F486169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 360 | 919 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300046463|Ga0495653_0007199|Ga0495653_0007199_836_1351 |
| Length | 171 |
| Sequence | LWRFLSLANTKRWRQNACLSGKQTVNMAKKLLLLNGPNLNLLGTREPAVYGATTLADIENAAVAQAQAAGATLACFQSNHEGALIDRIHAARQEGVNAIVINPGGLTHTSVALRDALAGVDIPFVEVHISNIYKREEFRHHSFLSAIAQGTICGLGADGYRFAIDFALKQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 2 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 3 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 4 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 5 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 6 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 7 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 8 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 9 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 10 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 11 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 12 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 13 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 14 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 15 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 16 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 19 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 20 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 21 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 27 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 28 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 135 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 162 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 172 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 173 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 176 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 177 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 178 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 179 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 180 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 293 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 294 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 295 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 320 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 321 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 325 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 326 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 334 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 335 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 339 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 340 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 359 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 360 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.9 |
| Metatranscriptomes | 4.39 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.84 |
| Nodule | 0.11 |
| Rhizoplane | 3.96 |
| Rhizosphere | 84.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1001655 | 3300002739 | Bacteria | 3836 |
| 2 | JGI25157J39369_1017589 | 3300002741 | Bacteria | 866 |
| 3 | JGI25152J39213_1000245 | 3300002773 | Bacteria | 36283 |
| 4 | JGI25150J39212_1028710 | 3300002774 | Bacteria | 786 |
| 5 | JGI25159J45721_1005640 | 3300002987 | Bacteria | 3896 |
| 6 | JGI25159J45721_1012666 | 3300002987 | Bacteria | 1998 |
| 7 | Ga0006759J45824_1068122 | 3300003163 | Bacteria | 1302 |
| 8 | JGI25153J46596_10001778 | 3300003215 | Bacteria | 12789 |
| 9 | rootH2_10032765 | 3300003320 | Bacteria | 31514 |
| 10 | rootL2_10002967 | 3300003322 | Bacteria | 10018 |
| 11 | rootL2_10002968 | 3300003322 | Bacteria | 4025 |
| 12 | rootH1_10071921 | 3300003323 | Bacteria | 4391 |
| 13 | JGI25160J50197_1003487 | 3300003354 | Bacteria | 7022 |
| 14 | JGI25161J50226_1003103 | 3300003374 | Bacteria | 3958 |
| 15 | Ga0007409J51694_1013231 | 3300003575 | Bacteria | 3960 |
| 16 | Ga0032354_1046455 | 3300003693 | Bacteria | 2324 |
| 17 | Ga0055526_1000556 | 3300003771 | Bacteria | 29488 |
| 18 | Ga0055526_1024738 | 3300003771 | Bacteria | 1951 |
| 19 | Ga0055537_1000056 | 3300003773 | Bacteria | 81623 |
| 20 | Ga0055524_1003233 | 3300003775 | Bacteria | 7979 |
| 21 | Ga0055534_1000178 | 3300003784 | Bacteria | 46872 |
| 22 | Ga0055534_1009222 | 3300003784 | Bacteria | 2162 |
| 23 | Ga0055528_1000297 | 3300003790 | Bacteria | 42261 |
| 24 | Ga0055528_1003822 | 3300003790 | Bacteria | 7410 |
| 25 | Ga0055530_10013759 | 3300003791 | Bacteria | 2741 |
| 26 | Ga0055531_10012000 | 3300003794 | Bacteria | 4115 |
| 27 | Ga0055543_1001330 | 3300004625 | Bacteria | 10091 |
| 28 | Ga0065165_1000447 | 3300005262 | Bacteria | 64800 |
| 29 | Ga0065165_1000986 | 3300005262 | Bacteria | 35247 |
| 30 | Ga0065165_1041456 | 3300005262 | Bacteria | 1367 |
| 31 | Ga0065714_10008115 | 3300005288 | Bacteria | 3585 |
| 32 | Ga0070658_10245369 | 3300005327 | Bacteria | 1519 |
| 33 | Ga0070658_11467976 | 3300005327 | Bacteria | 591 |
| 34 | Ga0070683_100045537 | 3300005329 | Bacteria | 4049 |
| 35 | Ga0070683_100371247 | 3300005329 | Bacteria | 1363 |
| 36 | Ga0070690_100327819 | 3300005330 | Bacteria | 1105 |
| 37 | Ga0068869_100000016 | 3300005334 | Bacteria | 70440 |
| 38 | Ga0068869_100126435 | 3300005334 | Bacteria | 1960 |
| 39 | Ga0068868_100064487 | 3300005338 | Bacteria | 2908 |
| 40 | Ga0068868_100076914 | 3300005338 | Bacteria | 2669 |
| 41 | Ga0070660_100020896 | 3300005339 | Bacteria | 4819 |
| 42 | Ga0070660_100665185 | 3300005339 | Bacteria | 872 |
| 43 | Ga0070659_100213325 | 3300005366 | Bacteria | 1591 |
| 44 | Ga0070659_101418986 | 3300005366 | Bacteria | 617 |
| 45 | Ga0070663_100285892 | 3300005455 | Bacteria | 1316 |
| 46 | Ga0070678_100787963 | 3300005456 | Bacteria | 862 |
| 47 | Ga0070662_100047427 | 3300005457 | Bacteria | 3090 |
| 48 | Ga0070662_100287705 | 3300005457 | Bacteria | 1331 |
| 49 | Ga0070662_100922971 | 3300005457 | Bacteria | 746 |
| 50 | Ga0068867_100000872 | 3300005459 | Bacteria | 20351 |
| 51 | Ga0070679_100033921 | 3300005530 | Bacteria | 5056 |
| 52 | Ga0070679_100131647 | 3300005530 | Bacteria | 2482 |
| 53 | Ga0070665_100496715 | 3300005548 | Bacteria | 1231 |
| 54 | Ga0068855_100001020 | 3300005563 | Bacteria | 34917 |
| 55 | Ga0068855_100014744 | 3300005563 | Bacteria | 9416 |
| 56 | Ga0068855_100103246 | 3300005563 | Bacteria | 3280 |
| 57 | Ga0070664_100034159 | 3300005564 | Bacteria | 4266 |
| 58 | Ga0070664_100222706 | 3300005564 | Bacteria | 1688 |
| 59 | Ga0068856_100001534 | 3300005614 | Bacteria | 24189 |
| 60 | Ga0068856_100372840 | 3300005614 | Bacteria | 1446 |
| 61 | Ga0068859_102045715 | 3300005617 | Bacteria | 632 |
| 62 | Ga0068862_100596410 | 3300005844 | Bacteria | 1060 |
| 63 | Ga0081538_10001906 | 3300005981 | Bacteria | 20950 |
| 64 | Ga0097621_100206978 | 3300006237 | Bacteria | 1705 |
| 65 | Ga0068871_100005339 | 3300006358 | Bacteria | 9008 |
| 66 | Ga0068871_100566446 | 3300006358 | Bacteria | 1030 |
| 67 | Ga0075433_10000299 | 3300006852 | Bacteria | 29738 |
| 68 | Ga0075433_10011819 | 3300006852 | Bacteria | 7031 |
| 69 | Ga0075434_100059706 | 3300006871 | Bacteria | 3791 |
| 70 | Ga0068865_100019070 | 3300006881 | Bacteria | 4436 |
| 71 | Ga0068865_100813314 | 3300006881 | Bacteria | 807 |
| 72 | Ga0075436_100008751 | 3300006914 | Bacteria | 6924 |
| 73 | Ga0097620_102045415 | 3300006931 | Bacteria | 632 |
| 74 | Ga0075435_100199384 | 3300007076 | Bacteria | 1696 |
| 75 | Ga0105240_10240122 | 3300009093 | Bacteria | 2101 |
| 76 | Ga0105240_10345191 | 3300009093 | Bacteria | 1690 |
| 77 | Ga0105245_10031045 | 3300009098 | Bacteria | 4726 |
| 78 | Ga0105243_10008313 | 3300009148 | Bacteria | 7972 |
| 79 | Ga0105241_10151149 | 3300009174 | Bacteria | 1900 |
| 80 | Ga0105242_10033488 | 3300009176 | Bacteria | 4113 |
| 81 | Ga0105242_10255942 | 3300009176 | Bacteria | 1579 |
| 82 | Ga0105237_10223903 | 3300009545 | Bacteria | 1881 |
| 83 | Ga0105238_10242950 | 3300009551 | Bacteria | 1778 |
| 84 | Ga0105239_10009203 | 3300010375 | Eukaryota | 11170 |
| 85 | Ga0157373_10000208 | 3300013100 | Bacteria | 48082 |
| 86 | Ga0157373_10105984 | 3300013100 | Bacteria | 1977 |
| 87 | Ga0157373_10342570 | 3300013100 | Bacteria | 1065 |
| 88 | Ga0157371_10407012 | 3300013102 | Bacteria | 996 |
| 89 | Ga0157370_10245395 | 3300013104 | Bacteria | 1657 |
| 90 | Ga0157369_10285537 | 3300013105 | Bacteria | 1718 |
| 91 | Ga0157378_10189454 | 3300013297 | Bacteria | 1939 |
| 92 | Ga0157372_10001960 | 3300013307 | Bacteria | 22372 |
| 93 | Ga0157372_11062449 | 3300013307 | Bacteria | 937 |
| 94 | Ga0157372_11143060 | 3300013307 | Bacteria | 900 |
| 95 | Ga0157377_10091734 | 3300014745 | Bacteria | 1795 |
| 96 | Ga0182006_1044792 | 3300015261 | Bacteria | 1724 |
| 97 | Ga0209436_100508 | 3300025208 | Bacteria | 17011 |
| 98 | Ga0209436_100526 | 3300025208 | Bacteria | 16661 |
| 99 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 100 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 101 | Ga0207425_1000310 | 3300025245 | Bacteria | 35129 |
| 102 | Ga0209026_1001421 | 3300025250 | Bacteria | 10631 |
| 103 | Ga0209677_103454 | 3300025253 | Bacteria | 5121 |
| 104 | Ga0209148_1000607 | 3300025254 | Bacteria | 32105 |
| 105 | Ga0209129_1000009 | 3300025258 | Bacteria | 633100 |
| 106 | Ga0209129_1005452 | 3300025258 | Bacteria | 4488 |
| 107 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 108 | Ga0209565_1001590 | 3300025263 | Bacteria | 9665 |
| 109 | Ga0209565_1010430 | 3300025263 | Bacteria | 2304 |
| 110 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 111 | Ga0209673_1007274 | 3300025273 | Bacteria | 5141 |
| 112 | Ga0209130_1000437 | 3300025284 | Bacteria | 44427 |
| 113 | Ga0209130_1001628 | 3300025284 | Bacteria | 13839 |
| 114 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 115 | Ga0209675_1000890 | 3300025291 | Bacteria | 19177 |
| 116 | Ga0209564_1000085 | 3300025295 | Bacteria | 251509 |
| 117 | Ga0209564_1000146 | 3300025295 | Bacteria | 174811 |
| 118 | Ga0209564_1003895 | 3300025295 | Bacteria | 9588 |
| 119 | Ga0209758_1000047 | 3300025297 | Bacteria | 360971 |
| 120 | Ga0209050_1000064 | 3300025298 | Bacteria | 314803 |
| 121 | Ga0209050_1011525 | 3300025298 | Bacteria | 4174 |
| 122 | Ga0209050_1011744 | 3300025298 | Bacteria | 4109 |
| 123 | Ga0209256_1000179 | 3300025299 | Bacteria | 123865 |
| 124 | Ga0209256_1000428 | 3300025299 | Bacteria | 66020 |
| 125 | Ga0209256_1003975 | 3300025299 | Bacteria | 9712 |
| 126 | Ga0209256_1071941 | 3300025299 | Bacteria | 775 |
| 127 | Ga0207426_1002247 | 3300025302 | Bacteria | 12823 |
| 128 | Ga0207426_1003558 | 3300025302 | Bacteria | 8300 |
| 129 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 130 | Ga0209257_1001902 | 3300025304 | Bacteria | 22569 |
| 131 | Ga0209257_1021334 | 3300025304 | Bacteria | 2356 |
| 132 | Ga0207705_10044713 | 3300025909 | Bacteria | 3182 |
| 133 | Ga0207705_10298809 | 3300025909 | Bacteria | 1235 |
| 134 | Ga0207705_10759528 | 3300025909 | Bacteria | 753 |
| 135 | Ga0207654_10001695 | 3300025911 | Bacteria | 11514 |
| 136 | Ga0207671_10138785 | 3300025914 | Eukaryota | 1871 |
| 137 | Ga0207671_10190862 | 3300025914 | Bacteria | 1598 |
| 138 | Ga0207657_10594267 | 3300025919 | Bacteria | 864 |
| 139 | Ga0207649_10009884 | 3300025920 | Bacteria | 5229 |
| 140 | Ga0207649_11117299 | 3300025920 | Bacteria | 622 |
| 141 | Ga0207652_10668107 | 3300025921 | Bacteria | 928 |
| 142 | Ga0207687_10376025 | 3300025927 | Bacteria | 1163 |
| 143 | Ga0207690_10125276 | 3300025932 | Bacteria | 1872 |
| 144 | Ga0207706_10138620 | 3300025933 | Bacteria | 2140 |
| 145 | Ga0207706_10298538 | 3300025933 | Bacteria | 1404 |
| 146 | Ga0207706_10922525 | 3300025933 | Bacteria | 737 |
| 147 | Ga0207686_10147464 | 3300025934 | Bacteria | 1634 |
| 148 | Ga0207709_10010217 | 3300025935 | Bacteria | 5170 |
| 149 | Ga0207704_10004481 | 3300025938 | Bacteria | 6383 |
| 150 | Ga0207704_10607087 | 3300025938 | Bacteria | 896 |
| 151 | Ga0207689_10000241 | 3300025942 | Bacteria | 48763 |
| 152 | Ga0207661_10007731 | 3300025944 | Bacteria | 7652 |
| 153 | Ga0207679_10928085 | 3300025945 | Bacteria | 797 |
| 154 | Ga0207679_11085444 | 3300025945 | Bacteria | 734 |
| 155 | Ga0207667_10000896 | 3300025949 | Bacteria | 37967 |
| 156 | Ga0207667_10019827 | 3300025949 | Bacteria | 7495 |
| 157 | Ga0207667_10531939 | 3300025949 | Bacteria | 1190 |
| 158 | Ga0207667_11124227 | 3300025949 | Eukaryota | 768 |
| 159 | Ga0207677_10045655 | 3300026023 | Bacteria | 2927 |
| 160 | Ga0207639_10554611 | 3300026041 | Bacteria | 1055 |
| 161 | Ga0207678_10061347 | 3300026067 | Bacteria | 3234 |
| 162 | Ga0207702_10001475 | 3300026078 | Bacteria | 23342 |
| 163 | Ga0207702_10723972 | 3300026078 | Bacteria | 981 |
| 164 | Ga0207648_10000756 | 3300026089 | Bacteria | 36333 |
| 165 | Ga0207648_10130406 | 3300026089 | Bacteria | 2213 |
| 166 | Ga0207674_10082515 | 3300026116 | Bacteria | 3216 |
| 167 | Ga0207674_11645664 | 3300026116 | Bacteria | 610 |
| 168 | Ga0207683_10681471 | 3300026121 | Bacteria | 953 |
| 169 | Ga0207698_10150254 | 3300026142 | Bacteria | 2020 |
| 170 | Ga0268266_10484789 | 3300028379 | Bacteria | 1179 |
| 171 | Ga0265337_1006922 | 3300028556 | Bacteria | 4304 |
| 172 | Ga0265337_1007423 | 3300028556 | Bacteria | 4103 |
| 173 | Ga0265337_1021153 | 3300028556 | Bacteria | 2031 |
| 174 | Ga0265337_1131577 | 3300028556 | Bacteria | 678 |
| 175 | Ga0265319_1001015 | 3300028563 | Bacteria | 17546 |
| 176 | Ga0265319_1002638 | 3300028563 | Bacteria | 9648 |
| 177 | Ga0265319_1010821 | 3300028563 | Bacteria | 3780 |
| 178 | Ga0265319_1014782 | 3300028563 | Bacteria | 3048 |
| 179 | Ga0265319_1016186 | 3300028563 | Bacteria | 2864 |
| 180 | Ga0265319_1016890 | 3300028563 | Bacteria | 2791 |
| 181 | Ga0265319_1043748 | 3300028563 | Bacteria | 1502 |
| 182 | Ga0265334_10023332 | 3300028573 | Bacteria | 2516 |
| 183 | Ga0265318_10001407 | 3300028577 | Bacteria | 14218 |
| 184 | Ga0265318_10007120 | 3300028577 | Bacteria | 5086 |
| 185 | Ga0265318_10008469 | 3300028577 | Bacteria | 4576 |
| 186 | Ga0265318_10042058 | 3300028577 | Bacteria | 1734 |
| 187 | Ga0265318_10345107 | 3300028577 | Bacteria | 543 |
| 188 | Ga0265323_10000069 | 3300028653 | Bacteria | 56761 |
| 189 | Ga0265323_10070875 | 3300028653 | Bacteria | 1192 |
| 190 | Ga0265322_10000305 | 3300028654 | Bacteria | 20763 |
| 191 | Ga0265322_10115042 | 3300028654 | Bacteria | 766 |
| 192 | Ga0265322_10153083 | 3300028654 | Bacteria | 659 |
| 193 | Ga0265336_10010984 | 3300028666 | Bacteria | 3085 |
| 194 | Ga0265338_10000329 | 3300028800 | Bacteria | 86337 |
| 195 | Ga0265338_10020776 | 3300028800 | Bacteria | 6886 |
| 196 | Ga0265338_10072963 | 3300028800 | Bacteria | 2928 |
| 197 | Ga0265338_10075568 | 3300028800 | Bacteria | 2858 |
| 198 | Ga0265338_10455523 | 3300028800 | Bacteria | 905 |
| 199 | Ga0265338_10732948 | 3300028800 | Bacteria | 680 |
| 200 | Ga0265324_10003662 | 3300029957 | Bacteria | 7211 |
| 201 | Ga0265324_10017110 | 3300029957 | Bacteria | 2638 |
| 202 | Ga0265324_10063104 | 3300029957 | Bacteria | 1265 |
| 203 | Ga0316182_1277600 | 3300030745 | Bacteria | 1057 |
| 204 | Ga0265330_10095838 | 3300031235 | Bacteria | 1272 |
| 205 | Ga0265330_10109542 | 3300031235 | Unclassified | 1180 |
| 206 | Ga0265332_10049693 | 3300031238 | Bacteria | 1803 |
| 207 | Ga0265328_10055459 | 3300031239 | Bacteria | 1454 |
| 208 | Ga0265320_10000515 | 3300031240 | Bacteria | 29979 |
| 209 | Ga0265320_10000735 | 3300031240 | Bacteria | 25059 |
| 210 | Ga0265320_10001485 | 3300031240 | Bacteria | 17124 |
| 211 | Ga0265320_10002038 | 3300031240 | Bacteria | 14226 |
| 212 | Ga0265320_10017525 | 3300031240 | Bacteria | 3973 |
| 213 | Ga0265320_10022073 | 3300031240 | Bacteria | 3412 |
| 214 | Ga0265320_10030912 | 3300031240 | Bacteria | 2755 |
| 215 | Ga0265325_10024461 | 3300031241 | Bacteria | 3286 |
| 216 | Ga0265340_10014689 | 3300031247 | Bacteria | 4084 |
| 217 | Ga0265339_10051665 | 3300031249 | Bacteria | 2242 |
| 218 | Ga0265339_10061599 | 3300031249 | Bacteria | 2019 |
| 219 | Ga0265331_10042698 | 3300031250 | Bacteria | 2199 |
| 220 | Ga0265331_10043625 | 3300031250 | Bacteria | 2171 |
| 221 | Ga0265327_10019749 | 3300031251 | Bacteria | 4131 |
| 222 | Ga0265327_10066161 | 3300031251 | Bacteria | 1825 |
| 223 | Ga0265316_10002099 | 3300031344 | Bacteria | 20962 |
| 224 | Ga0265316_10037727 | 3300031344 | Bacteria | 3898 |
| 225 | Ga0265316_10106340 | 3300031344 | Bacteria | 2128 |
| 226 | Ga0265316_10150493 | 3300031344 | Bacteria | 1743 |
| 227 | Ga0265316_10223063 | 3300031344 | Bacteria | 1390 |
| 228 | Ga0265316_10320357 | 3300031344 | Bacteria | 1126 |
| 229 | Ga0265316_10338292 | 3300031344 | Bacteria | 1091 |
| 230 | Ga0265316_10858917 | 3300031344 | Bacteria | 635 |
| 231 | Ga0307408_100000032 | 3300031548 | Bacteria | 213693 |
| 232 | Ga0307408_100000311 | 3300031548 | Bacteria | 46654 |
| 233 | Ga0265313_10000228 | 3300031595 | Bacteria | 60668 |
| 234 | Ga0265313_10001658 | 3300031595 | Bacteria | 20635 |
| 235 | Ga0265313_10046645 | 3300031595 | Bacteria | 2102 |
| 236 | Ga0265313_10208918 | 3300031595 | Bacteria | 809 |
| 237 | Ga0265314_10011755 | 3300031711 | Bacteria | 7200 |
| 238 | Ga0265314_10051519 | 3300031711 | Bacteria | 2867 |
| 239 | Ga0265314_10309112 | 3300031711 | Bacteria | 884 |
| 240 | Ga0265342_10007378 | 3300031712 | Bacteria | 8060 |
| 241 | Ga0265342_10060029 | 3300031712 | Bacteria | 2244 |
| 242 | Ga0265342_10068863 | 3300031712 | Bacteria | 2067 |
| 243 | Ga0265342_10129365 | 3300031712 | Bacteria | 1416 |
| 244 | Ga0265342_10470035 | 3300031712 | Bacteria | 644 |
| 245 | Ga0307410_10000013 | 3300031852 | Bacteria | 76345 |
| 246 | Ga0307412_10577980 | 3300031911 | Bacteria | 948 |
| 247 | Ga0307412_11407111 | 3300031911 | Bacteria | 631 |
| 248 | Ga0307409_100000031 | 3300031995 | Bacteria | 48910 |
| 249 | Ga0307416_100000038 | 3300032002 | Bacteria | 136704 |
| 250 | Ga0307416_100014397 | 3300032002 | Bacteria | 5419 |
| 251 | Ga0307414_10230779 | 3300032004 | Bacteria | 1526 |
| 252 | Ga0373934_0078195 | 3300035086 | Bacteria | 1327 |
| 253 | Ga0373940_0031344 | 3300035088 | Bacteria | 1419 |
| 254 | Ga0373951_0016056 | 3300035091 | Bacteria | 1688 |
| 255 | Ga0373931_0838126 | 3300035691 | Bacteria | 615 |
| 256 | Ga0373935_0141726 | 3300035692 | Bacteria | 1624 |
| 257 | Ga0373935_0223992 | 3300035692 | Bacteria | 1307 |
| 258 | Ga0373933_0168616 | 3300035724 | Bacteria | 1393 |
| 259 | Ga0373933_0349542 | 3300035724 | Bacteria | 960 |
| 260 | Ga0373937_0076142 | 3300036401 | Bacteria | 3099 |
| 261 | Ga0373937_1257363 | 3300036401 | Bacteria | 688 |
| 262 | Ga0372808_008597 | 3300036459 | Eukaryota | 1417 |
| 263 | Ga0310109_033945 | 3300036534 | Eukaryota | 671 |
| 264 | Ga0316584_0560662 | 3300036712 | Unclassified | 796 |
| 265 | Ga0395899_0096515 | 3300037312 | Bacteria | 2137 |
| 266 | Ga0395899_0149134 | 3300037312 | Bacteria | 1658 |
| 267 | Ga0395900_0000337 | 3300037418 | Bacteria | 69150 |
| 268 | Ga0395900_0010583 | 3300037418 | Bacteria | 9432 |
| 269 | Ga0395900_0017217 | 3300037418 | Bacteria | 7375 |
| 270 | Ga0395900_0069541 | 3300037418 | Bacteria | 3618 |
| 271 | Ga0395900_0267218 | 3300037418 | Bacteria | 1706 |
| 272 | Ga0395898_0064271 | 3300037466 | Bacteria | 3559 |
| 273 | Ga0395898_0090383 | 3300037466 | Bacteria | 2946 |
| 274 | Ga0395898_0287456 | 3300037466 | Bacteria | 1568 |
| 275 | Ga0395898_1070564 | 3300037466 | Bacteria | 740 |
| 276 | Ga0395905_0000015 | 3300037471 | Bacteria | 393880 |
| 277 | Ga0395905_0095396 | 3300037471 | Bacteria | 2791 |
| 278 | Ga0395905_0190391 | 3300037471 | Bacteria | 1924 |
| 279 | Ga0395905_0470630 | 3300037471 | Bacteria | 1155 |
| 280 | Ga0395905_0511133 | 3300037471 | Bacteria | 1101 |
| 281 | Ga0395905_0659801 | 3300037471 | Bacteria | 948 |
| 282 | Ga0395905_0797259 | 3300037471 | Bacteria | 847 |
| 283 | Ga0395905_0986346 | 3300037471 | Bacteria | 745 |
| 284 | Ga0395901_0000597 | 3300038443 | Bacteria | 42057 |
| 285 | Ga0395901_0094595 | 3300038443 | Bacteria | 3130 |
| 286 | Ga0395901_0146485 | 3300038443 | Bacteria | 2481 |
| 287 | Ga0395901_0195581 | 3300038443 | Bacteria | 2120 |
| 288 | Ga0395901_0278048 | 3300038443 | Bacteria | 1740 |
| 289 | Ga0395901_0710847 | 3300038443 | Bacteria | 1001 |
| 290 | Ga0395901_1081144 | 3300038443 | Bacteria | 773 |
| 291 | Ga0451793_1527940 | 3300041452 | Bacteria | 694 |
| 292 | Ga0451800_0000795 | 3300041459 | Unclassified | 746 |
| 293 | Ga0451837_1317882 | 3300041494 | Unclassified | 779 |
| 294 | Ga0439431_0042404 | 3300041997 | Bacteria | 1162 |
| 295 | Ga0439448_0000340 | 3300042005 | Bacteria | 10448 |
| 296 | Ga0439448_0013508 | 3300042005 | Bacteria | 2454 |
| 297 | Ga0439448_0109091 | 3300042005 | Bacteria | 944 |
| 298 | Ga0439448_0120177 | 3300042005 | Bacteria | 901 |
| 299 | Ga0439449_0027146 | 3300042007 | Bacteria | 2137 |
| 300 | Ga0439450_023368 | 3300042008 | Bacteria | 1341 |
| 301 | Ga0439450_042007 | 3300042008 | Bacteria | 1064 |
| 302 | Ga0439450_096966 | 3300042008 | Bacteria | 745 |
| 303 | Ga0439455_0042334 | 3300042012 | Bacteria | 1169 |
| 304 | Ga0450911_017939 | 3300042115 | Bacteria | 930 |
| 305 | Ga0450898_052173 | 3300042134 | Bacteria | 792 |
| 306 | Ga0450903_018547 | 3300042138 | Bacteria | 1083 |
| 307 | Ga0439458_0004623 | 3300042157 | Bacteria | 3143 |
| 308 | Ga0451577_0035000 | 3300042876 | Bacteria | 4525 |
| 309 | Ga0451577_0232719 | 3300042876 | Bacteria | 1667 |
| 310 | Ga0451577_0790539 | 3300042876 | Bacteria | 857 |
| 311 | Ga0451577_0957872 | 3300042876 | Bacteria | 769 |
| 312 | Ga0466969_0088195 | 3300044656 | Bacteria | 1472 |
| 313 | Ga0466969_0093180 | 3300044656 | Bacteria | 1425 |
| 314 | Ga0466972_0000412 | 3300044658 | Bacteria | 22404 |
| 315 | Ga0466972_0058334 | 3300044658 | Bacteria | 1853 |
| 316 | Ga0453683_0090229 | 3300044673 | Bacteria | 1921 |
| 317 | Ga0466965_0028296 | 3300044683 | Bacteria | 2722 |
| 318 | Ga0466965_0040500 | 3300044683 | Bacteria | 2293 |
| 319 | Ga0466965_0168049 | 3300044683 | Bacteria | 1152 |
| 320 | Ga0466965_0491350 | 3300044683 | Bacteria | 687 |
| 321 | Ga0466966_0011762 | 3300044684 | Bacteria | 5801 |
| 322 | Ga0466966_0068120 | 3300044684 | Bacteria | 2234 |
| 323 | Ga0466966_0950265 | 3300044684 | Bacteria | 518 |
| 324 | Ga0466961_0363837 | 3300044693 | Bacteria | 879 |
| 325 | Ga0466963_0069023 | 3300044694 | Bacteria | 2375 |
| 326 | Ga0466964_0010802 | 3300044706 | Bacteria | 3447 |
| 327 | Ga0466964_0013498 | 3300044706 | Bacteria | 3099 |
| 328 | Ga0466964_0191850 | 3300044706 | Bacteria | 975 |
| 329 | Ga0453684_0000045 | 3300044712 | Bacteria | 582917 |
| 330 | Ga0453684_0011780 | 3300044712 | Bacteria | 14574 |
| 331 | Ga0453684_0400446 | 3300044712 | Bacteria | 1537 |
| 332 | Ga0453684_1647184 | 3300044712 | Bacteria | 657 |
| 333 | Ga0466971_0042616 | 3300044719 | Bacteria | 2039 |
| 334 | Ga0466971_0311304 | 3300044719 | Bacteria | 757 |
| 335 | Ga0466968_0002554 | 3300044735 | Bacteria | 6689 |
| 336 | Ga0466968_0299089 | 3300044735 | Bacteria | 773 |
| 337 | Ga0466970_0184693 | 3300044765 | Bacteria | 1157 |
| 338 | Ga0466970_0306667 | 3300044765 | Bacteria | 896 |
| 339 | Ga0466970_0314634 | 3300044765 | Bacteria | 884 |
| 340 | Ga0466970_0384332 | 3300044765 | Bacteria | 799 |
| 341 | Ga0466957_0000394 | 3300044842 | Bacteria | 21306 |
| 342 | Ga0466957_0016249 | 3300044842 | Bacteria | 4352 |
| 343 | Ga0466957_0042880 | 3300044842 | Bacteria | 2738 |
| 344 | Ga0466957_0222545 | 3300044842 | Bacteria | 1246 |
| 345 | Ga0466957_0448731 | 3300044842 | Bacteria | 888 |
| 346 | Ga0466957_1184236 | 3300044842 | Bacteria | 552 |
| 347 | Ga0466960_0094536 | 3300044901 | Bacteria | 1529 |
| 348 | Ga0466960_0221664 | 3300044901 | Bacteria | 1041 |
| 349 | Ga0466960_0287208 | 3300044901 | Bacteria | 923 |
| 350 | Ga0466960_0485238 | 3300044901 | Bacteria | 722 |
| 351 | Ga0466960_0521380 | 3300044901 | Bacteria | 698 |
| 352 | Ga0451576_0001454 | 3300045051 | Bacteria | 40277 |
| 353 | Ga0451576_0001488 | 3300045051 | Bacteria | 39603 |
| 354 | Ga0451576_0002783 | 3300045051 | Bacteria | 25253 |
| 355 | Ga0451576_0090052 | 3300045051 | Bacteria | 3191 |
| 356 | Ga0466958_0085192 | 3300045836 | Bacteria | 1949 |
| 357 | Ga0466958_0320888 | 3300045836 | Bacteria | 995 |
| 358 | Ga0466958_0365618 | 3300045836 | Bacteria | 929 |
| 359 | Ga0466958_0833524 | 3300045836 | Bacteria | 601 |
| 360 | Ga0466958_0945408 | 3300045836 | Bacteria | 562 |
| 361 | Ga0466967_0001230 | 3300045976 | Bacteria | 14462 |
| 362 | Ga0466967_0032003 | 3300045976 | Bacteria | 4437 |
| 363 | Ga0466967_0078034 | 3300045976 | Bacteria | 2982 |
| 364 | Ga0466967_0555244 | 3300045976 | Bacteria | 1130 |
| 365 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 366 | Ga0495627_001427 | 3300046453 | Bacteria | 14061 |
| 367 | Ga0495627_003235 | 3300046453 | Bacteria | 7311 |
| 368 | Ga0495603_0035953 | 3300046455 | Bacteria | 2974 |
| 369 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 370 | Ga0495590_0000940 | 3300046457 | Bacteria | 12897 |
| 371 | Ga0495590_0006196 | 3300046457 | Bacteria | 4683 |
| 372 | Ga0495590_0097701 | 3300046457 | Bacteria | 1042 |
| 373 | Ga0495590_0204189 | 3300046457 | Bacteria | 727 |
| 374 | Ga0495590_0260230 | 3300046457 | Bacteria | 647 |
| 375 | Ga0495591_004261 | 3300046458 | Bacteria | 7078 |
| 376 | Ga0495591_014849 | 3300046458 | Bacteria | 2778 |
| 377 | Ga0495638_0012534 | 3300046460 | Bacteria | 5805 |
| 378 | Ga0495638_0431375 | 3300046460 | Bacteria | 677 |
| 379 | Ga0495653_0007199 | 3300046463 | Bacteria | 9117 |
| 380 | Ga0495653_0047254 | 3300046463 | Bacteria | 3330 |
| 381 | Ga0495650_0000969 | 3300046471 | Bacteria | 32892 |
| 382 | Ga0495650_0033047 | 3300046471 | Unclassified | 2307 |
| 383 | Ga0495650_0034752 | 3300046471 | Bacteria | 2227 |
| 384 | Ga0495650_0304105 | 3300046471 | Bacteria | 533 |
| 385 | Ga0495580_0070944 | 3300046472 | Bacteria | 2433 |
| 386 | Ga0495582_0001028 | 3300046473 | Bacteria | 15630 |
| 387 | Ga0495582_0017641 | 3300046473 | Bacteria | 3905 |
| 388 | Ga0495605_0001725 | 3300046474 | Bacteria | 14004 |
| 389 | Ga0495605_0002728 | 3300046474 | Bacteria | 10777 |
| 390 | Ga0495605_0019333 | 3300046474 | Bacteria | 3640 |
| 391 | Ga0495605_0031579 | 3300046474 | Bacteria | 2705 |
| 392 | Ga0495605_0033247 | 3300046474 | Bacteria | 2619 |
| 393 | Ga0495605_0039009 | 3300046474 | Bacteria | 2380 |
| 394 | Ga0495605_0055372 | 3300046474 | Bacteria | 1916 |
| 395 | Ga0495605_0106870 | 3300046474 | Bacteria | 1280 |
| 396 | Ga0495605_0147291 | 3300046474 | Bacteria | 1052 |
| 397 | Ga0495639_0037187 | 3300046475 | Bacteria | 2182 |
| 398 | Ga0495664_0074512 | 3300046477 | Bacteria | 2031 |
| 399 | Ga0495584_0002018 | 3300046491 | Bacteria | 11672 |
| 400 | Ga0495584_0003124 | 3300046491 | Bacteria | 9197 |
| 401 | Ga0495584_0004097 | 3300046491 | Bacteria | 7866 |
| 402 | Ga0495584_0004978 | 3300046491 | Bacteria | 7077 |
| 403 | Ga0495584_0008803 | 3300046491 | Bacteria | 5219 |
| 404 | Ga0495584_0029095 | 3300046491 | Bacteria | 2800 |
| 405 | Ga0495584_0029997 | 3300046491 | Bacteria | 2756 |
| 406 | Ga0495584_0032837 | 3300046491 | Bacteria | 2626 |
| 407 | Ga0495584_0043913 | 3300046491 | Bacteria | 2256 |
| 408 | Ga0495584_0202998 | 3300046491 | Bacteria | 1007 |
| 409 | Ga0495585_0000904 | 3300046492 | Bacteria | 25136 |
| 410 | Ga0495585_0007432 | 3300046492 | Bacteria | 6709 |
| 411 | Ga0495585_0012064 | 3300046492 | Bacteria | 5099 |
| 412 | Ga0495585_0014494 | 3300046492 | Bacteria | 4591 |
| 413 | Ga0495585_0029018 | 3300046492 | Bacteria | 3152 |
| 414 | Ga0495585_0031985 | 3300046492 | Bacteria | 2983 |
| 415 | Ga0495585_0034983 | 3300046492 | Bacteria | 2840 |
| 416 | Ga0495585_0045765 | 3300046492 | Bacteria | 2441 |
| 417 | Ga0495585_0072785 | 3300046492 | Bacteria | 1871 |
| 418 | Ga0495585_0138386 | 3300046492 | Bacteria | 1276 |
| 419 | Ga0495585_0256344 | 3300046492 | Bacteria | 871 |
| 420 | Ga0495594_0010644 | 3300046499 | Bacteria | 4769 |
| 421 | Ga0495594_0023395 | 3300046499 | Bacteria | 3310 |
| 422 | Ga0495594_0075294 | 3300046499 | Bacteria | 1881 |
| 423 | Ga0495594_0089879 | 3300046499 | Bacteria | 1720 |
| 424 | Ga0495594_0095601 | 3300046499 | Bacteria | 1668 |
| 425 | Ga0495594_0125443 | 3300046499 | Bacteria | 1452 |
| 426 | Ga0495594_0161693 | 3300046499 | Bacteria | 1273 |
| 427 | Ga0495596_0002563 | 3300046500 | Bacteria | 9668 |
| 428 | Ga0495596_0006747 | 3300046500 | Bacteria | 5247 |
| 429 | Ga0495596_0013962 | 3300046500 | Bacteria | 3392 |
| 430 | Ga0495596_0015276 | 3300046500 | Bacteria | 3218 |
| 431 | Ga0495596_0022377 | 3300046500 | Bacteria | 2574 |
| 432 | Ga0495596_0035315 | 3300046500 | Bacteria | 1982 |
| 433 | Ga0495596_0037999 | 3300046500 | Bacteria | 1903 |
| 434 | Ga0495596_0041037 | 3300046500 | Bacteria | 1825 |
| 435 | Ga0495596_0048534 | 3300046500 | Bacteria | 1664 |
| 436 | Ga0495596_0066072 | 3300046500 | Bacteria | 1406 |
| 437 | Ga0495596_0082437 | 3300046500 | Bacteria | 1248 |
| 438 | Ga0495607_0000834 | 3300046501 | Bacteria | 29098 |
| 439 | Ga0495607_0003363 | 3300046501 | Bacteria | 12266 |
| 440 | Ga0495607_0006325 | 3300046501 | Bacteria | 8345 |
| 441 | Ga0495607_0006614 | 3300046501 | Bacteria | 8130 |
| 442 | Ga0495607_0010586 | 3300046501 | Bacteria | 6190 |
| 443 | Ga0495607_0015612 | 3300046501 | Bacteria | 4919 |
| 444 | Ga0495607_0115391 | 3300046501 | Bacteria | 1417 |
| 445 | Ga0495583_0001085 | 3300046506 | Bacteria | 30173 |
| 446 | Ga0495583_0008146 | 3300046506 | Bacteria | 6452 |
| 447 | Ga0495583_0013210 | 3300046506 | Bacteria | 4619 |
| 448 | Ga0495583_0024181 | 3300046506 | Bacteria | 3058 |
| 449 | Ga0495583_0029225 | 3300046506 | Bacteria | 2699 |
| 450 | Ga0495583_0040025 | 3300046506 | Bacteria | 2204 |
| 451 | Ga0495583_0085548 | 3300046506 | Bacteria | 1364 |
| 452 | Ga0495583_0147558 | 3300046506 | Bacteria | 976 |
| 453 | Ga0495606_0035211 | 3300046507 | Bacteria | 3425 |
| 454 | Ga0495606_0051437 | 3300046507 | Bacteria | 2687 |
| 455 | Ga0495606_0061813 | 3300046507 | Bacteria | 2393 |
| 456 | Ga0495606_0067904 | 3300046507 | Bacteria | 2256 |
| 457 | Ga0495606_0109703 | 3300046507 | Bacteria | 1666 |
| 458 | Ga0495606_0215779 | 3300046507 | Bacteria | 1084 |
| 459 | Ga0495610_0003702 | 3300046512 | Bacteria | 11722 |
| 460 | Ga0495610_0062898 | 3300046512 | Bacteria | 1759 |
| 461 | Ga0495610_0069794 | 3300046512 | Bacteria | 1643 |
| 462 | Ga0495616_0001336 | 3300046513 | Bacteria | 17226 |
| 463 | Ga0495616_0009394 | 3300046513 | Bacteria | 5724 |
| 464 | Ga0495616_0014430 | 3300046513 | Bacteria | 4421 |
| 465 | Ga0495616_0017425 | 3300046513 | Bacteria | 3962 |
| 466 | Ga0495616_0024730 | 3300046513 | Bacteria | 3217 |
| 467 | Ga0495616_0027390 | 3300046513 | Bacteria | 3024 |
| 468 | Ga0495616_0037612 | 3300046513 | Bacteria | 2488 |
| 469 | Ga0495616_0057193 | 3300046513 | Bacteria | 1923 |
| 470 | Ga0495616_0063395 | 3300046513 | Bacteria | 1806 |
| 471 | Ga0495616_0080660 | 3300046513 | Bacteria | 1557 |
| 472 | Ga0495616_0110213 | 3300046513 | Bacteria | 1279 |
| 473 | Ga0495616_0197301 | 3300046513 | Bacteria | 886 |
| 474 | Ga0495616_0222833 | 3300046513 | Bacteria | 820 |
| 475 | Ga0495630_0009746 | 3300046517 | Bacteria | 6911 |
| 476 | Ga0495631_0004761 | 3300046518 | Bacteria | 7167 |
| 477 | Ga0495631_0005028 | 3300046518 | Bacteria | 6961 |
| 478 | Ga0495631_0005442 | 3300046518 | Bacteria | 6661 |
| 479 | Ga0495631_0005524 | 3300046518 | Bacteria | 6608 |
| 480 | Ga0495631_0015732 | 3300046518 | Bacteria | 3617 |
| 481 | Ga0495631_0037288 | 3300046518 | Bacteria | 2166 |
| 482 | Ga0495631_0043721 | 3300046518 | Bacteria | 1975 |
| 483 | Ga0495631_0296950 | 3300046518 | Bacteria | 687 |
| 484 | Ga0495632_0000148 | 3300046519 | Bacteria | 72492 |
| 485 | Ga0495632_0007100 | 3300046519 | Bacteria | 7091 |
| 486 | Ga0495632_0007463 | 3300046519 | Bacteria | 6866 |
| 487 | Ga0495632_0008697 | 3300046519 | Bacteria | 6195 |
| 488 | Ga0495632_0041328 | 3300046519 | Bacteria | 2317 |
| 489 | Ga0495632_0068087 | 3300046519 | Bacteria | 1716 |
| 490 | Ga0495632_0166387 | 3300046519 | Bacteria | 1014 |
| 491 | Ga0495637_0000006 | 3300046520 | Bacteria | 435763 |
| 492 | Ga0495637_0021375 | 3300046520 | Bacteria | 2968 |
| 493 | Ga0495637_0043231 | 3300046520 | Bacteria | 1924 |
| 494 | Ga0495643_0002220 | 3300046522 | Bacteria | 15780 |
| 495 | Ga0495643_0003624 | 3300046522 | Bacteria | 11220 |
| 496 | Ga0495643_0020278 | 3300046522 | Bacteria | 3835 |
| 497 | Ga0495643_0028825 | 3300046522 | Bacteria | 3109 |
| 498 | Ga0495643_0310623 | 3300046522 | Bacteria | 715 |
| 499 | Ga0495643_0358678 | 3300046522 | Bacteria | 651 |
| 500 | Ga0495644_0002343 | 3300046523 | Bacteria | 7552 |
| 501 | Ga0495644_0002779 | 3300046523 | Bacteria | 6934 |
| 502 | Ga0495644_0004141 | 3300046523 | Bacteria | 5701 |
| 503 | Ga0495644_0007340 | 3300046523 | Bacteria | 4258 |
| 504 | Ga0495644_0016303 | 3300046523 | Bacteria | 2844 |
| 505 | Ga0495644_0022329 | 3300046523 | Bacteria | 2411 |
| 506 | Ga0495648_0011970 | 3300046524 | Bacteria | 6503 |
| 507 | Ga0495648_0015757 | 3300046524 | Bacteria | 5470 |
| 508 | Ga0495648_0024170 | 3300046524 | Bacteria | 4146 |
| 509 | Ga0495648_0033135 | 3300046524 | Bacteria | 3379 |
| 510 | Ga0495648_0034375 | 3300046524 | Bacteria | 3299 |
| 511 | Ga0495648_0063736 | 3300046524 | Bacteria | 2174 |
| 512 | Ga0495648_0084832 | 3300046524 | Bacteria | 1791 |
| 513 | Ga0495648_0089969 | 3300046524 | Bacteria | 1721 |
| 514 | Ga0495648_0126998 | 3300046524 | Bacteria | 1361 |
| 515 | Ga0495648_0171750 | 3300046524 | Bacteria | 1110 |
| 516 | Ga0495648_0278196 | 3300046524 | Bacteria | 794 |
| 517 | Ga0495648_0310964 | 3300046524 | Bacteria | 734 |
| 518 | Ga0495663_0107264 | 3300046525 | Bacteria | 925 |
| 519 | Ga0495666_0000744 | 3300046526 | Bacteria | 14983 |
| 520 | Ga0495666_0012484 | 3300046526 | Bacteria | 4234 |
| 521 | Ga0495666_0086650 | 3300046526 | Bacteria | 1479 |
| 522 | Ga0495642_0000569 | 3300046528 | Bacteria | 18527 |
| 523 | Ga0495642_0003114 | 3300046528 | Bacteria | 6578 |
| 524 | Ga0495642_0011383 | 3300046528 | Bacteria | 3417 |
| 525 | Ga0495642_0013582 | 3300046528 | Bacteria | 3152 |
| 526 | Ga0495642_0015875 | 3300046528 | Bacteria | 2931 |
| 527 | Ga0495642_0028613 | 3300046528 | Bacteria | 2220 |
| 528 | Ga0495642_0034709 | 3300046528 | Bacteria | 2032 |
| 529 | Ga0495642_0119075 | 3300046528 | Bacteria | 1132 |
| 530 | Ga0495642_0232852 | 3300046528 | Bacteria | 804 |
| 531 | Ga0495652_0199498 | 3300046529 | Bacteria | 1519 |
| 532 | Ga0495654_0009322 | 3300046530 | Bacteria | 5380 |
| 533 | Ga0495654_0019833 | 3300046530 | Bacteria | 3511 |
| 534 | Ga0495654_0051828 | 3300046530 | Bacteria | 2001 |
| 535 | Ga0495654_0102276 | 3300046530 | Bacteria | 1317 |
| 536 | Ga0495654_0105954 | 3300046530 | Bacteria | 1288 |
| 537 | Ga0495665_0034032 | 3300046531 | Bacteria | 2724 |
| 538 | Ga0495665_0053057 | 3300046531 | Bacteria | 2145 |
| 539 | Ga0495665_0054761 | 3300046531 | Bacteria | 2107 |
| 540 | Ga0495640_0332240 | 3300046533 | Bacteria | 940 |
| 541 | Ga0495586_0030119 | 3300046535 | Bacteria | 2904 |
| 542 | Ga0495586_0094793 | 3300046535 | Bacteria | 1651 |
| 543 | Ga0495586_0114323 | 3300046535 | Bacteria | 1504 |
| 544 | Ga0495586_0527517 | 3300046535 | Bacteria | 681 |
| 545 | Ga0495587_0404604 | 3300046536 | Bacteria | 758 |
| 546 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 547 | Ga0495609_0000522 | 3300046538 | Bacteria | 30810 |
| 548 | Ga0495609_0005081 | 3300046538 | Bacteria | 7012 |
| 549 | Ga0495609_0006979 | 3300046538 | Bacteria | 5695 |
| 550 | Ga0495609_0013121 | 3300046538 | Bacteria | 3918 |
| 551 | Ga0495609_0029855 | 3300046538 | Bacteria | 2481 |
| 552 | Ga0495609_0032295 | 3300046538 | Bacteria | 2378 |
| 553 | Ga0495609_0263611 | 3300046538 | Bacteria | 707 |
| 554 | Ga0495609_0325757 | 3300046538 | Bacteria | 622 |
| 555 | Ga0495621_0370772 | 3300046539 | Bacteria | 603 |
| 556 | Ga0495597_0001858 | 3300046542 | Bacteria | 14443 |
| 557 | Ga0495597_0002415 | 3300046542 | Bacteria | 11888 |
| 558 | Ga0495597_0005167 | 3300046542 | Bacteria | 6952 |
| 559 | Ga0495597_0009834 | 3300046542 | Bacteria | 4704 |
| 560 | Ga0495597_0083286 | 3300046542 | Bacteria | 1366 |
| 561 | Ga0495597_0094028 | 3300046542 | Bacteria | 1269 |
| 562 | Ga0495597_0108527 | 3300046542 | Bacteria | 1165 |
| 563 | Ga0495597_0198054 | 3300046542 | Bacteria | 805 |
| 564 | Ga0495597_0350683 | 3300046542 | Bacteria | 566 |
| 565 | Ga0495645_0129125 | 3300046543 | Bacteria | 1773 |
| 566 | Ga0495622_0011709 | 3300046557 | Bacteria | 4055 |
| 567 | Ga0495622_0030966 | 3300046557 | Bacteria | 2501 |
| 568 | Ga0495622_0033569 | 3300046557 | Bacteria | 2394 |
| 569 | Ga0495622_0056631 | 3300046557 | Bacteria | 1818 |
| 570 | Ga0495622_0214449 | 3300046557 | Bacteria | 854 |
| 571 | Ga0495633_0005314 | 3300046558 | Bacteria | 7910 |
| 572 | Ga0495633_0006247 | 3300046558 | Bacteria | 7110 |
| 573 | Ga0495633_0006628 | 3300046558 | Bacteria | 6833 |
| 574 | Ga0495633_0038303 | 3300046558 | Bacteria | 2290 |
| 575 | Ga0495633_0040400 | 3300046558 | Bacteria | 2222 |
| 576 | Ga0495633_0043296 | 3300046558 | Bacteria | 2136 |
| 577 | Ga0495633_0079790 | 3300046558 | Bacteria | 1524 |
| 578 | Ga0495633_0123935 | 3300046558 | Bacteria | 1196 |
| 579 | Ga0495656_0015023 | 3300046615 | Bacteria | 2914 |
| 580 | Ga0495656_0074870 | 3300046615 | Bacteria | 1513 |
| 581 | Ga0495656_0155276 | 3300046615 | Bacteria | 1108 |
| 582 | Ga0495656_0237023 | 3300046615 | Bacteria | 917 |
| 583 | Ga0495656_0245225 | 3300046615 | Bacteria | 903 |
| 584 | Ga0495656_0287665 | 3300046615 | Bacteria | 839 |
| 585 | Ga0495668_0000021 | 3300046616 | Bacteria | 381308 |
| 586 | Ga0495668_0000049 | 3300046616 | Bacteria | 217657 |
| 587 | Ga0495668_0001558 | 3300046616 | Bacteria | 21752 |
| 588 | Ga0495668_0001735 | 3300046616 | Bacteria | 20052 |
| 589 | Ga0495668_0007257 | 3300046616 | Bacteria | 7110 |
| 590 | Ga0495668_0009224 | 3300046616 | Bacteria | 6070 |
| 591 | Ga0495668_0020897 | 3300046616 | Bacteria | 3759 |
| 592 | Ga0495668_0027726 | 3300046616 | Bacteria | 3209 |
| 593 | Ga0495668_0054902 | 3300046616 | Bacteria | 2200 |
| 594 | Ga0495668_0159041 | 3300046616 | Bacteria | 1237 |
| 595 | Ga0495634_0058211 | 3300046642 | Bacteria | 2576 |
| 596 | Ga0495611_0000309 | 3300046648 | Bacteria | 33038 |
| 597 | Ga0495611_0001771 | 3300046648 | Bacteria | 10432 |
| 598 | Ga0495611_0004407 | 3300046648 | Bacteria | 6092 |
| 599 | Ga0495611_0010876 | 3300046648 | Bacteria | 3854 |
| 600 | Ga0495611_0037824 | 3300046648 | Bacteria | 2145 |
| 601 | Ga0495611_0038370 | 3300046648 | Bacteria | 2130 |
| 602 | Ga0495611_0075955 | 3300046648 | Bacteria | 1539 |
| 603 | Ga0495625_0003181 | 3300046660 | Bacteria | 16707 |
| 604 | Ga0495625_0014069 | 3300046660 | Bacteria | 6403 |
| 605 | Ga0495625_0028518 | 3300046660 | Bacteria | 4186 |
| 606 | Ga0495625_0028905 | 3300046660 | Bacteria | 4151 |
| 607 | Ga0495625_0039495 | 3300046660 | Bacteria | 3446 |
| 608 | Ga0495625_0076032 | 3300046660 | Bacteria | 2349 |
| 609 | Ga0495625_0090689 | 3300046660 | Bacteria | 2113 |
| 610 | Ga0495625_0257858 | 3300046660 | Bacteria | 1129 |
| 611 | Ga0495659_0000098 | 3300046664 | Bacteria | 38376 |
| 612 | Ga0495659_0006084 | 3300046664 | Bacteria | 3815 |
| 613 | Ga0495659_0343928 | 3300046664 | Bacteria | 636 |
| 614 | Ga0495661_0011074 | 3300046665 | Bacteria | 6124 |
| 615 | Ga0495661_0014162 | 3300046665 | Bacteria | 5342 |
| 616 | Ga0495661_0023349 | 3300046665 | Bacteria | 4015 |
| 617 | Ga0495661_0031136 | 3300046665 | Bacteria | 3389 |
| 618 | Ga0495661_0032557 | 3300046665 | Bacteria | 3294 |
| 619 | Ga0495661_0033952 | 3300046665 | Bacteria | 3213 |
| 620 | Ga0495661_0041378 | 3300046665 | Bacteria | 2851 |
| 621 | Ga0495661_0042605 | 3300046665 | Bacteria | 2797 |
| 622 | Ga0495661_0043846 | 3300046665 | Bacteria | 2746 |
| 623 | Ga0495661_0046043 | 3300046665 | Bacteria | 2664 |
| 624 | Ga0495661_0060592 | 3300046665 | Bacteria | 2247 |
| 625 | Ga0495661_0067504 | 3300046665 | Bacteria | 2100 |
| 626 | Ga0495661_0078056 | 3300046665 | Bacteria | 1916 |
| 627 | Ga0495661_0094846 | 3300046665 | Bacteria | 1690 |
| 628 | Ga0495661_0100993 | 3300046665 | Bacteria | 1623 |
| 629 | Ga0495661_0102976 | 3300046665 | Bacteria | 1603 |
| 630 | Ga0495661_0232685 | 3300046665 | Bacteria | 949 |
| 631 | Ga0495661_0315704 | 3300046665 | Bacteria | 778 |
| 632 | Ga0495661_0489791 | 3300046665 | Bacteria | 587 |
| 633 | Ga0495588_0000135 | 3300046674 | Bacteria | 117387 |
| 634 | Ga0495588_0017232 | 3300046674 | Bacteria | 3503 |
| 635 | Ga0495588_0021690 | 3300046674 | Bacteria | 3168 |
| 636 | Ga0495588_0027852 | 3300046674 | Bacteria | 2825 |
| 637 | Ga0495588_0028510 | 3300046674 | Bacteria | 2794 |
| 638 | Ga0495588_0101812 | 3300046674 | Bacteria | 1509 |
| 639 | Ga0495588_0109238 | 3300046674 | Bacteria | 1456 |
| 640 | Ga0495588_0124617 | 3300046674 | Bacteria | 1358 |
| 641 | Ga0495588_0387781 | 3300046674 | Bacteria | 733 |
| 642 | Ga0495588_0554448 | 3300046674 | Bacteria | 602 |
| 643 | Ga0495623_0042373 | 3300046679 | Bacteria | 2899 |
| 644 | Ga0495646_0142442 | 3300046680 | Bacteria | 1339 |
| 645 | Ga0495669_0000400 | 3300046684 | Bacteria | 21289 |
| 646 | Ga0495669_0000418 | 3300046684 | Bacteria | 20527 |
| 647 | Ga0495669_0010842 | 3300046684 | Bacteria | 3858 |
| 648 | Ga0495669_0016839 | 3300046684 | Bacteria | 3133 |
| 649 | Ga0495669_0029643 | 3300046684 | Bacteria | 2400 |
| 650 | Ga0495669_0043868 | 3300046684 | Bacteria | 1991 |
| 651 | Ga0495669_0046897 | 3300046684 | Bacteria | 1929 |
| 652 | Ga0495669_0049532 | 3300046684 | Bacteria | 1881 |
| 653 | Ga0495669_0065511 | 3300046684 | Bacteria | 1649 |
| 654 | Ga0495670_0015322 | 3300046691 | Bacteria | 3769 |
| 655 | Ga0495670_0015421 | 3300046691 | Bacteria | 3754 |
| 656 | Ga0495670_0050606 | 3300046691 | Bacteria | 2079 |
| 657 | Ga0495670_0064745 | 3300046691 | Bacteria | 1842 |
| 658 | Ga0495670_0092952 | 3300046691 | Bacteria | 1545 |
| 659 | Ga0495670_0219178 | 3300046691 | Bacteria | 1010 |
| 660 | Ga0495670_0225224 | 3300046691 | Bacteria | 996 |
| 661 | Ga0495670_0246717 | 3300046691 | Bacteria | 951 |
| 662 | Ga0495671_0000522 | 3300046692 | Bacteria | 29251 |
| 663 | Ga0495671_0004896 | 3300046692 | Bacteria | 7921 |
| 664 | Ga0495671_0021644 | 3300046692 | Bacteria | 3374 |
| 665 | Ga0495671_0310795 | 3300046692 | Bacteria | 757 |
| 666 | Ga0495649_0000625 | 3300046694 | Bacteria | 29147 |
| 667 | Ga0495649_0005216 | 3300046694 | Bacteria | 8317 |
| 668 | Ga0495649_0008026 | 3300046694 | Bacteria | 6377 |
| 669 | Ga0495649_0043337 | 3300046694 | Bacteria | 2456 |
| 670 | Ga0495649_0075218 | 3300046694 | Bacteria | 1808 |
| 671 | Ga0495649_0110193 | 3300046694 | Bacteria | 1460 |
| 672 | Ga0495649_0192314 | 3300046694 | Bacteria | 1062 |
| 673 | Ga0495649_0216605 | 3300046694 | Bacteria | 991 |
| 674 | Ga0495589_0000353 | 3300046794 | Bacteria | 35738 |
| 675 | Ga0495589_0001512 | 3300046794 | Bacteria | 13375 |
| 676 | Ga0495589_0002800 | 3300046794 | Bacteria | 9643 |
| 677 | Ga0495589_0004643 | 3300046794 | Bacteria | 7301 |
| 678 | Ga0495589_0004825 | 3300046794 | Bacteria | 7164 |
| 679 | Ga0495589_0008572 | 3300046794 | Bacteria | 5330 |
| 680 | Ga0495589_0012156 | 3300046794 | Bacteria | 4463 |
| 681 | Ga0495589_0048393 | 3300046794 | Bacteria | 2105 |
| 682 | Ga0495589_0083014 | 3300046794 | Bacteria | 1557 |
| 683 | Ga0495589_0119006 | 3300046794 | Bacteria | 1272 |
| 684 | Ga0495589_0180740 | 3300046794 | Bacteria | 1000 |
| 685 | Ga0495589_0191183 | 3300046794 | Bacteria | 968 |
| 686 | Ga0495600_0060647 | 3300046809 | Bacteria | 2470 |
| 687 | Ga0495660_0000103 | 3300046810 | Bacteria | 91169 |
| 688 | Ga0495660_0003819 | 3300046810 | Bacteria | 9222 |
| 689 | Ga0495660_0013708 | 3300046810 | Bacteria | 4698 |
| 690 | Ga0495660_0024276 | 3300046810 | Bacteria | 3454 |
| 691 | Ga0495660_0035176 | 3300046810 | Bacteria | 2800 |
| 692 | Ga0495660_0054077 | 3300046810 | Bacteria | 2176 |
| 693 | Ga0495660_0060435 | 3300046810 | Bacteria | 2035 |
| 694 | Ga0495660_0102345 | 3300046810 | Bacteria | 1472 |
| 695 | Ga0495581_0029213 | 3300047315 | Bacteria | 3195 |
| 696 | Ga0495581_0157034 | 3300047315 | Bacteria | 1329 |
| 697 | Ga0495581_0364854 | 3300047315 | Bacteria | 843 |
| 698 | Ga0495636_0001265 | 3300047318 | Bacteria | 9570 |
| 699 | Ga0495636_0003721 | 3300047318 | Bacteria | 5935 |
| 700 | Ga0495636_0040605 | 3300047318 | Bacteria | 1929 |
| 701 | Ga0495636_0079855 | 3300047318 | Bacteria | 1407 |
| 702 | Ga0495636_0084274 | 3300047318 | Bacteria | 1372 |
| 703 | Ga0495672_0000118 | 3300047320 | Bacteria | 124396 |
| 704 | Ga0495672_0000287 | 3300047320 | Bacteria | 69547 |
| 705 | Ga0495672_0003619 | 3300047320 | Bacteria | 13107 |
| 706 | Ga0495672_0009762 | 3300047320 | Bacteria | 6914 |
| 707 | Ga0495672_0021332 | 3300047320 | Bacteria | 4226 |
| 708 | Ga0495672_0119976 | 3300047320 | Bacteria | 1399 |
| 709 | Ga0495672_0230055 | 3300047320 | Bacteria | 910 |
| 710 | Ga0495676_0000627 | 3300047321 | Bacteria | 29238 |
| 711 | Ga0495676_0083006 | 3300047321 | Bacteria | 2423 |
| 712 | Ga0495676_0403775 | 3300047321 | Bacteria | 906 |
| 713 | Ga0495683_0005242 | 3300047323 | Bacteria | 7201 |
| 714 | Ga0495683_0005405 | 3300047323 | Bacteria | 7091 |
| 715 | Ga0495683_0016184 | 3300047323 | Bacteria | 3873 |
| 716 | Ga0495683_0025633 | 3300047323 | Bacteria | 3020 |
| 717 | Ga0495683_0034591 | 3300047323 | Bacteria | 2569 |
| 718 | Ga0495683_0369765 | 3300047323 | Bacteria | 601 |
| 719 | Ga0495683_0473340 | 3300047323 | Bacteria | 511 |
| 720 | Ga0495687_000047 | 3300047443 | Bacteria | 206452 |
| 721 | Ga0495687_000166 | 3300047443 | Bacteria | 98891 |
| 722 | Ga0495687_000210 | 3300047443 | Bacteria | 83884 |
| 723 | Ga0495687_018829 | 3300047443 | Bacteria | 3402 |
| 724 | Ga0495687_024581 | 3300047443 | Bacteria | 2861 |
| 725 | Ga0495687_041822 | 3300047443 | Bacteria | 2007 |
| 726 | Ga0495687_090705 | 3300047443 | Bacteria | 1170 |
| 727 | Ga0495675_0030262 | 3300047444 | Bacteria | 3454 |
| 728 | Ga0495675_0075202 | 3300047444 | Bacteria | 2128 |
| 729 | Ga0495677_0000074 | 3300047445 | Bacteria | 50955 |
| 730 | Ga0495677_0000920 | 3300047445 | Bacteria | 11865 |
| 731 | Ga0495677_0001632 | 3300047445 | Bacteria | 9014 |
| 732 | Ga0495677_0005519 | 3300047445 | Bacteria | 4794 |
| 733 | Ga0495677_0017567 | 3300047445 | Bacteria | 2593 |
| 734 | Ga0495677_0021851 | 3300047445 | Bacteria | 2318 |
| 735 | Ga0495677_0034368 | 3300047445 | Bacteria | 1849 |
| 736 | Ga0495677_0034631 | 3300047445 | Bacteria | 1842 |
| 737 | Ga0495677_0036892 | 3300047445 | Bacteria | 1785 |
| 738 | Ga0495677_0216899 | 3300047445 | Bacteria | 745 |
| 739 | Ga0495679_007964 | 3300047446 | Bacteria | 4358 |
| 740 | Ga0495679_012140 | 3300047446 | Bacteria | 3291 |
| 741 | Ga0495679_018946 | 3300047446 | Bacteria | 2430 |
| 742 | Ga0495679_052201 | 3300047446 | Bacteria | 1224 |
| 743 | Ga0495679_068310 | 3300047446 | Bacteria | 1028 |
| 744 | Ga0495679_122076 | 3300047446 | Bacteria | 711 |
| 745 | Ga0495685_004856 | 3300047447 | Bacteria | 4363 |
| 746 | Ga0495685_016653 | 3300047447 | Bacteria | 2513 |
| 747 | Ga0495685_152066 | 3300047447 | Bacteria | 751 |
| 748 | Ga0495681_0002867 | 3300047470 | Bacteria | 12181 |
| 749 | Ga0495681_0003198 | 3300047470 | Bacteria | 11430 |
| 750 | Ga0495681_0009476 | 3300047470 | Bacteria | 5993 |
| 751 | Ga0495681_0023512 | 3300047470 | Bacteria | 3272 |
| 752 | Ga0495681_0031160 | 3300047470 | Bacteria | 2704 |
| 753 | Ga0495681_0183766 | 3300047470 | Bacteria | 857 |
| 754 | Ga0495681_0202704 | 3300047470 | Bacteria | 804 |
| 755 | Ga0495686_0000835 | 3300047472 | Bacteria | 39592 |
| 756 | Ga0495686_0006193 | 3300047472 | Bacteria | 9231 |
| 757 | Ga0495686_0006400 | 3300047472 | Bacteria | 9025 |
| 758 | Ga0495686_0029229 | 3300047472 | Bacteria | 3586 |
| 759 | Ga0495686_0078442 | 3300047472 | Bacteria | 2021 |
| 760 | Ga0495686_0089005 | 3300047472 | Bacteria | 1876 |
| 761 | Ga0495686_0133635 | 3300047472 | Bacteria | 1469 |
| 762 | Ga0495593_0051146 | 3300047673 | Bacteria | 2187 |
| 763 | Ga0495602_0042177 | 3300048088 | Bacteria | 4160 |
| 764 | Ga0495602_0179218 | 3300048088 | Bacteria | 1636 |
| 765 | Ga0495614_0020215 | 3300048089 | Bacteria | 2880 |
| 766 | Ga0495614_0075094 | 3300048089 | Bacteria | 1460 |
| 767 | Ga0495626_0000006 | 3300048091 | Bacteria | 284977 |
| 768 | Ga0495626_0000034 | 3300048091 | Bacteria | 183391 |
| 769 | Ga0495626_0005441 | 3300048091 | Bacteria | 7453 |
| 770 | Ga0495626_0006165 | 3300048091 | Bacteria | 6859 |
| 771 | Ga0495626_0006352 | 3300048091 | Bacteria | 6738 |
| 772 | Ga0495626_0010572 | 3300048091 | Bacteria | 4913 |
| 773 | Ga0495626_0017645 | 3300048091 | Bacteria | 3598 |
| 774 | Ga0495626_0019151 | 3300048091 | Bacteria | 3425 |
| 775 | Ga0495626_0029193 | 3300048091 | Bacteria | 2670 |
| 776 | Ga0495626_0043239 | 3300048091 | Bacteria | 2114 |
| 777 | Ga0495626_0053956 | 3300048091 | Bacteria | 1847 |
| 778 | Ga0495626_0137375 | 3300048091 | Bacteria | 1038 |
| 779 | Ga0496100_0424293 | 3300048903 | Bacteria | 1016 |
| 780 | Ga0496101_0118146 | 3300048904 | Bacteria | 2002 |
| 781 | Ga0496101_1405113 | 3300048904 | Bacteria | 544 |
| 782 | Ga0496102_0010040 | 3300048905 | Bacteria | 8142 |
| 783 | Ga0496102_0197528 | 3300048905 | Bacteria | 1896 |
| 784 | Ga0496102_0653733 | 3300048905 | Bacteria | 974 |
| 785 | Ga0496102_0679713 | 3300048905 | Bacteria | 952 |
| 786 | Ga0496102_0759295 | 3300048905 | Bacteria | 892 |
| 787 | Ga0496103_0071730 | 3300048906 | Bacteria | 2168 |
| 788 | Ga0496103_0151577 | 3300048906 | Bacteria | 1485 |
| 789 | Ga0496103_0179680 | 3300048906 | Bacteria | 1360 |
| 790 | Ga0496103_0207447 | 3300048906 | Bacteria | 1260 |
| 791 | Ga0496103_0247560 | 3300048906 | Bacteria | 1147 |
| 792 | Ga0496104_0066589 | 3300048907 | Bacteria | 3420 |
| 793 | Ga0496104_0201582 | 3300048907 | Bacteria | 1902 |
| 794 | Ga0496105_0541225 | 3300048908 | Bacteria | 910 |
| 795 | Ga0496106_0004987 | 3300048909 | Bacteria | 9827 |
| 796 | Ga0496106_0176687 | 3300048909 | Bacteria | 1694 |
| 797 | Ga0496106_0451959 | 3300048909 | Bacteria | 1032 |
| 798 | Ga0496107_0012714 | 3300048910 | Bacteria | 5881 |
| 799 | Ga0496107_0101165 | 3300048910 | Bacteria | 2113 |
| 800 | Ga0496108_0929699 | 3300048911 | Bacteria | 745 |
| 801 | Ga0496109_0034146 | 3300048912 | Bacteria | 4579 |
| 802 | Ga0496109_0339540 | 3300048912 | Bacteria | 1418 |
| 803 | Ga0496109_0402299 | 3300048912 | Bacteria | 1293 |
| 804 | Ga0496109_0724705 | 3300048912 | Bacteria | 932 |
| 805 | Ga0496110_0018489 | 3300048913 | Bacteria | 5843 |
| 806 | Ga0496111_0125865 | 3300048914 | Bacteria | 1894 |
| 807 | Ga0496111_0810019 | 3300048914 | Bacteria | 677 |
| 808 | Ga0496112_0279929 | 3300048915 | Bacteria | 1615 |
| 809 | Ga0496112_0473321 | 3300048915 | Bacteria | 1190 |
| 810 | Ga0496113_0024113 | 3300048916 | Bacteria | 4320 |
| 811 | Ga0496113_0572695 | 3300048916 | Bacteria | 905 |
| 812 | Ga0496114_0178228 | 3300048917 | Bacteria | 1855 |
| 813 | Ga0496115_0406788 | 3300048918 | Bacteria | 1104 |
| 814 | Ga0496116_0331977 | 3300048919 | Bacteria | 706 |
| 815 | Ga0496121_0078704 | 3300048924 | Bacteria | 2620 |
| 816 | Ga0496122_0003245 | 3300048925 | Bacteria | 21574 |
| 817 | Ga0496122_0015414 | 3300048925 | Bacteria | 7308 |
| 818 | Ga0496122_0267307 | 3300048925 | Bacteria | 945 |
| 819 | Ga0496123_0013411 | 3300048926 | Bacteria | 6884 |
| 820 | Ga0496123_0015341 | 3300048926 | Bacteria | 6291 |
| 821 | Ga0496123_0050901 | 3300048926 | Bacteria | 2764 |
| 822 | Ga0496124_0026676 | 3300048927 | Bacteria | 5206 |
| 823 | Ga0496124_0084722 | 3300048927 | Bacteria | 2598 |
| 824 | Ga0496124_0086232 | 3300048927 | Bacteria | 2570 |
| 825 | Ga0496124_0087250 | 3300048927 | Bacteria | 2552 |
| 826 | Ga0496124_0094902 | 3300048927 | Bacteria | 2425 |
| 827 | Ga0496124_0102421 | 3300048927 | Bacteria | 2317 |
| 828 | Ga0496125_0007861 | 3300048928 | Bacteria | 11269 |
| 829 | Ga0496125_0105869 | 3300048928 | Bacteria | 2055 |
| 830 | Ga0496125_0553867 | 3300048928 | Bacteria | 637 |
| 831 | Ga0496126_0145302 | 3300048929 | Bacteria | 2038 |
| 832 | Ga0501306_018117 | 3300049127 | Bacteria | 961 |
| 833 | Ga0501308_000946 | 3300049128 | Bacteria | 2147 |
| 834 | Ga0501308_018674 | 3300049128 | Bacteria | 850 |
| 835 | Ga0501309_004005 | 3300049129 | Bacteria | 1698 |
| 836 | Ga0501304_000167 | 3300049160 | Bacteria | 2797 |
| 837 | Ga0501307_006020 | 3300049162 | Bacteria | 1296 |
| 838 | Ga0501307_007028 | 3300049162 | Bacteria | 1232 |
| 839 | Ga0495678_000113 | 3300049459 | Bacteria | 96866 |
| 840 | Ga0495678_000601 | 3300049459 | Bacteria | 33888 |
| 841 | Ga0495678_010011 | 3300049459 | Bacteria | 4636 |
| 842 | Ga0495678_020985 | 3300049459 | Bacteria | 2884 |
| 843 | Ga0495678_076538 | 3300049459 | Bacteria | 1212 |
| 844 | Ga0495682_0003524 | 3300049460 | Bacteria | 6935 |
| 845 | Ga0495682_0006018 | 3300049460 | Bacteria | 4955 |
| 846 | Ga0495682_0009817 | 3300049460 | Bacteria | 3726 |
| 847 | Ga0495682_0014169 | 3300049460 | Bacteria | 3025 |
| 848 | Ga0495682_0065817 | 3300049460 | Bacteria | 1306 |
| 849 | Ga0501311_004404 | 3300049527 | Bacteria | 1497 |
| 850 | Ga0501313_006175 | 3300049529 | Bacteria | 1290 |
| 851 | Ga0501315_002695 | 3300049531 | Bacteria | 1702 |
| 852 | Ga0501315_006164 | 3300049531 | Bacteria | 1326 |
| 853 | Ga0501315_035017 | 3300049531 | Bacteria | 739 |
| 854 | Ga0501316_004314 | 3300049532 | Bacteria | 1422 |
| 855 | Ga0501316_032082 | 3300049532 | Bacteria | 706 |
| 856 | Ga0501316_075490 | 3300049532 | Bacteria | 516 |
| 857 | Ga0501318_020518 | 3300049534 | Bacteria | 833 |
| 858 | Ga0501323_008593 | 3300049539 | Bacteria | 1188 |
| 859 | Ga0501038_0322239 | 3300049574 | Bacteria | 1209 |
| 860 | Ga0501042_0472253 | 3300049578 | Bacteria | 910 |
| 861 | Ga0501043_0277175 | 3300049579 | Bacteria | 1286 |
| 862 | Ga0501046_0035622 | 3300049580 | Bacteria | 4010 |
| 863 | Ga0501046_0529471 | 3300049580 | Bacteria | 842 |
| 864 | Ga0501047_0031101 | 3300049581 | Bacteria | 5148 |
| 865 | Ga0501067_0708163 | 3300049583 | Bacteria | 566 |
| 866 | Ga0501070_0248645 | 3300049586 | Bacteria | 1455 |
| 867 | Ga0501070_0254639 | 3300049586 | Bacteria | 1436 |
| 868 | Ga0501202_050767 | 3300049652 | Bacteria | 918 |
| 869 | Ga0501207_023247 | 3300049654 | Bacteria | 1005 |
| 870 | Ga0501227_002378 | 3300049665 | Bacteria | 4157 |
| 871 | Ga0501227_021046 | 3300049665 | Bacteria | 1501 |
| 872 | Ga0501243_001360 | 3300049675 | Bacteria | 3498 |
| 873 | Ga0501083_0005756 | 3300049744 | Bacteria | 8768 |
| 874 | Ga0501263_034297 | 3300049760 | Bacteria | 727 |
| 875 | Ga0501263_060529 | 3300049760 | Bacteria | 593 |
| 876 | Ga0501279_003747 | 3300049775 | Bacteria | 1988 |
| 877 | Ga0501279_004114 | 3300049775 | Bacteria | 1905 |
| 878 | Ga0501279_011654 | 3300049775 | Bacteria | 1191 |
| 879 | Ga0501035_0004747 | 3300049822 | Bacteria | 12903 |
| 880 | Ga0501035_0006337 | 3300049822 | Bacteria | 11126 |
| 881 | Ga0501044_0001471 | 3300049823 | Bacteria | 27663 |
| 882 | Ga0501044_1151090 | 3300049823 | Bacteria | 644 |
| 883 | Ga0501226_012002 | 3300049853 | Bacteria | 960 |
| 884 | nmdc:mga0n895_5361_c1 | 3300050512 | Bacteria | 10694 |
| 885 | nmdc:mga0rr50_118422_c1 | 3300050513 | Bacteria | 2104 |
| 886 | nmdc:mga08x19_13862_c1 | 3300050514 | Bacteria | 4883 |
| 887 | nmdc:mga0a205_13293_c1 | 3300050515 | Bacteria | 7656 |
| 888 | Ga0500555_014711 | 3300053103 | Eukaryota | 2256 |
| 889 | Ga0500607_000615 | 3300053121 | Eukaryota | 34386 |
| 890 | Ga0500607_008419 | 3300053121 | Bacteria | 6276 |
| 891 | Ga0500614_039163 | 3300053123 | Bacteria | 1197 |
| 892 | Ga0500559_0226021 | 3300053136 | Bacteria | 882 |
| 893 | Ga0500636_0001052 | 3300053177 | Bacteria | 14818 |
| 894 | Ga0500637_0092525 | 3300053178 | Bacteria | 1752 |
| 895 | Ga0500625_119963 | 3300053729 | Bacteria | 1059 |
| 896 | Ga0587084_014618 | 3300059477 | Bacteria | 1097 |
| 897 | Ga0587066_053972 | 3300059490 | Bacteria | 800 |
| 898 | Ga0587070_070430 | 3300059491 | Bacteria | 745 |
| 899 | Ga0587073_0049366 | 3300059492 | Bacteria | 948 |
| 900 | Ga0587077_057286 | 3300059493 | Bacteria | 834 |
| 901 | Ga0587082_017491 | 3300059504 | Bacteria | 1130 |
| 902 | Ga0587083_0002352 | 3300059505 | Bacteria | 2340 |
| 903 | Ga0587083_0041313 | 3300059505 | Bacteria | 967 |
| 904 | Ga0587088_002623 | 3300059508 | Bacteria | 2076 |
| 905 | Ga0587091_020084 | 3300059511 | Bacteria | 1156 |
| 906 | Ga0587106_001842 | 3300059605 | Bacteria | 1973 |
| 907 | Ga0587106_006419 | 3300059605 | Bacteria | 1386 |
| 908 | Ga0587101_020970 | 3300059623 | Bacteria | 940 |
| 909 | Ga0587068_002833 | 3300059641 | Bacteria | 2152 |
| 910 | Ga0587072_027254 | 3300059643 | Bacteria | 1048 |
| 911 | Ga0587076_051532 | 3300059645 | Bacteria | 804 |
| 912 | Ga0587079_025914 | 3300059647 | Bacteria | 1092 |
| 913 | Ga0587102_005752 | 3300059649 | Bacteria | 1105 |
| 914 | Ga0587105_001963 | 3300059651 | Bacteria | 1129 |
| 915 | Ga0501082_1426855 | 3300060353 | Bacteria | 604 |
| 916 | Ga0466962_0050633 | 3300061719 | Bacteria | 1985 |
| 917 | Ga0466962_0156304 | 3300061719 | Bacteria | 1107 |
| 918 | Ga0466962_0591116 | 3300061719 | Bacteria | 565 |
| 919 | Ga0530510_0523549 | 3300061734 | Bacteria | 899 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041459 | Ga0451800_0000795 | Ga0451800_0000795_213_635 | 133 |
| 2 | 3300046684 | Ga0495669_0029643 | Ga0495669_0029643_1650_2087 | 134 |
| 3 | 3300046542 | Ga0495597_0002415 | Ga0495597_0002415_1531_2001 | 135 |
| 4 | 3300046794 | Ga0495589_0004643 | Ga0495589_0004643_1533_2003 | 135 |
| 5 | 3300005563 | Ga0068855_100001020 | Ga0068855_10000102032 | 136 |
| 6 | 3300025949 | Ga0207667_10000896 | Ga0207667_1000089618 | 136 |
| 7 | 3300002741 | JGI25157J39369_1017589 | JGI25157J39369_10175892 | 137 |
| 8 | 3300041452 | Ga0451793_1527940 | Ga0451793_1527940_247_666 | 137 |
| 9 | 3300046471 | Ga0495650_0304105 | Ga0495650_0304105_95_514 | 137 |
| 10 | 3300046492 | Ga0495585_0000904 | Ga0495585_0000904_24203_24622 | 137 |
| 11 | 3300046524 | Ga0495648_0011970 | Ga0495648_0011970_5210_5629 | 137 |
| 12 | 3300046538 | Ga0495609_0013121 | Ga0495609_0013121_2933_3352 | 137 |
| 13 | 3300046557 | Ga0495622_0030966 | Ga0495622_0030966_2045_2464 | 137 |
| 14 | 3300046616 | Ga0495668_0000021 | Ga0495668_0000021_242095_242514 | 137 |
| 15 | 3300046660 | Ga0495625_0003181 | Ga0495625_0003181_5162_5581 | 137 |
| 16 | 3300053123 | Ga0500614_039163 | Ga0500614_039163_466_885 | 137 |
| 17 | 3300005288 | Ga0065714_10008115 | Ga0065714_100081152 | 138 |
| 18 | 3300005329 | Ga0070683_100045537 | Ga0070683_1000455375 | 138 |
| 19 | 3300005614 | Ga0068856_100372840 | Ga0068856_1003728402 | 138 |
| 20 | 3300013100 | Ga0157373_10000208 | Ga0157373_1000020848 | 138 |
| 21 | 3300013307 | Ga0157372_10001960 | Ga0157372_1000196012 | 138 |
| 22 | 3300025250 | Ga0209026_1001421 | Ga0209026_10014212 | 138 |
| 23 | 3300025909 | Ga0207705_10298809 | Ga0207705_102988092 | 138 |
| 24 | 3300025944 | Ga0207661_10007731 | Ga0207661_100077312 | 138 |
| 25 | 3300036712 | Ga0316584_0560662 | Ga0316584_0560662_266_697 | 138 |
| 26 | 3300044673 | Ga0453683_0090229 | Ga0453683_0090229_1037_1468 | 138 |
| 27 | 3300046474 | Ga0495605_0031579 | Ga0495605_0031579_250_687 | 138 |
| 28 | 3300046500 | Ga0495596_0002563 | Ga0495596_0002563_3204_3641 | 138 |
| 29 | 3300046524 | Ga0495648_0034375 | Ga0495648_0034375_620_1057 | 138 |
| 30 | 3300046538 | Ga0495609_0005081 | Ga0495609_0005081_1037_1474 | 138 |
| 31 | 3300046794 | Ga0495589_0048393 | Ga0495589_0048393_761_1198 | 138 |
| 32 | 3300047320 | Ga0495672_0021332 | Ga0495672_0021332_1119_1556 | 138 |
| 33 | 3300047321 | Ga0495676_0403775 | Ga0495676_0403775_294_731 | 138 |
| 34 | 3300047323 | Ga0495683_0016184 | Ga0495683_0016184_1041_1478 | 138 |
| 35 | iso_pu_bacteria | 2786546940 | 2788436509 | 138 |
| 36 | 3300046491 | Ga0495584_0043913 | Ga0495584_0043913_1205_1642 | 139 |
| 37 | 3300046694 | Ga0495649_0110193 | Ga0495649_0110193_696_1133 | 139 |
| 38 | 3300005327 | Ga0070658_10245369 | Ga0070658_102453692 | 140 |
| 39 | 3300005530 | Ga0070679_100131647 | Ga0070679_1001316471 | 140 |
| 40 | 3300009093 | Ga0105240_10240122 | Ga0105240_102401222 | 140 |
| 41 | 3300035724 | Ga0373933_0349542 | Ga0373933_0349542_236_673 | 140 |
| 42 | 3300036401 | Ga0373937_0076142 | Ga0373937_0076142_865_1302 | 140 |
| 43 | 3300044712 | Ga0453684_1647184 | Ga0453684_1647184_216_641 | 140 |
| 44 | 3300046539 | Ga0495621_0370772 | Ga0495621_0370772_131_556 | 140 |
| 45 | 3300049532 | Ga0501316_075490 | Ga0501316_075490_83_505 | 140 |
| 46 | iso_pu_bacteria | 2808606364 | 2808869378 | 140 |
| 47 | 3300003320 | rootH2_10032765 | rootH2_1003276525 | 141 |
| 48 | 3300003323 | rootH1_10071921 | rootH1_100719212 | 141 |
| 49 | 3300005330 | Ga0070690_100327819 | Ga0070690_1003278192 | 141 |
| 50 | 3300005334 | Ga0068869_100000016 | Ga0068869_10000001620 | 141 |
| 51 | 3300005338 | Ga0068868_100064487 | Ga0068868_1000644872 | 141 |
| 52 | 3300005338 | Ga0068868_100076914 | Ga0068868_1000769142 | 141 |
| 53 | 3300005459 | Ga0068867_100000872 | Ga0068867_1000008727 | 141 |
| 54 | 3300005530 | Ga0070679_100033921 | Ga0070679_1000339217 | 141 |
| 55 | 3300005548 | Ga0070665_100496715 | Ga0070665_1004967153 | 141 |
| 56 | 3300005614 | Ga0068856_100001534 | Ga0068856_10000153411 | 141 |
| 57 | 3300005617 | Ga0068859_102045715 | Ga0068859_1020457152 | 141 |
| 58 | 3300005981 | Ga0081538_10001906 | Ga0081538_1000190618 | 141 |
| 59 | 3300006237 | Ga0097621_100206978 | Ga0097621_1002069782 | 141 |
| 60 | 3300006358 | Ga0068871_100005339 | Ga0068871_1000053399 | 141 |
| 61 | 3300006358 | Ga0068871_100566446 | Ga0068871_1005664462 | 141 |
| 62 | 3300006852 | Ga0075433_10000299 | Ga0075433_1000029931 | 141 |
| 63 | 3300006852 | Ga0075433_10011819 | Ga0075433_100118197 | 141 |
| 64 | 3300006871 | Ga0075434_100059706 | Ga0075434_1000597062 | 141 |
| 65 | 3300006881 | Ga0068865_100019070 | Ga0068865_1000190704 | 141 |
| 66 | 3300006881 | Ga0068865_100813314 | Ga0068865_1008133142 | 141 |
| 67 | 3300006914 | Ga0075436_100008751 | Ga0075436_1000087515 | 141 |
| 68 | 3300006931 | Ga0097620_102045415 | Ga0097620_1020454152 | 141 |
| 69 | 3300007076 | Ga0075435_100199384 | Ga0075435_1001993843 | 141 |
| 70 | 3300025921 | Ga0207652_10668107 | Ga0207652_106681072 | 141 |
| 71 | 3300025938 | Ga0207704_10004481 | Ga0207704_100044818 | 141 |
| 72 | 3300025938 | Ga0207704_10607087 | Ga0207704_106070872 | 141 |
| 73 | 3300025942 | Ga0207689_10000241 | Ga0207689_1000024127 | 141 |
| 74 | 3300026023 | Ga0207677_10045655 | Ga0207677_100456554 | 141 |
| 75 | 3300026078 | Ga0207702_10001475 | Ga0207702_1000147510 | 141 |
| 76 | 3300026089 | Ga0207648_10000756 | Ga0207648_1000075629 | 141 |
| 77 | 3300026116 | Ga0207674_11645664 | Ga0207674_116456641 | 141 |
| 78 | 3300028379 | Ga0268266_10484789 | Ga0268266_104847891 | 141 |
| 79 | 3300028556 | Ga0265337_1007423 | Ga0265337_10074232 | 141 |
| 80 | 3300028556 | Ga0265337_1021153 | Ga0265337_10211533 | 141 |
| 81 | 3300028556 | Ga0265337_1131577 | Ga0265337_11315771 | 141 |
| 82 | 3300028563 | Ga0265319_1002638 | Ga0265319_10026383 | 141 |
| 83 | 3300028563 | Ga0265319_1010821 | Ga0265319_10108212 | 141 |
| 84 | 3300028563 | Ga0265319_1016186 | Ga0265319_10161865 | 141 |
| 85 | 3300028573 | Ga0265334_10023332 | Ga0265334_100233322 | 141 |
| 86 | 3300028577 | Ga0265318_10007120 | Ga0265318_100071205 | 141 |
| 87 | 3300028577 | Ga0265318_10008469 | Ga0265318_100084696 | 141 |
| 88 | 3300028577 | Ga0265318_10042058 | Ga0265318_100420582 | 141 |
| 89 | 3300028577 | Ga0265318_10345107 | Ga0265318_103451072 | 141 |
| 90 | 3300028654 | Ga0265322_10115042 | Ga0265322_101150422 | 141 |
| 91 | 3300028654 | Ga0265322_10153083 | Ga0265322_101530832 | 141 |
| 92 | 3300028666 | Ga0265336_10010984 | Ga0265336_100109842 | 141 |
| 93 | 3300028800 | Ga0265338_10000329 | Ga0265338_1000032938 | 141 |
| 94 | 3300028800 | Ga0265338_10020776 | Ga0265338_100207765 | 141 |
| 95 | 3300028800 | Ga0265338_10072963 | Ga0265338_100729632 | 141 |
| 96 | 3300028800 | Ga0265338_10075568 | Ga0265338_100755683 | 141 |
| 97 | 3300028800 | Ga0265338_10455523 | Ga0265338_104555231 | 141 |
| 98 | 3300029957 | Ga0265324_10003662 | Ga0265324_100036627 | 141 |
| 99 | 3300029957 | Ga0265324_10017110 | Ga0265324_100171104 | 141 |
| 100 | 3300029957 | Ga0265324_10063104 | Ga0265324_100631042 | 141 |
| 101 | 3300031238 | Ga0265332_10049693 | Ga0265332_100496932 | 141 |
| 102 | 3300031239 | Ga0265328_10055459 | Ga0265328_100554592 | 141 |
| 103 | 3300031240 | Ga0265320_10000735 | Ga0265320_1000073515 | 141 |
| 104 | 3300031240 | Ga0265320_10017525 | Ga0265320_100175254 | 141 |
| 105 | 3300031240 | Ga0265320_10022073 | Ga0265320_100220733 | 141 |
| 106 | 3300031240 | Ga0265320_10030912 | Ga0265320_100309122 | 141 |
| 107 | 3300031241 | Ga0265325_10024461 | Ga0265325_100244614 | 141 |
| 108 | 3300031247 | Ga0265340_10014689 | Ga0265340_100146893 | 141 |
| 109 | 3300031249 | Ga0265339_10051665 | Ga0265339_100516652 | 141 |
| 110 | 3300031249 | Ga0265339_10061599 | Ga0265339_100615993 | 141 |
| 111 | 3300031250 | Ga0265331_10042698 | Ga0265331_100426982 | 141 |
| 112 | 3300031251 | Ga0265327_10019749 | Ga0265327_100197492 | 141 |
| 113 | 3300031251 | Ga0265327_10066161 | Ga0265327_100661612 | 141 |
| 114 | 3300031344 | Ga0265316_10037727 | Ga0265316_100377272 | 141 |
| 115 | 3300031344 | Ga0265316_10106340 | Ga0265316_101063401 | 141 |
| 116 | 3300031344 | Ga0265316_10150493 | Ga0265316_101504932 | 141 |
| 117 | 3300031344 | Ga0265316_10320357 | Ga0265316_103203572 | 141 |
| 118 | 3300031344 | Ga0265316_10338292 | Ga0265316_103382922 | 141 |
| 119 | 3300031548 | Ga0307408_100000032 | Ga0307408_10000003253 | 141 |
| 120 | 3300031595 | Ga0265313_10000228 | Ga0265313_1000022838 | 141 |
| 121 | 3300031595 | Ga0265313_10001658 | Ga0265313_1000165819 | 141 |
| 122 | 3300031711 | Ga0265314_10011755 | Ga0265314_100117558 | 141 |
| 123 | 3300031711 | Ga0265314_10051519 | Ga0265314_100515194 | 141 |
| 124 | 3300031711 | Ga0265314_10309112 | Ga0265314_103091121 | 141 |
| 125 | 3300031712 | Ga0265342_10060029 | Ga0265342_100600293 | 141 |
| 126 | 3300031712 | Ga0265342_10068863 | Ga0265342_100688632 | 141 |
| 127 | 3300031712 | Ga0265342_10129365 | Ga0265342_101293652 | 141 |
| 128 | 3300031852 | Ga0307410_10000013 | Ga0307410_1000001336 | 141 |
| 129 | 3300031995 | Ga0307409_100000031 | Ga0307409_10000003136 | 141 |
| 130 | 3300032002 | Ga0307416_100000038 | Ga0307416_1000000388 | 141 |
| 131 | 3300032004 | Ga0307414_10230779 | Ga0307414_102307793 | 141 |
| 132 | 3300035086 | Ga0373934_0078195 | Ga0373934_0078195_657_1085 | 141 |
| 133 | 3300035088 | Ga0373940_0031344 | Ga0373940_0031344_264_704 | 141 |
| 134 | 3300035091 | Ga0373951_0016056 | Ga0373951_0016056_16_444 | 141 |
| 135 | 3300035691 | Ga0373931_0838126 | Ga0373931_0838126_141_581 | 141 |
| 136 | 3300035692 | Ga0373935_0223992 | Ga0373935_0223992_670_1098 | 141 |
| 137 | 3300035724 | Ga0373933_0168616 | Ga0373933_0168616_357_785 | 141 |
| 138 | 3300036401 | Ga0373937_1257363 | Ga0373937_1257363_154_582 | 141 |
| 139 | 3300037471 | Ga0395905_0000015 | Ga0395905_0000015_385975_386403 | 141 |
| 140 | 3300041494 | Ga0451837_1317882 | Ga0451837_1317882_191_619 | 141 |
| 141 | 3300041997 | Ga0439431_0042404 | Ga0439431_0042404_565_993 | 141 |
| 142 | 3300042876 | Ga0451577_0232719 | Ga0451577_0232719_691_1119 | 141 |
| 143 | 3300042876 | Ga0451577_0790539 | Ga0451577_0790539_277_717 | 141 |
| 144 | 3300042876 | Ga0451577_0957872 | Ga0451577_0957872_133_561 | 141 |
| 145 | 3300044712 | Ga0453684_0011780 | Ga0453684_0011780_10833_11261 | 141 |
| 146 | 3300044712 | Ga0453684_0400446 | Ga0453684_0400446_181_609 | 141 |
| 147 | 3300044765 | Ga0466970_0306667 | Ga0466970_0306667_374_802 | 141 |
| 148 | 3300045051 | Ga0451576_0001454 | Ga0451576_0001454_11339_11767 | 141 |
| 149 | 3300045051 | Ga0451576_0001488 | Ga0451576_0001488_24304_24765 | 141 |
| 150 | 3300045051 | Ga0451576_0002783 | Ga0451576_0002783_13203_13631 | 141 |
| 151 | 3300045051 | Ga0451576_0090052 | Ga0451576_0090052_788_1216 | 141 |
| 152 | 3300046471 | Ga0495650_0033047 | Ga0495650_0033047_648_1076 | 141 |
| 153 | 3300049574 | Ga0501038_0322239 | Ga0501038_0322239_624_1052 | 141 |
| 154 | 3300049578 | Ga0501042_0472253 | Ga0501042_0472253_235_663 | 141 |
| 155 | 3300049579 | Ga0501043_0277175 | Ga0501043_0277175_498_926 | 141 |
| 156 | 3300049580 | Ga0501046_0035622 | Ga0501046_0035622_3401_3829 | 141 |
| 157 | 3300049580 | Ga0501046_0529471 | Ga0501046_0529471_379_807 | 141 |
| 158 | 3300049581 | Ga0501047_0031101 | Ga0501047_0031101_1238_1666 | 141 |
| 159 | 3300049583 | Ga0501067_0708163 | Ga0501067_0708163_13_441 | 141 |
| 160 | 3300049586 | Ga0501070_0248645 | Ga0501070_0248645_848_1276 | 141 |
| 161 | 3300049586 | Ga0501070_0254639 | Ga0501070_0254639_215_643 | 141 |
| 162 | 3300049675 | Ga0501243_001360 | Ga0501243_001360_2688_3116 | 141 |
| 163 | 3300049744 | Ga0501083_0005756 | Ga0501083_0005756_8020_8448 | 141 |
| 164 | 3300049760 | Ga0501263_060529 | Ga0501263_060529_35_463 | 141 |
| 165 | 3300049822 | Ga0501035_0006337 | Ga0501035_0006337_4410_4838 | 141 |
| 166 | 3300049823 | Ga0501044_0001471 | Ga0501044_0001471_26540_26968 | 141 |
| 167 | 3300049823 | Ga0501044_1151090 | Ga0501044_1151090_65_493 | 141 |
| 168 | 3300050512 | nmdc:mga0n895_5361_c1 | nmdc:mga0n895_5361_c1_9173_9613 | 141 |
| 169 | 3300050513 | nmdc:mga0rr50_118422_c1 | nmdc:mga0rr50_118422_c1_1035_1475 | 141 |
| 170 | 3300050514 | nmdc:mga08x19_13862_c1 | nmdc:mga08x19_13862_c1_1420_1860 | 141 |
| 171 | 3300050515 | nmdc:mga0a205_13293_c1 | nmdc:mga0a205_13293_c1_643_1083 | 141 |
| 172 | 3300060353 | Ga0501082_1426855 | Ga0501082_1426855_108_536 | 141 |
| 173 | 3300061719 | Ga0466962_0591116 | Ga0466962_0591116_48_476 | 141 |
| 174 | 3300061734 | Ga0530510_0523549 | Ga0530510_0523549_337_825 | 141 |
| 175 | iso_pu_bacteria | 2643221554 | 2643788683 | 141 |
| 176 | iso_pu_bacteria | 2643221638 | 2644213296 | 141 |
| 177 | iso_pu_bacteria | 2643221645 | 2644249636 | 141 |
| 178 | iso_pu_bacteria | 2643221664 | 2644356200 | 141 |
| 179 | iso_pu_bacteria | 2738541280 | 2738739147 | 141 |
| 180 | iso_pu_bacteria | 2738541300 | 2738846382 | 141 |
| 181 | iso_pu_bacteria | 2738543018 | 2739274969 | 141 |
| 182 | iso_pu_bacteria | 2738543030 | 2739344013 | 141 |
| 183 | iso_pu_bacteria | 2765235838 | 2765567555 | 141 |
| 184 | iso_pu_bacteria | 2808606418 | 2809144265 | 141 |
| 185 | iso_pu_bacteria | 2839094727 | 2839099499 | 141 |
| 186 | iso_pu_bacteria | 8047673197 | 8047679074 | 141 |
| 187 | 3300028556 | Ga0265337_1006922 | Ga0265337_10069222 | 142 |
| 188 | 3300028563 | Ga0265319_1043748 | Ga0265319_10437482 | 142 |
| 189 | 3300028653 | Ga0265323_10000069 | Ga0265323_1000006941 | 142 |
| 190 | 3300028653 | Ga0265323_10070875 | Ga0265323_100708751 | 142 |
| 191 | 3300028654 | Ga0265322_10000305 | Ga0265322_100003053 | 142 |
| 192 | 3300028800 | Ga0265338_10732948 | Ga0265338_107329481 | 142 |
| 193 | 3300031235 | Ga0265330_10095838 | Ga0265330_100958382 | 142 |
| 194 | 3300031235 | Ga0265330_10109542 | Ga0265330_101095421 | 142 |
| 195 | 3300031240 | Ga0265320_10002038 | Ga0265320_1000203813 | 142 |
| 196 | 3300031250 | Ga0265331_10043625 | Ga0265331_100436254 | 142 |
| 197 | 3300031344 | Ga0265316_10002099 | Ga0265316_100020996 | 142 |
| 198 | 3300031344 | Ga0265316_10223063 | Ga0265316_102230632 | 142 |
| 199 | 3300031344 | Ga0265316_10858917 | Ga0265316_108589171 | 142 |
| 200 | 3300031595 | Ga0265313_10046645 | Ga0265313_100466453 | 142 |
| 201 | 3300031712 | Ga0265342_10007378 | Ga0265342_100073784 | 142 |
| 202 | 3300031712 | Ga0265342_10470035 | Ga0265342_104700351 | 142 |
| 203 | 3300028563 | Ga0265319_1001015 | Ga0265319_10010152 | 143 |
| 204 | 3300028563 | Ga0265319_1014782 | Ga0265319_10147823 | 143 |
| 205 | 3300028563 | Ga0265319_1016890 | Ga0265319_10168902 | 143 |
| 206 | 3300028577 | Ga0265318_10001407 | Ga0265318_1000140713 | 143 |
| 207 | 3300031240 | Ga0265320_10000515 | Ga0265320_100005158 | 143 |
| 208 | 3300031240 | Ga0265320_10001485 | Ga0265320_100014856 | 143 |
| 209 | 3300031595 | Ga0265313_10208918 | Ga0265313_102089182 | 143 |
| 210 | 3300031911 | Ga0307412_11407111 | Ga0307412_114071111 | 143 |
| 211 | 3300042876 | Ga0451577_0035000 | Ga0451577_0035000_1703_2137 | 143 |
| 212 | 3300044712 | Ga0453684_0000045 | Ga0453684_0000045_8041_8475 | 143 |
| 213 | 3300046473 | Ga0495582_0001028 | Ga0495582_0001028_11452_11928 | 143 |
| 214 | 3300046474 | Ga0495605_0019333 | Ga0495605_0019333_2984_3460 | 143 |
| 215 | 3300046491 | Ga0495584_0202998 | Ga0495584_0202998_157_633 | 143 |
| 216 | 3300046492 | Ga0495585_0031985 | Ga0495585_0031985_1314_1790 | 143 |
| 217 | 3300046499 | Ga0495594_0075294 | Ga0495594_0075294_732_1163 | 143 |
| 218 | 3300046499 | Ga0495594_0095601 | Ga0495594_0095601_578_1054 | 143 |
| 219 | 3300046499 | Ga0495594_0161693 | Ga0495594_0161693_457_888 | 143 |
| 220 | 3300046500 | Ga0495596_0022377 | Ga0495596_0022377_1865_2341 | 143 |
| 221 | 3300046506 | Ga0495583_0147558 | Ga0495583_0147558_120_596 | 143 |
| 222 | 3300046513 | Ga0495616_0080660 | Ga0495616_0080660_756_1232 | 143 |
| 223 | 3300046522 | Ga0495643_0358678 | Ga0495643_0358678_111_587 | 143 |
| 224 | 3300046523 | Ga0495644_0007340 | Ga0495644_0007340_2551_3027 | 143 |
| 225 | 3300046526 | Ga0495666_0012484 | Ga0495666_0012484_2725_3156 | 143 |
| 226 | 3300046526 | Ga0495666_0086650 | Ga0495666_0086650_590_1021 | 143 |
| 227 | 3300046530 | Ga0495654_0105954 | Ga0495654_0105954_669_1145 | 143 |
| 228 | 3300046531 | Ga0495665_0034032 | Ga0495665_0034032_1667_2098 | 143 |
| 229 | 3300046531 | Ga0495665_0054761 | Ga0495665_0054761_1067_1498 | 143 |
| 230 | 3300046535 | Ga0495586_0094793 | Ga0495586_0094793_101_532 | 143 |
| 231 | 3300046535 | Ga0495586_0527517 | Ga0495586_0527517_223_654 | 143 |
| 232 | 3300046538 | Ga0495609_0029855 | Ga0495609_0029855_906_1382 | 143 |
| 233 | 3300046542 | Ga0495597_0108527 | Ga0495597_0108527_633_1109 | 143 |
| 234 | 3300046557 | Ga0495622_0011709 | Ga0495622_0011709_487_963 | 143 |
| 235 | 3300046557 | Ga0495622_0056631 | Ga0495622_0056631_971_1402 | 143 |
| 236 | 3300046558 | Ga0495633_0040400 | Ga0495633_0040400_578_1054 | 143 |
| 237 | 3300046616 | Ga0495668_0159041 | Ga0495668_0159041_488_964 | 143 |
| 238 | 3300046648 | Ga0495611_0038370 | Ga0495611_0038370_1168_1644 | 143 |
| 239 | 3300046660 | Ga0495625_0028905 | Ga0495625_0028905_3069_3545 | 143 |
| 240 | 3300046665 | Ga0495661_0046043 | Ga0495661_0046043_1975_2451 | 143 |
| 241 | 3300046674 | Ga0495588_0017232 | Ga0495588_0017232_2730_3206 | 143 |
| 242 | 3300046674 | Ga0495588_0028510 | Ga0495588_0028510_1079_1510 | 143 |
| 243 | 3300046674 | Ga0495588_0101812 | Ga0495588_0101812_694_1125 | 143 |
| 244 | 3300046684 | Ga0495669_0000400 | Ga0495669_0000400_10731_11207 | 143 |
| 245 | 3300046691 | Ga0495670_0015421 | Ga0495670_0015421_2792_3268 | 143 |
| 246 | 3300046691 | Ga0495670_0092952 | Ga0495670_0092952_519_950 | 143 |
| 247 | 3300046694 | Ga0495649_0043337 | Ga0495649_0043337_176_652 | 143 |
| 248 | 3300046794 | Ga0495589_0083014 | Ga0495589_0083014_651_1127 | 143 |
| 249 | 3300047315 | Ga0495581_0029213 | Ga0495581_0029213_1527_2003 | 143 |
| 250 | 3300047315 | Ga0495581_0157034 | Ga0495581_0157034_571_1002 | 143 |
| 251 | 3300047318 | Ga0495636_0040605 | Ga0495636_0040605_244_720 | 143 |
| 252 | 3300047320 | Ga0495672_0009762 | Ga0495672_0009762_5410_5841 | 143 |
| 253 | 3300047321 | Ga0495676_0083006 | Ga0495676_0083006_711_1142 | 143 |
| 254 | 3300047323 | Ga0495683_0369765 | Ga0495683_0369765_54_530 | 143 |
| 255 | 3300047443 | Ga0495687_000210 | Ga0495687_000210_12263_12694 | 143 |
| 256 | 3300047445 | Ga0495677_0036892 | Ga0495677_0036892_198_674 | 143 |
| 257 | 3300047446 | Ga0495679_052201 | Ga0495679_052201_374_850 | 143 |
| 258 | 3300047447 | Ga0495685_152066 | Ga0495685_152066_199_675 | 143 |
| 259 | 3300047470 | Ga0495681_0183766 | Ga0495681_0183766_163_639 | 143 |
| 260 | 3300048088 | Ga0495602_0179218 | Ga0495602_0179218_68_499 | 143 |
| 261 | 3300048089 | Ga0495614_0020215 | Ga0495614_0020215_887_1363 | 143 |
| 262 | 3300048091 | Ga0495626_0017645 | Ga0495626_0017645_2960_3436 | 143 |
| 263 | 3300049129 | Ga0501309_004005 | Ga0501309_004005_97_528 | 143 |
| 264 | 3300010375 | Ga0105239_10009203 | Ga0105239_1000920313 | 144 |
| 265 | 3300013100 | Ga0157373_10342570 | Ga0157373_103425702 | 144 |
| 266 | 3300025914 | Ga0207671_10138785 | Ga0207671_101387851 | 144 |
| 267 | 3300025949 | Ga0207667_11124227 | Ga0207667_111242271 | 144 |
| 268 | 3300042138 | Ga0450903_018547 | Ga0450903_018547_25_477 | 144 |
| 269 | 3300002739 | JGI25158J39367_1001655 | JGI25158J39367_10016555 | 145 |
| 270 | 3300002773 | JGI25152J39213_1000245 | JGI25152J39213_10002451 | 145 |
| 271 | 3300002774 | JGI25150J39212_1028710 | JGI25150J39212_10287102 | 145 |
| 272 | 3300002987 | JGI25159J45721_1005640 | JGI25159J45721_10056405 | 145 |
| 273 | 3300002987 | JGI25159J45721_1012666 | JGI25159J45721_10126662 | 145 |
| 274 | 3300003163 | Ga0006759J45824_1068122 | Ga0006759J45824_10681222 | 145 |
| 275 | 3300003215 | JGI25153J46596_10001778 | JGI25153J46596_100017784 | 145 |
| 276 | 3300003322 | rootL2_10002967 | rootL2_100029673 | 145 |
| 277 | 3300003322 | rootL2_10002968 | rootL2_100029683 | 145 |
| 278 | 3300003354 | JGI25160J50197_1003487 | JGI25160J50197_10034875 | 145 |
| 279 | 3300003374 | JGI25161J50226_1003103 | JGI25161J50226_10031032 | 145 |
| 280 | 3300003575 | Ga0007409J51694_1013231 | Ga0007409J51694_10132313 | 145 |
| 281 | 3300003693 | Ga0032354_1046455 | Ga0032354_10464553 | 145 |
| 282 | 3300003771 | Ga0055526_1000556 | Ga0055526_100055622 | 145 |
| 283 | 3300003771 | Ga0055526_1024738 | Ga0055526_10247383 | 145 |
| 284 | 3300003773 | Ga0055537_1000056 | Ga0055537_100005666 | 145 |
| 285 | 3300003775 | Ga0055524_1003233 | Ga0055524_10032335 | 145 |
| 286 | 3300003784 | Ga0055534_1000178 | Ga0055534_100017816 | 145 |
| 287 | 3300003784 | Ga0055534_1009222 | Ga0055534_10092223 | 145 |
| 288 | 3300003790 | Ga0055528_1000297 | Ga0055528_100029723 | 145 |
| 289 | 3300003790 | Ga0055528_1003822 | Ga0055528_10038225 | 145 |
| 290 | 3300003791 | Ga0055530_10013759 | Ga0055530_100137592 | 145 |
| 291 | 3300003794 | Ga0055531_10012000 | Ga0055531_100120002 | 145 |
| 292 | 3300004625 | Ga0055543_1001330 | Ga0055543_100133012 | 145 |
| 293 | 3300005262 | Ga0065165_1000447 | Ga0065165_100044748 | 145 |
| 294 | 3300005262 | Ga0065165_1000986 | Ga0065165_100098611 | 145 |
| 295 | 3300005262 | Ga0065165_1041456 | Ga0065165_10414561 | 145 |
| 296 | 3300005327 | Ga0070658_11467976 | Ga0070658_114679761 | 145 |
| 297 | 3300005329 | Ga0070683_100371247 | Ga0070683_1003712472 | 145 |
| 298 | 3300005334 | Ga0068869_100126435 | Ga0068869_1001264353 | 145 |
| 299 | 3300005339 | Ga0070660_100020896 | Ga0070660_1000208961 | 145 |
| 300 | 3300005339 | Ga0070660_100665185 | Ga0070660_1006651851 | 145 |
| 301 | 3300005366 | Ga0070659_100213325 | Ga0070659_1002133251 | 145 |
| 302 | 3300005366 | Ga0070659_101418986 | Ga0070659_1014189861 | 145 |
| 303 | 3300005455 | Ga0070663_100285892 | Ga0070663_1002858922 | 145 |
| 304 | 3300005456 | Ga0070678_100787963 | Ga0070678_1007879632 | 145 |
| 305 | 3300005457 | Ga0070662_100047427 | Ga0070662_1000474274 | 145 |
| 306 | 3300005457 | Ga0070662_100287705 | Ga0070662_1002877051 | 145 |
| 307 | 3300005457 | Ga0070662_100922971 | Ga0070662_1009229711 | 145 |
| 308 | 3300005563 | Ga0068855_100014744 | Ga0068855_1000147444 | 145 |
| 309 | 3300005563 | Ga0068855_100103246 | Ga0068855_1001032464 | 145 |
| 310 | 3300005564 | Ga0070664_100034159 | Ga0070664_1000341595 | 145 |
| 311 | 3300005564 | Ga0070664_100222706 | Ga0070664_1002227062 | 145 |
| 312 | 3300005844 | Ga0068862_100596410 | Ga0068862_1005964102 | 145 |
| 313 | 3300009093 | Ga0105240_10345191 | Ga0105240_103451912 | 145 |
| 314 | 3300009098 | Ga0105245_10031045 | Ga0105245_100310453 | 145 |
| 315 | 3300009148 | Ga0105243_10008313 | Ga0105243_100083134 | 145 |
| 316 | 3300009174 | Ga0105241_10151149 | Ga0105241_101511493 | 145 |
| 317 | 3300009176 | Ga0105242_10033488 | Ga0105242_100334884 | 145 |
| 318 | 3300009176 | Ga0105242_10255942 | Ga0105242_102559423 | 145 |
| 319 | 3300009545 | Ga0105237_10223903 | Ga0105237_102239032 | 145 |
| 320 | 3300009551 | Ga0105238_10242950 | Ga0105238_102429502 | 145 |
| 321 | 3300013100 | Ga0157373_10105984 | Ga0157373_101059843 | 145 |
| 322 | 3300013102 | Ga0157371_10407012 | Ga0157371_104070121 | 145 |
| 323 | 3300013104 | Ga0157370_10245395 | Ga0157370_102453951 | 145 |
| 324 | 3300013105 | Ga0157369_10285537 | Ga0157369_102855371 | 145 |
| 325 | 3300013297 | Ga0157378_10189454 | Ga0157378_101894542 | 145 |
| 326 | 3300013307 | Ga0157372_11062449 | Ga0157372_110624492 | 145 |
| 327 | 3300013307 | Ga0157372_11143060 | Ga0157372_111430602 | 145 |
| 328 | 3300014745 | Ga0157377_10091734 | Ga0157377_100917341 | 145 |
| 329 | 3300015261 | Ga0182006_1044792 | Ga0182006_10447922 | 145 |
| 330 | 3300025208 | Ga0209436_100508 | Ga0209436_10050815 | 145 |
| 331 | 3300025208 | Ga0209436_100526 | Ga0209436_10052615 | 145 |
| 332 | 3300025230 | Ga0209563_100015 | Ga0209563_100015448 | 145 |
| 333 | 3300025245 | Ga0207425_1000006 | Ga0207425_1000006220 | 145 |
| 334 | 3300025245 | Ga0207425_1000310 | Ga0207425_100031025 | 145 |
| 335 | 3300025253 | Ga0209677_103454 | Ga0209677_1034543 | 145 |
| 336 | 3300025254 | Ga0209148_1000607 | Ga0209148_100060721 | 145 |
| 337 | 3300025258 | Ga0209129_1000009 | Ga0209129_100000949 | 145 |
| 338 | 3300025258 | Ga0209129_1005452 | Ga0209129_10054522 | 145 |
| 339 | 3300025263 | Ga0209565_1000006 | Ga0209565_1000006298 | 145 |
| 340 | 3300025263 | Ga0209565_1001590 | Ga0209565_100159012 | 145 |
| 341 | 3300025263 | Ga0209565_1010430 | Ga0209565_10104301 | 145 |
| 342 | 3300025273 | Ga0209673_1000004 | Ga0209673_1000004531 | 145 |
| 343 | 3300025273 | Ga0209673_1007274 | Ga0209673_10072745 | 145 |
| 344 | 3300025284 | Ga0209130_1000437 | Ga0209130_100043726 | 145 |
| 345 | 3300025284 | Ga0209130_1001628 | Ga0209130_10016282 | 145 |
| 346 | 3300025291 | Ga0209675_1000006 | Ga0209675_1000006297 | 145 |
| 347 | 3300025291 | Ga0209675_1000890 | Ga0209675_100089018 | 145 |
| 348 | 3300025295 | Ga0209564_1000085 | Ga0209564_100008522 | 145 |
| 349 | 3300025295 | Ga0209564_1000146 | Ga0209564_100014675 | 145 |
| 350 | 3300025295 | Ga0209564_1003895 | Ga0209564_10038951 | 145 |
| 351 | 3300025297 | Ga0209758_1000047 | Ga0209758_1000047120 | 145 |
| 352 | 3300025298 | Ga0209050_1000064 | Ga0209050_1000064243 | 145 |
| 353 | 3300025298 | Ga0209050_1011525 | Ga0209050_10115255 | 145 |
| 354 | 3300025298 | Ga0209050_1011744 | Ga0209050_10117442 | 145 |
| 355 | 3300025299 | Ga0209256_1000179 | Ga0209256_100017916 | 145 |
| 356 | 3300025299 | Ga0209256_1000428 | Ga0209256_100042811 | 145 |
| 357 | 3300025299 | Ga0209256_1003975 | Ga0209256_10039751 | 145 |
| 358 | 3300025299 | Ga0209256_1071941 | Ga0209256_10719411 | 145 |
| 359 | 3300025302 | Ga0207426_1002247 | Ga0207426_10022475 | 145 |
| 360 | 3300025302 | Ga0207426_1003558 | Ga0207426_10035584 | 145 |
| 361 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010603 | 145 |
| 362 | 3300025304 | Ga0209257_1001902 | Ga0209257_10019028 | 145 |
| 363 | 3300025304 | Ga0209257_1021334 | Ga0209257_10213342 | 145 |
| 364 | 3300025909 | Ga0207705_10044713 | Ga0207705_100447132 | 145 |
| 365 | 3300025909 | Ga0207705_10759528 | Ga0207705_107595282 | 145 |
| 366 | 3300025911 | Ga0207654_10001695 | Ga0207654_100016957 | 145 |
| 367 | 3300025914 | Ga0207671_10190862 | Ga0207671_101908623 | 145 |
| 368 | 3300025919 | Ga0207657_10594267 | Ga0207657_105942672 | 145 |
| 369 | 3300025920 | Ga0207649_10009884 | Ga0207649_100098843 | 145 |
| 370 | 3300025920 | Ga0207649_11117299 | Ga0207649_111172991 | 145 |
| 371 | 3300025927 | Ga0207687_10376025 | Ga0207687_103760252 | 145 |
| 372 | 3300025932 | Ga0207690_10125276 | Ga0207690_101252763 | 145 |
| 373 | 3300025933 | Ga0207706_10138620 | Ga0207706_101386201 | 145 |
| 374 | 3300025933 | Ga0207706_10298538 | Ga0207706_102985383 | 145 |
| 375 | 3300025933 | Ga0207706_10922525 | Ga0207706_109225252 | 145 |
| 376 | 3300025934 | Ga0207686_10147464 | Ga0207686_101474642 | 145 |
| 377 | 3300025935 | Ga0207709_10010217 | Ga0207709_100102172 | 145 |
| 378 | 3300025945 | Ga0207679_10928085 | Ga0207679_109280851 | 145 |
| 379 | 3300025945 | Ga0207679_11085444 | Ga0207679_110854441 | 145 |
| 380 | 3300025949 | Ga0207667_10019827 | Ga0207667_100198274 | 145 |
| 381 | 3300025949 | Ga0207667_10531939 | Ga0207667_105319392 | 145 |
| 382 | 3300026041 | Ga0207639_10554611 | Ga0207639_105546112 | 145 |
| 383 | 3300026067 | Ga0207678_10061347 | Ga0207678_100613473 | 145 |
| 384 | 3300026078 | Ga0207702_10723972 | Ga0207702_107239721 | 145 |
| 385 | 3300026089 | Ga0207648_10130406 | Ga0207648_101304063 | 145 |
| 386 | 3300026116 | Ga0207674_10082515 | Ga0207674_100825154 | 145 |
| 387 | 3300026121 | Ga0207683_10681471 | Ga0207683_106814712 | 145 |
| 388 | 3300026142 | Ga0207698_10150254 | Ga0207698_101502543 | 145 |
| 389 | 3300030745 | Ga0316182_1277600 | Ga0316182_12776002 | 145 |
| 390 | 3300031548 | Ga0307408_100000311 | Ga0307408_10000031123 | 145 |
| 391 | 3300031911 | Ga0307412_10577980 | Ga0307412_105779802 | 145 |
| 392 | 3300032002 | Ga0307416_100014397 | Ga0307416_1000143974 | 145 |
| 393 | 3300035692 | Ga0373935_0141726 | Ga0373935_0141726_118_555 | 145 |
| 394 | 3300036459 | Ga0372808_008597 | Ga0372808_008597_825_1283 | 145 |
| 395 | 3300036534 | Ga0310109_033945 | Ga0310109_033945_167_625 | 145 |
| 396 | 3300037312 | Ga0395899_0096515 | Ga0395899_0096515_1262_1699 | 145 |
| 397 | 3300037312 | Ga0395899_0149134 | Ga0395899_0149134_1072_1509 | 145 |
| 398 | 3300037418 | Ga0395900_0000337 | Ga0395900_0000337_25515_25952 | 145 |
| 399 | 3300037418 | Ga0395900_0010583 | Ga0395900_0010583_1207_1644 | 145 |
| 400 | 3300037418 | Ga0395900_0017217 | Ga0395900_0017217_5410_5847 | 145 |
| 401 | 3300037418 | Ga0395900_0069541 | Ga0395900_0069541_1685_2122 | 145 |
| 402 | 3300037418 | Ga0395900_0267218 | Ga0395900_0267218_151_588 | 145 |
| 403 | 3300037466 | Ga0395898_0064271 | Ga0395898_0064271_781_1218 | 145 |
| 404 | 3300037466 | Ga0395898_0090383 | Ga0395898_0090383_2344_2781 | 145 |
| 405 | 3300037466 | Ga0395898_0287456 | Ga0395898_0287456_129_566 | 145 |
| 406 | 3300037466 | Ga0395898_1070564 | Ga0395898_1070564_150_587 | 145 |
| 407 | 3300037471 | Ga0395905_0095396 | Ga0395905_0095396_868_1305 | 145 |
| 408 | 3300037471 | Ga0395905_0190391 | Ga0395905_0190391_147_584 | 145 |
| 409 | 3300037471 | Ga0395905_0470630 | Ga0395905_0470630_409_846 | 145 |
| 410 | 3300037471 | Ga0395905_0511133 | Ga0395905_0511133_86_523 | 145 |
| 411 | 3300037471 | Ga0395905_0659801 | Ga0395905_0659801_346_783 | 145 |
| 412 | 3300037471 | Ga0395905_0797259 | Ga0395905_0797259_245_682 | 145 |
| 413 | 3300037471 | Ga0395905_0986346 | Ga0395905_0986346_158_595 | 145 |
| 414 | 3300038443 | Ga0395901_0000597 | Ga0395901_0000597_18734_19171 | 145 |
| 415 | 3300038443 | Ga0395901_0094595 | Ga0395901_0094595_1516_1953 | 145 |
| 416 | 3300038443 | Ga0395901_0146485 | Ga0395901_0146485_1189_1626 | 145 |
| 417 | 3300038443 | Ga0395901_0195581 | Ga0395901_0195581_150_587 | 145 |
| 418 | 3300038443 | Ga0395901_0278048 | Ga0395901_0278048_907_1344 | 145 |
| 419 | 3300038443 | Ga0395901_0710847 | Ga0395901_0710847_415_852 | 145 |
| 420 | 3300038443 | Ga0395901_1081144 | Ga0395901_1081144_192_629 | 145 |
| 421 | 3300042005 | Ga0439448_0000340 | Ga0439448_0000340_8522_8959 | 145 |
| 422 | 3300042005 | Ga0439448_0013508 | Ga0439448_0013508_1878_2315 | 145 |
| 423 | 3300042005 | Ga0439448_0109091 | Ga0439448_0109091_138_575 | 145 |
| 424 | 3300042005 | Ga0439448_0120177 | Ga0439448_0120177_260_697 | 145 |
| 425 | 3300042007 | Ga0439449_0027146 | Ga0439449_0027146_1096_1533 | 145 |
| 426 | 3300042008 | Ga0439450_023368 | Ga0439450_023368_465_902 | 145 |
| 427 | 3300042008 | Ga0439450_042007 | Ga0439450_042007_154_591 | 145 |
| 428 | 3300042008 | Ga0439450_096966 | Ga0439450_096966_46_483 | 145 |
| 429 | 3300042012 | Ga0439455_0042334 | Ga0439455_0042334_617_1054 | 145 |
| 430 | 3300042115 | Ga0450911_017939 | Ga0450911_017939_166_603 | 145 |
| 431 | 3300042134 | Ga0450898_052173 | Ga0450898_052173_268_759 | 145 |
| 432 | 3300042157 | Ga0439458_0004623 | Ga0439458_0004623_43_480 | 145 |
| 433 | 3300044656 | Ga0466969_0088195 | Ga0466969_0088195_28_465 | 145 |
| 434 | 3300044656 | Ga0466969_0093180 | Ga0466969_0093180_613_1050 | 145 |
| 435 | 3300044658 | Ga0466972_0000412 | Ga0466972_0000412_21374_21811 | 145 |
| 436 | 3300044658 | Ga0466972_0058334 | Ga0466972_0058334_549_986 | 145 |
| 437 | 3300044683 | Ga0466965_0028296 | Ga0466965_0028296_171_608 | 145 |
| 438 | 3300044683 | Ga0466965_0040500 | Ga0466965_0040500_168_605 | 145 |
| 439 | 3300044683 | Ga0466965_0168049 | Ga0466965_0168049_332_769 | 145 |
| 440 | 3300044683 | Ga0466965_0491350 | Ga0466965_0491350_195_632 | 145 |
| 441 | 3300044684 | Ga0466966_0011762 | Ga0466966_0011762_3833_4270 | 145 |
| 442 | 3300044684 | Ga0466966_0068120 | Ga0466966_0068120_615_1052 | 145 |
| 443 | 3300044684 | Ga0466966_0950265 | Ga0466966_0950265_40_477 | 145 |
| 444 | 3300044693 | Ga0466961_0363837 | Ga0466961_0363837_30_467 | 145 |
| 445 | 3300044694 | Ga0466963_0069023 | Ga0466963_0069023_793_1230 | 145 |
| 446 | 3300044706 | Ga0466964_0010802 | Ga0466964_0010802_1181_1618 | 145 |
| 447 | 3300044706 | Ga0466964_0013498 | Ga0466964_0013498_15_452 | 145 |
| 448 | 3300044706 | Ga0466964_0191850 | Ga0466964_0191850_35_472 | 145 |
| 449 | 3300044719 | Ga0466971_0042616 | Ga0466971_0042616_1115_1552 | 145 |
| 450 | 3300044719 | Ga0466971_0311304 | Ga0466971_0311304_34_471 | 145 |
| 451 | 3300044735 | Ga0466968_0002554 | Ga0466968_0002554_1005_1442 | 145 |
| 452 | 3300044735 | Ga0466968_0299089 | Ga0466968_0299089_238_675 | 145 |
| 453 | 3300044765 | Ga0466970_0184693 | Ga0466970_0184693_478_915 | 145 |
| 454 | 3300044765 | Ga0466970_0314634 | Ga0466970_0314634_168_605 | 145 |
| 455 | 3300044765 | Ga0466970_0384332 | Ga0466970_0384332_193_630 | 145 |
| 456 | 3300044842 | Ga0466957_0000394 | Ga0466957_0000394_19665_20102 | 145 |
| 457 | 3300044842 | Ga0466957_0016249 | Ga0466957_0016249_171_608 | 145 |
| 458 | 3300044842 | Ga0466957_0042880 | Ga0466957_0042880_2161_2598 | 145 |
| 459 | 3300044842 | Ga0466957_0222545 | Ga0466957_0222545_504_941 | 145 |
| 460 | 3300044842 | Ga0466957_0448731 | Ga0466957_0448731_243_680 | 145 |
| 461 | 3300044842 | Ga0466957_1184236 | Ga0466957_1184236_84_521 | 145 |
| 462 | 3300044901 | Ga0466960_0094536 | Ga0466960_0094536_979_1416 | 145 |
| 463 | 3300044901 | Ga0466960_0221664 | Ga0466960_0221664_309_746 | 145 |
| 464 | 3300044901 | Ga0466960_0287208 | Ga0466960_0287208_403_840 | 145 |
| 465 | 3300044901 | Ga0466960_0485238 | Ga0466960_0485238_123_560 | 145 |
| 466 | 3300044901 | Ga0466960_0521380 | Ga0466960_0521380_35_496 | 145 |
| 467 | 3300045836 | Ga0466958_0085192 | Ga0466958_0085192_381_818 | 145 |
| 468 | 3300045836 | Ga0466958_0320888 | Ga0466958_0320888_260_697 | 145 |
| 469 | 3300045836 | Ga0466958_0365618 | Ga0466958_0365618_119_556 | 145 |
| 470 | 3300045836 | Ga0466958_0833524 | Ga0466958_0833524_129_566 | 145 |
| 471 | 3300045836 | Ga0466958_0945408 | Ga0466958_0945408_74_511 | 145 |
| 472 | 3300045976 | Ga0466967_0001230 | Ga0466967_0001230_13331_13768 | 145 |
| 473 | 3300045976 | Ga0466967_0032003 | Ga0466967_0032003_3571_4008 | 145 |
| 474 | 3300045976 | Ga0466967_0078034 | Ga0466967_0078034_877_1314 | 145 |
| 475 | 3300045976 | Ga0466967_0555244 | Ga0466967_0555244_608_1045 | 145 |
| 476 | 3300046452 | Ga0495617_000002 | Ga0495617_000002_223873_224310 | 145 |
| 477 | 3300046453 | Ga0495627_001427 | Ga0495627_001427_18_488 | 145 |
| 478 | 3300046453 | Ga0495627_003235 | Ga0495627_003235_1464_1901 | 145 |
| 479 | 3300046455 | Ga0495603_0035953 | Ga0495603_0035953_1547_1984 | 145 |
| 480 | 3300046457 | Ga0495590_0000007 | Ga0495590_0000007_1360_1797 | 145 |
| 481 | 3300046457 | Ga0495590_0000940 | Ga0495590_0000940_11274_11711 | 145 |
| 482 | 3300046457 | Ga0495590_0006196 | Ga0495590_0006196_1107_1544 | 145 |
| 483 | 3300046457 | Ga0495590_0097701 | Ga0495590_0097701_288_725 | 145 |
| 484 | 3300046457 | Ga0495590_0204189 | Ga0495590_0204189_239_676 | 145 |
| 485 | 3300046457 | Ga0495590_0260230 | Ga0495590_0260230_59_496 | 145 |
| 486 | 3300046458 | Ga0495591_004261 | Ga0495591_004261_5305_5742 | 145 |
| 487 | 3300046458 | Ga0495591_014849 | Ga0495591_014849_2160_2630 | 145 |
| 488 | 3300046460 | Ga0495638_0012534 | Ga0495638_0012534_293_730 | 145 |
| 489 | 3300046460 | Ga0495638_0431375 | Ga0495638_0431375_151_588 | 145 |
| 490 | 3300046463 | Ga0495653_0007199 | Ga0495653_0007199_836_1351 | 145 |
| 491 | 3300046463 | Ga0495653_0047254 | Ga0495653_0047254_2137_2652 | 145 |
| 492 | 3300046471 | Ga0495650_0000969 | Ga0495650_0000969_31423_31860 | 145 |
| 493 | 3300046471 | Ga0495650_0034752 | Ga0495650_0034752_1740_2177 | 145 |
| 494 | 3300046472 | Ga0495580_0070944 | Ga0495580_0070944_1588_2103 | 145 |
| 495 | 3300046473 | Ga0495582_0017641 | Ga0495582_0017641_1135_1650 | 145 |
| 496 | 3300046474 | Ga0495605_0001725 | Ga0495605_0001725_1350_1787 | 145 |
| 497 | 3300046474 | Ga0495605_0002728 | Ga0495605_0002728_143_580 | 145 |
| 498 | 3300046474 | Ga0495605_0033247 | Ga0495605_0033247_1032_1502 | 145 |
| 499 | 3300046474 | Ga0495605_0039009 | Ga0495605_0039009_318_755 | 145 |
| 500 | 3300046474 | Ga0495605_0055372 | Ga0495605_0055372_306_743 | 145 |
| 501 | 3300046474 | Ga0495605_0106870 | Ga0495605_0106870_410_847 | 145 |
| 502 | 3300046474 | Ga0495605_0147291 | Ga0495605_0147291_29_466 | 145 |
| 503 | 3300046475 | Ga0495639_0037187 | Ga0495639_0037187_1424_1939 | 145 |
| 504 | 3300046477 | Ga0495664_0074512 | Ga0495664_0074512_664_1101 | 145 |
| 505 | 3300046491 | Ga0495584_0002018 | Ga0495584_0002018_1451_1888 | 145 |
| 506 | 3300046491 | Ga0495584_0003124 | Ga0495584_0003124_6261_6698 | 145 |
| 507 | 3300046491 | Ga0495584_0004097 | Ga0495584_0004097_1967_2437 | 145 |
| 508 | 3300046491 | Ga0495584_0004978 | Ga0495584_0004978_5421_5858 | 145 |
| 509 | 3300046491 | Ga0495584_0008803 | Ga0495584_0008803_534_971 | 145 |
| 510 | 3300046491 | Ga0495584_0029095 | Ga0495584_0029095_2170_2607 | 145 |
| 511 | 3300046491 | Ga0495584_0029997 | Ga0495584_0029997_1273_1710 | 145 |
| 512 | 3300046491 | Ga0495584_0032837 | Ga0495584_0032837_2037_2474 | 145 |
| 513 | 3300046492 | Ga0495585_0007432 | Ga0495585_0007432_5447_5884 | 145 |
| 514 | 3300046492 | Ga0495585_0012064 | Ga0495585_0012064_3198_3635 | 145 |
| 515 | 3300046492 | Ga0495585_0014494 | Ga0495585_0014494_3568_4005 | 145 |
| 516 | 3300046492 | Ga0495585_0029018 | Ga0495585_0029018_1996_2433 | 145 |
| 517 | 3300046492 | Ga0495585_0034983 | Ga0495585_0034983_1244_1681 | 145 |
| 518 | 3300046492 | Ga0495585_0045765 | Ga0495585_0045765_436_906 | 145 |
| 519 | 3300046492 | Ga0495585_0072785 | Ga0495585_0072785_822_1259 | 145 |
| 520 | 3300046492 | Ga0495585_0138386 | Ga0495585_0138386_758_1195 | 145 |
| 521 | 3300046492 | Ga0495585_0256344 | Ga0495585_0256344_287_724 | 145 |
| 522 | 3300046499 | Ga0495594_0010644 | Ga0495594_0010644_959_1396 | 145 |
| 523 | 3300046499 | Ga0495594_0023395 | Ga0495594_0023395_942_1379 | 145 |
| 524 | 3300046499 | Ga0495594_0089879 | Ga0495594_0089879_1159_1674 | 145 |
| 525 | 3300046499 | Ga0495594_0125443 | Ga0495594_0125443_321_758 | 145 |
| 526 | 3300046500 | Ga0495596_0006747 | Ga0495596_0006747_1269_1706 | 145 |
| 527 | 3300046500 | Ga0495596_0013962 | Ga0495596_0013962_1711_2148 | 145 |
| 528 | 3300046500 | Ga0495596_0015276 | Ga0495596_0015276_868_1338 | 145 |
| 529 | 3300046500 | Ga0495596_0035315 | Ga0495596_0035315_1257_1694 | 145 |
| 530 | 3300046500 | Ga0495596_0037999 | Ga0495596_0037999_1389_1826 | 145 |
| 531 | 3300046500 | Ga0495596_0041037 | Ga0495596_0041037_710_1147 | 145 |
| 532 | 3300046500 | Ga0495596_0048534 | Ga0495596_0048534_808_1245 | 145 |
| 533 | 3300046500 | Ga0495596_0066072 | Ga0495596_0066072_198_668 | 145 |
| 534 | 3300046500 | Ga0495596_0082437 | Ga0495596_0082437_52_489 | 145 |
| 535 | 3300046501 | Ga0495607_0000834 | Ga0495607_0000834_1210_1695 | 145 |
| 536 | 3300046501 | Ga0495607_0003363 | Ga0495607_0003363_157_594 | 145 |
| 537 | 3300046501 | Ga0495607_0006325 | Ga0495607_0006325_5422_5859 | 145 |
| 538 | 3300046501 | Ga0495607_0006614 | Ga0495607_0006614_2574_3011 | 145 |
| 539 | 3300046501 | Ga0495607_0010586 | Ga0495607_0010586_3689_4126 | 145 |
| 540 | 3300046501 | Ga0495607_0015612 | Ga0495607_0015612_4233_4703 | 145 |
| 541 | 3300046501 | Ga0495607_0115391 | Ga0495607_0115391_694_1131 | 145 |
| 542 | 3300046506 | Ga0495583_0001085 | Ga0495583_0001085_28044_28481 | 145 |
| 543 | 3300046506 | Ga0495583_0008146 | Ga0495583_0008146_1093_1530 | 145 |
| 544 | 3300046506 | Ga0495583_0013210 | Ga0495583_0013210_2987_3424 | 145 |
| 545 | 3300046506 | Ga0495583_0024181 | Ga0495583_0024181_1347_1817 | 145 |
| 546 | 3300046506 | Ga0495583_0029225 | Ga0495583_0029225_578_1015 | 145 |
| 547 | 3300046506 | Ga0495583_0040025 | Ga0495583_0040025_457_894 | 145 |
| 548 | 3300046506 | Ga0495583_0085548 | Ga0495583_0085548_421_858 | 145 |
| 549 | 3300046507 | Ga0495606_0035211 | Ga0495606_0035211_2389_2859 | 145 |
| 550 | 3300046507 | Ga0495606_0051437 | Ga0495606_0051437_1933_2403 | 145 |
| 551 | 3300046507 | Ga0495606_0061813 | Ga0495606_0061813_1444_1881 | 145 |
| 552 | 3300046507 | Ga0495606_0067904 | Ga0495606_0067904_1231_1701 | 145 |
| 553 | 3300046507 | Ga0495606_0109703 | Ga0495606_0109703_960_1397 | 145 |
| 554 | 3300046507 | Ga0495606_0215779 | Ga0495606_0215779_37_474 | 145 |
| 555 | 3300046512 | Ga0495610_0003702 | Ga0495610_0003702_6461_6898 | 145 |
| 556 | 3300046512 | Ga0495610_0062898 | Ga0495610_0062898_419_856 | 145 |
| 557 | 3300046512 | Ga0495610_0069794 | Ga0495610_0069794_627_1064 | 145 |
| 558 | 3300046513 | Ga0495616_0001336 | Ga0495616_0001336_249_686 | 145 |
| 559 | 3300046513 | Ga0495616_0009394 | Ga0495616_0009394_436_873 | 145 |
| 560 | 3300046513 | Ga0495616_0014430 | Ga0495616_0014430_2932_3402 | 145 |
| 561 | 3300046513 | Ga0495616_0017425 | Ga0495616_0017425_971_1408 | 145 |
| 562 | 3300046513 | Ga0495616_0024730 | Ga0495616_0024730_1427_1864 | 145 |
| 563 | 3300046513 | Ga0495616_0027390 | Ga0495616_0027390_433_870 | 145 |
| 564 | 3300046513 | Ga0495616_0037612 | Ga0495616_0037612_592_1029 | 145 |
| 565 | 3300046513 | Ga0495616_0057193 | Ga0495616_0057193_328_813 | 145 |
| 566 | 3300046513 | Ga0495616_0063395 | Ga0495616_0063395_93_530 | 145 |
| 567 | 3300046513 | Ga0495616_0110213 | Ga0495616_0110213_90_527 | 145 |
| 568 | 3300046513 | Ga0495616_0197301 | Ga0495616_0197301_123_560 | 145 |
| 569 | 3300046513 | Ga0495616_0222833 | Ga0495616_0222833_208_645 | 145 |
| 570 | 3300046517 | Ga0495630_0009746 | Ga0495630_0009746_4458_4973 | 145 |
| 571 | 3300046518 | Ga0495631_0004761 | Ga0495631_0004761_1739_2176 | 145 |
| 572 | 3300046518 | Ga0495631_0005028 | Ga0495631_0005028_5376_5813 | 145 |
| 573 | 3300046518 | Ga0495631_0005442 | Ga0495631_0005442_5322_5759 | 145 |
| 574 | 3300046518 | Ga0495631_0005524 | Ga0495631_0005524_808_1245 | 145 |
| 575 | 3300046518 | Ga0495631_0015732 | Ga0495631_0015732_778_1215 | 145 |
| 576 | 3300046518 | Ga0495631_0037288 | Ga0495631_0037288_436_873 | 145 |
| 577 | 3300046518 | Ga0495631_0043721 | Ga0495631_0043721_822_1292 | 145 |
| 578 | 3300046518 | Ga0495631_0296950 | Ga0495631_0296950_234_671 | 145 |
| 579 | 3300046519 | Ga0495632_0000148 | Ga0495632_0000148_60339_60776 | 145 |
| 580 | 3300046519 | Ga0495632_0007100 | Ga0495632_0007100_1322_1759 | 145 |
| 581 | 3300046519 | Ga0495632_0007463 | Ga0495632_0007463_5424_5909 | 145 |
| 582 | 3300046519 | Ga0495632_0008697 | Ga0495632_0008697_1330_1767 | 145 |
| 583 | 3300046519 | Ga0495632_0041328 | Ga0495632_0041328_1472_1909 | 145 |
| 584 | 3300046519 | Ga0495632_0068087 | Ga0495632_0068087_286_723 | 145 |
| 585 | 3300046519 | Ga0495632_0166387 | Ga0495632_0166387_203_640 | 145 |
| 586 | 3300046520 | Ga0495637_0000006 | Ga0495637_0000006_253120_253557 | 145 |
| 587 | 3300046520 | Ga0495637_0021375 | Ga0495637_0021375_445_882 | 145 |
| 588 | 3300046520 | Ga0495637_0043231 | Ga0495637_0043231_988_1458 | 145 |
| 589 | 3300046522 | Ga0495643_0002220 | Ga0495643_0002220_1219_1704 | 145 |
| 590 | 3300046522 | Ga0495643_0003624 | Ga0495643_0003624_1150_1635 | 145 |
| 591 | 3300046522 | Ga0495643_0020278 | Ga0495643_0020278_953_1390 | 145 |
| 592 | 3300046522 | Ga0495643_0028825 | Ga0495643_0028825_1885_2322 | 145 |
| 593 | 3300046522 | Ga0495643_0310623 | Ga0495643_0310623_177_614 | 145 |
| 594 | 3300046523 | Ga0495644_0002343 | Ga0495644_0002343_1711_2148 | 145 |
| 595 | 3300046523 | Ga0495644_0002779 | Ga0495644_0002779_1612_2082 | 145 |
| 596 | 3300046523 | Ga0495644_0004141 | Ga0495644_0004141_1374_1811 | 145 |
| 597 | 3300046523 | Ga0495644_0016303 | Ga0495644_0016303_1387_1824 | 145 |
| 598 | 3300046523 | Ga0495644_0022329 | Ga0495644_0022329_1393_1830 | 145 |
| 599 | 3300046524 | Ga0495648_0015757 | Ga0495648_0015757_974_1411 | 145 |
| 600 | 3300046524 | Ga0495648_0024170 | Ga0495648_0024170_2050_2487 | 145 |
| 601 | 3300046524 | Ga0495648_0033135 | Ga0495648_0033135_2489_2926 | 145 |
| 602 | 3300046524 | Ga0495648_0063736 | Ga0495648_0063736_1008_1478 | 145 |
| 603 | 3300046524 | Ga0495648_0084832 | Ga0495648_0084832_422_859 | 145 |
| 604 | 3300046524 | Ga0495648_0089969 | Ga0495648_0089969_1020_1490 | 145 |
| 605 | 3300046524 | Ga0495648_0126998 | Ga0495648_0126998_727_1164 | 145 |
| 606 | 3300046524 | Ga0495648_0171750 | Ga0495648_0171750_39_476 | 145 |
| 607 | 3300046524 | Ga0495648_0278196 | Ga0495648_0278196_229_666 | 145 |
| 608 | 3300046524 | Ga0495648_0310964 | Ga0495648_0310964_155_592 | 145 |
| 609 | 3300046525 | Ga0495663_0107264 | Ga0495663_0107264_108_578 | 145 |
| 610 | 3300046526 | Ga0495666_0000744 | Ga0495666_0000744_3085_3600 | 145 |
| 611 | 3300046528 | Ga0495642_0000569 | Ga0495642_0000569_11617_12054 | 145 |
| 612 | 3300046528 | Ga0495642_0003114 | Ga0495642_0003114_1294_1731 | 145 |
| 613 | 3300046528 | Ga0495642_0011383 | Ga0495642_0011383_2150_2587 | 145 |
| 614 | 3300046528 | Ga0495642_0013582 | Ga0495642_0013582_1687_2124 | 145 |
| 615 | 3300046528 | Ga0495642_0015875 | Ga0495642_0015875_1705_2142 | 145 |
| 616 | 3300046528 | Ga0495642_0028613 | Ga0495642_0028613_1390_1827 | 145 |
| 617 | 3300046528 | Ga0495642_0034709 | Ga0495642_0034709_468_938 | 145 |
| 618 | 3300046528 | Ga0495642_0119075 | Ga0495642_0119075_100_537 | 145 |
| 619 | 3300046528 | Ga0495642_0232852 | Ga0495642_0232852_103_540 | 145 |
| 620 | 3300046529 | Ga0495652_0199498 | Ga0495652_0199498_955_1470 | 145 |
| 621 | 3300046530 | Ga0495654_0009322 | Ga0495654_0009322_4045_4482 | 145 |
| 622 | 3300046530 | Ga0495654_0019833 | Ga0495654_0019833_653_1090 | 145 |
| 623 | 3300046530 | Ga0495654_0051828 | Ga0495654_0051828_1252_1689 | 145 |
| 624 | 3300046530 | Ga0495654_0102276 | Ga0495654_0102276_469_906 | 145 |
| 625 | 3300046531 | Ga0495665_0053057 | Ga0495665_0053057_258_773 | 145 |
| 626 | 3300046533 | Ga0495640_0332240 | Ga0495640_0332240_344_781 | 145 |
| 627 | 3300046535 | Ga0495586_0030119 | Ga0495586_0030119_1953_2468 | 145 |
| 628 | 3300046535 | Ga0495586_0114323 | Ga0495586_0114323_976_1413 | 145 |
| 629 | 3300046536 | Ga0495587_0404604 | Ga0495587_0404604_164_679 | 145 |
| 630 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_13555_13992 | 145 |
| 631 | 3300046538 | Ga0495609_0000522 | Ga0495609_0000522_28940_29377 | 145 |
| 632 | 3300046538 | Ga0495609_0006979 | Ga0495609_0006979_481_918 | 145 |
| 633 | 3300046538 | Ga0495609_0032295 | Ga0495609_0032295_1544_2014 | 145 |
| 634 | 3300046538 | Ga0495609_0263611 | Ga0495609_0263611_184_621 | 145 |
| 635 | 3300046538 | Ga0495609_0325757 | Ga0495609_0325757_65_502 | 145 |
| 636 | 3300046542 | Ga0495597_0001858 | Ga0495597_0001858_1045_1515 | 145 |
| 637 | 3300046542 | Ga0495597_0005167 | Ga0495597_0005167_1163_1600 | 145 |
| 638 | 3300046542 | Ga0495597_0009834 | Ga0495597_0009834_1033_1470 | 145 |
| 639 | 3300046542 | Ga0495597_0083286 | Ga0495597_0083286_380_865 | 145 |
| 640 | 3300046542 | Ga0495597_0094028 | Ga0495597_0094028_471_908 | 145 |
| 641 | 3300046542 | Ga0495597_0198054 | Ga0495597_0198054_38_475 | 145 |
| 642 | 3300046542 | Ga0495597_0350683 | Ga0495597_0350683_95_532 | 145 |
| 643 | 3300046543 | Ga0495645_0129125 | Ga0495645_0129125_390_827 | 145 |
| 644 | 3300046557 | Ga0495622_0033569 | Ga0495622_0033569_399_836 | 145 |
| 645 | 3300046557 | Ga0495622_0214449 | Ga0495622_0214449_227_742 | 145 |
| 646 | 3300046558 | Ga0495633_0005314 | Ga0495633_0005314_174_611 | 145 |
| 647 | 3300046558 | Ga0495633_0006247 | Ga0495633_0006247_5238_5675 | 145 |
| 648 | 3300046558 | Ga0495633_0006628 | Ga0495633_0006628_960_1397 | 145 |
| 649 | 3300046558 | Ga0495633_0038303 | Ga0495633_0038303_741_1211 | 145 |
| 650 | 3300046558 | Ga0495633_0043296 | Ga0495633_0043296_984_1421 | 145 |
| 651 | 3300046558 | Ga0495633_0079790 | Ga0495633_0079790_241_678 | 145 |
| 652 | 3300046558 | Ga0495633_0123935 | Ga0495633_0123935_27_464 | 145 |
| 653 | 3300046615 | Ga0495656_0015023 | Ga0495656_0015023_1335_1772 | 145 |
| 654 | 3300046615 | Ga0495656_0074870 | Ga0495656_0074870_871_1308 | 145 |
| 655 | 3300046615 | Ga0495656_0155276 | Ga0495656_0155276_174_611 | 145 |
| 656 | 3300046615 | Ga0495656_0237023 | Ga0495656_0237023_143_580 | 145 |
| 657 | 3300046615 | Ga0495656_0245225 | Ga0495656_0245225_138_575 | 145 |
| 658 | 3300046615 | Ga0495656_0287665 | Ga0495656_0287665_74_511 | 145 |
| 659 | 3300046616 | Ga0495668_0000049 | Ga0495668_0000049_202310_202747 | 145 |
| 660 | 3300046616 | Ga0495668_0001558 | Ga0495668_0001558_19625_20062 | 145 |
| 661 | 3300046616 | Ga0495668_0001735 | Ga0495668_0001735_18263_18700 | 145 |
| 662 | 3300046616 | Ga0495668_0007257 | Ga0495668_0007257_1292_1729 | 145 |
| 663 | 3300046616 | Ga0495668_0009224 | Ga0495668_0009224_4672_5142 | 145 |
| 664 | 3300046616 | Ga0495668_0020897 | Ga0495668_0020897_933_1370 | 145 |
| 665 | 3300046616 | Ga0495668_0027726 | Ga0495668_0027726_1618_2055 | 145 |
| 666 | 3300046616 | Ga0495668_0054902 | Ga0495668_0054902_1659_2096 | 145 |
| 667 | 3300046642 | Ga0495634_0058211 | Ga0495634_0058211_931_1446 | 145 |
| 668 | 3300046648 | Ga0495611_0000309 | Ga0495611_0000309_1720_2157 | 145 |
| 669 | 3300046648 | Ga0495611_0001771 | Ga0495611_0001771_3179_3616 | 145 |
| 670 | 3300046648 | Ga0495611_0004407 | Ga0495611_0004407_4852_5289 | 145 |
| 671 | 3300046648 | Ga0495611_0010876 | Ga0495611_0010876_849_1286 | 145 |
| 672 | 3300046648 | Ga0495611_0037824 | Ga0495611_0037824_1457_1894 | 145 |
| 673 | 3300046648 | Ga0495611_0075955 | Ga0495611_0075955_238_708 | 145 |
| 674 | 3300046660 | Ga0495625_0014069 | Ga0495625_0014069_5561_5998 | 145 |
| 675 | 3300046660 | Ga0495625_0028518 | Ga0495625_0028518_2616_3053 | 145 |
| 676 | 3300046660 | Ga0495625_0039495 | Ga0495625_0039495_1327_1764 | 145 |
| 677 | 3300046660 | Ga0495625_0076032 | Ga0495625_0076032_1881_2318 | 145 |
| 678 | 3300046660 | Ga0495625_0090689 | Ga0495625_0090689_151_588 | 145 |
| 679 | 3300046660 | Ga0495625_0257858 | Ga0495625_0257858_607_1044 | 145 |
| 680 | 3300046664 | Ga0495659_0000098 | Ga0495659_0000098_10726_11163 | 145 |
| 681 | 3300046664 | Ga0495659_0006084 | Ga0495659_0006084_1913_2350 | 145 |
| 682 | 3300046664 | Ga0495659_0343928 | Ga0495659_0343928_103_585 | 145 |
| 683 | 3300046665 | Ga0495661_0011074 | Ga0495661_0011074_233_670 | 145 |
| 684 | 3300046665 | Ga0495661_0014162 | Ga0495661_0014162_1562_1999 | 145 |
| 685 | 3300046665 | Ga0495661_0023349 | Ga0495661_0023349_1006_1443 | 145 |
| 686 | 3300046665 | Ga0495661_0031136 | Ga0495661_0031136_1862_2299 | 145 |
| 687 | 3300046665 | Ga0495661_0032557 | Ga0495661_0032557_2574_3011 | 145 |
| 688 | 3300046665 | Ga0495661_0033952 | Ga0495661_0033952_1047_1532 | 145 |
| 689 | 3300046665 | Ga0495661_0041378 | Ga0495661_0041378_172_609 | 145 |
| 690 | 3300046665 | Ga0495661_0042605 | Ga0495661_0042605_888_1325 | 145 |
| 691 | 3300046665 | Ga0495661_0043846 | Ga0495661_0043846_1274_1711 | 145 |
| 692 | 3300046665 | Ga0495661_0060592 | Ga0495661_0060592_1304_1774 | 145 |
| 693 | 3300046665 | Ga0495661_0067504 | Ga0495661_0067504_234_671 | 145 |
| 694 | 3300046665 | Ga0495661_0078056 | Ga0495661_0078056_858_1328 | 145 |
| 695 | 3300046665 | Ga0495661_0094846 | Ga0495661_0094846_241_678 | 145 |
| 696 | 3300046665 | Ga0495661_0100993 | Ga0495661_0100993_714_1151 | 145 |
| 697 | 3300046665 | Ga0495661_0102976 | Ga0495661_0102976_861_1298 | 145 |
| 698 | 3300046665 | Ga0495661_0232685 | Ga0495661_0232685_454_924 | 145 |
| 699 | 3300046665 | Ga0495661_0315704 | Ga0495661_0315704_39_476 | 145 |
| 700 | 3300046665 | Ga0495661_0489791 | Ga0495661_0489791_82_519 | 145 |
| 701 | 3300046674 | Ga0495588_0000135 | Ga0495588_0000135_115516_115953 | 145 |
| 702 | 3300046674 | Ga0495588_0021690 | Ga0495588_0021690_731_1168 | 145 |
| 703 | 3300046674 | Ga0495588_0027852 | Ga0495588_0027852_1034_1471 | 145 |
| 704 | 3300046674 | Ga0495588_0109238 | Ga0495588_0109238_736_1251 | 145 |
| 705 | 3300046674 | Ga0495588_0124617 | Ga0495588_0124617_428_898 | 145 |
| 706 | 3300046674 | Ga0495588_0387781 | Ga0495588_0387781_246_683 | 145 |
| 707 | 3300046674 | Ga0495588_0554448 | Ga0495588_0554448_132_569 | 145 |
| 708 | 3300046679 | Ga0495623_0042373 | Ga0495623_0042373_1447_1962 | 145 |
| 709 | 3300046680 | Ga0495646_0142442 | Ga0495646_0142442_708_1223 | 145 |
| 710 | 3300046684 | Ga0495669_0000418 | Ga0495669_0000418_1390_1827 | 145 |
| 711 | 3300046684 | Ga0495669_0010842 | Ga0495669_0010842_2418_2855 | 145 |
| 712 | 3300046684 | Ga0495669_0016839 | Ga0495669_0016839_1323_1760 | 145 |
| 713 | 3300046684 | Ga0495669_0043868 | Ga0495669_0043868_811_1248 | 145 |
| 714 | 3300046684 | Ga0495669_0046897 | Ga0495669_0046897_182_652 | 145 |
| 715 | 3300046684 | Ga0495669_0049532 | Ga0495669_0049532_218_655 | 145 |
| 716 | 3300046684 | Ga0495669_0065511 | Ga0495669_0065511_437_874 | 145 |
| 717 | 3300046691 | Ga0495670_0015322 | Ga0495670_0015322_209_646 | 145 |
| 718 | 3300046691 | Ga0495670_0050606 | Ga0495670_0050606_1099_1569 | 145 |
| 719 | 3300046691 | Ga0495670_0064745 | Ga0495670_0064745_1043_1480 | 145 |
| 720 | 3300046691 | Ga0495670_0219178 | Ga0495670_0219178_71_541 | 145 |
| 721 | 3300046691 | Ga0495670_0225224 | Ga0495670_0225224_454_891 | 145 |
| 722 | 3300046691 | Ga0495670_0246717 | Ga0495670_0246717_459_896 | 145 |
| 723 | 3300046692 | Ga0495671_0000522 | Ga0495671_0000522_27257_27694 | 145 |
| 724 | 3300046692 | Ga0495671_0004896 | Ga0495671_0004896_6044_6481 | 145 |
| 725 | 3300046692 | Ga0495671_0021644 | Ga0495671_0021644_80_517 | 145 |
| 726 | 3300046692 | Ga0495671_0310795 | Ga0495671_0310795_228_665 | 145 |
| 727 | 3300046694 | Ga0495649_0000625 | Ga0495649_0000625_863_1300 | 145 |
| 728 | 3300046694 | Ga0495649_0005216 | Ga0495649_0005216_406_843 | 145 |
| 729 | 3300046694 | Ga0495649_0008026 | Ga0495649_0008026_430_867 | 145 |
| 730 | 3300046694 | Ga0495649_0075218 | Ga0495649_0075218_516_953 | 145 |
| 731 | 3300046694 | Ga0495649_0192314 | Ga0495649_0192314_601_1038 | 145 |
| 732 | 3300046694 | Ga0495649_0216605 | Ga0495649_0216605_399_836 | 145 |
| 733 | 3300046794 | Ga0495589_0000353 | Ga0495589_0000353_631_1068 | 145 |
| 734 | 3300046794 | Ga0495589_0001512 | Ga0495589_0001512_786_1223 | 145 |
| 735 | 3300046794 | Ga0495589_0002800 | Ga0495589_0002800_6039_6476 | 145 |
| 736 | 3300046794 | Ga0495589_0004825 | Ga0495589_0004825_1616_2053 | 145 |
| 737 | 3300046794 | Ga0495589_0008572 | Ga0495589_0008572_1233_1703 | 145 |
| 738 | 3300046794 | Ga0495589_0012156 | Ga0495589_0012156_1989_2459 | 145 |
| 739 | 3300046794 | Ga0495589_0119006 | Ga0495589_0119006_606_1043 | 145 |
| 740 | 3300046794 | Ga0495589_0180740 | Ga0495589_0180740_379_816 | 145 |
| 741 | 3300046794 | Ga0495589_0191183 | Ga0495589_0191183_274_711 | 145 |
| 742 | 3300046809 | Ga0495600_0060647 | Ga0495600_0060647_1534_2049 | 145 |
| 743 | 3300046810 | Ga0495660_0000103 | Ga0495660_0000103_76048_76485 | 145 |
| 744 | 3300046810 | Ga0495660_0003819 | Ga0495660_0003819_6249_6686 | 145 |
| 745 | 3300046810 | Ga0495660_0013708 | Ga0495660_0013708_1312_1782 | 145 |
| 746 | 3300046810 | Ga0495660_0024276 | Ga0495660_0024276_1128_1565 | 145 |
| 747 | 3300046810 | Ga0495660_0035176 | Ga0495660_0035176_1312_1749 | 145 |
| 748 | 3300046810 | Ga0495660_0054077 | Ga0495660_0054077_143_580 | 145 |
| 749 | 3300046810 | Ga0495660_0060435 | Ga0495660_0060435_421_858 | 145 |
| 750 | 3300046810 | Ga0495660_0102345 | Ga0495660_0102345_730_1167 | 145 |
| 751 | 3300047315 | Ga0495581_0364854 | Ga0495581_0364854_164_679 | 145 |
| 752 | 3300047318 | Ga0495636_0001265 | Ga0495636_0001265_8367_8804 | 145 |
| 753 | 3300047318 | Ga0495636_0003721 | Ga0495636_0003721_1716_2153 | 145 |
| 754 | 3300047318 | Ga0495636_0079855 | Ga0495636_0079855_48_485 | 145 |
| 755 | 3300047318 | Ga0495636_0084274 | Ga0495636_0084274_585_1022 | 145 |
| 756 | 3300047320 | Ga0495672_0000118 | Ga0495672_0000118_7025_7462 | 145 |
| 757 | 3300047320 | Ga0495672_0000287 | Ga0495672_0000287_33807_34244 | 145 |
| 758 | 3300047320 | Ga0495672_0003619 | Ga0495672_0003619_949_1386 | 145 |
| 759 | 3300047320 | Ga0495672_0119976 | Ga0495672_0119976_909_1346 | 145 |
| 760 | 3300047320 | Ga0495672_0230055 | Ga0495672_0230055_422_892 | 145 |
| 761 | 3300047321 | Ga0495676_0000627 | Ga0495676_0000627_1629_2099 | 145 |
| 762 | 3300047323 | Ga0495683_0005242 | Ga0495683_0005242_5322_5759 | 145 |
| 763 | 3300047323 | Ga0495683_0005405 | Ga0495683_0005405_2999_3436 | 145 |
| 764 | 3300047323 | Ga0495683_0025633 | Ga0495683_0025633_1443_1913 | 145 |
| 765 | 3300047323 | Ga0495683_0034591 | Ga0495683_0034591_581_1051 | 145 |
| 766 | 3300047323 | Ga0495683_0473340 | Ga0495683_0473340_57_494 | 145 |
| 767 | 3300047443 | Ga0495687_000047 | Ga0495687_000047_204800_205237 | 145 |
| 768 | 3300047443 | Ga0495687_000166 | Ga0495687_000166_16139_16576 | 145 |
| 769 | 3300047443 | Ga0495687_018829 | Ga0495687_018829_1442_1879 | 145 |
| 770 | 3300047443 | Ga0495687_024581 | Ga0495687_024581_1334_1771 | 145 |
| 771 | 3300047443 | Ga0495687_041822 | Ga0495687_041822_1394_1831 | 145 |
| 772 | 3300047443 | Ga0495687_090705 | Ga0495687_090705_147_584 | 145 |
| 773 | 3300047444 | Ga0495675_0030262 | Ga0495675_0030262_888_1403 | 145 |
| 774 | 3300047444 | Ga0495675_0075202 | Ga0495675_0075202_16_531 | 145 |
| 775 | 3300047445 | Ga0495677_0000074 | Ga0495677_0000074_15982_16419 | 145 |
| 776 | 3300047445 | Ga0495677_0000920 | Ga0495677_0000920_10038_10475 | 145 |
| 777 | 3300047445 | Ga0495677_0001632 | Ga0495677_0001632_7692_8129 | 145 |
| 778 | 3300047445 | Ga0495677_0005519 | Ga0495677_0005519_3120_3557 | 145 |
| 779 | 3300047445 | Ga0495677_0017567 | Ga0495677_0017567_1135_1572 | 145 |
| 780 | 3300047445 | Ga0495677_0021851 | Ga0495677_0021851_115_552 | 145 |
| 781 | 3300047445 | Ga0495677_0034368 | Ga0495677_0034368_38_475 | 145 |
| 782 | 3300047445 | Ga0495677_0034631 | Ga0495677_0034631_464_901 | 145 |
| 783 | 3300047445 | Ga0495677_0216899 | Ga0495677_0216899_258_695 | 145 |
| 784 | 3300047446 | Ga0495679_007964 | Ga0495679_007964_1715_2152 | 145 |
| 785 | 3300047446 | Ga0495679_012140 | Ga0495679_012140_942_1379 | 145 |
| 786 | 3300047446 | Ga0495679_018946 | Ga0495679_018946_1015_1452 | 145 |
| 787 | 3300047446 | Ga0495679_068310 | Ga0495679_068310_549_986 | 145 |
| 788 | 3300047446 | Ga0495679_122076 | Ga0495679_122076_257_694 | 145 |
| 789 | 3300047447 | Ga0495685_004856 | Ga0495685_004856_3001_3471 | 145 |
| 790 | 3300047447 | Ga0495685_016653 | Ga0495685_016653_1802_2239 | 145 |
| 791 | 3300047470 | Ga0495681_0002867 | Ga0495681_0002867_9637_10074 | 145 |
| 792 | 3300047470 | Ga0495681_0003198 | Ga0495681_0003198_10059_10496 | 145 |
| 793 | 3300047470 | Ga0495681_0009476 | Ga0495681_0009476_145_615 | 145 |
| 794 | 3300047470 | Ga0495681_0023512 | Ga0495681_0023512_1729_2166 | 145 |
| 795 | 3300047470 | Ga0495681_0031160 | Ga0495681_0031160_2036_2473 | 145 |
| 796 | 3300047470 | Ga0495681_0202704 | Ga0495681_0202704_71_541 | 145 |
| 797 | 3300047472 | Ga0495686_0000835 | Ga0495686_0000835_37801_38238 | 145 |
| 798 | 3300047472 | Ga0495686_0006193 | Ga0495686_0006193_5180_5617 | 145 |
| 799 | 3300047472 | Ga0495686_0006400 | Ga0495686_0006400_3788_4225 | 145 |
| 800 | 3300047472 | Ga0495686_0029229 | Ga0495686_0029229_1377_1814 | 145 |
| 801 | 3300047472 | Ga0495686_0078442 | Ga0495686_0078442_1023_1460 | 145 |
| 802 | 3300047472 | Ga0495686_0089005 | Ga0495686_0089005_434_871 | 145 |
| 803 | 3300047472 | Ga0495686_0133635 | Ga0495686_0133635_295_732 | 145 |
| 804 | 3300047673 | Ga0495593_0051146 | Ga0495593_0051146_902_1339 | 145 |
| 805 | 3300048088 | Ga0495602_0042177 | Ga0495602_0042177_1003_1440 | 145 |
| 806 | 3300048089 | Ga0495614_0075094 | Ga0495614_0075094_303_818 | 145 |
| 807 | 3300048091 | Ga0495626_0000006 | Ga0495626_0000006_163862_164299 | 145 |
| 808 | 3300048091 | Ga0495626_0000034 | Ga0495626_0000034_13495_13932 | 145 |
| 809 | 3300048091 | Ga0495626_0005441 | Ga0495626_0005441_1635_2072 | 145 |
| 810 | 3300048091 | Ga0495626_0006165 | Ga0495626_0006165_179_616 | 145 |
| 811 | 3300048091 | Ga0495626_0006352 | Ga0495626_0006352_5158_5643 | 145 |
| 812 | 3300048091 | Ga0495626_0010572 | Ga0495626_0010572_2923_3360 | 145 |
| 813 | 3300048091 | Ga0495626_0019151 | Ga0495626_0019151_2152_2622 | 145 |
| 814 | 3300048091 | Ga0495626_0029193 | Ga0495626_0029193_177_614 | 145 |
| 815 | 3300048091 | Ga0495626_0043239 | Ga0495626_0043239_1137_1574 | 145 |
| 816 | 3300048091 | Ga0495626_0053956 | Ga0495626_0053956_995_1465 | 145 |
| 817 | 3300048091 | Ga0495626_0137375 | Ga0495626_0137375_47_484 | 145 |
| 818 | 3300048903 | Ga0496100_0424293 | Ga0496100_0424293_443_880 | 145 |
| 819 | 3300048904 | Ga0496101_0118146 | Ga0496101_0118146_1341_1778 | 145 |
| 820 | 3300048904 | Ga0496101_1405113 | Ga0496101_1405113_89_526 | 145 |
| 821 | 3300048905 | Ga0496102_0010040 | Ga0496102_0010040_1429_1866 | 145 |
| 822 | 3300048905 | Ga0496102_0197528 | Ga0496102_0197528_1228_1665 | 145 |
| 823 | 3300048905 | Ga0496102_0653733 | Ga0496102_0653733_308_745 | 145 |
| 824 | 3300048905 | Ga0496102_0679713 | Ga0496102_0679713_96_533 | 145 |
| 825 | 3300048905 | Ga0496102_0759295 | Ga0496102_0759295_172_609 | 145 |
| 826 | 3300048906 | Ga0496103_0071730 | Ga0496103_0071730_810_1247 | 145 |
| 827 | 3300048906 | Ga0496103_0151577 | Ga0496103_0151577_887_1324 | 145 |
| 828 | 3300048906 | Ga0496103_0179680 | Ga0496103_0179680_18_455 | 145 |
| 829 | 3300048906 | Ga0496103_0207447 | Ga0496103_0207447_663_1100 | 145 |
| 830 | 3300048906 | Ga0496103_0247560 | Ga0496103_0247560_233_670 | 145 |
| 831 | 3300048907 | Ga0496104_0066589 | Ga0496104_0066589_990_1427 | 145 |
| 832 | 3300048907 | Ga0496104_0201582 | Ga0496104_0201582_22_459 | 145 |
| 833 | 3300048908 | Ga0496105_0541225 | Ga0496105_0541225_58_495 | 145 |
| 834 | 3300048909 | Ga0496106_0004987 | Ga0496106_0004987_763_1200 | 145 |
| 835 | 3300048909 | Ga0496106_0176687 | Ga0496106_0176687_395_865 | 145 |
| 836 | 3300048909 | Ga0496106_0451959 | Ga0496106_0451959_393_830 | 145 |
| 837 | 3300048910 | Ga0496107_0012714 | Ga0496107_0012714_1500_1970 | 145 |
| 838 | 3300048910 | Ga0496107_0101165 | Ga0496107_0101165_417_854 | 145 |
| 839 | 3300048911 | Ga0496108_0929699 | Ga0496108_0929699_224_661 | 145 |
| 840 | 3300048912 | Ga0496109_0034146 | Ga0496109_0034146_3113_3550 | 145 |
| 841 | 3300048912 | Ga0496109_0339540 | Ga0496109_0339540_245_682 | 145 |
| 842 | 3300048912 | Ga0496109_0402299 | Ga0496109_0402299_48_485 | 145 |
| 843 | 3300048912 | Ga0496109_0724705 | Ga0496109_0724705_278_748 | 145 |
| 844 | 3300048913 | Ga0496110_0018489 | Ga0496110_0018489_5241_5678 | 145 |
| 845 | 3300048914 | Ga0496111_0125865 | Ga0496111_0125865_350_787 | 145 |
| 846 | 3300048914 | Ga0496111_0810019 | Ga0496111_0810019_123_560 | 145 |
| 847 | 3300048915 | Ga0496112_0279929 | Ga0496112_0279929_213_650 | 145 |
| 848 | 3300048915 | Ga0496112_0473321 | Ga0496112_0473321_362_799 | 145 |
| 849 | 3300048916 | Ga0496113_0024113 | Ga0496113_0024113_2757_3194 | 145 |
| 850 | 3300048916 | Ga0496113_0572695 | Ga0496113_0572695_37_474 | 145 |
| 851 | 3300048917 | Ga0496114_0178228 | Ga0496114_0178228_1119_1556 | 145 |
| 852 | 3300048918 | Ga0496115_0406788 | Ga0496115_0406788_626_1063 | 145 |
| 853 | 3300048919 | Ga0496116_0331977 | Ga0496116_0331977_211_648 | 145 |
| 854 | 3300048924 | Ga0496121_0078704 | Ga0496121_0078704_1312_1749 | 145 |
| 855 | 3300048925 | Ga0496122_0003245 | Ga0496122_0003245_449_886 | 145 |
| 856 | 3300048925 | Ga0496122_0015414 | Ga0496122_0015414_1422_1859 | 145 |
| 857 | 3300048925 | Ga0496122_0267307 | Ga0496122_0267307_21_491 | 145 |
| 858 | 3300048926 | Ga0496123_0013411 | Ga0496123_0013411_5441_5878 | 145 |
| 859 | 3300048926 | Ga0496123_0015341 | Ga0496123_0015341_5142_5579 | 145 |
| 860 | 3300048926 | Ga0496123_0050901 | Ga0496123_0050901_1815_2252 | 145 |
| 861 | 3300048927 | Ga0496124_0026676 | Ga0496124_0026676_377_814 | 145 |
| 862 | 3300048927 | Ga0496124_0084722 | Ga0496124_0084722_1999_2436 | 145 |
| 863 | 3300048927 | Ga0496124_0086232 | Ga0496124_0086232_2014_2451 | 145 |
| 864 | 3300048927 | Ga0496124_0087250 | Ga0496124_0087250_1535_1972 | 145 |
| 865 | 3300048927 | Ga0496124_0094902 | Ga0496124_0094902_1061_1498 | 145 |
| 866 | 3300048927 | Ga0496124_0102421 | Ga0496124_0102421_1718_2155 | 145 |
| 867 | 3300048928 | Ga0496125_0007861 | Ga0496125_0007861_3112_3549 | 145 |
| 868 | 3300048928 | Ga0496125_0105869 | Ga0496125_0105869_156_593 | 145 |
| 869 | 3300048928 | Ga0496125_0553867 | Ga0496125_0553867_111_548 | 145 |
| 870 | 3300048929 | Ga0496126_0145302 | Ga0496126_0145302_270_707 | 145 |
| 871 | 3300049127 | Ga0501306_018117 | Ga0501306_018117_19_456 | 145 |
| 872 | 3300049128 | Ga0501308_000946 | Ga0501308_000946_1290_1727 | 145 |
| 873 | 3300049128 | Ga0501308_018674 | Ga0501308_018674_225_662 | 145 |
| 874 | 3300049160 | Ga0501304_000167 | Ga0501304_000167_1258_1695 | 145 |
| 875 | 3300049162 | Ga0501307_006020 | Ga0501307_006020_842_1279 | 145 |
| 876 | 3300049162 | Ga0501307_007028 | Ga0501307_007028_91_528 | 145 |
| 877 | 3300049459 | Ga0495678_000113 | Ga0495678_000113_1245_1682 | 145 |
| 878 | 3300049459 | Ga0495678_000601 | Ga0495678_000601_1301_1771 | 145 |
| 879 | 3300049459 | Ga0495678_010011 | Ga0495678_010011_145_615 | 145 |
| 880 | 3300049459 | Ga0495678_020985 | Ga0495678_020985_1820_2257 | 145 |
| 881 | 3300049459 | Ga0495678_076538 | Ga0495678_076538_79_516 | 145 |
| 882 | 3300049460 | Ga0495682_0003524 | Ga0495682_0003524_5403_5873 | 145 |
| 883 | 3300049460 | Ga0495682_0006018 | Ga0495682_0006018_3543_3980 | 145 |
| 884 | 3300049460 | Ga0495682_0009817 | Ga0495682_0009817_2288_2758 | 145 |
| 885 | 3300049460 | Ga0495682_0014169 | Ga0495682_0014169_759_1196 | 145 |
| 886 | 3300049460 | Ga0495682_0065817 | Ga0495682_0065817_449_886 | 145 |
| 887 | 3300049527 | Ga0501311_004404 | Ga0501311_004404_67_549 | 145 |
| 888 | 3300049529 | Ga0501313_006175 | Ga0501313_006175_705_1142 | 145 |
| 889 | 3300049531 | Ga0501315_002695 | Ga0501315_002695_866_1303 | 145 |
| 890 | 3300049531 | Ga0501315_006164 | Ga0501315_006164_12_449 | 145 |
| 891 | 3300049531 | Ga0501315_035017 | Ga0501315_035017_98_535 | 145 |
| 892 | 3300049532 | Ga0501316_004314 | Ga0501316_004314_150_587 | 145 |
| 893 | 3300049532 | Ga0501316_032082 | Ga0501316_032082_15_452 | 145 |
| 894 | 3300049534 | Ga0501318_020518 | Ga0501318_020518_154_591 | 145 |
| 895 | 3300049539 | Ga0501323_008593 | Ga0501323_008593_741_1178 | 145 |
| 896 | 3300049652 | Ga0501202_050767 | Ga0501202_050767_140_622 | 145 |
| 897 | 3300049654 | Ga0501207_023247 | Ga0501207_023247_229_666 | 145 |
| 898 | 3300049665 | Ga0501227_002378 | Ga0501227_002378_2485_2967 | 145 |
| 899 | 3300049665 | Ga0501227_021046 | Ga0501227_021046_173_655 | 145 |
| 900 | 3300049760 | Ga0501263_034297 | Ga0501263_034297_82_564 | 145 |
| 901 | 3300049775 | Ga0501279_003747 | Ga0501279_003747_1199_1681 | 145 |
| 902 | 3300049775 | Ga0501279_004114 | Ga0501279_004114_1255_1737 | 145 |
| 903 | 3300049775 | Ga0501279_011654 | Ga0501279_011654_569_1006 | 145 |
| 904 | 3300049822 | Ga0501035_0004747 | Ga0501035_0004747_3048_3485 | 145 |
| 905 | 3300049853 | Ga0501226_012002 | Ga0501226_012002_106_543 | 145 |
| 906 | 3300053103 | Ga0500555_014711 | Ga0500555_014711_1657_2115 | 145 |
| 907 | 3300053121 | Ga0500607_000615 | Ga0500607_000615_26588_27046 | 145 |
| 908 | 3300053121 | Ga0500607_008419 | Ga0500607_008419_1751_2242 | 145 |
| 909 | 3300053136 | Ga0500559_0226021 | Ga0500559_0226021_65_556 | 145 |
| 910 | 3300053177 | Ga0500636_0001052 | Ga0500636_0001052_6901_7392 | 145 |
| 911 | 3300053178 | Ga0500637_0092525 | Ga0500637_0092525_458_949 | 145 |
| 912 | 3300053729 | Ga0500625_119963 | Ga0500625_119963_65_556 | 145 |
| 913 | 3300059477 | Ga0587084_014618 | Ga0587084_014618_553_990 | 145 |
| 914 | 3300059490 | Ga0587066_053972 | Ga0587066_053972_265_702 | 145 |
| 915 | 3300059491 | Ga0587070_070430 | Ga0587070_070430_110_580 | 145 |
| 916 | 3300059492 | Ga0587073_0049366 | Ga0587073_0049366_71_508 | 145 |
| 917 | 3300059493 | Ga0587077_057286 | Ga0587077_057286_120_590 | 145 |
| 918 | 3300059504 | Ga0587082_017491 | Ga0587082_017491_402_839 | 145 |
| 919 | 3300059505 | Ga0587083_0002352 | Ga0587083_0002352_1253_1690 | 145 |
| 920 | 3300059505 | Ga0587083_0041313 | Ga0587083_0041313_407_844 | 145 |
| 921 | 3300059508 | Ga0587088_002623 | Ga0587088_002623_1306_1776 | 145 |
| 922 | 3300059511 | Ga0587091_020084 | Ga0587091_020084_217_654 | 145 |
| 923 | 3300059605 | Ga0587106_001842 | Ga0587106_001842_226_696 | 145 |
| 924 | 3300059605 | Ga0587106_006419 | Ga0587106_006419_718_1155 | 145 |
| 925 | 3300059623 | Ga0587101_020970 | Ga0587101_020970_218_688 | 145 |
| 926 | 3300059641 | Ga0587068_002833 | Ga0587068_002833_1416_1886 | 145 |
| 927 | 3300059643 | Ga0587072_027254 | Ga0587072_027254_487_924 | 145 |
| 928 | 3300059645 | Ga0587076_051532 | Ga0587076_051532_213_683 | 145 |
| 929 | 3300059647 | Ga0587079_025914 | Ga0587079_025914_321_758 | 145 |
| 930 | 3300059649 | Ga0587102_005752 | Ga0587102_005752_254_691 | 145 |
| 931 | 3300059651 | Ga0587105_001963 | Ga0587105_001963_338_808 | 145 |
| 932 | 3300061719 | Ga0466962_0050633 | Ga0466962_0050633_383_820 | 145 |
| 933 | 3300061719 | Ga0466962_0156304 | Ga0466962_0156304_278_715 | 145 |
| 934 | iso_pu_bacteria | 2643221556 | 2643797775 | 145 |
| 935 | iso_pu_bacteria | 2643221684 | 2644472953 | 145 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uqr-assembly1.cif.gz_I | type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae | 0.9937 | 3 | 144 |
| 6hs9-assembly1.cif.gz_A | the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876 | 0.9862 | 2 | 141 |
| 3kip-assembly3.cif.gz_I | crystal structure of type-ii 3-dehydroquinase from c. albicans | 0.9856 | 1 | 142 |
| 1uqr-assembly1.cif.gz_F | type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae | 0.9824 | 3 | 144 |
| 4l8l-assembly1.cif.gz_A | crystal structure of the type ii dehydroquinase from pseudomonas aeruginosa | 0.9813 | 3 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kiuM00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9653 | 4 | 143 | 3.40.50.9100 |
| 3kipN00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9653 | 1 | 143 | 3.40.50.9100 |
| 1d0iH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9646 | 3 | 143 | 3.40.50.9100 |
| 1gqoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9596 | 4 | 143 | 3.40.50.9100 |
| 4kiuM00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II | 0.9446 | 4 | 143 | 3.40.50.9100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7L5YE95-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 1.002 | 1 | 144 |
GO:0003855
GO:0003989 GO:0006633 GO:0008652 GO:0009073 GO:0009317 GO:0009423 GO:0019631 |
| AF-W0V249-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 1.002 | 29 | 145 |
GO:0003855
GO:0008652 GO:0009073 GO:0009423 GO:0019631 |
| AF-A0A522IQJ0-F1-model_v4 | 3-dehydroquinate dehydratase (EC 4.2.1.10) | 1.002 | 34 | 143 |
GO:0003855
GO:0009423 GO:0019631 |
| AF-A0A855HS84-F1-model_v4 | deleted | 1.001 | 29 | 144 |
|
| AF-A4VPK2-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 1 | 3 | 144 |
GO:0003855
GO:0008652 GO:0009073 GO:0009423 GO:0019631 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar