F486140

General Info

Members Datasets Scaffolds Average Seq Length
934 573 676 146

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0296666|Ga0501042_0296666_190_711
Length 173
Sequence MAAHGGIAAGAERAMLGAGSRRAVLEGNMTLHLIKLCVGCESIEDLASWQKERLGERRKAGEKRPQLFHRTFQMPKRRDELLAGGSLYWVIKGLVACRQPLLGIKPFTDKDGIGRCHLLLDPVVIPVEPRPSRPFQGWRYLASRDAPRDLKAGRGLAKMPEELRQELAQLGLI

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
19 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
20 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
21 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
22 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
23 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
24 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
25 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
26 2519899620 Rhizobium sp. Pop5 Isolate Nodule
27 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
28 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
29 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
30 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
31 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
32 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
33 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
34 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
35 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
36 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
37 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
38 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
39 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
40 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
41 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
42 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
43 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
44 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
45 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
46 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
47 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
48 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
49 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
50 2643221558 Rhizobium sp. Root149 Isolate Unclassified
51 2643221568 Rhizobium sp. Root564 Isolate Unclassified
52 2643221582 Rhizobium sp. Root651 Isolate Unclassified
53 2643221599 Rhizobium sp. Root708 Isolate Unclassified
54 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
55 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
56 2643221693 Rhizobium sp. Root491 Isolate Unclassified
57 2718217882 Rhizobium sp. N741 Isolate Nodule
58 2718217927 Rhizobium sp. N324 Isolate Nodule
59 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
60 2718218009 Rhizobium sp. N561 Isolate Nodule
61 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
62 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
63 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
64 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
65 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
66 2718218363 Rhizobium sp. N113 Isolate Nodule
67 2718218365 Rhizobium sp. N731 Isolate Nodule
68 2718218366 Rhizobium sp. N621 Isolate Nodule
69 2718218423 Rhizobium sp. N941 Isolate Nodule
70 2721755514 Rhizobium sp. N6212 Isolate Nodule
71 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
72 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
73 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
74 2721755809 Rhizobium sp. N541 Isolate Nodule
75 2721755810 Rhizobium sp. N871 Isolate Nodule
76 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
77 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
78 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
79 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
80 2728369365 Rhizobium sp. N1341 Isolate Nodule
81 2728369397 Rhizobium sp. N1314 Isolate Nodule
82 2738541293 Rhizobium sp. GV031 Isolate Unclassified
83 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
84 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
85 2791355256 Rhizobium sp. M10 Isolate Nodule
86 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
87 2791355260 Rhizobium sp. L9 Isolate Nodule
88 2791355261 Rhizobium sp. J15 Isolate Nodule
89 2791355262 Rhizobium sp. M1 Isolate Nodule
90 2791355263 Rhizobium chutanense C5 Isolate Nodule
91 2791355264 Rhizobium sp. S9 Isolate Nodule
92 2791355265 Rhizobium sp. H4 Isolate Nodule
93 2791355266 Rhizobium sp. L43 Isolate Nodule
94 2791355267 Rhizobium sp. L18 Isolate Nodule
95 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
96 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
97 2802429633 Rhizobium anhuiense J3 Isolate Nodule
98 2802429634 Rhizobium anhuiense S10 Isolate Nodule
99 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
100 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
101 2802429637 Rhizobium anhuiense C15 Isolate Nodule
102 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
103 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
104 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
105 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
106 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
107 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
108 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
109 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
110 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
111 2838048938 Rhizobium pisi 27/80 Isolate Nodule
112 2838061910 Rhizobium phaseoli L15 Isolate Nodule
113 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
114 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
115 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
116 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
117 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
118 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
119 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
120 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
121 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
122 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
123 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
124 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
125 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
126 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
127 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
128 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
129 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
130 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
131 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
132 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
133 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
134 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
135 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
136 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
137 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
138 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
139 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
140 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
141 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
142 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
143 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
144 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
145 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
146 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
147 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
148 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
149 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
150 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
151 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
152 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
153 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
154 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
155 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
156 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
157 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
158 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
159 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
160 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
161 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
162 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
163 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
164 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
165 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
166 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
167 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
168 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
169 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
170 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
171 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
172 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
173 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
174 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
175 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
176 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
177 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
178 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
179 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
180 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
181 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
182 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
183 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
184 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
185 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
186 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
187 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
188 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
189 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
190 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
191 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
192 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
193 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
194 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
195 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
196 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
197 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
198 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
199 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
200 2933599457 Rhizobium phaseoli M3 Isolate Nodule
201 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
202 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
203 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
204 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
205 2936381700 Rhizobium chutanense C16 Isolate Unclassified
206 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
207 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
208 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
209 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
210 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
211 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
212 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
213 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
214 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
215 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
216 2996887358 Rhizobium sp. R711 Isolate Nodule
217 2996893221 Rhizobium sp. R635 Isolate Nodule
218 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
219 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
220 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
221 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
222 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
223 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
224 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
225 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
226 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
227 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
228 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
229 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
230 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
231 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
232 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
233 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
234 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
235 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
236 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
237 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
238 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
239 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
240 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
241 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
242 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
243 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
244 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
245 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
246 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
247 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
248 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
249 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
250 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
251 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
252 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
253 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
254 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
255 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
256 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
257 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
258 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
259 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
260 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
261 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
262 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
263 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
264 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
265 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
266 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
267 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
268 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
269 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
270 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
271 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
272 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
273 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
274 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
275 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
276 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
277 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
278 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
279 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
280 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
281 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
282 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
283 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
284 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
285 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
286 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
287 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
288 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
289 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
290 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
291 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
292 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
293 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
294 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
295 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
296 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
297 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
298 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
299 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
300 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
303 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
306 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
307 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
308 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
310 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
311 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
332 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
334 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
335 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
338 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
339 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
340 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
341 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
342 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
343 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
344 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
345 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
346 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
347 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
348 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
349 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
350 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
351 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
352 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
353 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
354 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
355 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
356 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
357 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
358 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
359 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
360 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
361 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
362 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
363 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
364 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
365 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
366 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
367 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
368 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
369 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
370 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
371 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
372 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
373 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
374 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
375 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
376 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
377 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
378 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
379 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
380 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
381 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
382 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
383 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
384 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
385 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
386 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
387 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
388 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
389 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
390 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
391 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
392 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
393 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
394 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
395 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
396 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
397 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
398 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
399 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
400 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
401 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
402 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
403 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
404 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
405 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
406 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
407 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
408 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
409 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
410 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
411 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
412 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
413 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
414 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
415 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
416 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
417 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
418 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
419 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
420 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
421 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
422 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
423 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
424 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
425 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
426 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
427 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
428 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
429 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
430 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
431 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
432 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
437 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
438 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
439 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
440 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
443 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
444 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
445 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
446 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
447 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
448 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
449 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
450 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
451 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
452 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
453 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
454 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
455 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
456 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
457 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
458 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
459 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
460 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
461 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
469 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
470 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
484 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
485 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
486 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
487 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
488 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
489 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
490 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
491 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
492 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
494 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
495 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
496 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
497 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
498 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
499 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
500 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
501 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
502 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
503 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
504 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
505 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
506 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
507 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
508 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
509 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
510 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
511 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
512 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
513 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
514 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
515 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
516 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
517 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
518 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
519 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
520 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
521 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
522 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
523 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
524 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
525 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
526 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
527 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
528 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
529 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
530 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
531 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
532 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
533 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
534 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
535 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
536 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
537 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
538 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
539 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
540 8005258706 Rhizobium sp. R693 Isolate Nodule
541 8005275841 Rhizobium sp. N4311 Isolate Nodule
542 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
543 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
544 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
545 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
546 8005321885 Rhizobium sp. R72 Isolate Nodule
547 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
548 8005382845 Rhizobium sp. R634 Isolate Nodule
549 8005395548 Rhizobium sp. R339 Isolate Nodule
550 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
551 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
552 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
553 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
554 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
555 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
556 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
557 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
558 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
559 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
560 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
561 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
562 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
563 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
564 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
565 8018176218 Rhizobium sp. N122 Isolate Nodule
566 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
567 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
568 8024501048 Rhizobium sp. H4 Isolate Nodule
569 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
570 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
571 8056382006 Rhizobium croatiense 13T Isolate Nodule
572 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
573 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.06
Metatranscriptomes 0.32
Isolates 27.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 23.77
Nodule 19.91
Rhizoplane 2.46
Rhizosphere 35.22
Stem 0
Stem Tuber 0
Unclassified 18.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000033 3300002739 Bacteria 30955
2 JGI25152J39213_1000526 3300002773 Bacteria 21222
3 JGI25152J39213_1004775 3300002773 Bacteria 4163
4 JGI25152J39213_1005934 3300002773 Bacteria 3436
5 JGI25152J39213_1008818 3300002773 Bacteria 2463
6 JGI25152J39213_1011566 3300002773 Bacteria 1946
7 JGI25152J39213_1011567 3300002773 Bacteria 1946
8 JGI25150J39212_1000010 3300002774 Bacteria 236260
9 JGI25150J39212_1002491 3300002774 Bacteria 4561
10 JGI25159J45721_1002570 3300002987 Bacteria 6808
11 JGI25151J46595_10000026 3300003187 Bacteria 211045
12 JGI25151J46595_10000942 3300003187 Bacteria 22517
13 JGI25151J46595_10004710 3300003187 Bacteria 7173
14 JGI25151J46595_10011116 3300003187 Bacteria 4149
15 JGI25151J46595_10069449 3300003187 Bacteria 1075
16 JGI25151J46595_10140627 3300003187 Bacteria 589
17 JGI25153J46596_10003998 3300003215 Bacteria 8052
18 JGI25153J46596_10009882 3300003215 Bacteria 4376
19 JGI25153J46596_10028302 3300003215 Bacteria 1946
20 JGI25153J46596_10028308 3300003215 Bacteria 1946
21 JGI25153J46596_10045921 3300003215 Bacteria 1299
22 JGI25153J46596_10051881 3300003215 Bacteria 1171
23 JGI25153J46596_10113137 3300003215 Bacteria 621
24 rootH1_10018254 3300003316 Bacteria 3091
25 rootH2_10083074 3300003320 Bacteria 1886
26 rootH1_10209458 3300003323 Bacteria 1823
27 JGI25160J50197_1002155 3300003354 Bacteria 9321
28 JGI25160J50197_1060657 3300003354 Bacteria 757
29 JGI25161J50226_1000285 3300003374 Bacteria 28780
30 JGI25161J50226_1000346 3300003374 Bacteria 24757
31 JGI25161J50226_1001041 3300003374 Bacteria 9526
32 Ga0006562J51391_1040093 3300003578 Bacteria 2006
33 Ga0055526_1001677 3300003771 Bacteria 15538
34 Ga0055526_1008048 3300003771 Bacteria 5326
35 Ga0055526_1012169 3300003771 Bacteria 3782
36 Ga0055526_1026624 3300003771 Bacteria 1816
37 Ga0055526_1053312 3300003771 Bacteria 906
38 Ga0055524_1002383 3300003775 Bacteria 9739
39 Ga0055524_1005290 3300003775 Bacteria 5795
40 Ga0055524_1008069 3300003775 Bacteria 4403
41 Ga0055524_1008900 3300003775 Bacteria 4132
42 Ga0055524_1035651 3300003775 Bacteria 1353
43 Ga0055536_1011865 3300003781 Bacteria 3290
44 Ga0055528_1000851 3300003790 Bacteria 20725
45 Ga0055528_1001075 3300003790 Bacteria 18004
46 Ga0055528_1001905 3300003790 Bacteria 11844
47 Ga0055528_1014016 3300003790 Bacteria 2995
48 Ga0055530_10020414 3300003791 Bacteria 1979
49 Ga0055540_1000620 3300003792 Bacteria 25294
50 Ga0055540_1001108 3300003792 Bacteria 16992
51 Ga0055540_1002555 3300003792 Bacteria 9485
52 Ga0055540_1013077 3300003792 Bacteria 2559
53 Ga0055540_1018768 3300003792 Bacteria 1885
54 Ga0055531_10005313 3300003794 Bacteria 7558
55 Ga0058692_1000424 3300003856 Bacteria 19461
56 Ga0058692_1000954 3300003856 Bacteria 11370
57 Ga0055543_1000032 3300004625 Bacteria 130218
58 Ga0055543_1000507 3300004625 Bacteria 22412
59 Ga0065165_1003516 3300005262 Bacteria 10870
60 Ga0065165_1009353 3300005262 Bacteria 4407
61 Ga0065165_1024876 3300005262 Bacteria 2002
62 Ga0070670_100038746 3300005331 Bacteria 4098
63 Ga0070660_100201442 3300005339 Bacteria 1614
64 Ga0070660_100651878 3300005339 Bacteria 882
65 Ga0070668_100771571 3300005347 Bacteria 852
66 Ga0070668_100837491 3300005347 Bacteria 819
67 Ga0070669_100062353 3300005353 Bacteria 2741
68 Ga0070669_100073137 3300005353 Bacteria 2539
69 Ga0070659_100530984 3300005366 Bacteria 1005
70 Ga0070713_100083761 3300005436 Bacteria 2727
71 Ga0070710_10114578 3300005437 Bacteria 1624
72 Ga0070710_10383778 3300005437 Bacteria 938
73 Ga0070678_100178951 3300005456 Bacteria 1734
74 Ga0070662_100619462 3300005457 Bacteria 911
75 Ga0070681_10117048 3300005458 Bacteria 2601
76 Ga0070679_100185033 3300005530 Bacteria 2054
77 Ga0068853_100036646 3300005539 Bacteria 4172
78 Ga0070665_100012992 3300005548 Bacteria 8388
79 Ga0070665_100263110 3300005548 Bacteria 1726
80 Ga0068855_100247060 3300005563 Bacteria 1991
81 Ga0068855_100269142 3300005563 Bacteria 1895
82 Ga0068857_100437125 3300005577 Bacteria 1222
83 Ga0068852_100574031 3300005616 Bacteria 1130
84 Ga0068863_100097227 3300005841 Bacteria 2796
85 Ga0081455_10016377 3300005937 Bacteria 7160
86 Ga0081538_10064338 3300005981 Bacteria 2075
87 Ga0081540_1025775 3300005983 Bacteria 3374
88 Ga0075365_10004225 3300006038 Bacteria 7571
89 Ga0075365_10006168 3300006038 Bacteria 6565
90 Ga0075365_10154341 3300006038 Bacteria 1598
91 Ga0075365_10275338 3300006038 Bacteria 1184
92 Ga0075368_10017047 3300006042 Bacteria 2714
93 Ga0075368_10162980 3300006042 Bacteria 935
94 Ga0075363_100511895 3300006048 Bacteria 714
95 Ga0075364_10000170 3300006051 Bacteria 29008
96 Ga0075364_10232346 3300006051 Bacteria 1252
97 Ga0075364_10337542 3300006051 Bacteria 1027
98 Ga0075364_10362265 3300006051 Bacteria 989
99 Ga0075364_10394792 3300006051 Bacteria 944
100 Ga0075364_10575475 3300006051 Bacteria 770
101 Ga0075364_10795008 3300006051 Bacteria 645
102 Ga0070716_100431425 3300006173 Bacteria 956
103 Ga0070712_100362024 3300006175 Bacteria 1190
104 Ga0075362_10000803 3300006177 Bacteria 9374
105 Ga0075362_10010765 3300006177 Bacteria 3582
106 Ga0075362_10027933 3300006177 Bacteria 2419
107 Ga0075367_10001565 3300006178 Bacteria 9892
108 Ga0075367_10005669 3300006178 Bacteria 6231
109 Ga0075367_10019031 3300006178 Bacteria 3800
110 Ga0075367_10501875 3300006178 Bacteria 770
111 Ga0075369_10000650 3300006186 Bacteria 11063
112 Ga0075369_10028406 3300006186 Bacteria 2344
113 Ga0075369_10151567 3300006186 Bacteria 1060
114 Ga0075369_10305039 3300006186 Bacteria 744
115 Ga0075366_10451194 3300006195 Bacteria 793
116 Ga0075370_10040386 3300006353 Bacteria 2631
117 Ga0075370_10670238 3300006353 Bacteria 630
118 Ga0079104_1000209 3300006946 Bacteria 81844
119 Ga0099826_10000103 3300006948 Bacteria 39924
120 Ga0105240_10899515 3300009093 Bacteria 952
121 Ga0105243_10124642 3300009148 Bacteria 2177
122 Ga0105243_11153790 3300009148 Bacteria 786
123 Ga0105241_11943512 3300009174 Bacteria 578
124 Ga0105248_10908857 3300009177 Bacteria 994
125 Ga0105237_10067121 3300009545 Bacteria 3581
126 Ga0105238_10282255 3300009551 Bacteria 1642
127 Ga0105238_11232641 3300009551 Bacteria 773
128 Ga0123340_1081144 3300009763 Bacteria 646
129 Ga0123341_1001018 3300009765 Bacteria 19906
130 Ga0123341_1032179 3300009765 Bacteria 3860
131 Ga0123342_1036935 3300009766 Bacteria 1989
132 Ga0105239_10699119 3300010375 Bacteria 1159
133 Ga0105246_11803613 3300011119 Unclassified 585
134 Ga0157319_1001870 3300012497 Bacteria 1143
135 Ga0157373_10012025 3300013100 Bacteria 6363
136 Ga0157373_10040944 3300013100 Bacteria 3315
137 Ga0157373_10594276 3300013100 Bacteria 805
138 Ga0157371_10000015 3300013102 Bacteria 339838
139 Ga0157371_10041317 3300013102 Bacteria 3292
140 Ga0157370_10000309 3300013104 Bacteria 61167
141 Ga0157370_10083084 3300013104 Bacteria 3012
142 Ga0157370_10227534 3300013104 Bacteria 1726
143 Ga0157369_10026552 3300013105 Bacteria 6422
144 Ga0163163_11423371 3300014325 Bacteria 755
145 Ga0163163_11926299 3300014325 Bacteria 651
146 Ga0213872_10119664 3300021361 Bacteria 1165
147 Ga0213874_10018750 3300021377 Bacteria 1874
148 Ga0213876_10051446 3300021384 Bacteria 2177
149 Ga0213876_10221343 3300021384 Bacteria 1006
150 Ga0213871_10182512 3300021441 Bacteria 649
151 Ga0213871_10204647 3300021441 Bacteria 617
152 Ga0209436_100001 3300025208 Bacteria 304543
153 Ga0207425_1000010 3300025245 Bacteria 572898
154 Ga0207425_1000826 3300025245 Bacteria 15458
155 Ga0207425_1011745 3300025245 Bacteria 2075
156 Ga0209129_1000099 3300025258 Bacteria 162471
157 Ga0209129_1000580 3300025258 Bacteria 25201
158 Ga0209129_1000593 3300025258 Bacteria 24734
159 Ga0209129_1001147 3300025258 Bacteria 15336
160 Ga0209129_1002836 3300025258 Bacteria 8018
161 Ga0209129_1004971 3300025258 Bacteria 4922
162 Ga0209129_1007616 3300025258 Bacteria 3180
163 Ga0209565_1021755 3300025263 Bacteria 1335
164 Ga0209673_1000013 3300025273 Bacteria 571633
165 Ga0209673_1000048 3300025273 Bacteria 287976
166 Ga0209673_1000841 3300025273 Bacteria 40004
167 Ga0209673_1001196 3300025273 Bacteria 27855
168 Ga0209673_1001233 3300025273 Bacteria 26813
169 Ga0209673_1001920 3300025273 Bacteria 16520
170 Ga0209673_1007723 3300025273 Bacteria 4897
171 Ga0209673_1009029 3300025273 Bacteria 4370
172 Ga0209673_1011162 3300025273 Bacteria 3724
173 Ga0209673_1054429 3300025273 Bacteria 1037
174 Ga0209130_1000004 3300025284 Bacteria 633436
175 Ga0209130_1008084 3300025284 Bacteria 3150
176 Ga0209130_1026826 3300025284 Bacteria 1231
177 Ga0209130_1032942 3300025284 Bacteria 1052
178 Ga0209675_1025138 3300025291 Bacteria 1507
179 Ga0209676_1001764 3300025292 Bacteria 18335
180 Ga0209676_1030148 3300025292 Bacteria 1663
181 Ga0209025_1000022 3300025294 Bacteria 574487
182 Ga0209025_1000787 3300025294 Bacteria 52060
183 Ga0209025_1001289 3300025294 Bacteria 34281
184 Ga0209025_1001860 3300025294 Bacteria 24723
185 Ga0209025_1002946 3300025294 Bacteria 16924
186 Ga0209025_1007031 3300025294 Bacteria 8526
187 Ga0209025_1017404 3300025294 Bacteria 4151
188 Ga0209025_1018065 3300025294 Bacteria 4030
189 Ga0209025_1024099 3300025294 Bacteria 3155
190 Ga0209564_1000566 3300025295 Bacteria 58647
191 Ga0209564_1000906 3300025295 Bacteria 38845
192 Ga0209564_1004549 3300025295 Bacteria 8421
193 Ga0209564_1007058 3300025295 Bacteria 5881
194 Ga0209564_1019336 3300025295 Bacteria 2550
195 Ga0209758_1000086 3300025297 Bacteria 254778
196 Ga0209758_1000821 3300025297 Bacteria 43465
197 Ga0209758_1000977 3300025297 Bacteria 38489
198 Ga0209758_1001150 3300025297 Bacteria 33851
199 Ga0209758_1001420 3300025297 Bacteria 28346
200 Ga0209758_1005307 3300025297 Bacteria 10057
201 Ga0209758_1012058 3300025297 Bacteria 4899
202 Ga0209758_1072740 3300025297 Bacteria 1074
203 Ga0209758_1132444 3300025297 Bacteria 657
204 Ga0209050_1001733 3300025298 Bacteria 21711
205 Ga0209050_1048154 3300025298 Bacteria 1104
206 Ga0209256_1000947 3300025299 Bacteria 35197
207 Ga0209256_1001331 3300025299 Bacteria 26356
208 Ga0209256_1002910 3300025299 Bacteria 12910
209 Ga0209256_1009756 3300025299 Bacteria 4144
210 Ga0209256_1019473 3300025299 Bacteria 2158
211 Ga0209256_1035721 3300025299 Bacteria 1310
212 Ga0207426_1000003 3300025302 Bacteria 1063212
213 Ga0207426_1000427 3300025302 Bacteria 68840
214 Ga0207426_1003684 3300025302 Bacteria 8039
215 Ga0209051_1000125 3300025303 Bacteria 142863
216 Ga0209051_1001061 3300025303 Bacteria 25637
217 Ga0209051_1002163 3300025303 Bacteria 14581
218 Ga0209051_1014843 3300025303 Bacteria 3615
219 Ga0209051_1149955 3300025303 Bacteria 548
220 Ga0209257_1001014 3300025304 Bacteria 37770
221 Ga0209257_1001705 3300025304 Bacteria 24654
222 Ga0209257_1065890 3300025304 Bacteria 970
223 Ga0207647_10032694 3300025904 Bacteria 3339
224 Ga0207705_10366009 3300025909 Bacteria 1112
225 Ga0207705_10530484 3300025909 Bacteria 915
226 Ga0207693_10038062 3300025915 Bacteria 3789
227 Ga0207660_10093030 3300025917 Bacteria 2239
228 Ga0207657_10002501 3300025919 Bacteria 19880
229 Ga0207657_10493979 3300025919 Bacteria 959
230 Ga0207652_10531851 3300025921 Bacteria 1057
231 Ga0207681_10301986 3300025923 Bacteria 1267
232 Ga0207681_10343899 3300025923 Bacteria 1192
233 Ga0207650_10026479 3300025925 Bacteria 4137
234 Ga0207664_10781767 3300025929 Bacteria 859
235 Ga0207706_10787589 3300025933 Bacteria 808
236 Ga0207709_10182291 3300025935 Bacteria 1484
237 Ga0207709_10890427 3300025935 Unclassified 723
238 Ga0207711_10780460 3300025941 Bacteria 890
239 Ga0207667_10225867 3300025949 Bacteria 1918
240 Ga0207668_10236653 3300025972 Bacteria 1475
241 Ga0207668_10882044 3300025972 Bacteria 795
242 Ga0207678_10403505 3300026067 Bacteria 1184
243 Ga0207641_10055424 3300026088 Bacteria 3366
244 Ga0207648_10687806 3300026089 Bacteria 947
245 Ga0207683_10216327 3300026121 Bacteria 1745
246 Ga0209281_1000580 3300027111 Bacteria 43078
247 Ga0209371_1000058 3300027312 Bacteria 237920
248 Ga0209371_1000904 3300027312 Bacteria 23544
249 Ga0209282_1000095 3300027666 Bacteria 60099
250 Ga0209813_10023353 3300027866 Bacteria 1758
251 Ga0268266_10083220 3300028379 Bacteria 2793
252 Ga0268266_10126895 3300028379 Bacteria 2278
253 Ga0268266_11138298 3300028379 Bacteria 755
254 Ga0268265_10340830 3300028380 Bacteria 1365
255 Ga0307515_10001393 3300028794 Bacteria 54715
256 Ga0307515_10004439 3300028794 Bacteria 29051
257 Ga0307515_10072377 3300028794 Bacteria 4653
258 Ga0265338_10105959 3300028800 Bacteria 2278
259 Ga0268256_1000056 3300030500 Bacteria 231684
260 Ga0268256_1004374 3300030500 Bacteria 5888
261 Ga0316182_1233033 3300030745 Bacteria 1192
262 Ga0265320_10012013 3300031240 Bacteria 5066
263 Ga0265325_10179200 3300031241 Bacteria 988
264 Ga0265340_10350755 3300031247 Bacteria 652
265 Ga0265327_10038869 3300031251 Bacteria 2591
266 Ga0307513_10024524 3300031456 Bacteria 7017
267 Ga0307408_100020868 3300031548 Bacteria 4426
268 Ga0265314_10011047 3300031711 Bacteria 7487
269 Ga0265314_10211308 3300031711 Bacteria 1139
270 Ga0316576_10059041 3300031727 Bacteria 2807
271 Ga0316578_10005669 3300031728 Bacteria 6078
272 Ga0307516_10359782 3300031730 Bacteria 1120
273 Ga0307405_10021745 3300031731 Bacteria 3611
274 Ga0307406_10019146 3300031901 Bacteria 4015
275 Ga0307412_10002546 3300031911 Bacteria 10129
276 Ga0307416_100194009 3300032002 Bacteria 1919
277 Ga0307510_10196832 3300033180 Bacteria 1556
278 Ga0373952_0224739 3300035092 Bacteria 559
279 Ga0316574_0000978 3300035398 Bacteria 12825
280 Ga0373935_0035232 3300035692 Bacteria 3124
281 Ga0316584_0270665 3300036712 Bacteria 1236
282 Ga0373925_0008671 3300037068 Bacteria 7409
283 Ga0395899_0350773 3300037312 Bacteria 987
284 Ga0395900_0132273 3300037418 Bacteria 2556
285 Ga0395901_0056893 3300038443 Bacteria 4068
286 Ga0395901_0277390 3300038443 Bacteria 1743
287 Ga0436365_1716423 3300039437 Bacteria 4980
288 Ga0436360_0668397 3300039438 Bacteria 1774
289 Ga0436360_0672973 3300039438 Bacteria 1674
290 Ga0436360_0726396 3300039438 Bacteria 656
291 Ga0436360_0772974 3300039438 Bacteria 1727
292 Ga0436360_0891092 3300039438 Bacteria 544
293 Ga0436360_0966143 3300039438 Bacteria 4069
294 Ga0436360_1263519 3300039438 Bacteria 891
295 Ga0436360_1279400 3300039438 Bacteria 5324
296 Ga0436360_1280006 3300039438 Bacteria 2161
297 Ga0436360_1349174 3300039438 Bacteria 1979
298 Ga0436361_0056445 3300039447 Bacteria 1833
299 Ga0436361_0195628 3300039447 Bacteria 3486
300 Ga0436361_0504000 3300039447 Bacteria 828
301 Ga0436361_1066451 3300039447 Bacteria 748
302 Ga0436361_1131419 3300039447 Bacteria 1398
303 Ga0436362_1271493 3300039453 Bacteria 548
304 Ga0436362_1294587 3300039453 Bacteria 1693
305 Ga0439436_0061624 3300041404 Bacteria 1050
306 Ga0439438_064870 3300041405 Bacteria 910
307 Ga0439466_0186910 3300041411 Bacteria 631
308 Ga0439465_0002039 3300041413 Bacteria 6621
309 Ga0439465_0014447 3300041413 Bacteria 2460
310 Ga0439465_0062128 3300041413 Bacteria 1239
311 Ga0439465_0096782 3300041413 Bacteria 1015
312 Ga0451787_483819 3300041441 Bacteria 688
313 Ga0451789_0132731 3300041443 Bacteria 780
314 Ga0451791_0446157 3300041451 Bacteria 1961
315 Ga0451797_0099719 3300041453 Bacteria 540
316 Ga0451802_0003539 3300041460 Bacteria 568
317 Ga0451804_0654900 3300041463 Bacteria 1281
318 Ga0451833_0487316 3300041491 Bacteria 1954
319 Ga0451833_0973106 3300041491 Bacteria 2052
320 Ga0451835_0582272 3300041492 Bacteria 2579
321 Ga0451837_0252729 3300041494 Bacteria 1497
322 Ga0451837_1669237 3300041494 Bacteria 1910
323 Ga0451839_0052569 3300041496 Bacteria 1934
324 Ga0451839_0226926 3300041496 Bacteria 1753
325 Ga0451839_1053254 3300041496 Bacteria 1169
326 Ga0451841_0507248 3300041498 Bacteria 1521
327 Ga0451841_1220323 3300041498 Bacteria 1325
328 Ga0451845_0011679 3300041501 Bacteria 4968
329 Ga0451847_0191909 3300041503 Bacteria 2978
330 Ga0451847_1000258 3300041503 Bacteria 905
331 Ga0451849_0371999 3300041505 Bacteria 1278
332 Ga0451850_01285 3300041506 Bacteria 529
333 Ga0451851_0136593 3300041507 Bacteria 2601
334 Ga0451843_0529508 3300041509 Bacteria 3948
335 Ga0451843_1322506 3300041509 Bacteria 619
336 Ga0451854_37769 3300041510 Bacteria 788
337 Ga0451853_1427546 3300041512 Bacteria 698
338 Ga0451853_3057193 3300041512 Bacteria 1423
339 Ga0439432_094870 3300042006 Bacteria 896
340 Ga0439449_0044732 3300042007 Bacteria 1642
341 Ga0439449_0164469 3300042007 Bacteria 829
342 Ga0450900_013192 3300042136 Bacteria 1089
343 Ga0450900_051686 3300042136 Bacteria 630
344 Ga0451577_0170953 3300042876 Bacteria 1958
345 Ga0453683_0105549 3300044673 Bacteria 1770
346 Ga0453683_0677123 3300044673 Bacteria 675
347 Ga0466965_0183085 3300044683 Bacteria 1106
348 Ga0453684_0352126 3300044712 Bacteria 1660
349 Ga0451576_0000752 3300045051 Bacteria 64762
350 Ga0451576_0016110 3300045051 Bacteria 8260
351 Ga0451576_0065534 3300045051 Bacteria 3782
352 Ga0451576_0761571 3300045051 Bacteria 1017
353 Ga0495617_048343 3300046452 Bacteria 1416
354 Ga0495592_0390125 3300046454 Bacteria 884
355 Ga0495603_0169952 3300046455 Bacteria 1263
356 Ga0495629_0119616 3300046459 Bacteria 1835
357 Ga0495638_0000597 3300046460 Bacteria 40647
358 Ga0495638_0048834 3300046460 Bacteria 2647
359 Ga0495638_0250344 3300046460 Bacteria 977
360 Ga0495638_0451292 3300046460 Bacteria 656
361 Ga0495651_0170300 3300046462 Bacteria 1551
362 Ga0495651_0427307 3300046462 Bacteria 860
363 Ga0495650_0062085 3300046471 Bacteria 1494
364 Ga0495650_0067025 3300046471 Bacteria 1419
365 Ga0495650_0082224 3300046471 Bacteria 1239
366 Ga0495605_0010494 3300046474 Bacteria 5180
367 Ga0495605_0052317 3300046474 Bacteria 1985
368 Ga0495605_0110426 3300046474 Bacteria 1255
369 Ga0495662_0042557 3300046476 Bacteria 2192
370 Ga0495585_0008606 3300046492 Bacteria 6179
371 Ga0495585_0014614 3300046492 Bacteria 4569
372 Ga0495585_0062670 3300046492 Bacteria 2042
373 Ga0495607_0020706 3300046501 Bacteria 4151
374 Ga0495607_0078852 3300046501 Bacteria 1816
375 Ga0495607_0109190 3300046501 Bacteria 1469
376 Ga0495583_0004644 3300046506 Bacteria 9693
377 Ga0495583_0038373 3300046506 Bacteria 2263
378 Ga0495583_0059957 3300046506 Bacteria 1703
379 Ga0495606_0001192 3300046507 Bacteria 36659
380 Ga0495606_0014966 3300046507 Bacteria 6016
381 Ga0495606_0080629 3300046507 Bacteria 2025
382 Ga0495606_0172548 3300046507 Bacteria 1253
383 Ga0495606_0310973 3300046507 Bacteria 850
384 Ga0495610_0000823 3300046512 Bacteria 29049
385 Ga0495610_0013855 3300046512 Bacteria 4766
386 Ga0495616_0099882 3300046513 Bacteria 1362
387 Ga0495616_0308931 3300046513 Bacteria 666
388 Ga0495620_0006195 3300046515 Bacteria 6590
389 Ga0495620_0016721 3300046515 Bacteria 3674
390 Ga0495620_0048443 3300046515 Bacteria 1824
391 Ga0495620_0079383 3300046515 Bacteria 1329
392 Ga0495620_0108720 3300046515 Bacteria 1100
393 Ga0495631_0000740 3300046518 Bacteria 20967
394 Ga0495631_0114198 3300046518 Bacteria 1161
395 Ga0495631_0260989 3300046518 Bacteria 738
396 Ga0495632_0002039 3300046519 Bacteria 15901
397 Ga0495632_0017858 3300046519 Bacteria 3904
398 Ga0495632_0044674 3300046519 Bacteria 2211
399 Ga0495632_0278320 3300046519 Bacteria 745
400 Ga0495637_0139725 3300046520 Bacteria 920
401 Ga0495643_0058453 3300046522 Bacteria 2052
402 Ga0495643_0133632 3300046522 Bacteria 1243
403 Ga0495652_0161142 3300046529 Bacteria 1742
404 Ga0495654_0000641 3300046530 Bacteria 27579
405 Ga0495654_0416245 3300046530 Bacteria 532
406 Ga0495640_0360520 3300046533 Bacteria 896
407 Ga0495587_0426661 3300046536 Bacteria 736
408 Ga0495609_0129367 3300046538 Bacteria 1082
409 Ga0495597_0015218 3300046542 Bacteria 3644
410 Ga0495597_0164750 3300046542 Bacteria 903
411 Ga0495622_0175598 3300046557 Bacteria 962
412 Ga0495633_0012938 3300046558 Bacteria 4415
413 Ga0495633_0079454 3300046558 Bacteria 1527
414 Ga0495633_0183738 3300046558 Bacteria 962
415 Ga0495633_0443469 3300046558 Bacteria 586
416 Ga0495668_0004290 3300046616 Bacteria 10222
417 Ga0495668_0024255 3300046616 Bacteria 3451
418 Ga0495634_0702416 3300046642 Bacteria 581
419 Ga0495611_0005299 3300046648 Bacteria 5521
420 Ga0495611_0297048 3300046648 Bacteria 745
421 Ga0495611_0394647 3300046648 Bacteria 633
422 Ga0495625_0001750 3300046660 Bacteria 25112
423 Ga0495625_0120200 3300046660 Bacteria 1788
424 Ga0495625_0196758 3300046660 Bacteria 1332
425 Ga0495661_0058247 3300046665 Bacteria 2303
426 Ga0495661_0161776 3300046665 Bacteria 1201
427 Ga0495658_0319812 3300046683 Bacteria 983
428 Ga0495613_0515563 3300046689 Bacteria 804
429 Ga0495624_0445747 3300046690 Bacteria 776
430 Ga0495670_0025865 3300046691 Bacteria 2905
431 Ga0495670_0055914 3300046691 Bacteria 1979
432 Ga0495671_0066511 3300046692 Bacteria 1774
433 Ga0495671_0366336 3300046692 Bacteria 691
434 Ga0495589_0033057 3300046794 Bacteria 2599
435 Ga0495600_0061319 3300046809 Bacteria 2456
436 Ga0495660_0013150 3300046810 Bacteria 4797
437 Ga0495660_0073249 3300046810 Bacteria 1812
438 Ga0495604_0074492 3300047317 Bacteria 2558
439 Ga0495672_0007762 3300047320 Bacteria 8029
440 Ga0495683_0019292 3300047323 Bacteria 3520
441 Ga0495685_201877 3300047447 Bacteria 637
442 Ga0495681_0041135 3300047470 Bacteria 2245
443 Ga0495686_0003300 3300047472 Bacteria 14084
444 Ga0495686_0010445 3300047472 Bacteria 6604
445 Ga0495686_0012162 3300047472 Bacteria 6036
446 Ga0495686_0013205 3300047472 Bacteria 5743
447 Ga0495686_0082206 3300047472 Bacteria 1966
448 Ga0495686_0256162 3300047472 Bacteria 981
449 Ga0495686_0551787 3300047472 Bacteria 601
450 Ga0495686_0636159 3300047472 Bacteria 549
451 Ga0495615_0147023 3300048090 Bacteria 699
452 Ga0495626_0087468 3300048091 Bacteria 1375
453 Ga0496100_0129364 3300048903 Bacteria 1777
454 Ga0496101_0556962 3300048904 Bacteria 907
455 Ga0496104_0273064 3300048907 Bacteria 1603
456 Ga0496104_0420617 3300048907 Bacteria 1248
457 Ga0496105_0753326 3300048908 Bacteria 744
458 Ga0496106_0000801 3300048909 Bacteria 22763
459 Ga0496106_0170481 3300048909 Bacteria 1725
460 Ga0496107_0343330 3300048910 Bacteria 1111
461 Ga0496107_0408015 3300048910 Bacteria 1010
462 Ga0496110_0518323 3300048913 Bacteria 1085
463 Ga0496110_1381248 3300048913 Bacteria 614
464 Ga0496110_1409562 3300048913 Bacteria 606
465 Ga0496111_0000625 3300048914 Bacteria 18727
466 Ga0496114_0599271 3300048917 Bacteria 972
467 Ga0496116_0000043 3300048919 Bacteria 328085
468 Ga0496116_0002893 3300048919 Bacteria 17567
469 Ga0496116_0048551 3300048919 Bacteria 2847
470 Ga0496116_0066801 3300048919 Bacteria 2299
471 Ga0496116_0083983 3300048919 Bacteria 1963
472 Ga0496116_0135199 3300048919 Bacteria 1398
473 Ga0496116_0135754 3300048919 Bacteria 1393
474 Ga0496116_0151396 3300048919 Bacteria 1288
475 Ga0496116_0165662 3300048919 Bacteria 1205
476 Ga0496117_0000002 3300048920 Bacteria 2483758
477 Ga0496117_0002492 3300048920 Bacteria 23104
478 Ga0496117_0017063 3300048920 Bacteria 6080
479 Ga0496117_0049600 3300048920 Bacteria 2984
480 Ga0496117_0053258 3300048920 Bacteria 2844
481 Ga0496117_0091707 3300048920 Bacteria 1953
482 Ga0496117_0317675 3300048920 Bacteria 817
483 Ga0496118_0001850 3300048921 Bacteria 30309
484 Ga0496118_0002255 3300048921 Bacteria 26416
485 Ga0496118_0055604 3300048921 Bacteria 2984
486 Ga0496118_0055781 3300048921 Bacteria 2977
487 Ga0496118_0070257 3300048921 Bacteria 2529
488 Ga0496118_0119184 3300048921 Bacteria 1726
489 Ga0496118_0190656 3300048921 Bacteria 1226
490 Ga0496118_0333192 3300048921 Bacteria 817
491 Ga0496119_0009038 3300048922 Bacteria 8639
492 Ga0496119_0055250 3300048922 Bacteria 2412
493 Ga0496119_0068361 3300048922 Bacteria 2092
494 Ga0496119_0077578 3300048922 Bacteria 1924
495 Ga0496119_0291363 3300048922 Bacteria 808
496 Ga0496119_0336704 3300048922 Bacteria 734
497 Ga0496119_0421149 3300048922 Bacteria 634
498 Ga0496119_0537224 3300048922 Bacteria 539
499 Ga0496120_0000078 3300048923 Bacteria 162312
500 Ga0496120_0117643 3300048923 Bacteria 1378
501 Ga0496120_0216153 3300048923 Bacteria 919
502 Ga0496121_0000003 3300048924 Bacteria 1191431
503 Ga0496121_0000751 3300048924 Bacteria 59594
504 Ga0496121_0005759 3300048924 Bacteria 15725
505 Ga0496121_0016740 3300048924 Bacteria 7544
506 Ga0496121_0033826 3300048924 Bacteria 4614
507 Ga0496121_0037070 3300048924 Bacteria 4335
508 Ga0496121_0050317 3300048924 Bacteria 3521
509 Ga0496121_0055812 3300048924 Bacteria 3287
510 Ga0496121_0185828 3300048924 Bacteria 1495
511 Ga0496121_0241327 3300048924 Bacteria 1259
512 Ga0496121_0247651 3300048924 Bacteria 1238
513 Ga0496121_0375424 3300048924 Bacteria 939
514 Ga0496121_0388232 3300048924 Bacteria 918
515 Ga0496121_0414040 3300048924 Bacteria 879
516 Ga0496122_0000001 3300048925 Bacteria 1827766
517 Ga0496122_0000399 3300048925 Bacteria 92476
518 Ga0496122_0043507 3300048925 Bacteria 3517
519 Ga0496122_0047654 3300048925 Bacteria 3306
520 Ga0496122_0175972 3300048925 Bacteria 1282
521 Ga0496122_0200130 3300048925 Bacteria 1169
522 Ga0496122_0221660 3300048925 Bacteria 1084
523 Ga0496122_0243563 3300048925 Bacteria 1011
524 Ga0496123_0000001 3300048926 Bacteria 1831497
525 Ga0496123_0002112 3300048926 Bacteria 25505
526 Ga0496123_0007774 3300048926 Bacteria 9990
527 Ga0496123_0018288 3300048926 Bacteria 5581
528 Ga0496123_0032077 3300048926 Bacteria 3811
529 Ga0496123_0055467 3300048926 Bacteria 2599
530 Ga0496123_0148710 3300048926 Bacteria 1267
531 Ga0496123_0177001 3300048926 Bacteria 1118
532 Ga0496124_0000377 3300048927 Bacteria 81321
533 Ga0496124_0002648 3300048927 Bacteria 23011
534 Ga0496124_0007941 3300048927 Bacteria 11170
535 Ga0496124_0039431 3300048927 Bacteria 4094
536 Ga0496124_0083345 3300048927 Bacteria 2623
537 Ga0496124_0085245 3300048927 Bacteria 2589
538 Ga0496124_0089750 3300048927 Bacteria 2508
539 Ga0496124_0241109 3300048927 Bacteria 1344
540 Ga0496124_0245429 3300048927 Bacteria 1328
541 Ga0496124_0264933 3300048927 Bacteria 1262
542 Ga0496124_0384363 3300048927 Bacteria 980
543 Ga0496124_0443009 3300048927 Bacteria 888
544 Ga0496125_0000141 3300048928 Bacteria 158991
545 Ga0496125_0001650 3300048928 Bacteria 31436
546 Ga0496125_0030094 3300048928 Bacteria 4863
547 Ga0496125_0059323 3300048928 Bacteria 3084
548 Ga0496126_0000362 3300048929 Bacteria 94734
549 Ga0496126_0001055 3300048929 Bacteria 46595
550 Ga0496126_0108174 3300048929 Bacteria 2424
551 Ga0496126_0133653 3300048929 Bacteria 2142
552 Ga0496126_0178712 3300048929 Bacteria 1804
553 Ga0496126_0307160 3300048929 Bacteria 1307
554 Ga0496126_0355000 3300048929 Bacteria 1198
555 Ga0496126_0401876 3300048929 Bacteria 1111
556 Ga0496126_0721480 3300048929 Bacteria 772
557 Ga0496126_0980343 3300048929 Bacteria 635
558 Ga0495678_014086 3300049459 Bacteria 3730
559 Ga0495678_029360 3300049459 Bacteria 2310
560 Ga0495682_0111537 3300049460 Bacteria 980
561 Ga0501031_0262833 3300049568 Bacteria 1121
562 Ga0501032_0043453 3300049569 Bacteria 3043
563 Ga0501032_0322287 3300049569 Bacteria 997
564 Ga0501032_0957740 3300049569 Bacteria 538
565 Ga0501033_0001044 3300049570 Bacteria 25238
566 Ga0501033_0083686 3300049570 Bacteria 2338
567 Ga0501033_1133102 3300049570 Bacteria 519
568 Ga0501034_0011050 3300049571 Bacteria 9376
569 Ga0501034_0041937 3300049571 Bacteria 4631
570 Ga0501034_0270792 3300049571 Bacteria 1639
571 Ga0501034_0489838 3300049571 Bacteria 1144
572 Ga0501036_0019092 3300049572 Bacteria 5753
573 Ga0501036_0054502 3300049572 Bacteria 3387
574 Ga0501036_0654855 3300049572 Bacteria 869
575 Ga0501037_0047500 3300049573 Bacteria 3146
576 Ga0501037_0145295 3300049573 Bacteria 1696
577 Ga0501038_0359874 3300049574 Bacteria 1132
578 Ga0501038_0628707 3300049574 Bacteria 810
579 Ga0501039_0213010 3300049575 Bacteria 1519
580 Ga0501039_0403908 3300049575 Bacteria 1073
581 Ga0501042_0296666 3300049578 Bacteria 1168
582 Ga0501043_0021712 3300049579 Bacteria 5032
583 Ga0501043_0595146 3300049579 Bacteria 817
584 Ga0501046_0068367 3300049580 Bacteria 2765
585 Ga0501046_0543615 3300049580 Bacteria 829
586 Ga0501046_0963078 3300049580 Bacteria 593
587 Ga0501047_0009309 3300049581 Bacteria 9276
588 Ga0501047_0472262 3300049581 Bacteria 1082
589 Ga0501048_0126905 3300049582 Bacteria 1804
590 Ga0501048_0129826 3300049582 Bacteria 1782
591 Ga0501048_0233882 3300049582 Bacteria 1304
592 Ga0501067_0053980 3300049583 Bacteria 2227
593 Ga0501068_0129075 3300049584 Bacteria 1580
594 Ga0501070_0608971 3300049586 Bacteria 870
595 Ga0501071_0122293 3300049587 Bacteria 1930
596 Ga0501073_0084268 3300049589 Bacteria 2212
597 Ga0501073_0150329 3300049589 Bacteria 1614
598 Ga0501073_0551658 3300049589 Bacteria 796
599 Ga0501074_0090849 3300049590 Bacteria 2187
600 Ga0501079_0594495 3300049741 Bacteria 871
601 Ga0501079_0734447 3300049741 Bacteria 777
602 Ga0501080_0187661 3300049742 Bacteria 1901
603 Ga0501080_0381235 3300049742 Bacteria 1270
604 Ga0501083_0266414 3300049744 Bacteria 1114
605 Ga0501035_0001225 3300049822 Bacteria 26738
606 Ga0501035_0036982 3300049822 Bacteria 4422
607 Ga0501044_0106055 3300049823 Bacteria 2822
608 nmdc:mga03683_16720_c2 3300050489 Bacteria 2247
609 nmdc:mga03683_1843_c1 3300050489 Bacteria 6438
610 nmdc:mga03n38_501576_c1 3300050490 Bacteria 681
611 nmdc:mga00v17_232788_c1 3300050491 Bacteria 1194
612 nmdc:mga00v17_291_c1 3300050491 Bacteria 29216
613 nmdc:mga00v17_430441_c1 3300050491 Bacteria 857
614 nmdc:mga00v17_725615_c1 3300050491 Bacteria 636
615 nmdc:mga00v17_831775_c1 3300050491 Bacteria 587
616 nmdc:mga0yw44_174970_c1 3300050492 Bacteria 1411
617 nmdc:mga0yw44_26184_c1 3300050492 Bacteria 3328
618 nmdc:mga0yw44_30132_c1 3300050492 Bacteria 910
619 nmdc:mga0k408_12066_c1 3300050493 Bacteria 4718
620 nmdc:mga06z11_144358_c1 3300050494 Bacteria 1348
621 nmdc:mga06z11_375383_c1 3300050494 Bacteria 854
622 nmdc:mga04h51_38387_c1 3300050495 Bacteria 1551
623 nmdc:mga07m45_26904_c2 3300050496 Bacteria 2760
624 nmdc:mga07m45_375564_c1 3300050496 Bacteria 826
625 nmdc:mga07m45_619570_c1 3300050496 Bacteria 624
626 nmdc:mga0sz30_174166_c1 3300050516 Bacteria 954
627 nmdc:mga0sz30_17576_c2 3300050516 Bacteria 1648
628 nmdc:mga0sz30_271449_c1 3300050516 Bacteria 755
629 Ga0495619_0126977 3300053085 Bacteria 1751
630 Ga0500578_0188161 3300053086 Bacteria 1268
631 Ga0500578_0233289 3300053086 Bacteria 1114
632 Ga0500643_043370 3300053087 Bacteria 1312
633 Ga0500643_073048 3300053087 Bacteria 950
634 Ga0500583_0310640 3300053092 Bacteria 770
635 Ga0500651_0064859 3300053093 Bacteria 2277
636 Ga0500651_0096023 3300053093 Bacteria 1821
637 Ga0500641_0170765 3300053096 Bacteria 936
638 Ga0500557_063408 3300053105 Bacteria 1203
639 Ga0500560_000049 3300053107 Bacteria 11683
640 Ga0500562_061128 3300053108 Bacteria 1012
641 Ga0500569_004820 3300053109 Bacteria 2865
642 Ga0500572_000978 3300053111 Bacteria 8651
643 Ga0500594_0062570 3300053118 Bacteria 1076
644 Ga0500594_0107070 3300053118 Bacteria 866
645 Ga0500595_016597 3300053119 Bacteria 2738
646 Ga0500595_083161 3300053119 Bacteria 934
647 Ga0500607_177570 3300053121 Bacteria 949
648 Ga0500618_000125 3300053125 Bacteria 63168
649 Ga0500618_000289 3300053125 Bacteria 38453
650 Ga0500618_003300 3300053125 Bacteria 5599
651 Ga0500618_012009 3300053125 Bacteria 2279
652 Ga0500628_038501 3300053129 Bacteria 1080
653 Ga0500642_0099012 3300053130 Bacteria 1354
654 Ga0500658_0001913 3300053134 Bacteria 8158
655 Ga0500658_0452703 3300053134 Bacteria 584
656 Ga0500561_0000141 3300053137 Bacteria 14001
657 Ga0500568_0000411 3300053139 Bacteria 32773
658 Ga0500568_0001577 3300053139 Bacteria 14417
659 Ga0500573_0003547 3300053140 Bacteria 8085
660 Ga0500573_0076549 3300053140 Bacteria 1904
661 Ga0500577_0025801 3300053142 Bacteria 1993
662 Ga0500590_002241 3300053148 Bacteria 8467
663 Ga0500604_0030499 3300053151 Bacteria 1577
664 Ga0500616_0000661 3300053153 Bacteria 41050
665 Ga0500616_0013882 3300053153 Bacteria 4650
666 Ga0500620_260879 3300053155 Bacteria 573
667 Ga0500622_0000428 3300053156 Bacteria 39928
668 Ga0500624_000266 3300053157 Bacteria 18246
669 Ga0500624_072200 3300053157 Bacteria 676
670 Ga0500633_0003216 3300053160 Bacteria 3520
671 Ga0500634_0053147 3300053161 Bacteria 2174
672 Ga0500636_0000202 3300053177 Bacteria 32341
673 Ga0500636_0002748 3300053177 Bacteria 9799
674 Ga0500636_0202751 3300053177 Bacteria 1048
675 Ga0500611_050321 3300053727 Bacteria 952
676 Ga0501082_0398967 3300060353 Bacteria 1200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10687806 Ga0207648_106878062 120
2 3300041509 Ga0451843_1322506 Ga0451843_1322506_21_386 120
3 3300053155 Ga0500620_260879 Ga0500620_260879_187_552 120
4 3300049570 Ga0501033_1133102 Ga0501033_1133102_110_484 124
5 3300045051 Ga0451576_0000752 Ga0451576_0000752_58650_59087 129
6 3300005563 Ga0068855_100269142 Ga0068855_1002691422 134
7 3300009148 Ga0105243_11153790 Ga0105243_111537902 134
8 3300009174 Ga0105241_11943512 Ga0105241_119435121 134
9 3300014325 Ga0163163_11423371 Ga0163163_114233712 134
10 3300025949 Ga0207667_10225867 Ga0207667_102258672 134
11 3300028800 Ga0265338_10105959 Ga0265338_101059591 134
12 3300031240 Ga0265320_10012013 Ga0265320_100120135 134
13 3300031241 Ga0265325_10179200 Ga0265325_101792001 134
14 3300031711 Ga0265314_10011047 Ga0265314_100110476 134
15 3300042876 Ga0451577_0170953 Ga0451577_0170953_959_1366 134
16 3300044673 Ga0453683_0105549 Ga0453683_0105549_108_515 134
17 3300044673 Ga0453683_0677123 Ga0453683_0677123_11_418 134
18 3300044712 Ga0453684_0352126 Ga0453684_0352126_1002_1409 134
19 3300045051 Ga0451576_0016110 Ga0451576_0016110_6644_7051 134
20 3300045051 Ga0451576_0065534 Ga0451576_0065534_2706_3113 134
21 3300021441 Ga0213871_10204647 Ga0213871_102046471 135
22 3300005841 Ga0068863_100097227 Ga0068863_1000972275 138
23 3300026088 Ga0207641_10055424 Ga0207641_100554242 138
24 3300031251 Ga0265327_10038869 Ga0265327_100388693 138
25 3300003320 rootH2_10083074 rootH2_100830743 139
26 3300003578 Ga0006562J51391_1040093 Ga0006562J51391_10400932 139
27 3300003856 Ga0058692_1000954 Ga0058692_10009548 139
28 3300006177 Ga0075362_10027933 Ga0075362_100279333 139
29 3300006948 Ga0099826_10000103 Ga0099826_1000010339 139
30 3300027312 Ga0209371_1000058 Ga0209371_100005847 139
31 3300027666 Ga0209282_1000095 Ga0209282_100009516 139
32 3300030500 Ga0268256_1000056 Ga0268256_100005637 139
33 3300030745 Ga0316182_1233033 Ga0316182_12330332 139
34 3300039438 Ga0436360_0891092 Ga0436360_0891092_11_433 139
35 3300042136 Ga0450900_013192 Ga0450900_013192_43_477 139
36 3300048907 Ga0496104_0420617 Ga0496104_0420617_671_1105 139
37 3300048919 Ga0496116_0135199 Ga0496116_0135199_173_607 139
38 3300048920 Ga0496117_0317675 Ga0496117_0317675_31_465 139
39 3300048921 Ga0496118_0190656 Ga0496118_0190656_210_644 139
40 3300048922 Ga0496119_0009038 Ga0496119_0009038_6739_7173 139
41 3300048923 Ga0496120_0117643 Ga0496120_0117643_776_1210 139
42 3300048924 Ga0496121_0414040 Ga0496121_0414040_347_784 139
43 3300048927 Ga0496124_0264933 Ga0496124_0264933_625_1059 139
44 3300050489 nmdc:mga03683_16720_c2 nmdc:mga03683_16720_c2_767_1186 139
45 iso_pu_bacteria 2919450847 2919451089 139
46 iso_pu_bacteria 8001845381 8001848951 139
47 3300013100 Ga0157373_10594276 Ga0157373_105942762 140
48 iso_pu_bacteria 2537561587 2537876568 140
49 iso_pu_bacteria 2599185210 2599601356 140
50 iso_pu_bacteria 2643221568 2643855546 140
51 iso_pu_bacteria 2818991439 2819559699 140
52 iso_pu_bacteria 2828305725 2828305736 140
53 iso_pu_bacteria 2838714209 2838714987 140
54 iso_pu_bacteria 2838719591 2838721212 140
55 iso_pu_bacteria 2841846520 2841848170 140
56 iso_pu_bacteria 2842170452 2842171231 140
57 iso_pu_bacteria 2842187318 2842188096 140
58 iso_pu_bacteria 2842211629 2842212407 140
59 iso_pu_bacteria 2842224351 2842225974 140
60 iso_pu_bacteria 2889790730 2889794122 140
61 iso_pu_bacteria 2889914905 2889915877 140
62 iso_pu_bacteria 2919166419 2919167689 140
63 iso_pu_bacteria 2926754445 2926756043 140
64 iso_pu_bacteria 2933006813 2933008476 140
65 iso_pu_bacteria 2933011516 2933013291 140
66 iso_pu_bacteria 2978969890 2978974148 140
67 iso_pu_bacteria 2979100975 2979103606 140
68 iso_pu_bacteria 2984509177 2984511831 140
69 iso_pu_bacteria 2984518228 2984521809 140
70 iso_pu_bacteria 2984537506 2984541107 140
71 iso_pu_bacteria 2984587000 2984589475 140
72 iso_pu_bacteria 2984601300 2984603386 140
73 iso_pu_bacteria 8054460903 8054462800 140
74 iso_pu_bacteria 2510065019 2510133190 141
75 iso_pu_bacteria 2510461076 2510894556 141
76 iso_pu_bacteria 2510917028 2511183838 141
77 iso_pu_bacteria 2510917030 2511193357 141
78 iso_pu_bacteria 2513237084 2513572236 141
79 iso_pu_bacteria 2513237085 2513579605 141
80 iso_pu_bacteria 2513237093 2513634377 141
81 iso_pu_bacteria 2513237103 2513708847 141
82 iso_pu_bacteria 2513237138 2513866900 141
83 iso_pu_bacteria 2513237144 2513914022 141
84 iso_pu_bacteria 2513237146 2513926737 141
85 iso_pu_bacteria 2513237162 2514022813 141
86 iso_pu_bacteria 2515075009 2515112152 141
87 iso_pu_bacteria 2515154113 2515635619 141
88 iso_pu_bacteria 2515154114 2515646181 141
89 iso_pu_bacteria 2515154116 2515657295 141
90 iso_pu_bacteria 2515154134 2515738700 141
91 iso_pu_bacteria 2516653077 2517035886 141
92 iso_pu_bacteria 2516653085 2517076274 141
93 iso_pu_bacteria 2517093000 2517095031 141
94 iso_pu_bacteria 2519899620 2520379365 141
95 iso_pu_bacteria 2529292951 2530645409 141
96 iso_pu_bacteria 2534681796 2535516368 141
97 iso_pu_bacteria 2554235003 2554247831 141
98 iso_pu_bacteria 2558860242 2559294961 141
99 iso_pu_bacteria 2582581294 2585200054 141
100 iso_pu_bacteria 2582581298 2585224234 141
101 iso_pu_bacteria 2582581299 2585230172 141
102 iso_pu_bacteria 2582581304 2585254601 141
103 iso_pu_bacteria 2582581867 2585403554 141
104 iso_pu_bacteria 2585427526 2585529813 141
105 iso_pu_bacteria 2585427528 2585542337 141
106 iso_pu_bacteria 2585427529 2585546355 141
107 iso_pu_bacteria 2585427590 2585819478 141
108 iso_pu_bacteria 2585427593 2585838828 141
109 iso_pu_bacteria 2585427594 2585845867 141
110 iso_pu_bacteria 2585427633 2585995933 141
111 iso_pu_bacteria 2585427634 2586000501 141
112 iso_pu_bacteria 2599185170 2599417837 141
113 iso_pu_bacteria 2599185236 2599720915 141
114 iso_pu_bacteria 2600254933 2600375754 141
115 iso_pu_bacteria 2615840624 2616292581 141
116 iso_pu_bacteria 2643221558 2643811973 141
117 iso_pu_bacteria 2643221582 2643919455 141
118 iso_pu_bacteria 2643221599 2644005813 141
119 iso_pu_bacteria 2643221634 2644193040 141
120 iso_pu_bacteria 2643221643 2644239471 141
121 iso_pu_bacteria 2643221693 2644522357 141
122 iso_pu_bacteria 2718217882 2719181058 141
123 iso_pu_bacteria 2718217997 2719665492 141
124 iso_pu_bacteria 2718218009 2719731807 141
125 iso_pu_bacteria 2718218199 2720491912 141
126 iso_pu_bacteria 2718218232 2720613179 141
127 iso_pu_bacteria 2718218233 2720620034 141
128 iso_pu_bacteria 2718218235 2720631459 141
129 iso_pu_bacteria 2718218269 2720775187 141
130 iso_pu_bacteria 2718218363 2721147152 141
131 iso_pu_bacteria 2718218365 2721158686 141
132 iso_pu_bacteria 2718218366 2721164070 141
133 iso_pu_bacteria 2721755514 2722840240 141
134 iso_pu_bacteria 2721755556 2723026824 141
135 iso_pu_bacteria 2721755684 2723560441 141
136 iso_pu_bacteria 2721755685 2723567006 141
137 iso_pu_bacteria 2721755810 2724044563 141
138 iso_pu_bacteria 2721755819 2724089794 141
139 iso_pu_bacteria 2721755822 2724104271 141
140 iso_pu_bacteria 2721755823 2724110086 141
141 iso_pu_bacteria 2728369352 2730107760 141
142 iso_pu_bacteria 2728369365 2730164295 141
143 iso_pu_bacteria 2728369397 2730298318 141
144 iso_pu_bacteria 2738541293 2738799057 141
145 iso_pu_bacteria 2738541333 2739038115 141
146 iso_pu_bacteria 2765235942 2766063050 141
147 iso_pu_bacteria 2791355256 2793298150 141
148 iso_pu_bacteria 2791355260 2793322151 141
149 iso_pu_bacteria 2791355261 2793326554 141
150 iso_pu_bacteria 2791355262 2793337225 141
151 iso_pu_bacteria 2791355264 2793350470 141
152 iso_pu_bacteria 2791355265 2793352501 141
153 iso_pu_bacteria 2791355266 2793361287 141
154 iso_pu_bacteria 2791355267 2793369554 141
155 iso_pu_bacteria 2802429605 2805931060 141
156 iso_pu_bacteria 2802429606 2805938097 141
157 iso_pu_bacteria 2802429633 2806047927 141
158 iso_pu_bacteria 2802429634 2806056322 141
159 iso_pu_bacteria 2802429635 2806061609 141
160 iso_pu_bacteria 2802429636 2806070116 141
161 iso_pu_bacteria 2802429637 2806072493 141
162 iso_pu_bacteria 2808606387 2808985268 141
163 iso_pu_bacteria 2818991461 2819688621 141
164 iso_pu_bacteria 2821123053 2821127769 141
165 iso_pu_bacteria 2838016132 2838021031 141
166 iso_pu_bacteria 2838022645 2838027975 141
167 iso_pu_bacteria 2838035591 2838041657 141
168 iso_pu_bacteria 2838042994 2838043308 141
169 iso_pu_bacteria 2838048938 2838052543 141
170 iso_pu_bacteria 2838061910 2838066069 141
171 iso_pu_bacteria 2838068647 2838071593 141
172 iso_pu_bacteria 2838661181 2838666382 141
173 iso_pu_bacteria 2838668709 2838673992 141
174 iso_pu_bacteria 2838680041 2838682347 141
175 iso_pu_bacteria 2838686498 2838689365 141
176 iso_pu_bacteria 2838694306 2838696918 141
177 iso_pu_bacteria 2838701080 2838706370 141
178 iso_pu_bacteria 2838707686 2838709841 141
179 iso_pu_bacteria 2838729681 2838730698 141
180 iso_pu_bacteria 2838736955 2838738193 141
181 iso_pu_bacteria 2838742623 2838743639 141
182 iso_pu_bacteria 2841840854 2841841437 141
183 iso_pu_bacteria 2841851746 2841854685 141
184 iso_pu_bacteria 2842077413 2842078015 141
185 iso_pu_bacteria 2842110456 2842110623 141
186 iso_pu_bacteria 2842118031 2842119477 141
187 iso_pu_bacteria 2842140634 2842141215 141
188 iso_pu_bacteria 2842146304 2842148704 141
189 iso_pu_bacteria 2842156927 2842157548 141
190 iso_pu_bacteria 2842163707 2842164740 141
191 iso_pu_bacteria 2842180545 2842180867 141
192 iso_pu_bacteria 2842192696 2842196750 141
193 iso_pu_bacteria 2842198810 2842203869 141
194 iso_pu_bacteria 2842205361 2842206173 141
195 iso_pu_bacteria 2842217011 2842217106 141
196 iso_pu_bacteria 2842229732 2842231075 141
197 iso_pu_bacteria 2842237096 2842239254 141
198 iso_pu_bacteria 2842243621 2842244818 141
199 iso_pu_bacteria 2842250916 2842256110 141
200 iso_pu_bacteria 2842257432 2842258631 141
201 iso_pu_bacteria 2842264693 2842268156 141
202 iso_pu_bacteria 2842271015 2842273385 141
203 iso_pu_bacteria 2842278818 2842279630 141
204 iso_pu_bacteria 2842285085 2842286271 141
205 iso_pu_bacteria 2842291075 2842291678 141
206 iso_pu_bacteria 2842304105 2842304162 141
207 iso_pu_bacteria 2842311132 2842313793 141
208 iso_pu_bacteria 2842317721 2842318044 141
209 iso_pu_bacteria 2842363717 2842364414 141
210 iso_pu_bacteria 2842370503 2842372913 141
211 iso_pu_bacteria 2842377471 2842378074 141
212 iso_pu_bacteria 2842384541 2842385985 141
213 iso_pu_bacteria 2842402390 2842408012 141
214 iso_pu_bacteria 2842409023 2842414773 141
215 iso_pu_bacteria 2842415677 2842421344 141
216 iso_pu_bacteria 2842422224 2842424749 141
217 iso_pu_bacteria 2842428310 2842431609 141
218 iso_pu_bacteria 2842434925 2842438431 141
219 iso_pu_bacteria 2842441272 2842445061 141
220 iso_pu_bacteria 2842447887 2842452376 141
221 iso_pu_bacteria 2842462802 2842465981 141
222 iso_pu_bacteria 2842469257 2842473046 141
223 iso_pu_bacteria 2842489311 2842492991 141
224 iso_pu_bacteria 2842495871 2842496314 141
225 iso_pu_bacteria 2844454524 2844459295 141
226 iso_pu_bacteria 2854896431 2854899305 141
227 iso_pu_bacteria 2854916844 2854919261 141
228 iso_pu_bacteria 2857516855 2857518593 141
229 iso_pu_bacteria 2857531043 2857534490 141
230 iso_pu_bacteria 2891373044 2891374386 141
231 iso_pu_bacteria 2899803654 2899804791 141
232 iso_pu_bacteria 2899845264 2899846458 141
233 iso_pu_bacteria 2919100787 2919106955 141
234 iso_pu_bacteria 2919171160 2919175029 141
235 iso_pu_bacteria 2923556063 2923557805 141
236 iso_pu_bacteria 2926760298 2926760359 141
237 iso_pu_bacteria 2929138655 2929140553 141
238 iso_pu_bacteria 2933016740 2933016881 141
239 iso_pu_bacteria 2933570622 2933571441 141
240 iso_pu_bacteria 2933586486 2933586649 141
241 iso_pu_bacteria 2933599457 2933602392 141
242 iso_pu_bacteria 2935894831 2935897227 141
243 iso_pu_bacteria 2935901341 2935904613 141
244 iso_pu_bacteria 2936367885 2936372850 141
245 iso_pu_bacteria 2979089926 2979094363 141
246 iso_pu_bacteria 2979095461 2979098254 141
247 iso_pu_bacteria 2989349275 2989353181 141
248 iso_pu_bacteria 2996887358 2996890005 141
249 iso_pu_bacteria 3005445848 3005447397 141
250 iso_pu_bacteria 3005452660 3005454007 141
251 iso_pu_bacteria 639633055 639648419 141
252 iso_pu_bacteria 650716007 650740220 141
253 iso_pu_bacteria 8003570095 8003571283 141
254 iso_pu_bacteria 8005258706 8005261725 141
255 iso_pu_bacteria 8005282627 8005285667 141
256 iso_pu_bacteria 8005289223 8005290724 141
257 iso_pu_bacteria 8005301065 8005302276 141
258 iso_pu_bacteria 8005307578 8005314401 141
259 iso_pu_bacteria 8005321885 8005324532 141
260 iso_pu_bacteria 8005376324 8005379067 141
261 iso_pu_bacteria 8005382845 8005388210 141
262 iso_pu_bacteria 8005395548 8005397264 141
263 iso_pu_bacteria 8005430974 8005433619 141
264 iso_pu_bacteria 8005460587 8005462812 141
265 iso_pu_bacteria 8005497431 8005500213 141
266 iso_pu_bacteria 8005542996 8005545018 141
267 iso_pu_bacteria 8005556819 8005557844 141
268 iso_pu_bacteria 8005563573 8005569016 141
269 iso_pu_bacteria 8005570704 8005572155 141
270 iso_pu_bacteria 8005619151 8005621505 141
271 iso_pu_bacteria 8005626139 8005631150 141
272 iso_pu_bacteria 8005668836 8005671629 141
273 iso_pu_bacteria 8005688590 8005689849 141
274 iso_pu_bacteria 8018127388 8018129789 141
275 iso_pu_bacteria 8018150411 8018155515 141
276 iso_pu_bacteria 8018163183 8018166929 141
277 iso_pu_bacteria 8023680758 8023685522 141
278 iso_pu_bacteria 8024479707 8024482169 141
279 iso_pu_bacteria 8024501048 8024506733 141
280 iso_pu_bacteria 8056375014 8056377302 141
281 iso_pu_bacteria 8056382006 8056388216 141
282 iso_pu_bacteria 8056875544 8056877581 141
283 iso_pu_bacteria 8057874678 8057875194 141
284 3300005937 Ga0081455_10016377 Ga0081455_100163775 143
285 3300025933 Ga0207706_10787589 Ga0207706_107875892 143
286 3300031727 Ga0316576_10059041 Ga0316576_100590414 143
287 3300031728 Ga0316578_10005669 Ga0316578_100056694 143
288 3300035398 Ga0316574_0000978 Ga0316574_0000978_3232_3678 143
289 3300036712 Ga0316584_0270665 Ga0316584_0270665_135_581 143
290 3300041498 Ga0451841_1220323 Ga0451841_1220323_15_446 143
291 3300046460 Ga0495638_0451292 Ga0495638_0451292_75_548 143
292 3300053727 Ga0500611_050321 Ga0500611_050321_179_652 143
293 3300003187 JGI25151J46595_10140627 JGI25151J46595_101406271 144
294 3300003856 Ga0058692_1000424 Ga0058692_100042416 144
295 3300006038 Ga0075365_10154341 Ga0075365_101543412 144
296 3300006051 Ga0075364_10394792 Ga0075364_103947922 144
297 3300006051 Ga0075364_10575475 Ga0075364_105754752 144
298 3300006178 Ga0075367_10501875 Ga0075367_105018752 144
299 3300006186 Ga0075369_10028406 Ga0075369_100284063 144
300 3300011119 Ga0105246_11803613 Ga0105246_118036131 144
301 3300013102 Ga0157371_10041317 Ga0157371_100413172 144
302 3300021384 Ga0213876_10221343 Ga0213876_102213432 144
303 3300021441 Ga0213871_10182512 Ga0213871_101825121 144
304 3300025294 Ga0209025_1001860 Ga0209025_100186023 144
305 3300027312 Ga0209371_1000904 Ga0209371_100090416 144
306 3300030500 Ga0268256_1004374 Ga0268256_10043745 144
307 3300035692 Ga0373935_0035232 Ga0373935_0035232_530_982 144
308 3300037068 Ga0373925_0008671 Ga0373925_0008671_3023_3475 144
309 3300039437 Ga0436365_1716423 Ga0436365_1716423_434_868 144
310 3300039438 Ga0436360_0668397 Ga0436360_0668397_817_1254 144
311 3300039438 Ga0436360_0772974 Ga0436360_0772974_370_807 144
312 3300042136 Ga0450900_051686 Ga0450900_051686_184_618 144
313 3300048919 Ga0496116_0000043 Ga0496116_0000043_221082_221516 144
314 3300048921 Ga0496118_0055781 Ga0496118_0055781_1903_2337 144
315 3300048922 Ga0496119_0291363 Ga0496119_0291363_223_657 144
316 3300048925 Ga0496122_0200130 Ga0496122_0200130_638_1072 144
317 3300048927 Ga0496124_0000377 Ga0496124_0000377_26844_27278 144
318 3300048927 Ga0496124_0241109 Ga0496124_0241109_14_448 144
319 3300048929 Ga0496126_0000362 Ga0496126_0000362_26045_26479 144
320 3300049578 Ga0501042_0296666 Ga0501042_0296666_190_711 144
321 3300050491 nmdc:mga00v17_725615_c1 nmdc:mga00v17_725615_c1_37_471 144
322 3300050492 nmdc:mga0yw44_30132_c1 nmdc:mga0yw44_30132_c1_10_444 144
323 3300050494 nmdc:mga06z11_375383_c1 nmdc:mga06z11_375383_c1_126_560 144
324 3300050516 nmdc:mga0sz30_174166_c1 nmdc:mga0sz30_174166_c1_214_648 144
325 3300053111 Ga0500572_000978 Ga0500572_000978_2840_3274 144
326 3300053177 Ga0500636_0000202 Ga0500636_0000202_11879_12313 144
327 3300053177 Ga0500636_0002748 Ga0500636_0002748_395_829 144
328 3300002739 JGI25158J39367_1000033 JGI25158J39367_100003328 145
329 3300002773 JGI25152J39213_1000526 JGI25152J39213_10005262 145
330 3300002773 JGI25152J39213_1004775 JGI25152J39213_10047753 145
331 3300002773 JGI25152J39213_1005934 JGI25152J39213_10059341 145
332 3300002773 JGI25152J39213_1008818 JGI25152J39213_10088182 145
333 3300002773 JGI25152J39213_1011566 JGI25152J39213_10115661 145
334 3300002773 JGI25152J39213_1011567 JGI25152J39213_10115672 145
335 3300002774 JGI25150J39212_1000010 JGI25150J39212_1000010115 145
336 3300002774 JGI25150J39212_1002491 JGI25150J39212_10024913 145
337 3300002987 JGI25159J45721_1002570 JGI25159J45721_10025704 145
338 3300003187 JGI25151J46595_10000026 JGI25151J46595_1000002695 145
339 3300003187 JGI25151J46595_10000942 JGI25151J46595_1000094218 145
340 3300003187 JGI25151J46595_10004710 JGI25151J46595_100047105 145
341 3300003187 JGI25151J46595_10011116 JGI25151J46595_100111163 145
342 3300003187 JGI25151J46595_10069449 JGI25151J46595_100694492 145
343 3300003215 JGI25153J46596_10003998 JGI25153J46596_100039985 145
344 3300003215 JGI25153J46596_10009882 JGI25153J46596_100098823 145
345 3300003215 JGI25153J46596_10028302 JGI25153J46596_100283021 145
346 3300003215 JGI25153J46596_10028308 JGI25153J46596_100283081 145
347 3300003215 JGI25153J46596_10045921 JGI25153J46596_100459211 145
348 3300003215 JGI25153J46596_10051881 JGI25153J46596_100518811 145
349 3300003215 JGI25153J46596_10113137 JGI25153J46596_101131371 145
350 3300003316 rootH1_10018254 rootH1_100182544 145
351 3300003323 rootH1_10209458 rootH1_102094583 145
352 3300003354 JGI25160J50197_1002155 JGI25160J50197_10021553 145
353 3300003354 JGI25160J50197_1060657 JGI25160J50197_10606572 145
354 3300003374 JGI25161J50226_1000285 JGI25161J50226_10002858 145
355 3300003374 JGI25161J50226_1000346 JGI25161J50226_100034618 145
356 3300003374 JGI25161J50226_1001041 JGI25161J50226_10010413 145
357 3300003771 Ga0055526_1001677 Ga0055526_10016775 145
358 3300003771 Ga0055526_1008048 Ga0055526_10080483 145
359 3300003771 Ga0055526_1012169 Ga0055526_10121691 145
360 3300003771 Ga0055526_1026624 Ga0055526_10266241 145
361 3300003771 Ga0055526_1053312 Ga0055526_10533121 145
362 3300003775 Ga0055524_1002383 Ga0055524_10023835 145
363 3300003775 Ga0055524_1005290 Ga0055524_10052903 145
364 3300003775 Ga0055524_1008069 Ga0055524_10080692 145
365 3300003775 Ga0055524_1008900 Ga0055524_10089004 145
366 3300003775 Ga0055524_1035651 Ga0055524_10356511 145
367 3300003781 Ga0055536_1011865 Ga0055536_10118654 145
368 3300003790 Ga0055528_1000851 Ga0055528_100085120 145
369 3300003790 Ga0055528_1001075 Ga0055528_10010753 145
370 3300003790 Ga0055528_1001905 Ga0055528_100190511 145
371 3300003790 Ga0055528_1014016 Ga0055528_10140164 145
372 3300003791 Ga0055530_10020414 Ga0055530_100204142 145
373 3300003792 Ga0055540_1000620 Ga0055540_100062020 145
374 3300003792 Ga0055540_1001108 Ga0055540_100110811 145
375 3300003792 Ga0055540_1002555 Ga0055540_10025553 145
376 3300003792 Ga0055540_1013077 Ga0055540_10130772 145
377 3300003792 Ga0055540_1018768 Ga0055540_10187683 145
378 3300003794 Ga0055531_10005313 Ga0055531_100053135 145
379 3300004625 Ga0055543_1000032 Ga0055543_100003245 145
380 3300004625 Ga0055543_1000507 Ga0055543_10005074 145
381 3300005262 Ga0065165_1003516 Ga0065165_10035164 145
382 3300005262 Ga0065165_1009353 Ga0065165_10093531 145
383 3300005262 Ga0065165_1024876 Ga0065165_10248762 145
384 3300005331 Ga0070670_100038746 Ga0070670_1000387465 145
385 3300005339 Ga0070660_100201442 Ga0070660_1002014422 145
386 3300005339 Ga0070660_100651878 Ga0070660_1006518782 145
387 3300005347 Ga0070668_100771571 Ga0070668_1007715712 145
388 3300005347 Ga0070668_100837491 Ga0070668_1008374911 145
389 3300005353 Ga0070669_100062353 Ga0070669_1000623532 145
390 3300005353 Ga0070669_100073137 Ga0070669_1000731373 145
391 3300005366 Ga0070659_100530984 Ga0070659_1005309841 145
392 3300005436 Ga0070713_100083761 Ga0070713_1000837612 145
393 3300005437 Ga0070710_10114578 Ga0070710_101145782 145
394 3300005437 Ga0070710_10383778 Ga0070710_103837782 145
395 3300005456 Ga0070678_100178951 Ga0070678_1001789511 145
396 3300005457 Ga0070662_100619462 Ga0070662_1006194622 145
397 3300005458 Ga0070681_10117048 Ga0070681_101170482 145
398 3300005530 Ga0070679_100185033 Ga0070679_1001850333 145
399 3300005539 Ga0068853_100036646 Ga0068853_1000366462 145
400 3300005548 Ga0070665_100012992 Ga0070665_1000129925 145
401 3300005548 Ga0070665_100263110 Ga0070665_1002631102 145
402 3300005563 Ga0068855_100247060 Ga0068855_1002470602 145
403 3300005577 Ga0068857_100437125 Ga0068857_1004371252 145
404 3300005616 Ga0068852_100574031 Ga0068852_1005740311 145
405 3300005981 Ga0081538_10064338 Ga0081538_100643382 145
406 3300005983 Ga0081540_1025775 Ga0081540_10257754 145
407 3300006038 Ga0075365_10004225 Ga0075365_100042252 145
408 3300006038 Ga0075365_10006168 Ga0075365_100061686 145
409 3300006038 Ga0075365_10275338 Ga0075365_102753382 145
410 3300006042 Ga0075368_10017047 Ga0075368_100170474 145
411 3300006042 Ga0075368_10162980 Ga0075368_101629802 145
412 3300006048 Ga0075363_100511895 Ga0075363_1005118952 145
413 3300006051 Ga0075364_10000170 Ga0075364_100001703 145
414 3300006051 Ga0075364_10232346 Ga0075364_102323462 145
415 3300006051 Ga0075364_10337542 Ga0075364_103375422 145
416 3300006051 Ga0075364_10362265 Ga0075364_103622652 145
417 3300006051 Ga0075364_10795008 Ga0075364_107950081 145
418 3300006173 Ga0070716_100431425 Ga0070716_1004314252 145
419 3300006175 Ga0070712_100362024 Ga0070712_1003620242 145
420 3300006177 Ga0075362_10000803 Ga0075362_100008036 145
421 3300006177 Ga0075362_10010765 Ga0075362_100107652 145
422 3300006178 Ga0075367_10001565 Ga0075367_100015655 145
423 3300006178 Ga0075367_10005669 Ga0075367_100056692 145
424 3300006178 Ga0075367_10019031 Ga0075367_100190313 145
425 3300006186 Ga0075369_10000650 Ga0075369_100006504 145
426 3300006186 Ga0075369_10151567 Ga0075369_101515672 145
427 3300006186 Ga0075369_10305039 Ga0075369_103050392 145
428 3300006195 Ga0075366_10451194 Ga0075366_104511942 145
429 3300006353 Ga0075370_10040386 Ga0075370_100403863 145
430 3300006353 Ga0075370_10670238 Ga0075370_106702381 145
431 3300006946 Ga0079104_1000209 Ga0079104_100020967 145
432 3300009093 Ga0105240_10899515 Ga0105240_108995152 145
433 3300009148 Ga0105243_10124642 Ga0105243_101246424 145
434 3300009177 Ga0105248_10908857 Ga0105248_109088572 145
435 3300009545 Ga0105237_10067121 Ga0105237_100671213 145
436 3300009551 Ga0105238_10282255 Ga0105238_102822551 145
437 3300009551 Ga0105238_11232641 Ga0105238_112326412 145
438 3300009763 Ga0123340_1081144 Ga0123340_10811442 145
439 3300009765 Ga0123341_1001018 Ga0123341_100101817 145
440 3300009765 Ga0123341_1032179 Ga0123341_10321793 145
441 3300009766 Ga0123342_1036935 Ga0123342_10369352 145
442 3300010375 Ga0105239_10699119 Ga0105239_106991191 145
443 3300012497 Ga0157319_1001870 Ga0157319_10018702 145
444 3300013100 Ga0157373_10012025 Ga0157373_100120252 145
445 3300013100 Ga0157373_10040944 Ga0157373_100409443 145
446 3300013102 Ga0157371_10000015 Ga0157371_10000015276 145
447 3300013104 Ga0157370_10000309 Ga0157370_1000030915 145
448 3300013104 Ga0157370_10083084 Ga0157370_100830842 145
449 3300013104 Ga0157370_10227534 Ga0157370_102275343 145
450 3300013105 Ga0157369_10026552 Ga0157369_100265526 145
451 3300014325 Ga0163163_11926299 Ga0163163_119262991 145
452 3300021361 Ga0213872_10119664 Ga0213872_101196642 145
453 3300021377 Ga0213874_10018750 Ga0213874_100187502 145
454 3300021384 Ga0213876_10051446 Ga0213876_100514463 145
455 3300025208 Ga0209436_100001 Ga0209436_10000144 145
456 3300025245 Ga0207425_1000010 Ga0207425_1000010444 145
457 3300025245 Ga0207425_1000826 Ga0207425_100082615 145
458 3300025245 Ga0207425_1011745 Ga0207425_10117452 145
459 3300025258 Ga0209129_1000099 Ga0209129_100009958 145
460 3300025258 Ga0209129_1000580 Ga0209129_100058018 145
461 3300025258 Ga0209129_1000593 Ga0209129_100059325 145
462 3300025258 Ga0209129_1001147 Ga0209129_100114718 145
463 3300025258 Ga0209129_1002836 Ga0209129_10028367 145
464 3300025258 Ga0209129_1004971 Ga0209129_10049712 145
465 3300025258 Ga0209129_1007616 Ga0209129_10076164 145
466 3300025263 Ga0209565_1021755 Ga0209565_10217551 145
467 3300025273 Ga0209673_1000013 Ga0209673_1000013558 145
468 3300025273 Ga0209673_1000048 Ga0209673_100004863 145
469 3300025273 Ga0209673_1000841 Ga0209673_100084116 145
470 3300025273 Ga0209673_1001196 Ga0209673_100119616 145
471 3300025273 Ga0209673_1001233 Ga0209673_100123316 145
472 3300025273 Ga0209673_1001920 Ga0209673_10019203 145
473 3300025273 Ga0209673_1007723 Ga0209673_10077232 145
474 3300025273 Ga0209673_1009029 Ga0209673_10090293 145
475 3300025273 Ga0209673_1011162 Ga0209673_10111623 145
476 3300025273 Ga0209673_1054429 Ga0209673_10544293 145
477 3300025284 Ga0209130_1000004 Ga0209130_100000468 145
478 3300025284 Ga0209130_1008084 Ga0209130_10080843 145
479 3300025284 Ga0209130_1026826 Ga0209130_10268263 145
480 3300025284 Ga0209130_1032942 Ga0209130_10329422 145
481 3300025291 Ga0209675_1025138 Ga0209675_10251382 145
482 3300025292 Ga0209676_1001764 Ga0209676_100176416 145
483 3300025292 Ga0209676_1030148 Ga0209676_10301482 145
484 3300025294 Ga0209025_1000022 Ga0209025_1000022139 145
485 3300025294 Ga0209025_1000787 Ga0209025_100078737 145
486 3300025294 Ga0209025_1001289 Ga0209025_100128921 145
487 3300025294 Ga0209025_1002946 Ga0209025_100294612 145
488 3300025294 Ga0209025_1007031 Ga0209025_100703110 145
489 3300025294 Ga0209025_1017404 Ga0209025_10174041 145
490 3300025294 Ga0209025_1018065 Ga0209025_10180654 145
491 3300025294 Ga0209025_1024099 Ga0209025_10240992 145
492 3300025295 Ga0209564_1000566 Ga0209564_100056633 145
493 3300025295 Ga0209564_1000906 Ga0209564_100090631 145
494 3300025295 Ga0209564_1004549 Ga0209564_10045494 145
495 3300025295 Ga0209564_1007058 Ga0209564_10070584 145
496 3300025295 Ga0209564_1019336 Ga0209564_10193363 145
497 3300025297 Ga0209758_1000086 Ga0209758_1000086120 145
498 3300025297 Ga0209758_1000821 Ga0209758_100082130 145
499 3300025297 Ga0209758_1000977 Ga0209758_100097725 145
500 3300025297 Ga0209758_1001150 Ga0209758_100115042 145
501 3300025297 Ga0209758_1001420 Ga0209758_100142026 145
502 3300025297 Ga0209758_1005307 Ga0209758_100530710 145
503 3300025297 Ga0209758_1012058 Ga0209758_10120584 145
504 3300025297 Ga0209758_1072740 Ga0209758_10727402 145
505 3300025297 Ga0209758_1132444 Ga0209758_11324442 145
506 3300025298 Ga0209050_1001733 Ga0209050_10017335 145
507 3300025298 Ga0209050_1048154 Ga0209050_10481542 145
508 3300025299 Ga0209256_1000947 Ga0209256_10009478 145
509 3300025299 Ga0209256_1001331 Ga0209256_100133116 145
510 3300025299 Ga0209256_1002910 Ga0209256_10029103 145
511 3300025299 Ga0209256_1009756 Ga0209256_10097565 145
512 3300025299 Ga0209256_1019473 Ga0209256_10194732 145
513 3300025299 Ga0209256_1035721 Ga0209256_10357212 145
514 3300025302 Ga0207426_1000003 Ga0207426_1000003660 145
515 3300025302 Ga0207426_1000427 Ga0207426_100042718 145
516 3300025302 Ga0207426_1003684 Ga0207426_10036844 145
517 3300025303 Ga0209051_1000125 Ga0209051_1000125131 145
518 3300025303 Ga0209051_1001061 Ga0209051_100106116 145
519 3300025303 Ga0209051_1002163 Ga0209051_100216311 145
520 3300025303 Ga0209051_1014843 Ga0209051_10148433 145
521 3300025303 Ga0209051_1149955 Ga0209051_11499551 145
522 3300025304 Ga0209257_1001014 Ga0209257_100101432 145
523 3300025304 Ga0209257_1001705 Ga0209257_10017056 145
524 3300025304 Ga0209257_1065890 Ga0209257_10658902 145
525 3300025904 Ga0207647_10032694 Ga0207647_100326942 145
526 3300025909 Ga0207705_10366009 Ga0207705_103660092 145
527 3300025909 Ga0207705_10530484 Ga0207705_105304842 145
528 3300025915 Ga0207693_10038062 Ga0207693_100380622 145
529 3300025917 Ga0207660_10093030 Ga0207660_100930302 145
530 3300025919 Ga0207657_10002501 Ga0207657_100025019 145
531 3300025919 Ga0207657_10493979 Ga0207657_104939792 145
532 3300025921 Ga0207652_10531851 Ga0207652_105318512 145
533 3300025923 Ga0207681_10301986 Ga0207681_103019862 145
534 3300025923 Ga0207681_10343899 Ga0207681_103438992 145
535 3300025925 Ga0207650_10026479 Ga0207650_100264795 145
536 3300025929 Ga0207664_10781767 Ga0207664_107817671 145
537 3300025935 Ga0207709_10182291 Ga0207709_101822911 145
538 3300025935 Ga0207709_10890427 Ga0207709_108904272 145
539 3300025941 Ga0207711_10780460 Ga0207711_107804602 145
540 3300025972 Ga0207668_10236653 Ga0207668_102366532 145
541 3300025972 Ga0207668_10882044 Ga0207668_108820442 145
542 3300026067 Ga0207678_10403505 Ga0207678_104035052 145
543 3300026121 Ga0207683_10216327 Ga0207683_102163273 145
544 3300027111 Ga0209281_1000580 Ga0209281_100058018 145
545 3300027866 Ga0209813_10023353 Ga0209813_100233533 145
546 3300028379 Ga0268266_10083220 Ga0268266_100832202 145
547 3300028379 Ga0268266_10126895 Ga0268266_101268953 145
548 3300028379 Ga0268266_11138298 Ga0268266_111382982 145
549 3300028380 Ga0268265_10340830 Ga0268265_103408303 145
550 3300028794 Ga0307515_10001393 Ga0307515_1000139317 145
551 3300028794 Ga0307515_10004439 Ga0307515_1000443925 145
552 3300028794 Ga0307515_10072377 Ga0307515_100723775 145
553 3300031247 Ga0265340_10350755 Ga0265340_103507551 145
554 3300031456 Ga0307513_10024524 Ga0307513_100245242 145
555 3300031548 Ga0307408_100020868 Ga0307408_1000208685 145
556 3300031711 Ga0265314_10211308 Ga0265314_102113082 145
557 3300031730 Ga0307516_10359782 Ga0307516_103597822 145
558 3300031731 Ga0307405_10021745 Ga0307405_100217454 145
559 3300031901 Ga0307406_10019146 Ga0307406_100191463 145
560 3300031911 Ga0307412_10002546 Ga0307412_100025464 145
561 3300032002 Ga0307416_100194009 Ga0307416_1001940092 145
562 3300033180 Ga0307510_10196832 Ga0307510_101968322 145
563 3300035092 Ga0373952_0224739 Ga0373952_0224739_38_475 145
564 3300037312 Ga0395899_0350773 Ga0395899_0350773_131_568 145
565 3300037418 Ga0395900_0132273 Ga0395900_0132273_1012_1449 145
566 3300038443 Ga0395901_0056893 Ga0395901_0056893_878_1315 145
567 3300038443 Ga0395901_0277390 Ga0395901_0277390_456_893 145
568 3300039438 Ga0436360_0672973 Ga0436360_0672973_355_792 145
569 3300039438 Ga0436360_0726396 Ga0436360_0726396_125_595 145
570 3300039438 Ga0436360_0966143 Ga0436360_0966143_926_1363 145
571 3300039438 Ga0436360_1263519 Ga0436360_1263519_248_688 145
572 3300039438 Ga0436360_1279400 Ga0436360_1279400_283_720 145
573 3300039438 Ga0436360_1280006 Ga0436360_1280006_218_655 145
574 3300039438 Ga0436360_1349174 Ga0436360_1349174_11_454 145
575 3300039447 Ga0436361_0056445 Ga0436361_0056445_552_989 145
576 3300039447 Ga0436361_0195628 Ga0436361_0195628_167_604 145
577 3300039447 Ga0436361_0504000 Ga0436361_0504000_27_464 145
578 3300039447 Ga0436361_1066451 Ga0436361_1066451_237_677 145
579 3300039447 Ga0436361_1131419 Ga0436361_1131419_841_1278 145
580 3300039453 Ga0436362_1271493 Ga0436362_1271493_42_485 145
581 3300039453 Ga0436362_1294587 Ga0436362_1294587_1231_1668 145
582 3300041404 Ga0439436_0061624 Ga0439436_0061624_351_788 145
583 3300041405 Ga0439438_064870 Ga0439438_064870_139_576 145
584 3300041411 Ga0439466_0186910 Ga0439466_0186910_125_598 145
585 3300041413 Ga0439465_0002039 Ga0439465_0002039_1924_2397 145
586 3300041413 Ga0439465_0014447 Ga0439465_0014447_739_1176 145
587 3300041413 Ga0439465_0062128 Ga0439465_0062128_685_1122 145
588 3300041413 Ga0439465_0096782 Ga0439465_0096782_121_597 145
589 3300041441 Ga0451787_483819 Ga0451787_483819_51_530 145
590 3300041443 Ga0451789_0132731 Ga0451789_0132731_280_759 145
591 3300041451 Ga0451791_0446157 Ga0451791_0446157_784_1221 145
592 3300041453 Ga0451797_0099719 Ga0451797_0099719_21_500 145
593 3300041460 Ga0451802_0003539 Ga0451802_0003539_94_531 145
594 3300041463 Ga0451804_0654900 Ga0451804_0654900_532_1011 145
595 3300041491 Ga0451833_0487316 Ga0451833_0487316_1312_1791 145
596 3300041491 Ga0451833_0973106 Ga0451833_0973106_1192_1671 145
597 3300041492 Ga0451835_0582272 Ga0451835_0582272_574_1053 145
598 3300041494 Ga0451837_0252729 Ga0451837_0252729_38_517 145
599 3300041494 Ga0451837_1669237 Ga0451837_1669237_1103_1582 145
600 3300041496 Ga0451839_0052569 Ga0451839_0052569_1460_1897 145
601 3300041496 Ga0451839_0226926 Ga0451839_0226926_757_1236 145
602 3300041496 Ga0451839_1053254 Ga0451839_1053254_257_694 145
603 3300041498 Ga0451841_0507248 Ga0451841_0507248_531_1010 145
604 3300041501 Ga0451845_0011679 Ga0451845_0011679_3292_3771 145
605 3300041503 Ga0451847_0191909 Ga0451847_0191909_314_793 145
606 3300041503 Ga0451847_1000258 Ga0451847_1000258_275_754 145
607 3300041505 Ga0451849_0371999 Ga0451849_0371999_443_880 145
608 3300041506 Ga0451850_01285 Ga0451850_01285_38_475 145
609 3300041507 Ga0451851_0136593 Ga0451851_0136593_1434_1913 145
610 3300041509 Ga0451843_0529508 Ga0451843_0529508_2583_3020 145
611 3300041510 Ga0451854_37769 Ga0451854_37769_61_540 145
612 3300041512 Ga0451853_1427546 Ga0451853_1427546_52_489 145
613 3300041512 Ga0451853_3057193 Ga0451853_3057193_52_531 145
614 3300042006 Ga0439432_094870 Ga0439432_094870_54_527 145
615 3300042007 Ga0439449_0044732 Ga0439449_0044732_445_918 145
616 3300042007 Ga0439449_0164469 Ga0439449_0164469_298_735 145
617 3300044683 Ga0466965_0183085 Ga0466965_0183085_42_482 145
618 3300045051 Ga0451576_0761571 Ga0451576_0761571_331_768 145
619 3300046452 Ga0495617_048343 Ga0495617_048343_141_620 145
620 3300046454 Ga0495592_0390125 Ga0495592_0390125_223_660 145
621 3300046455 Ga0495603_0169952 Ga0495603_0169952_450_887 145
622 3300046459 Ga0495629_0119616 Ga0495629_0119616_1261_1698 145
623 3300046460 Ga0495638_0000597 Ga0495638_0000597_13915_14394 145
624 3300046460 Ga0495638_0048834 Ga0495638_0048834_1142_1579 145
625 3300046460 Ga0495638_0250344 Ga0495638_0250344_287_766 145
626 3300046462 Ga0495651_0170300 Ga0495651_0170300_57_497 145
627 3300046462 Ga0495651_0427307 Ga0495651_0427307_186_623 145
628 3300046471 Ga0495650_0062085 Ga0495650_0062085_671_1108 145
629 3300046471 Ga0495650_0067025 Ga0495650_0067025_668_1105 145
630 3300046471 Ga0495650_0082224 Ga0495650_0082224_356_832 145
631 3300046474 Ga0495605_0010494 Ga0495605_0010494_4375_4854 145
632 3300046474 Ga0495605_0052317 Ga0495605_0052317_1039_1476 145
633 3300046474 Ga0495605_0110426 Ga0495605_0110426_385_864 145
634 3300046476 Ga0495662_0042557 Ga0495662_0042557_1417_1854 145
635 3300046492 Ga0495585_0008606 Ga0495585_0008606_3107_3586 145
636 3300046492 Ga0495585_0014614 Ga0495585_0014614_3679_4158 145
637 3300046492 Ga0495585_0062670 Ga0495585_0062670_1238_1675 145
638 3300046501 Ga0495607_0020706 Ga0495607_0020706_2879_3358 145
639 3300046501 Ga0495607_0078852 Ga0495607_0078852_1235_1672 145
640 3300046501 Ga0495607_0109190 Ga0495607_0109190_376_855 145
641 3300046506 Ga0495583_0004644 Ga0495583_0004644_8830_9267 145
642 3300046506 Ga0495583_0038373 Ga0495583_0038373_445_924 145
643 3300046506 Ga0495583_0059957 Ga0495583_0059957_1170_1664 145
644 3300046507 Ga0495606_0001192 Ga0495606_0001192_30952_31389 145
645 3300046507 Ga0495606_0014966 Ga0495606_0014966_3578_4054 145
646 3300046507 Ga0495606_0080629 Ga0495606_0080629_1405_1842 145
647 3300046507 Ga0495606_0172548 Ga0495606_0172548_373_867 145
648 3300046507 Ga0495606_0310973 Ga0495606_0310973_296_733 145
649 3300046512 Ga0495610_0000823 Ga0495610_0000823_16148_16585 145
650 3300046512 Ga0495610_0013855 Ga0495610_0013855_3194_3673 145
651 3300046513 Ga0495616_0099882 Ga0495616_0099882_457_936 145
652 3300046513 Ga0495616_0308931 Ga0495616_0308931_59_496 145
653 3300046515 Ga0495620_0006195 Ga0495620_0006195_1758_2237 145
654 3300046515 Ga0495620_0016721 Ga0495620_0016721_3169_3606 145
655 3300046515 Ga0495620_0048443 Ga0495620_0048443_484_963 145
656 3300046515 Ga0495620_0079383 Ga0495620_0079383_72_551 145
657 3300046515 Ga0495620_0108720 Ga0495620_0108720_220_657 145
658 3300046518 Ga0495631_0000740 Ga0495631_0000740_8351_8830 145
659 3300046518 Ga0495631_0114198 Ga0495631_0114198_631_1110 145
660 3300046518 Ga0495631_0260989 Ga0495631_0260989_132_611 145
661 3300046519 Ga0495632_0002039 Ga0495632_0002039_13849_14337 145
662 3300046519 Ga0495632_0017858 Ga0495632_0017858_2985_3422 145
663 3300046519 Ga0495632_0044674 Ga0495632_0044674_1654_2091 145
664 3300046519 Ga0495632_0278320 Ga0495632_0278320_48_485 145
665 3300046520 Ga0495637_0139725 Ga0495637_0139725_56_535 145
666 3300046522 Ga0495643_0058453 Ga0495643_0058453_882_1319 145
667 3300046522 Ga0495643_0133632 Ga0495643_0133632_666_1103 145
668 3300046529 Ga0495652_0161142 Ga0495652_0161142_436_873 145
669 3300046530 Ga0495654_0000641 Ga0495654_0000641_13873_14310 145
670 3300046530 Ga0495654_0416245 Ga0495654_0416245_41_520 145
671 3300046533 Ga0495640_0360520 Ga0495640_0360520_203_640 145
672 3300046536 Ga0495587_0426661 Ga0495587_0426661_163_600 145
673 3300046538 Ga0495609_0129367 Ga0495609_0129367_210_689 145
674 3300046542 Ga0495597_0015218 Ga0495597_0015218_422_901 145
675 3300046542 Ga0495597_0164750 Ga0495597_0164750_98_535 145
676 3300046557 Ga0495622_0175598 Ga0495622_0175598_223_660 145
677 3300046558 Ga0495633_0012938 Ga0495633_0012938_212_691 145
678 3300046558 Ga0495633_0079454 Ga0495633_0079454_919_1356 145
679 3300046558 Ga0495633_0183738 Ga0495633_0183738_113_550 145
680 3300046558 Ga0495633_0443469 Ga0495633_0443469_24_461 145
681 3300046616 Ga0495668_0004290 Ga0495668_0004290_6706_7185 145
682 3300046616 Ga0495668_0024255 Ga0495668_0024255_2222_2659 145
683 3300046642 Ga0495634_0702416 Ga0495634_0702416_93_530 145
684 3300046648 Ga0495611_0005299 Ga0495611_0005299_3011_3490 145
685 3300046648 Ga0495611_0297048 Ga0495611_0297048_154_633 145
686 3300046648 Ga0495611_0394647 Ga0495611_0394647_74_511 145
687 3300046660 Ga0495625_0001750 Ga0495625_0001750_18495_18974 145
688 3300046660 Ga0495625_0120200 Ga0495625_0120200_399_878 145
689 3300046660 Ga0495625_0196758 Ga0495625_0196758_538_1017 145
690 3300046665 Ga0495661_0058247 Ga0495661_0058247_1766_2245 145
691 3300046665 Ga0495661_0161776 Ga0495661_0161776_252_689 145
692 3300046683 Ga0495658_0319812 Ga0495658_0319812_188_625 145
693 3300046689 Ga0495613_0515563 Ga0495613_0515563_136_573 145
694 3300046690 Ga0495624_0445747 Ga0495624_0445747_50_487 145
695 3300046691 Ga0495670_0025865 Ga0495670_0025865_624_1103 145
696 3300046691 Ga0495670_0055914 Ga0495670_0055914_213_692 145
697 3300046692 Ga0495671_0066511 Ga0495671_0066511_655_1149 145
698 3300046692 Ga0495671_0366336 Ga0495671_0366336_196_633 145
699 3300046794 Ga0495589_0033057 Ga0495589_0033057_472_909 145
700 3300046809 Ga0495600_0061319 Ga0495600_0061319_907_1344 145
701 3300046810 Ga0495660_0013150 Ga0495660_0013150_3903_4382 145
702 3300046810 Ga0495660_0073249 Ga0495660_0073249_905_1384 145
703 3300047317 Ga0495604_0074492 Ga0495604_0074492_1237_1674 145
704 3300047320 Ga0495672_0007762 Ga0495672_0007762_4645_5124 145
705 3300047323 Ga0495683_0019292 Ga0495683_0019292_2509_2988 145
706 3300047447 Ga0495685_201877 Ga0495685_201877_183_620 145
707 3300047470 Ga0495681_0041135 Ga0495681_0041135_310_747 145
708 3300047472 Ga0495686_0003300 Ga0495686_0003300_11936_12373 145
709 3300047472 Ga0495686_0010445 Ga0495686_0010445_5552_6031 145
710 3300047472 Ga0495686_0012162 Ga0495686_0012162_4386_4823 145
711 3300047472 Ga0495686_0013205 Ga0495686_0013205_2049_2528 145
712 3300047472 Ga0495686_0082206 Ga0495686_0082206_1002_1439 145
713 3300047472 Ga0495686_0256162 Ga0495686_0256162_70_507 145
714 3300047472 Ga0495686_0551787 Ga0495686_0551787_68_505 145
715 3300047472 Ga0495686_0636159 Ga0495686_0636159_100_537 145
716 3300048090 Ga0495615_0147023 Ga0495615_0147023_249_686 145
717 3300048091 Ga0495626_0087468 Ga0495626_0087468_270_749 145
718 3300048903 Ga0496100_0129364 Ga0496100_0129364_1133_1627 145
719 3300048904 Ga0496101_0556962 Ga0496101_0556962_337_774 145
720 3300048907 Ga0496104_0273064 Ga0496104_0273064_1070_1519 145
721 3300048908 Ga0496105_0753326 Ga0496105_0753326_246_683 145
722 3300048909 Ga0496106_0000801 Ga0496106_0000801_8534_8971 145
723 3300048909 Ga0496106_0170481 Ga0496106_0170481_395_868 145
724 3300048910 Ga0496107_0343330 Ga0496107_0343330_244_681 145
725 3300048910 Ga0496107_0408015 Ga0496107_0408015_64_537 145
726 3300048913 Ga0496110_0518323 Ga0496110_0518323_462_899 145
727 3300048913 Ga0496110_1381248 Ga0496110_1381248_62_499 145
728 3300048913 Ga0496110_1409562 Ga0496110_1409562_70_519 145
729 3300048914 Ga0496111_0000625 Ga0496111_0000625_6099_6536 145
730 3300048917 Ga0496114_0599271 Ga0496114_0599271_197_634 145
731 3300048919 Ga0496116_0002893 Ga0496116_0002893_15208_15723 145
732 3300048919 Ga0496116_0048551 Ga0496116_0048551_520_966 145
733 3300048919 Ga0496116_0066801 Ga0496116_0066801_706_1191 145
734 3300048919 Ga0496116_0083983 Ga0496116_0083983_1161_1655 145
735 3300048919 Ga0496116_0135754 Ga0496116_0135754_520_966 145
736 3300048919 Ga0496116_0151396 Ga0496116_0151396_225_662 145
737 3300048919 Ga0496116_0165662 Ga0496116_0165662_388_903 145
738 3300048920 Ga0496117_0000002 Ga0496117_0000002_850907_851344 145
739 3300048920 Ga0496117_0002492 Ga0496117_0002492_4793_5230 145
740 3300048920 Ga0496117_0017063 Ga0496117_0017063_5248_5694 145
741 3300048920 Ga0496117_0049600 Ga0496117_0049600_844_1338 145
742 3300048920 Ga0496117_0053258 Ga0496117_0053258_548_985 145
743 3300048920 Ga0496117_0091707 Ga0496117_0091707_1072_1587 145
744 3300048921 Ga0496118_0001850 Ga0496118_0001850_19764_20201 145
745 3300048921 Ga0496118_0002255 Ga0496118_0002255_8945_9424 145
746 3300048921 Ga0496118_0055604 Ga0496118_0055604_319_834 145
747 3300048921 Ga0496118_0070257 Ga0496118_0070257_1967_2413 145
748 3300048921 Ga0496118_0119184 Ga0496118_0119184_610_1125 145
749 3300048921 Ga0496118_0333192 Ga0496118_0333192_362_799 145
750 3300048922 Ga0496119_0055250 Ga0496119_0055250_905_1342 145
751 3300048922 Ga0496119_0068361 Ga0496119_0068361_43_480 145
752 3300048922 Ga0496119_0077578 Ga0496119_0077578_924_1361 145
753 3300048922 Ga0496119_0336704 Ga0496119_0336704_218_664 145
754 3300048922 Ga0496119_0421149 Ga0496119_0421149_108_545 145
755 3300048922 Ga0496119_0537224 Ga0496119_0537224_29_478 145
756 3300048923 Ga0496120_0000078 Ga0496120_0000078_132552_132989 145
757 3300048923 Ga0496120_0216153 Ga0496120_0216153_429_866 145
758 3300048924 Ga0496121_0000003 Ga0496121_0000003_86631_87077 145
759 3300048924 Ga0496121_0000751 Ga0496121_0000751_43352_43789 145
760 3300048924 Ga0496121_0005759 Ga0496121_0005759_10275_10790 145
761 3300048924 Ga0496121_0016740 Ga0496121_0016740_2263_2700 145
762 3300048924 Ga0496121_0033826 Ga0496121_0033826_388_903 145
763 3300048924 Ga0496121_0037070 Ga0496121_0037070_3862_4299 145
764 3300048924 Ga0496121_0050317 Ga0496121_0050317_850_1323 145
765 3300048924 Ga0496121_0055812 Ga0496121_0055812_1877_2371 145
766 3300048924 Ga0496121_0185828 Ga0496121_0185828_71_550 145
767 3300048924 Ga0496121_0241327 Ga0496121_0241327_414_923 145
768 3300048924 Ga0496121_0247651 Ga0496121_0247651_616_1053 145
769 3300048924 Ga0496121_0375424 Ga0496121_0375424_309_746 145
770 3300048924 Ga0496121_0388232 Ga0496121_0388232_361_876 145
771 3300048925 Ga0496122_0000001 Ga0496122_0000001_157340_157777 145
772 3300048925 Ga0496122_0000399 Ga0496122_0000399_43871_44308 145
773 3300048925 Ga0496122_0043507 Ga0496122_0043507_1918_2433 145
774 3300048925 Ga0496122_0047654 Ga0496122_0047654_2190_2684 145
775 3300048925 Ga0496122_0175972 Ga0496122_0175972_380_895 145
776 3300048925 Ga0496122_0221660 Ga0496122_0221660_472_909 145
777 3300048925 Ga0496122_0243563 Ga0496122_0243563_256_693 145
778 3300048926 Ga0496123_0000001 Ga0496123_0000001_161071_161508 145
779 3300048926 Ga0496123_0002112 Ga0496123_0002112_5749_6186 145
780 3300048926 Ga0496123_0007774 Ga0496123_0007774_7520_8014 145
781 3300048926 Ga0496123_0018288 Ga0496123_0018288_2268_2705 145
782 3300048926 Ga0496123_0032077 Ga0496123_0032077_1879_2352 145
783 3300048926 Ga0496123_0055467 Ga0496123_0055467_387_902 145
784 3300048926 Ga0496123_0148710 Ga0496123_0148710_365_880 145
785 3300048926 Ga0496123_0177001 Ga0496123_0177001_158_604 145
786 3300048927 Ga0496124_0002648 Ga0496124_0002648_2714_3151 145
787 3300048927 Ga0496124_0007941 Ga0496124_0007941_4060_4497 145
788 3300048927 Ga0496124_0039431 Ga0496124_0039431_841_1278 145
789 3300048927 Ga0496124_0083345 Ga0496124_0083345_1949_2428 145
790 3300048927 Ga0496124_0085245 Ga0496124_0085245_202_696 145
791 3300048927 Ga0496124_0089750 Ga0496124_0089750_1607_2122 145
792 3300048927 Ga0496124_0245429 Ga0496124_0245429_502_939 145
793 3300048927 Ga0496124_0384363 Ga0496124_0384363_250_765 145
794 3300048927 Ga0496124_0443009 Ga0496124_0443009_358_795 145
795 3300048928 Ga0496125_0000141 Ga0496125_0000141_7960_8406 145
796 3300048928 Ga0496125_0001650 Ga0496125_0001650_15535_15972 145
797 3300048928 Ga0496125_0030094 Ga0496125_0030094_1145_1639 145
798 3300048928 Ga0496125_0059323 Ga0496125_0059323_387_902 145
799 3300048929 Ga0496126_0001055 Ga0496126_0001055_27810_28247 145
800 3300048929 Ga0496126_0108174 Ga0496126_0108174_270_707 145
801 3300048929 Ga0496126_0133653 Ga0496126_0133653_177_614 145
802 3300048929 Ga0496126_0178712 Ga0496126_0178712_373_810 145
803 3300048929 Ga0496126_0307160 Ga0496126_0307160_261_755 145
804 3300048929 Ga0496126_0355000 Ga0496126_0355000_357_872 145
805 3300048929 Ga0496126_0401876 Ga0496126_0401876_638_1075 145
806 3300048929 Ga0496126_0721480 Ga0496126_0721480_309_755 145
807 3300048929 Ga0496126_0980343 Ga0496126_0980343_98_571 145
808 3300049459 Ga0495678_014086 Ga0495678_014086_625_1104 145
809 3300049459 Ga0495678_029360 Ga0495678_029360_239_676 145
810 3300049460 Ga0495682_0111537 Ga0495682_0111537_377_856 145
811 3300049568 Ga0501031_0262833 Ga0501031_0262833_371_808 145
812 3300049569 Ga0501032_0043453 Ga0501032_0043453_1461_1898 145
813 3300049569 Ga0501032_0322287 Ga0501032_0322287_389_826 145
814 3300049569 Ga0501032_0957740 Ga0501032_0957740_14_451 145
815 3300049570 Ga0501033_0001044 Ga0501033_0001044_18537_18974 145
816 3300049570 Ga0501033_0083686 Ga0501033_0083686_1209_1646 145
817 3300049571 Ga0501034_0011050 Ga0501034_0011050_4160_4597 145
818 3300049571 Ga0501034_0041937 Ga0501034_0041937_1087_1524 145
819 3300049571 Ga0501034_0270792 Ga0501034_0270792_1182_1619 145
820 3300049571 Ga0501034_0489838 Ga0501034_0489838_13_450 145
821 3300049572 Ga0501036_0019092 Ga0501036_0019092_4746_5183 145
822 3300049572 Ga0501036_0054502 Ga0501036_0054502_1941_2378 145
823 3300049572 Ga0501036_0654855 Ga0501036_0654855_205_684 145
824 3300049573 Ga0501037_0047500 Ga0501037_0047500_43_480 145
825 3300049573 Ga0501037_0145295 Ga0501037_0145295_1123_1560 145
826 3300049574 Ga0501038_0359874 Ga0501038_0359874_365_844 145
827 3300049574 Ga0501038_0628707 Ga0501038_0628707_318_755 145
828 3300049575 Ga0501039_0213010 Ga0501039_0213010_802_1281 145
829 3300049575 Ga0501039_0403908 Ga0501039_0403908_581_1018 145
830 3300049579 Ga0501043_0021712 Ga0501043_0021712_3080_3517 145
831 3300049579 Ga0501043_0595146 Ga0501043_0595146_84_521 145
832 3300049580 Ga0501046_0068367 Ga0501046_0068367_390_827 145
833 3300049580 Ga0501046_0543615 Ga0501046_0543615_316_753 145
834 3300049580 Ga0501046_0963078 Ga0501046_0963078_39_518 145
835 3300049581 Ga0501047_0009309 Ga0501047_0009309_6020_6457 145
836 3300049581 Ga0501047_0472262 Ga0501047_0472262_365_844 145
837 3300049582 Ga0501048_0126905 Ga0501048_0126905_674_1111 145
838 3300049582 Ga0501048_0129826 Ga0501048_0129826_34_513 145
839 3300049582 Ga0501048_0233882 Ga0501048_0233882_10_447 145
840 3300049583 Ga0501067_0053980 Ga0501067_0053980_810_1247 145
841 3300049584 Ga0501068_0129075 Ga0501068_0129075_58_495 145
842 3300049586 Ga0501070_0608971 Ga0501070_0608971_171_608 145
843 3300049587 Ga0501071_0122293 Ga0501071_0122293_1063_1500 145
844 3300049589 Ga0501073_0084268 Ga0501073_0084268_1660_2139 145
845 3300049589 Ga0501073_0150329 Ga0501073_0150329_1105_1542 145
846 3300049589 Ga0501073_0551658 Ga0501073_0551658_95_532 145
847 3300049590 Ga0501074_0090849 Ga0501074_0090849_360_797 145
848 3300049741 Ga0501079_0594495 Ga0501079_0594495_19_456 145
849 3300049741 Ga0501079_0734447 Ga0501079_0734447_86_523 145
850 3300049742 Ga0501080_0187661 Ga0501080_0187661_96_533 145
851 3300049742 Ga0501080_0381235 Ga0501080_0381235_697_1134 145
852 3300049744 Ga0501083_0266414 Ga0501083_0266414_508_987 145
853 3300049822 Ga0501035_0001225 Ga0501035_0001225_18135_18572 145
854 3300049822 Ga0501035_0036982 Ga0501035_0036982_3081_3518 145
855 3300049823 Ga0501044_0106055 Ga0501044_0106055_945_1382 145
856 3300050489 nmdc:mga03683_1843_c1 nmdc:mga03683_1843_c1_497_934 145
857 3300050490 nmdc:mga03n38_501576_c1 nmdc:mga03n38_501576_c1_99_578 145
858 3300050491 nmdc:mga00v17_232788_c1 nmdc:mga00v17_232788_c1_420_866 145
859 3300050491 nmdc:mga00v17_291_c1 nmdc:mga00v17_291_c1_174_611 145
860 3300050491 nmdc:mga00v17_430441_c1 nmdc:mga00v17_430441_c1_94_531 145
861 3300050491 nmdc:mga00v17_831775_c1 nmdc:mga00v17_831775_c1_21_536 145
862 3300050492 nmdc:mga0yw44_174970_c1 nmdc:mga0yw44_174970_c1_577_1014 145
863 3300050492 nmdc:mga0yw44_26184_c1 nmdc:mga0yw44_26184_c1_2338_2775 145
864 3300050493 nmdc:mga0k408_12066_c1 nmdc:mga0k408_12066_c1_428_865 145
865 3300050494 nmdc:mga06z11_144358_c1 nmdc:mga06z11_144358_c1_312_749 145
866 3300050495 nmdc:mga04h51_38387_c1 nmdc:mga04h51_38387_c1_898_1335 145
867 3300050496 nmdc:mga07m45_26904_c2 nmdc:mga07m45_26904_c2_405_842 145
868 3300050496 nmdc:mga07m45_375564_c1 nmdc:mga07m45_375564_c1_173_610 145
869 3300050496 nmdc:mga07m45_619570_c1 nmdc:mga07m45_619570_c1_58_495 145
870 3300050516 nmdc:mga0sz30_17576_c2 nmdc:mga0sz30_17576_c2_140_634 145
871 3300050516 nmdc:mga0sz30_271449_c1 nmdc:mga0sz30_271449_c1_257_694 145
872 3300053085 Ga0495619_0126977 Ga0495619_0126977_464_901 145
873 3300053086 Ga0500578_0188161 Ga0500578_0188161_666_1103 145
874 3300053086 Ga0500578_0233289 Ga0500578_0233289_340_819 145
875 3300053087 Ga0500643_043370 Ga0500643_043370_319_756 145
876 3300053087 Ga0500643_073048 Ga0500643_073048_254_691 145
877 3300053092 Ga0500583_0310640 Ga0500583_0310640_169_606 145
878 3300053093 Ga0500651_0064859 Ga0500651_0064859_1404_1841 145
879 3300053093 Ga0500651_0096023 Ga0500651_0096023_1358_1795 145
880 3300053096 Ga0500641_0170765 Ga0500641_0170765_48_485 145
881 3300053105 Ga0500557_063408 Ga0500557_063408_348_827 145
882 3300053107 Ga0500560_000049 Ga0500560_000049_2937_3374 145
883 3300053108 Ga0500562_061128 Ga0500562_061128_184_663 145
884 3300053109 Ga0500569_004820 Ga0500569_004820_388_825 145
885 3300053118 Ga0500594_0062570 Ga0500594_0062570_184_663 145
886 3300053118 Ga0500594_0107070 Ga0500594_0107070_359_796 145
887 3300053119 Ga0500595_016597 Ga0500595_016597_1174_1611 145
888 3300053119 Ga0500595_083161 Ga0500595_083161_195_632 145
889 3300053121 Ga0500607_177570 Ga0500607_177570_386_823 145
890 3300053125 Ga0500618_000125 Ga0500618_000125_46073_46510 145
891 3300053125 Ga0500618_000289 Ga0500618_000289_25880_26317 145
892 3300053125 Ga0500618_003300 Ga0500618_003300_2888_3325 145
893 3300053125 Ga0500618_012009 Ga0500618_012009_68_505 145
894 3300053129 Ga0500628_038501 Ga0500628_038501_570_1049 145
895 3300053130 Ga0500642_0099012 Ga0500642_0099012_892_1329 145
896 3300053134 Ga0500658_0001913 Ga0500658_0001913_4039_4518 145
897 3300053134 Ga0500658_0452703 Ga0500658_0452703_27_464 145
898 3300053137 Ga0500561_0000141 Ga0500561_0000141_2859_3296 145
899 3300053139 Ga0500568_0000411 Ga0500568_0000411_18764_19243 145
900 3300053139 Ga0500568_0001577 Ga0500568_0001577_346_783 145
901 3300053140 Ga0500573_0003547 Ga0500573_0003547_7603_8040 145
902 3300053140 Ga0500573_0076549 Ga0500573_0076549_44_481 145
903 3300053142 Ga0500577_0025801 Ga0500577_0025801_328_807 145
904 3300053148 Ga0500590_002241 Ga0500590_002241_365_802 145
905 3300053151 Ga0500604_0030499 Ga0500604_0030499_1041_1478 145
906 3300053153 Ga0500616_0000661 Ga0500616_0000661_27944_28408 145
907 3300053153 Ga0500616_0013882 Ga0500616_0013882_1949_2428 145
908 3300053156 Ga0500622_0000428 Ga0500622_0000428_13720_14214 145
909 3300053157 Ga0500624_000266 Ga0500624_000266_10669_11106 145
910 3300053157 Ga0500624_072200 Ga0500624_072200_180_617 145
911 3300053160 Ga0500633_0003216 Ga0500633_0003216_92_529 145
912 3300053161 Ga0500634_0053147 Ga0500634_0053147_270_707 145
913 3300053177 Ga0500636_0202751 Ga0500636_0202751_445_882 145
914 3300060353 Ga0501082_0398967 Ga0501082_0398967_619_1056 145
915 iso_pu_bacteria 2509276021 2509386798 145
916 iso_pu_bacteria 2509276033 2509442345 145
917 iso_pu_bacteria 2510917026 2511175608 145
918 iso_pu_bacteria 2513237088 2513594481 145
919 iso_pu_bacteria 2517287029 2517406664 145
920 iso_pu_bacteria 2718217927 2719385673 145
921 iso_pu_bacteria 2718218423 2721399453 145
922 iso_pu_bacteria 2721755809 2724038266 145
923 iso_pu_bacteria 2791355259 2793313640 145
924 iso_pu_bacteria 2791355263 2793341406 145
925 iso_pu_bacteria 2841864319 2841864679 145
926 iso_pu_bacteria 2842341865 2842345958 145
927 iso_pu_bacteria 2842395702 2842397542 145
928 iso_pu_bacteria 2936375103 2936376724 145
929 iso_pu_bacteria 2936381700 2936385099 145
930 iso_pu_bacteria 2996893221 2996898266 145
931 iso_pu_bacteria 3005409236 3005415269 145
932 iso_pu_bacteria 8005275841 8005280448 145
933 iso_pu_bacteria 8005695170 8005700150 145
934 iso_pu_bacteria 8018176218 8018179962 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07370

DUF1489

Protein of unknown function (DUF1489)

33

173

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6unp-assembly2.cif.gz_B crystal structure of the kinase domain of bmpr2-d485g 0.7597 70 92
5o1v-assembly1.cif.gz_B crystal structure of wnk3 kinase domain in a monophosphorylated apo state (a-loop swapped) 0.7514 70 92
7avy-assembly1.cif.gz_A mertk kinase domain in complex with quinazoline-based inhbitor 0.7401 70 92
3g2f-assembly2.cif.gz_B crystal structure of the kinase domain of bone morphogenetic protein receptor type ii (bmpr2) at 2.35 a resolution 0.7353 70 92
4wua-assembly1.cif.gz_A crystal structure of human srpk1 complexed to an inhibitor srpin340 0.7248 70 92
ID Description Score Start End Superfamily
af_Q59SK8_134_235_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8527 74 90 3.30.780.10
af_Q9VK37_32_125_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8222 70 92 3.30.200.20
af_A4HXQ3_17_104_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8166 70 92 3.30.200.20
af_Q6NQB8_66_391_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7808 75 89 1.10.10.10
af_B0V0H4_197_291_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7442 70 92 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A4Q3CD48-F1-model_v4 DUF1489 family protein 1.001 1 98
AF-A0A7J4VR54-F1-model_v4 DUF1489 family protein 0.9922 1 145
AF-A0A4Q3CD48-F1-model_v4 DUF1489 family protein 0.9904 1 98
AF-A0A2A6K051-F1-model_v4 DUF1489 domain-containing protein 0.9885 1 145
AF-A0A6A8A181-F1-model_v4 DUF1489 family protein 0.9709 1 145

Feature Viewer

pLDDT pTM Quality
94.31 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map