0010644 Ga0495594_0010644_959_1396 145
523 3300046499 Ga0495594_0023395 Ga0495594_0023395_942_1379 145
524 3300046499 Ga0495594_0089879 Ga0495594_0089879_1159_1674 145
525 3300046499 Ga0495594_0125443 Ga0495594_0125443_321_758 145
526 3300046500 Ga0495596_0006747 Ga0495596_0006747_1269_1706 145
527 3300046500 Ga0495596_0013962 Ga0495596_0013962_1711_2148 145
528 3300046500 Ga0495596_0015276 Ga0495596_0015276_868_1338 145
529 3300046500 Ga0495596_0035315 Ga0495596_0035315_1257_1694 145
530 3300046500 Ga0495596_0037999 Ga0495596_0037999_1389_1826 145
531 3300046500 Ga0495596_0041037 Ga0495596_0041037_710_1147 145
532 3300046500 Ga0495596_0048534 Ga0495596_0048534_808_1245 145
533 3300046500 Ga0495596_0066072 Ga0495596_0066072_198_668 145
534 3300046500 Ga0495596_0082437 Ga0495596_0082437_52_489 145
535 3300046501 Ga0495607_0000834 Ga0495607_0000834_1210_1695 145
536 3300046501 Ga0495607_0003363 Ga0495607_0003363_157_594 145
537 3300046501 Ga0495607_0006325 Ga0495607_0006325_5422_5859 145
538 3300046501 Ga0495607_0006614 Ga0495607_0006614_2574_3011 145
539 3300046501 Ga0495607_0010586 Ga0495607_0010586_3689_4126 145
540 3300046501 Ga0495607_0015612 Ga0495607_0015612_4233_4703 145
541 3300046501 Ga0495607_0115391 Ga0495607_0115391_694_1131 145
542 3300046506 Ga0495583_0001085 Ga0495583_0001085_28044_28481 145
543 3300046506 Ga0495583_0008146 Ga0495583_0008146_1093_1530 145
544 3300046506 Ga0495583_0013210 Ga0495583_0013210_2987_3424 145
545 3300046506 Ga0495583_0024181 Ga0495583_0024181_1347_1817 145
546 3300046506 Ga0495583_0029225 Ga0495583_0029225_578_1015 145
547 3300046506 Ga0495583_0040025 Ga0495583_0040025_457_894 145
548 3300046506 Ga0495583_0085548 Ga0495583_0085548_421_858 145
549 3300046507 Ga0495606_0035211 Ga0495606_0035211_2389_2859 145
550 3300046507 Ga0495606_0051437 Ga0495606_0051437_1933_2403 145
551 3300046507 Ga0495606_0061813 Ga0495606_0061813_1444_1881 145
552 3300046507 Ga0495606_0067904 Ga0495606_0067904_1231_1701 145
553 3300046507 Ga0495606_0109703 Ga0495606_0109703_960_1397 145
554 3300046507 Ga0495606_0215779 Ga0495606_0215779_37_474 145
555 3300046512 Ga0495610_0003702 Ga0495610_0003702_6461_6898 145
556 3300046512 Ga0495610_0062898 Ga0495610_0062898_419_856 145
557 3300046512 Ga0495610_0069794 Ga0495610_0069794_627_1064 145
558 3300046513 Ga0495616_0001336 Ga0495616_0001336_249_686 145
559 3300046513 Ga0495616_0009394 Ga0495616_0009394_436_873 145
560 3300046513 Ga0495616_0014430 Ga0495616_0014430_2932_3402 145
561 3300046513 Ga0495616_0017425 Ga0495616_0017425_971_1408 145
562 3300046513 Ga0495616_0024730 Ga0495616_0024730_1427_1864 145
563 3300046513 Ga0495616_0027390 Ga0495616_0027390_433_870 145
564 3300046513 Ga0495616_0037612 Ga0495616_0037612_592_1029 145
565 3300046513 Ga0495616_0057193 Ga0495616_0057193_328_813 145
566 3300046513 Ga0495616_0063395 Ga0495616_0063395_93_530 145
567 3300046513 Ga0495616_0110213 Ga0495616_0110213_90_527 145
568 3300046513 Ga0495616_0197301 Ga0495616_0197301_123_560 145
569 3300046513 Ga0495616_0222833 Ga0495616_0222833_208_645 145
570 3300046517 Ga0495630_0009746 Ga0495630_0009746_4458_4973 145
571 3300046518 Ga0495631_0004761 Ga0495631_0004761_1739_2176 145
572 3300046518 Ga0495631_0005028 Ga0495631_0005028_5376_5813 145
573 3300046518 Ga0495631_0005442 Ga0495631_0005442_5322_5759 145
574 3300046518 Ga0495631_0005524 Ga0495631_0005524_808_1245 145
575 3300046518 Ga0495631_0015732 Ga0495631_0015732_778_1215 145
576 3300046518 Ga0495631_0037288 Ga0495631_0037288_436_873 145
577 3300046518 Ga0495631_0043721 Ga0495631_0043721_822_1292 145
578 3300046518 Ga0495631_0296950 Ga0495631_0296950_234_671 145
579 3300046519 Ga0495632_0000148 Ga0495632_0000148_60339_60776 145
580 3300046519 Ga0495632_0007100 Ga0495632_0007100_1322_1759 145
581 3300046519 Ga0495632_0007463 Ga0495632_0007463_5424_5909 145
582 3300046519 Ga0495632_0008697 Ga0495632_0008697_1330_1767 145
583 3300046519 Ga0495632_0041328 Ga0495632_0041328_1472_1909 145
584 3300046519 Ga0495632_0068087 Ga0495632_0068087_286_723 145
585 3300046519 Ga0495632_0166387 Ga0495632_0166387_203_640 145
586 3300046520 Ga0495637_0000006 Ga0495637_0000006_253120_253557 145
587 3300046520 Ga0495637_0021375 Ga0495637_0021375_445_882 145
588 3300046520 Ga0495637_0043231 Ga0495637_0043231_988_1458 145
589 3300046522 Ga0495643_0002220 Ga0495643_0002220_1219_1704 145
590 3300046522 Ga0495643_0003624 Ga0495643_0003624_1150_1635 145
591 3300046522 Ga0495643_0020278 Ga0495643_0020278_953_1390 145
592 3300046522 Ga0495643_0028825 Ga0495643_0028825_1885_2322 145
593 3300046522 Ga0495643_0310623 Ga0495643_0310623_177_614 145
594 3300046523 Ga0495644_0002343 Ga0495644_0002343_1711_2148 145
595 3300046523 Ga0495644_0002779 Ga0495644_0002779_1612_2082 145
596 3300046523 Ga0495644_0004141 Ga0495644_0004141_1374_1811 145
597 3300046523 Ga0495644_0016303 Ga0495644_0016303_1387_1824 145
598 3300046523 Ga0495644_0022329 Ga0495644_0022329_1393_1830 145
599 3300046524 Ga0495648_0015757 Ga0495648_0015757_974_1411 145
600 3300046524 Ga0495648_0024170 Ga0495648_0024170_2050_2487 145
601 3300046524 Ga0495648_0033135 Ga0495648_0033135_2489_2926 145
602 3300046524 Ga0495648_0063736 Ga0495648_0063736_1008_1478 145
603 3300046524 Ga0495648_0084832 Ga0495648_0084832_422_859 145
604 3300046524 Ga0495648_0089969 Ga0495648_0089969_1020_1490 145
605 3300046524 Ga0495648_0126998 Ga0495648_0126998_727_1164 145
606 3300046524 Ga0495648_0171750 Ga0495648_0171750_39_476 145
607 3300046524 Ga0495648_0278196 Ga0495648_0278196_229_666 145
608 3300046524 Ga0495648_0310964 Ga0495648_0310964_155_592 145
609 3300046525 Ga0495663_0107264 Ga0495663_0107264_108_578 145
610 3300046526 Ga0495666_0000744 Ga0495666_0000744_3085_3600 145
611 3300046528 Ga0495642_0000569 Ga0495642_0000569_11617_12054 145
612 3300046528 Ga0495642_0003114 Ga0495642_0003114_1294_1731 145
613 3300046528 Ga0495642_0011383 Ga0495642_0011383_2150_2587 145
614 3300046528 Ga0495642_0013582 Ga0495642_0013582_1687_2124 145
615 3300046528 Ga0495642_0015875 Ga0495642_0015875_1705_2142 145
616 3300046528 Ga0495642_0028613 Ga0495642_0028613_1390_1827 145
617 3300046528 Ga0495642_0034709 Ga0495642_0034709_468_938 145
618 3300046528 Ga0495642_0119075 Ga0495642_0119075_100_537 145
619 3300046528 Ga0495642_0232852 Ga0495642_0232852_103_540 145
620 3300046529 Ga0495652_0199498 Ga0495652_0199498_955_1470 145
621 3300046530 Ga0495654_0009322 Ga0495654_0009322_4045_4482 145
622 3300046530 Ga0495654_0019833 Ga0495654_0019833_653_1090 145
623 3300046530 Ga0495654_0051828 Ga0495654_0051828_1252_1689 145
624 3300046530 Ga0495654_0102276 Ga0495654_0102276_469_906 145
625 3300046531 Ga0495665_0053057 Ga0495665_0053057_258_773 145
626 3300046533 Ga0495640_0332240 Ga0495640_0332240_344_781 145
627 3300046535 Ga0495586_0030119 Ga0495586_0030119_1953_2468 145
628 3300046535 Ga0495586_0114323 Ga0495586_0114323_976_1413 145
629 3300046536 Ga0495587_0404604 Ga0495587_0404604_164_679 145
630 3300046538 Ga0495609_0000002 Ga0495609_0000002_13555_13992 145
631 3300046538 Ga0495609_0000522 Ga0495609_0000522_28940_29377 145
632 3300046538 Ga0495609_0006979 Ga0495609_0006979_481_918 145
633 3300046538 Ga0495609_0032295 Ga0495609_0032295_1544_2014 145
634 3300046538 Ga0495609_0263611 Ga0495609_0263611_184_621 145
635 3300046538 Ga0495609_0325757 Ga0495609_0325757_65_502 145
636 3300046542 Ga0495597_0001858 Ga0495597_0001858_1045_1515 145
637 3300046542 Ga0495597_0005167 Ga0495597_0005167_1163_1600 145
638 3300046542 Ga0495597_0009834 Ga0495597_0009834_1033_1470 145
639 3300046542 Ga0495597_0083286 Ga0495597_0083286_380_865 145
640 3300046542 Ga0495597_0094028 Ga0495597_0094028_471_908 145
641 3300046542 Ga0495597_0198054 Ga0495597_0198054_38_475 145
642 3300046542 Ga0495597_0350683 Ga0495597_0350683_95_532 145
643 3300046543 Ga0495645_0129125 Ga0495645_0129125_390_827 145
644 3300046557 Ga0495622_0033569 Ga0495622_0033569_399_836 145
645 3300046557 Ga0495622_0214449 Ga0495622_0214449_227_742 145
646 3300046558 Ga0495633_0005314 Ga0495633_0005314_174_611 145
647 3300046558 Ga0495633_0006247 Ga0495633_0006247_5238_5675 145
648 3300046558 Ga0495633_0006628 Ga0495633_0006628_960_1397 145
649 3300046558 Ga0495633_0038303 Ga0495633_0038303_741_1211 145
650 3300046558 Ga0495633_0043296 Ga0495633_0043296_984_1421 145
651 3300046558 Ga0495633_0079790 Ga0495633_0079790_241_678 145
652 3300046558 Ga0495633_0123935 Ga0495633_0123935_27_464 145
653 3300046615 Ga0495656_0015023 Ga0495656_0015023_1335_1772 145
654 3300046615 Ga0495656_0074870 Ga0495656_0074870_871_1308 145
655 3300046615 Ga0495656_0155276 Ga0495656_0155276_174_611 145
656 3300046615 Ga0495656_0237023 Ga0495656_0237023_143_580 145
657 3300046615 Ga0495656_0245225 Ga0495656_0245225_138_575 145
658 3300046615 Ga0495656_0287665 Ga0495656_0287665_74_511 145
659 3300046616 Ga0495668_0000049 Ga0495668_0000049_202310_202747 145
660 3300046616 Ga0495668_0001558 Ga0495668_0001558_19625_20062 145
661 3300046616 Ga0495668_0001735 Ga0495668_0001735_18263_18700 145
662 3300046616 Ga0495668_0007257 Ga0495668_0007257_1292_1729 145
663 3300046616 Ga0495668_0009224 Ga0495668_0009224_4672_5142 145
664 3300046616 Ga0495668_0020897 Ga0495668_0020897_933_1370 145
665 3300046616 Ga0495668_0027726 Ga0495668_0027726_1618_2055 145
666 3300046616 Ga0495668_0054902 Ga0495668_0054902_1659_2096 145
667 3300046642 Ga0495634_0058211 Ga0495634_0058211_931_1446 145
668 3300046648 Ga0495611_0000309 Ga0495611_0000309_1720_2157 145
669 3300046648 Ga0495611_0001771 Ga0495611_0001771_3179_3616 145
670 3300046648 Ga0495611_0004407 Ga0495611_0004407_4852_5289 145
671 3300046648 Ga0495611_0010876 Ga0495611_0010876_849_1286 145
672 3300046648 Ga0495611_0037824 Ga0495611_0037824_1457_1894 145
673 3300046648 Ga0495611_0075955 Ga0495611_0075955_238_708 145
674 3300046660 Ga0495625_0014069 Ga0495625_0014069_5561_5998 145
675 3300046660 Ga0495625_0028518 Ga0495625_0028518_2616_3053 145
676 3300046660 Ga0495625_0039495 Ga0495625_0039495_1327_1764 145
677 3300046660 Ga0495625_0076032 Ga0495625_0076032_1881_2318 145
678 3300046660 Ga0495625_0090689 Ga0495625_0090689_151_588 145
679 3300046660 Ga0495625_0257858 Ga0495625_0257858_607_1044 145
680 3300046664 Ga0495659_0000098 Ga0495659_0000098_10726_11163 145
681 3300046664 Ga0495659_0006084 Ga0495659_0006084_1913_2350 145
682 3300046664 Ga0495659_0343928 Ga0495659_0343928_103_585 145
683 3300046665 Ga0495661_0011074 Ga0495661_0011074_233_670 145
684 3300046665 Ga0495661_0014162 Ga0495661_0014162_1562_1999 145
685 3300046665 Ga0495661_0023349 Ga0495661_0023349_1006_1443 145
686 3300046665 Ga0495661_0031136 Ga0495661_0031136_1862_2299 145
687 3300046665 Ga0495661_0032557 Ga0495661_0032557_2574_3011 145
688 3300046665 Ga0495661_0033952 Ga0495661_0033952_1047_1532 145
689 3300046665 Ga0495661_0041378 Ga0495661_0041378_172_609 145
690 3300046665 Ga0495661_0042605 Ga0495661_0042605_888_1325 145
691 3300046665 Ga0495661_0043846 Ga0495661_0043846_1274_1711 145
692 3300046665 Ga0495661_0060592 Ga0495661_0060592_1304_1774 145
693 3300046665 Ga0495661_0067504 Ga0495661_0067504_234_671 145
694 3300046665 Ga0495661_0078056 Ga0495661_0078056_858_1328 145
695 3300046665 Ga0495661_0094846 Ga0495661_0094846_241_678 145
696 3300046665 Ga0495661_0100993 Ga0495661_0100993_714_1151 145
697 3300046665 Ga0495661_0102976 Ga0495661_0102976_861_1298 145
698 3300046665 Ga0495661_0232685 Ga0495661_0232685_454_924 145
699 3300046665 Ga0495661_0315704 Ga0495661_0315704_39_476 145
700 3300046665 Ga0495661_0489791 Ga0495661_0489791_82_519 145
701 3300046674 Ga0495588_0000135 Ga0495588_0000135_115516_115953 145
702 3300046674 Ga0495588_0021690 Ga0495588_0021690_731_1168 145
703 3300046674 Ga0495588_0027852 Ga0495588_0027852_1034_1471 145
704 3300046674 Ga0495588_0109238 Ga0495588_0109238_736_1251 145
705 3300046674 Ga0495588_0124617 Ga0495588_0124617_428_898 145
706 3300046674 Ga0495588_0387781 Ga0495588_0387781_246_683 145
707 3300046674 Ga0495588_0554448 Ga0495588_0554448_132_569 145
708 3300046679 Ga0495623_0042373 Ga0495623_0042373_1447_1962 145
709 3300046680 Ga0495646_0142442 Ga0495646_0142442_708_1223 145
710 3300046684 Ga0495669_0000418 Ga0495669_0000418_1390_1827 145
711 3300046684 Ga0495669_0010842 Ga0495669_0010842_2418_2855 145
712 3300046684 Ga0495669_0016839 Ga0495669_0016839_1323_1760 145
713 3300046684 Ga0495669_0043868 Ga0495669_0043868_811_1248 145
714 3300046684 Ga0495669_0046897 Ga0495669_0046897_182_652 145
715 3300046684 Ga0495669_0049532 Ga0495669_0049532_218_655 145
716 3300046684 Ga0495669_0065511 Ga0495669_0065511_437_874 145
717 3300046691 Ga0495670_0015322 Ga0495670_0015322_209_646 145
718 3300046691 Ga0495670_0050606 Ga0495670_0050606_1099_1569 145
719 3300046691 Ga0495670_0064745 Ga0495670_0064745_1043_1480 145
720 3300046691 Ga0495670_0219178 Ga0495670_0219178_71_541 145
721 3300046691 Ga0495670_0225224 Ga0495670_0225224_454_891 145
722 3300046691 Ga0495670_0246717 Ga0495670_0246717_459_896 145
723 3300046692 Ga0495671_0000522 Ga0495671_0000522_27257_27694 145
724 3300046692 Ga0495671_0004896 Ga0495671_0004896_6044_6481 145
725 3300046692 Ga0495671_0021644 Ga0495671_0021644_80_517 145
726 3300046692 Ga0495671_0310795 Ga0495671_0310795_228_665 145
727 3300046694 Ga0495649_0000625 Ga0495649_0000625_863_1300 145
728 3300046694 Ga0495649_0005216 Ga0495649_0005216_406_843 145
729 3300046694 Ga0495649_0008026 Ga0495649_0008026_430_867 145
730 3300046694 Ga0495649_0075218 Ga0495649_0075218_516_953 145
731 3300046694 Ga0495649_0192314 Ga0495649_0192314_601_1038 145
732 3300046694 Ga0495649_0216605 Ga0495649_0216605_399_836 145
733 3300046794 Ga0495589_0000353 Ga0495589_0000353_631_1068 145
734 3300046794 Ga0495589_0001512 Ga0495589_0001512_786_1223 145
735 3300046794 Ga0495589_0002800 Ga0495589_0002800_6039_6476 145
736 3300046794 Ga0495589_0004825 Ga0495589_0004825_1616_2053 145
737 3300046794 Ga0495589_0008572 Ga0495589_0008572_1233_1703 145
738 3300046794 Ga0495589_0012156 Ga0495589_0012156_1989_2459 145
739 3300046794 Ga0495589_0119006 Ga0495589_0119006_606_1043 145
740 3300046794 Ga0495589_0180740 Ga0495589_0180740_379_816 145
741 3300046794 Ga0495589_0191183 Ga0495589_0191183_274_711 145
742 3300046809 Ga0495600_0060647 Ga0495600_0060647_1534_2049 145
743 3300046810 Ga0495660_0000103 Ga0495660_0000103_76048_76485 145
744 3300046810 Ga0495660_0003819 Ga0495660_0003819_6249_6686 145
745 3300046810 Ga0495660_0013708 Ga0495660_0013708_1312_1782 145
746 3300046810 Ga0495660_0024276 Ga0495660_0024276_1128_1565 145
747 3300046810 Ga0495660_0035176 Ga0495660_0035176_1312_1749 145
748 3300046810 Ga0495660_0054077 Ga0495660_0054077_143_580 145
749 3300046810 Ga0495660_0060435 Ga0495660_0060435_421_858 145
750 3300046810 Ga0495660_0102345 Ga0495660_0102345_730_1167 145
751 3300047315 Ga0495581_0364854 Ga0495581_0364854_164_679 145
752 3300047318 Ga0495636_0001265 Ga0495636_0001265_8367_8804 145
753 3300047318 Ga0495636_0003721 Ga0495636_0003721_1716_2153 145
754 3300047318 Ga0495636_0079855 Ga0495636_0079855_48_485 145
755 3300047318 Ga0495636_0084274 Ga0495636_0084274_585_1022 145
756 3300047320 Ga0495672_0000118 Ga0495672_0000118_7025_7462 145
757 3300047320 Ga0495672_0000287 Ga0495672_0000287_33807_34244 145
758 3300047320 Ga0495672_0003619 Ga0495672_0003619_949_1386 145
759 3300047320 Ga0495672_0119976 Ga0495672_0119976_909_1346 145
760 3300047320 Ga0495672_0230055 Ga0495672_0230055_422_892 145
761 3300047321 Ga0495676_0000627 Ga0495676_0000627_1629_2099 145
762 3300047323 Ga0495683_0005242 Ga0495683_0005242_5322_5759 145
763 3300047323 Ga0495683_0005405 Ga0495683_0005405_2999_3436 145
764 3300047323 Ga0495683_0025633 Ga0495683_0025633_1443_1913 145
765 3300047323 Ga0495683_0034591 Ga0495683_0034591_581_1051 145
766 3300047323 Ga0495683_0473340 Ga0495683_0473340_57_494 145
767 3300047443 Ga0495687_000047 Ga0495687_000047_204800_205237 145
768 3300047443 Ga0495687_000166 Ga0495687_000166_16139_16576 145
769 3300047443 Ga0495687_018829 Ga0495687_018829_1442_1879 145
770 3300047443 Ga0495687_024581 Ga0495687_024581_1334_1771 145
771 3300047443 Ga0495687_041822 Ga0495687_041822_1394_1831 145
772 3300047443 Ga0495687_090705 Ga0495687_090705_147_584 145
773 3300047444 Ga0495675_0030262 Ga0495675_0030262_888_1403 145
774 3300047444 Ga0495675_0075202 Ga0495675_0075202_16_531 145
775 3300047445 Ga0495677_0000074 Ga0495677_0000074_15982_16419 145
776 3300047445 Ga0495677_0000920 Ga0495677_0000920_10038_10475 145
777 3300047445 Ga0495677_0001632 Ga0495677_0001632_7692_8129 145
778 3300047445 Ga0495677_0005519 Ga0495677_0005519_3120_3557 145
779 3300047445 Ga0495677_0017567 Ga0495677_0017567_1135_1572 145
780 3300047445 Ga0495677_0021851 Ga0495677_0021851_115_552 145
781 3300047445 Ga0495677_0034368 Ga0495677_0034368_38_475 145
782 3300047445 Ga0495677_0034631 Ga0495677_0034631_464_901 145
783 3300047445 Ga0495677_0216899 Ga0495677_0216899_258_695 145
784 3300047446 Ga0495679_007964 Ga0495679_007964_1715_2152 145
785 3300047446 Ga0495679_012140 Ga0495679_012140_942_1379 145
786 3300047446 Ga0495679_018946 Ga0495679_018946_1015_1452 145
787 3300047446 Ga0495679_068310 Ga0495679_068310_549_986 145
788 3300047446 Ga0495679_122076 Ga0495679_122076_257_694 145
789 3300047447 Ga0495685_004856 Ga0495685_004856_3001_3471 145
790 3300047447 Ga0495685_016653 Ga0495685_016653_1802_2239 145
791 3300047470 Ga0495681_0002867 Ga0495681_0002867_9637_10074 145
792 3300047470 Ga0495681_0003198 Ga0495681_0003198_10059_10496 145
793 3300047470 Ga0495681_0009476 Ga0495681_0009476_145_615 145
794 3300047470 Ga0495681_0023512 Ga0495681_0023512_1729_2166 145
795 3300047470 Ga0495681_0031160 Ga0495681_0031160_2036_2473 145
796 3300047470 Ga0495681_0202704 Ga0495681_0202704_71_541 145
797 3300047472 Ga0495686_0000835 Ga0495686_0000835_37801_38238 145
798 3300047472 Ga0495686_0006193 Ga0495686_0006193_5180_5617 145
799 3300047472 Ga0495686_0006400 Ga0495686_0006400_3788_4225 145
800 3300047472 Ga0495686_0029229 Ga0495686_0029229_1377_1814 145
801 3300047472 Ga0495686_0078442 Ga0495686_0078442_1023_1460 145
802 3300047472 Ga0495686_0089005 Ga0495686_0089005_434_871 145
803 3300047472 Ga0495686_0133635 Ga0495686_0133635_295_732 145
804 3300047673 Ga0495593_0051146 Ga0495593_0051146_902_1339 145
805 3300048088 Ga0495602_0042177 Ga0495602_0042177_1003_1440 145
806 3300048089 Ga0495614_0075094 Ga0495614_0075094_303_818 145
807 3300048091 Ga0495626_0000006 Ga0495626_0000006_163862_164299 145
808 3300048091 Ga0495626_0000034 Ga0495626_0000034_13495_13932 145
809 3300048091 Ga0495626_0005441 Ga0495626_0005441_1635_2072 145
810 3300048091 Ga0495626_0006165 Ga0495626_0006165_179_616 145
811 3300048091 Ga0495626_0006352 Ga0495626_0006352_5158_5643 145
812 3300048091 Ga0495626_0010572 Ga0495626_0010572_2923_3360 145
813 3300048091 Ga0495626_0019151 Ga0495626_0019151_2152_2622 145
814 3300048091 Ga0495626_0029193 Ga0495626_0029193_177_614 145
815 3300048091 Ga0495626_0043239 Ga0495626_0043239_1137_1574 145
816 3300048091 Ga0495626_0053956 Ga0495626_0053956_995_1465 145
817 3300048091 Ga0495626_0137375 Ga0495626_0137375_47_484 145
818 3300048903 Ga0496100_0424293 Ga0496100_0424293_443_880 145
819 3300048904 Ga0496101_0118146 Ga0496101_0118146_1341_1778 145
820 3300048904 Ga0496101_1405113 Ga0496101_1405113_89_526 145
821 3300048905 Ga0496102_0010040 Ga0496102_0010040_1429_1866 145
822 3300048905 Ga0496102_0197528 Ga0496102_0197528_1228_1665 145
823 3300048905 Ga0496102_0653733 Ga0496102_0653733_308_745 145
824 3300048905 Ga0496102_0679713 Ga0496102_0679713_96_533 145
825 3300048905 Ga0496102_0759295 Ga0496102_0759295_172_609 145
826 3300048906 Ga0496103_0071730 Ga0496103_0071730_810_1247 145
827 3300048906 Ga0496103_0151577 Ga0496103_0151577_887_1324 145
828 3300048906 Ga0496103_0179680 Ga0496103_0179680_18_455 145
829 3300048906 Ga0496103_0207447 Ga0496103_0207447_663_1100 145
830 3300048906 Ga0496103_0247560 Ga0496103_0247560_233_670 145
831 3300048907 Ga0496104_0066589 Ga0496104_0066589_990_1427 145
832 3300048907 Ga0496104_0201582 Ga0496104_0201582_22_459 145
833 3300048908 Ga0496105_0541225 Ga0496105_0541225_58_495 145
834 3300048909 Ga0496106_0004987 Ga0496106_0004987_763_1200 145
835 3300048909 Ga0496106_0176687 Ga0496106_0176687_395_865 145
836 3300048909 Ga0496106_0451959 Ga0496106_0451959_393_830 145
837 3300048910 Ga0496107_0012714 Ga0496107_0012714_1500_1970 145
838 3300048910 Ga0496107_0101165 Ga0496107_0101165_417_854 145
839 3300048911 Ga0496108_0929699 Ga0496108_0929699_224_661 145
840 3300048912 Ga0496109_0034146 Ga0496109_0034146_3113_3550 145
841 3300048912 Ga0496109_0339540 Ga0496109_0339540_245_682 145
842 3300048912 Ga0496109_0402299 Ga0496109_0402299_48_485 145
843 3300048912 Ga0496109_0724705 Ga0496109_0724705_278_748 145
844 3300048913 Ga0496110_0018489 Ga0496110_0018489_5241_5678 145
845 3300048914 Ga0496111_0125865 Ga0496111_0125865_350_787 145
846 3300048914 Ga0496111_0810019 Ga0496111_0810019_123_560 145
847 3300048915 Ga0496112_0279929 Ga0496112_0279929_213_650 145
848 3300048915 Ga0496112_0473321 Ga0496112_0473321_362_799 145
849 3300048916 Ga0496113_0024113 Ga0496113_0024113_2757_3194 145
850 3300048916 Ga0496113_0572695 Ga0496113_0572695_37_474 145
851 3300048917 Ga0496114_0178228 Ga0496114_0178228_1119_1556 145
852 3300048918 Ga0496115_0406788 Ga0496115_0406788_626_1063 145
853 3300048919 Ga0496116_0331977 Ga0496116_0331977_211_648 145
854 3300048924 Ga0496121_0078704 Ga0496121_0078704_1312_1749 145
855 3300048925 Ga0496122_0003245 Ga0496122_0003245_449_886 145
856 3300048925 Ga0496122_0015414 Ga0496122_0015414_1422_1859 145
857 3300048925 Ga0496122_0267307 Ga0496122_0267307_21_491 145
858 3300048926 Ga0496123_0013411 Ga0496123_0013411_5441_5878 145
859 3300048926 Ga0496123_0015341 Ga0496123_0015341_5142_5579 145
860 3300048926 Ga0496123_0050901 Ga0496123_0050901_1815_2252 145
861 3300048927 Ga0496124_0026676 Ga0496124_0026676_377_814 145
862 3300048927 Ga0496124_0084722 Ga0496124_0084722_1999_2436 145
863 3300048927 Ga0496124_0086232 Ga0496124_0086232_2014_2451 145
864 3300048927 Ga0496124_0087250 Ga0496124_0087250_1535_1972 145
865 3300048927 Ga0496124_0094902 Ga0496124_0094902_1061_1498 145
866 3300048927 Ga0496124_0102421 Ga0496124_0102421_1718_2155 145
867 3300048928 Ga0496125_0007861 Ga0496125_0007861_3112_3549 145
868 3300048928 Ga0496125_0105869 Ga0496125_0105869_156_593 145
869 3300048928 Ga0496125_0553867 Ga0496125_0553867_111_548 145
870 3300048929 Ga0496126_0145302 Ga0496126_0145302_270_707 145
871 3300049127 Ga0501306_018117 Ga0501306_018117_19_456 145
872 3300049128 Ga0501308_000946 Ga0501308_000946_1290_1727 145
873 3300049128 Ga0501308_018674 Ga0501308_018674_225_662 145
874 3300049160 Ga0501304_000167 Ga0501304_000167_1258_1695 145
875 3300049162 Ga0501307_006020 Ga0501307_006020_842_1279 145
876 3300049162 Ga0501307_007028 Ga0501307_007028_91_528 145
877 3300049459 Ga0495678_000113 Ga0495678_000113_1245_1682 145
878 3300049459 Ga0495678_000601 Ga0495678_000601_1301_1771 145
879 3300049459 Ga0495678_010011 Ga0495678_010011_145_615 145
880 3300049459 Ga0495678_020985 Ga0495678_020985_1820_2257 145
881 3300049459 Ga0495678_076538 Ga0495678_076538_79_516 145
882 3300049460 Ga0495682_0003524 Ga0495682_0003524_5403_5873 145
883 3300049460 Ga0495682_0006018 Ga0495682_0006018_3543_3980 145
884 3300049460 Ga0495682_0009817 Ga0495682_0009817_2288_2758 145
885 3300049460 Ga0495682_0014169 Ga0495682_0014169_759_1196 145
886 3300049460 Ga0495682_0065817 Ga0495682_0065817_449_886 145
887 3300049527 Ga0501311_004404 Ga0501311_004404_67_549 145
888 3300049529 Ga0501313_006175 Ga0501313_006175_705_1142 145
889 3300049531 Ga0501315_002695 Ga0501315_002695_866_1303 145
890 3300049531 Ga0501315_006164 Ga0501315_006164_12_449 145
891 3300049531 Ga0501315_035017 Ga0501315_035017_98_535 145
892 3300049532 Ga0501316_004314 Ga0501316_004314_150_587 145
893 3300049532 Ga0501316_032082 Ga0501316_032082_15_452 145
894 3300049534 Ga0501318_020518 Ga0501318_020518_154_591 145
895 3300049539 Ga0501323_008593 Ga0501323_008593_741_1178 145
896 3300049652 Ga0501202_050767 Ga0501202_050767_140_622 145
897 3300049654 Ga0501207_023247 Ga0501207_023247_229_666 145
898 3300049665 Ga0501227_002378 Ga0501227_002378_2485_2967 145
899 3300049665 Ga0501227_021046 Ga0501227_021046_173_655 145
900 3300049760 Ga0501263_034297 Ga0501263_034297_82_564 145
901 3300049775 Ga0501279_003747 Ga0501279_003747_1199_1681 145
902 3300049775 Ga0501279_004114 Ga0501279_004114_1255_1737 145
903 3300049775 Ga0501279_011654 Ga0501279_011654_569_1006 145
904 3300049822 Ga0501035_0004747 Ga0501035_0004747_3048_3485 145
905 3300049853 Ga0501226_012002 Ga0501226_012002_106_543 145
906 3300053103 Ga0500555_014711 Ga0500555_014711_1657_2115 145
907 3300053121 Ga0500607_000615 Ga0500607_000615_26588_27046 145
908 3300053121 Ga0500607_008419 Ga0500607_008419_1751_2242 145
909 3300053136 Ga0500559_0226021 Ga0500559_0226021_65_556 145
910 3300053177 Ga0500636_0001052 Ga0500636_0001052_6901_7392 145
911 3300053178 Ga0500637_0092525 Ga0500637_0092525_458_949 145
912 3300053729 Ga0500625_119963 Ga0500625_119963_65_556 145
913 3300059477 Ga0587084_014618 Ga0587084_014618_553_990 145
914 3300059490 Ga0587066_053972 Ga0587066_053972_265_702 145
915 3300059491 Ga0587070_070430 Ga0587070_070430_110_580 145
916 3300059492 Ga0587073_0049366 Ga0587073_0049366_71_508 145
917 3300059493 Ga0587077_057286 Ga0587077_057286_120_590 145
918 3300059504 Ga0587082_017491 Ga0587082_017491_402_839 145
919 3300059505 Ga0587083_0002352 Ga0587083_0002352_1253_1690 145
920 3300059505 Ga0587083_0041313 Ga0587083_0041313_407_844 145
921 3300059508 Ga0587088_002623 Ga0587088_002623_1306_1776 145
922 3300059511 Ga0587091_020084 Ga0587091_020084_217_654 145
923 3300059605 Ga0587106_001842 Ga0587106_001842_226_696 145
924 3300059605 Ga0587106_006419 Ga0587106_006419_718_1155 145
925 3300059623 Ga0587101_020970 Ga0587101_020970_218_688 145
926 3300059641 Ga0587068_002833 Ga0587068_002833_1416_1886 145
927 3300059643 Ga0587072_027254 Ga0587072_027254_487_924 145
928 3300059645 Ga0587076_051532 Ga0587076_051532_213_683 145
929 3300059647 Ga0587079_025914 Ga0587079_025914_321_758 145
930 3300059649 Ga0587102_005752 Ga0587102_005752_254_691 145
931 3300059651 Ga0587105_001963 Ga0587105_001963_338_808 145
932 3300061719 Ga0466962_0050633 Ga0466962_0050633_383_820 145
933 3300061719 Ga0466962_0156304 Ga0466962_0156304_278_715 145
934 iso_pu_bacteria 2643221556 2643797775 145
935 iso_pu_bacteria 2643221684 2644472953 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

30

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uqr-assembly1.cif.gz_I type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae 0.9937 3 144
6hs9-assembly1.cif.gz_A the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 0.9862 2 141
3kip-assembly3.cif.gz_I crystal structure of type-ii 3-dehydroquinase from c. albicans 0.9856 1 142
1uqr-assembly1.cif.gz_F type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae 0.9824 3 144
4l8l-assembly1.cif.gz_A crystal structure of the type ii dehydroquinase from pseudomonas aeruginosa 0.9813 3 144
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9653 4 143 3.40.50.9100
3kipN00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9653 1 143 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9646 3 143 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9596 4 143 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9446 4 143 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A7L5YE95-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1.002 1 144 GO:0003855
GO:0003989
GO:0006633
GO:0008652
GO:0009073
GO:0009317
GO:0009423
GO:0019631
AF-W0V249-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1.002 29 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A522IQJ0-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 1.002 34 143 GO:0003855
GO:0009423
GO:0019631
AF-A0A855HS84-F1-model_v4 deleted 1.001 29 144
AF-A4VPK2-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1 3 144 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Feature Viewer

pLDDT pTM Quality
94.81 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map