F486135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 543 | 1868 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0182216|Ga0495625_0182216_254_997 |
| Length | 247 |
| Sequence | LKLGLLETGAPPPALSPRFGDYPAMFRRLLGEDAYDYTTWRVDAGELPDRAEACDAYLVTGSSAGVYDPLPWIGPLKDFLVAAKGRAALVGVCFGHQVMAEAFGGRVVKSPKGWGVGLQSYAVSRSEPWMDPADRIRIAASHQDQVIEAPPGAEVLAASDFTPFAMLAYRDQPAISLQPHPEFEPDYAKALIRGRSGDRFRADLADPAIRSLDQPNDRVRVGGWIKAGRRLARGLRPGPRTKTGGRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 105 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 106 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 107 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 175 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 176 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 328 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 333 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 337 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 340 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 341 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 342 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 343 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 344 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 347 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 348 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 350 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 354 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 356 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 358 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 360 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 363 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 367 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 368 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 369 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 370 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 371 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 372 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 373 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 374 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 375 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 376 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 377 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 378 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 379 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 380 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 381 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 382 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 383 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 384 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 385 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 386 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 387 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 388 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 389 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 390 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 391 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 392 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 393 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 394 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 395 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 396 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 397 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 398 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 399 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 400 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 401 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 402 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 403 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 404 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 405 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 406 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 407 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 408 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 409 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 410 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 411 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 412 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 413 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 414 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 415 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 416 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 417 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 418 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 419 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 420 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 421 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 422 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 423 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 424 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 425 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 426 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 427 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 428 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 429 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 430 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 431 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 432 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 433 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 434 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 435 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 436 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 437 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 438 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 439 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 440 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 441 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 442 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 443 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 444 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 445 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 446 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 447 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 448 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 449 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 450 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 451 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 452 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 453 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 454 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 455 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 456 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 457 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 458 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 459 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 460 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 461 | 2922368715 | |||
| 462 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 463 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 464 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 465 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 466 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 467 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 468 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 469 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 470 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 471 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 472 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 473 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 474 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 475 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 476 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 477 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 478 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 479 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 480 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 481 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 482 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 483 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 484 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 485 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 486 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 487 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 488 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 489 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 490 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 491 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 492 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 493 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 494 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 495 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 496 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 497 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 498 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 499 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 500 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 501 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 502 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 503 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 504 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 505 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 506 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 507 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 508 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 509 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 510 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 511 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 512 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 513 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 514 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 515 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 516 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 517 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 518 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 519 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 520 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 521 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 522 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 523 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 524 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 525 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 526 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 527 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 528 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 529 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 530 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 531 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 532 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 533 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 534 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 535 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 536 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 537 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 538 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 539 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 540 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 541 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 542 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 543 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.24 |
| Metatranscriptomes | 0 |
| Isolates | 18.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.24 |
| Nodule | 13.92 |
| Rhizoplane | 4.93 |
| Rhizosphere | 56.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495625_0182216 | 3300046660 | Bacteria | 1396 |
| 2 | JGI24739J22299_10019620 | 3300001989 | Bacteria | 2419 |
| 3 | JGI25153J46596_10000732 | 3300003215 | Bacteria | 20120 |
| 4 | JGI25153J46596_10004233 | 3300003215 | Bacteria | 7763 |
| 5 | JGI25153J46596_10008565 | 3300003215 | Bacteria | 4874 |
| 6 | JGI25153J46596_10009899 | 3300003215 | Bacteria | 4368 |
| 7 | rootH2_10044168 | 3300003320 | Bacteria | 1419 |
| 8 | rootL2_10058382 | 3300003322 | Bacteria | 5962 |
| 9 | JGI25160J50197_1001947 | 3300003354 | Bacteria | 9864 |
| 10 | JGI25160J50197_1011819 | 3300003354 | Bacteria | 3066 |
| 11 | JGI25160J50197_1030521 | 3300003354 | Bacteria | 1403 |
| 12 | Ga0055542_1003059 | 3300003762 | Bacteria | 4827 |
| 13 | Ga0055536_1000576 | 3300003781 | Bacteria | 25026 |
| 14 | Ga0055536_1000606 | 3300003781 | Bacteria | 24402 |
| 15 | Ga0055530_10004098 | 3300003791 | Bacteria | 7757 |
| 16 | Ga0055530_10009857 | 3300003791 | Bacteria | 3606 |
| 17 | Ga0055540_1024409 | 3300003792 | Bacteria | 1500 |
| 18 | Ga0055531_10000294 | 3300003794 | Bacteria | 49839 |
| 19 | Ga0055531_10012403 | 3300003794 | Bacteria | 4013 |
| 20 | Ga0055543_1003066 | 3300004625 | Bacteria | 5135 |
| 21 | Ga0065165_1002046 | 3300005262 | Bacteria | 18689 |
| 22 | Ga0065165_1002144 | 3300005262 | Bacteria | 17883 |
| 23 | Ga0065712_10075409 | 3300005290 | Bacteria | 3869 |
| 24 | Ga0065712_10166263 | 3300005290 | Bacteria | 1271 |
| 25 | Ga0070658_10286389 | 3300005327 | Bacteria | 1403 |
| 26 | Ga0070690_100021139 | 3300005330 | Bacteria | 3971 |
| 27 | Ga0070690_100483710 | 3300005330 | Unclassified | 923 |
| 28 | Ga0070670_100000032 | 3300005331 | Bacteria | 158514 |
| 29 | Ga0070670_100004709 | 3300005331 | Bacteria | 11450 |
| 30 | Ga0070670_100123191 | 3300005331 | Bacteria | 2237 |
| 31 | Ga0070670_100217269 | 3300005331 | Bacteria | 1663 |
| 32 | Ga0068869_100015582 | 3300005334 | Bacteria | 5105 |
| 33 | Ga0068869_100059446 | 3300005334 | Bacteria | 2798 |
| 34 | Ga0070666_10047736 | 3300005335 | Bacteria | 2875 |
| 35 | Ga0070666_10456853 | 3300005335 | Bacteria | 923 |
| 36 | Ga0070680_100050255 | 3300005336 | Bacteria | 3400 |
| 37 | Ga0068868_100439293 | 3300005338 | Bacteria | 1133 |
| 38 | Ga0070660_100054341 | 3300005339 | Bacteria | 3092 |
| 39 | Ga0070689_100000337 | 3300005340 | Bacteria | 27384 |
| 40 | Ga0070687_100081866 | 3300005343 | Bacteria | 1764 |
| 41 | Ga0070661_100127898 | 3300005344 | Bacteria | 1907 |
| 42 | Ga0070668_100000975 | 3300005347 | Bacteria | 20042 |
| 43 | Ga0070668_100004762 | 3300005347 | Bacteria | 10066 |
| 44 | Ga0070668_100007849 | 3300005347 | Bacteria | 7925 |
| 45 | Ga0070668_100007904 | 3300005347 | Bacteria | 7896 |
| 46 | Ga0070668_100088866 | 3300005347 | Bacteria | 2433 |
| 47 | Ga0070669_100015826 | 3300005353 | Bacteria | 5378 |
| 48 | Ga0070669_100079827 | 3300005353 | Bacteria | 2434 |
| 49 | Ga0070669_100089976 | 3300005353 | Bacteria | 2300 |
| 50 | Ga0070675_100000590 | 3300005354 | Bacteria | 24895 |
| 51 | Ga0070675_100242533 | 3300005354 | Bacteria | 1575 |
| 52 | Ga0070671_100019456 | 3300005355 | Bacteria | 5526 |
| 53 | Ga0070671_100055425 | 3300005355 | Bacteria | 3298 |
| 54 | Ga0070671_100058724 | 3300005355 | Bacteria | 3201 |
| 55 | Ga0070671_100065351 | 3300005355 | Bacteria | 3030 |
| 56 | Ga0070671_100083308 | 3300005355 | Bacteria | 2674 |
| 57 | Ga0070674_100027551 | 3300005356 | Bacteria | 3724 |
| 58 | Ga0070674_100151164 | 3300005356 | Unclassified | 1752 |
| 59 | Ga0070674_100156508 | 3300005356 | Bacteria | 1725 |
| 60 | Ga0070674_100691939 | 3300005356 | Bacteria | 871 |
| 61 | Ga0070673_100059214 | 3300005364 | Bacteria | 3031 |
| 62 | Ga0070688_100013340 | 3300005365 | Bacteria | 4630 |
| 63 | Ga0070659_100545920 | 3300005366 | Bacteria | 992 |
| 64 | Ga0070667_100000110 | 3300005367 | Bacteria | 105201 |
| 65 | Ga0070667_100015527 | 3300005367 | Bacteria | 6295 |
| 66 | Ga0070667_100053948 | 3300005367 | Bacteria | 3394 |
| 67 | Ga0070667_100094456 | 3300005367 | Bacteria | 2577 |
| 68 | Ga0070667_100441689 | 3300005367 | Bacteria | 1188 |
| 69 | Ga0070667_100448697 | 3300005367 | Bacteria | 1178 |
| 70 | Ga0070667_100650934 | 3300005367 | Bacteria | 973 |
| 71 | Ga0070701_10075713 | 3300005438 | Bacteria | 1810 |
| 72 | Ga0070705_100022249 | 3300005440 | Bacteria | 3386 |
| 73 | Ga0070700_100049110 | 3300005441 | Bacteria | 2618 |
| 74 | Ga0070700_100111925 | 3300005441 | Unclassified | 1816 |
| 75 | Ga0070663_100015157 | 3300005455 | Bacteria | 4966 |
| 76 | Ga0070663_100287292 | 3300005455 | Bacteria | 1312 |
| 77 | Ga0070662_100063311 | 3300005457 | Bacteria | 2705 |
| 78 | Ga0070662_100086619 | 3300005457 | Bacteria | 2343 |
| 79 | Ga0070662_100091604 | 3300005457 | Bacteria | 2283 |
| 80 | Ga0070662_100201929 | 3300005457 | Bacteria | 1578 |
| 81 | Ga0070662_100240675 | 3300005457 | Bacteria | 1451 |
| 82 | Ga0070681_10025372 | 3300005458 | Bacteria | 5962 |
| 83 | Ga0070681_10126415 | 3300005458 | Bacteria | 2489 |
| 84 | Ga0068867_100000827 | 3300005459 | Bacteria | 20846 |
| 85 | Ga0070685_10067918 | 3300005466 | Bacteria | 2104 |
| 86 | Ga0070706_100231801 | 3300005467 | Bacteria | 1724 |
| 87 | Ga0070679_100258365 | 3300005530 | Unclassified | 1697 |
| 88 | Ga0070679_100387290 | 3300005530 | Bacteria | 1344 |
| 89 | Ga0070684_100001718 | 3300005535 | Bacteria | 15952 |
| 90 | Ga0070684_100173377 | 3300005535 | Bacteria | 1959 |
| 91 | Ga0068853_100180329 | 3300005539 | Bacteria | 1915 |
| 92 | Ga0068853_100226820 | 3300005539 | Bacteria | 1708 |
| 93 | Ga0070672_100027336 | 3300005543 | Bacteria | 4253 |
| 94 | Ga0070686_100023073 | 3300005544 | Bacteria | 3715 |
| 95 | Ga0070665_100000232 | 3300005548 | Bacteria | 92207 |
| 96 | Ga0070665_100002174 | 3300005548 | Bacteria | 21852 |
| 97 | Ga0070665_100022111 | 3300005548 | Bacteria | 6397 |
| 98 | Ga0070665_100033123 | 3300005548 | Bacteria | 5199 |
| 99 | Ga0070665_100035301 | 3300005548 | Bacteria | 5027 |
| 100 | Ga0070665_100093379 | 3300005548 | Bacteria | 3014 |
| 101 | Ga0068855_100122020 | 3300005563 | Bacteria | 2982 |
| 102 | Ga0068855_100209575 | 3300005563 | Bacteria | 2191 |
| 103 | Ga0070664_100000397 | 3300005564 | Bacteria | 32538 |
| 104 | Ga0070664_100268400 | 3300005564 | Bacteria | 1536 |
| 105 | Ga0068857_100007163 | 3300005577 | Bacteria | 9608 |
| 106 | Ga0068857_100054907 | 3300005577 | Bacteria | 3535 |
| 107 | Ga0068857_100190180 | 3300005577 | Bacteria | 1869 |
| 108 | Ga0068854_100108066 | 3300005578 | Bacteria | 2094 |
| 109 | Ga0068854_100122520 | 3300005578 | Bacteria | 1976 |
| 110 | Ga0070702_100011407 | 3300005615 | Bacteria | 4420 |
| 111 | Ga0068852_100039336 | 3300005616 | Bacteria | 3981 |
| 112 | Ga0068852_100096846 | 3300005616 | Bacteria | 2653 |
| 113 | Ga0068852_100218124 | 3300005616 | Bacteria | 1813 |
| 114 | Ga0068859_100001635 | 3300005617 | Bacteria | 22899 |
| 115 | Ga0068859_100007383 | 3300005617 | Bacteria | 11152 |
| 116 | Ga0068859_100029735 | 3300005617 | Bacteria | 5481 |
| 117 | Ga0068859_100082233 | 3300005617 | Bacteria | 3263 |
| 118 | Ga0068864_100000673 | 3300005618 | Bacteria | 28561 |
| 119 | Ga0068864_100005130 | 3300005618 | Bacteria | 10724 |
| 120 | Ga0068864_100011767 | 3300005618 | Bacteria | 7227 |
| 121 | Ga0068864_100083027 | 3300005618 | Bacteria | 2813 |
| 122 | Ga0068866_10168052 | 3300005718 | Bacteria | 1285 |
| 123 | Ga0068861_100013434 | 3300005719 | Bacteria | 5733 |
| 124 | Ga0068861_100016431 | 3300005719 | Bacteria | 5238 |
| 125 | Ga0068861_100638392 | 3300005719 | Bacteria | 982 |
| 126 | Ga0068870_10164351 | 3300005840 | Unclassified | 1319 |
| 127 | Ga0068870_10273525 | 3300005840 | Bacteria | 1056 |
| 128 | Ga0068863_100000998 | 3300005841 | Bacteria | 28350 |
| 129 | Ga0068863_100001377 | 3300005841 | Bacteria | 24126 |
| 130 | Ga0068863_100010242 | 3300005841 | Bacteria | 9115 |
| 131 | Ga0068863_100121361 | 3300005841 | Bacteria | 2492 |
| 132 | Ga0068863_100435273 | 3300005841 | Bacteria | 1286 |
| 133 | Ga0068863_100493703 | 3300005841 | Bacteria | 1205 |
| 134 | Ga0068858_100006036 | 3300005842 | Bacteria | 11808 |
| 135 | Ga0068858_100433894 | 3300005842 | Bacteria | 1264 |
| 136 | Ga0068860_100000100 | 3300005843 | Bacteria | 144580 |
| 137 | Ga0068860_100000167 | 3300005843 | Bacteria | 108234 |
| 138 | Ga0068860_100005700 | 3300005843 | Bacteria | 12574 |
| 139 | Ga0068860_100007072 | 3300005843 | Bacteria | 11232 |
| 140 | Ga0068860_100016951 | 3300005843 | Bacteria | 7101 |
| 141 | Ga0068862_100000542 | 3300005844 | Bacteria | 39532 |
| 142 | Ga0068862_100001288 | 3300005844 | Bacteria | 23450 |
| 143 | Ga0068862_100001632 | 3300005844 | Bacteria | 20403 |
| 144 | Ga0068862_100004915 | 3300005844 | Bacteria | 11255 |
| 145 | Ga0068862_100057617 | 3300005844 | Bacteria | 3333 |
| 146 | Ga0081540_1014591 | 3300005983 | Bacteria | 5023 |
| 147 | Ga0075365_10032298 | 3300006038 | Bacteria | 3363 |
| 148 | Ga0075365_10039062 | 3300006038 | Bacteria | 3088 |
| 149 | Ga0075365_10151974 | 3300006038 | Bacteria | 1611 |
| 150 | Ga0075365_10174020 | 3300006038 | Bacteria | 1503 |
| 151 | Ga0075365_10318181 | 3300006038 | Bacteria | 1096 |
| 152 | Ga0075363_100000252 | 3300006048 | Bacteria | 15249 |
| 153 | Ga0075364_10028984 | 3300006051 | Bacteria | 3547 |
| 154 | Ga0075364_10078364 | 3300006051 | Bacteria | 2182 |
| 155 | Ga0075367_10013385 | 3300006178 | Bacteria | 4408 |
| 156 | Ga0075369_10005684 | 3300006186 | Bacteria | 4675 |
| 157 | Ga0075369_10117694 | 3300006186 | Bacteria | 1201 |
| 158 | Ga0075366_10010251 | 3300006195 | Bacteria | 5257 |
| 159 | Ga0097621_100180647 | 3300006237 | Bacteria | 1823 |
| 160 | Ga0075370_10012820 | 3300006353 | Bacteria | 4440 |
| 161 | Ga0075370_10220971 | 3300006353 | Bacteria | 1120 |
| 162 | Ga0068871_100359251 | 3300006358 | Bacteria | 1290 |
| 163 | Ga0075428_100000382 | 3300006844 | Bacteria | 43854 |
| 164 | Ga0075428_100008063 | 3300006844 | Bacteria | 11697 |
| 165 | Ga0075428_100162246 | 3300006844 | Bacteria | 2426 |
| 166 | Ga0075430_100005192 | 3300006846 | Bacteria | 10972 |
| 167 | Ga0075430_100005806 | 3300006846 | Bacteria | 10412 |
| 168 | Ga0075430_100167185 | 3300006846 | Bacteria | 1830 |
| 169 | Ga0075430_100616617 | 3300006846 | Bacteria | 895 |
| 170 | Ga0075431_100000837 | 3300006847 | Bacteria | 26929 |
| 171 | Ga0075431_100003681 | 3300006847 | Bacteria | 14887 |
| 172 | Ga0075431_100021183 | 3300006847 | Bacteria | 6643 |
| 173 | Ga0075431_100076181 | 3300006847 | Bacteria | 3462 |
| 174 | Ga0075434_100179045 | 3300006871 | Bacteria | 2140 |
| 175 | Ga0075429_100002408 | 3300006880 | Bacteria | 15757 |
| 176 | Ga0075429_100010168 | 3300006880 | Bacteria | 8146 |
| 177 | Ga0068865_100389892 | 3300006881 | Unclassified | 1138 |
| 178 | Ga0097620_100001635 | 3300006931 | Bacteria | 22899 |
| 179 | Ga0097620_100007383 | 3300006931 | Bacteria | 11152 |
| 180 | Ga0097620_100029735 | 3300006931 | Bacteria | 5481 |
| 181 | Ga0097620_100082233 | 3300006931 | Bacteria | 3263 |
| 182 | Ga0099824_1029721 | 3300006942 | Bacteria | 2287 |
| 183 | Ga0105240_10004052 | 3300009093 | Bacteria | 22539 |
| 184 | Ga0105240_10016708 | 3300009093 | Bacteria | 9926 |
| 185 | Ga0105240_10185697 | 3300009093 | Bacteria | 2449 |
| 186 | Ga0105240_10790256 | 3300009093 | Bacteria | 1029 |
| 187 | Ga0111539_10006149 | 3300009094 | Bacteria | 15500 |
| 188 | Ga0111539_10007063 | 3300009094 | Bacteria | 14405 |
| 189 | Ga0111539_10133087 | 3300009094 | Bacteria | 2911 |
| 190 | Ga0111539_10152287 | 3300009094 | Bacteria | 2707 |
| 191 | Ga0105245_10170180 | 3300009098 | Bacteria | 2074 |
| 192 | Ga0105247_10018785 | 3300009101 | Bacteria | 4150 |
| 193 | Ga0105247_10092762 | 3300009101 | Bacteria | 1919 |
| 194 | Ga0114129_10007216 | 3300009147 | Bacteria | 15821 |
| 195 | Ga0114129_10012199 | 3300009147 | Bacteria | 12228 |
| 196 | Ga0105243_10099448 | 3300009148 | Bacteria | 2411 |
| 197 | Ga0105243_10636025 | 3300009148 | Bacteria | 1032 |
| 198 | Ga0105243_11053955 | 3300009148 | Bacteria | 819 |
| 199 | Ga0105241_10052901 | 3300009174 | Bacteria | 3103 |
| 200 | Ga0105241_10125246 | 3300009174 | Bacteria | 2074 |
| 201 | Ga0105241_10183787 | 3300009174 | Bacteria | 1736 |
| 202 | Ga0105248_10001405 | 3300009177 | Bacteria | 26896 |
| 203 | Ga0105248_10004080 | 3300009177 | Bacteria | 16149 |
| 204 | Ga0105248_10191218 | 3300009177 | Bacteria | 2306 |
| 205 | Ga0105248_10610343 | 3300009177 | Bacteria | 1231 |
| 206 | Ga0105248_10698718 | 3300009177 | Bacteria | 1144 |
| 207 | Ga0105237_10001506 | 3300009545 | Bacteria | 30623 |
| 208 | Ga0105237_10471021 | 3300009545 | Bacteria | 1262 |
| 209 | Ga0105237_10667673 | 3300009545 | Bacteria | 1046 |
| 210 | Ga0105238_10214574 | 3300009551 | Bacteria | 1901 |
| 211 | Ga0105238_10373764 | 3300009551 | Bacteria | 1416 |
| 212 | Ga0105238_10435445 | 3300009551 | Bacteria | 1307 |
| 213 | Ga0105238_10649232 | 3300009551 | Bacteria | 1065 |
| 214 | Ga0105249_10015977 | 3300009553 | Bacteria | 6654 |
| 215 | Ga0105249_10067710 | 3300009553 | Bacteria | 3290 |
| 216 | Ga0105239_10036592 | 3300010375 | Bacteria | 5389 |
| 217 | Ga0105239_10040350 | 3300010375 | Bacteria | 5114 |
| 218 | Ga0105239_10051145 | 3300010375 | Bacteria | 4530 |
| 219 | Ga0105239_11198645 | 3300010375 | Bacteria | 875 |
| 220 | Ga0105246_10055226 | 3300011119 | Bacteria | 2740 |
| 221 | Ga0157369_10782482 | 3300013105 | Bacteria | 981 |
| 222 | Ga0157374_10094982 | 3300013296 | Bacteria | 2850 |
| 223 | Ga0157378_10868436 | 3300013297 | Bacteria | 931 |
| 224 | Ga0163162_10018051 | 3300013306 | Bacteria | 6903 |
| 225 | Ga0163162_10188520 | 3300013306 | Bacteria | 2190 |
| 226 | Ga0163162_10297220 | 3300013306 | Bacteria | 1746 |
| 227 | Ga0163162_10515824 | 3300013306 | Bacteria | 1325 |
| 228 | Ga0163162_11306555 | 3300013306 | Bacteria | 824 |
| 229 | Ga0163163_10000628 | 3300014325 | Bacteria | 30437 |
| 230 | Ga0163163_10005530 | 3300014325 | Bacteria | 10941 |
| 231 | Ga0163163_10091778 | 3300014325 | Bacteria | 3052 |
| 232 | Ga0163163_10324097 | 3300014325 | Bacteria | 1594 |
| 233 | Ga0157380_10321421 | 3300014326 | Bacteria | 1435 |
| 234 | Ga0157379_10002605 | 3300014968 | Bacteria | 15162 |
| 235 | Ga0157379_10182197 | 3300014968 | Bacteria | 1897 |
| 236 | Ga0157379_10250412 | 3300014968 | Bacteria | 1608 |
| 237 | Ga0157379_10298665 | 3300014968 | Bacteria | 1467 |
| 238 | Ga0157376_10782234 | 3300014969 | Bacteria | 966 |
| 239 | Ga0214544_1021932 | 3300021320 | Bacteria | 4014 |
| 240 | Ga0214544_1039874 | 3300021320 | Bacteria | 1058 |
| 241 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 242 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 243 | Ga0214543_1000111 | 3300021327 | Bacteria | 106517 |
| 244 | Ga0213874_10035051 | 3300021377 | Bacteria | 1472 |
| 245 | Ga0213876_10000772 | 3300021384 | Bacteria | 21985 |
| 246 | Ga0213876_10025619 | 3300021384 | Bacteria | 3111 |
| 247 | Ga0209563_101874 | 3300025230 | Bacteria | 5103 |
| 248 | Ga0209677_101271 | 3300025253 | Bacteria | 11324 |
| 249 | Ga0209148_1000235 | 3300025254 | Bacteria | 90398 |
| 250 | Ga0209148_1008186 | 3300025254 | Bacteria | 2116 |
| 251 | Ga0209233_1001018 | 3300025261 | Bacteria | 11960 |
| 252 | Ga0209233_1016165 | 3300025261 | Bacteria | 2061 |
| 253 | Ga0209233_1040449 | 3300025261 | Bacteria | 1014 |
| 254 | Ga0209455_1001985 | 3300025272 | Bacteria | 8387 |
| 255 | Ga0209455_1002071 | 3300025272 | Bacteria | 8097 |
| 256 | Ga0209455_1020389 | 3300025272 | Bacteria | 1313 |
| 257 | Ga0209130_1028066 | 3300025284 | Bacteria | 1187 |
| 258 | Ga0209676_1000295 | 3300025292 | Bacteria | 100711 |
| 259 | Ga0209676_1000392 | 3300025292 | Bacteria | 79950 |
| 260 | Ga0209564_1013288 | 3300025295 | Bacteria | 3513 |
| 261 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 262 | Ga0209758_1000680 | 3300025297 | Bacteria | 50663 |
| 263 | Ga0209758_1000867 | 3300025297 | Bacteria | 41694 |
| 264 | Ga0209758_1002379 | 3300025297 | Bacteria | 19359 |
| 265 | Ga0209758_1004754 | 3300025297 | Bacteria | 11021 |
| 266 | Ga0209758_1015190 | 3300025297 | Bacteria | 4013 |
| 267 | Ga0209050_1000362 | 3300025298 | Bacteria | 87030 |
| 268 | Ga0209050_1000411 | 3300025298 | Bacteria | 79805 |
| 269 | Ga0209256_1006004 | 3300025299 | Bacteria | 6653 |
| 270 | Ga0209256_1032768 | 3300025299 | Bacteria | 1406 |
| 271 | Ga0207426_1000532 | 3300025302 | Bacteria | 54755 |
| 272 | Ga0207426_1000644 | 3300025302 | Bacteria | 43409 |
| 273 | Ga0209051_1002168 | 3300025303 | Bacteria | 14552 |
| 274 | Ga0209051_1063369 | 3300025303 | Bacteria | 1151 |
| 275 | Ga0209257_1000513 | 3300025304 | Bacteria | 67348 |
| 276 | Ga0209257_1003364 | 3300025304 | Bacteria | 13812 |
| 277 | Ga0209257_1016145 | 3300025304 | Bacteria | 3045 |
| 278 | Ga0207642_10308122 | 3300025899 | Bacteria | 920 |
| 279 | Ga0207680_10026661 | 3300025903 | Bacteria | 3206 |
| 280 | Ga0207680_10031694 | 3300025903 | Bacteria | 2997 |
| 281 | Ga0207680_10397820 | 3300025903 | Bacteria | 973 |
| 282 | Ga0207647_10011108 | 3300025904 | Bacteria | 6326 |
| 283 | Ga0207643_10134752 | 3300025908 | Bacteria | 1472 |
| 284 | Ga0207643_10333842 | 3300025908 | Bacteria | 949 |
| 285 | Ga0207705_10033457 | 3300025909 | Bacteria | 3672 |
| 286 | Ga0207705_10227182 | 3300025909 | Bacteria | 1419 |
| 287 | Ga0207684_10199588 | 3300025910 | Bacteria | 1726 |
| 288 | Ga0207654_10021126 | 3300025911 | Bacteria | 3458 |
| 289 | Ga0207654_10022953 | 3300025911 | Bacteria | 3336 |
| 290 | Ga0207707_10009506 | 3300025912 | Bacteria | 8434 |
| 291 | Ga0207707_10114888 | 3300025912 | Bacteria | 2352 |
| 292 | Ga0207707_10137271 | 3300025912 | Bacteria | 2138 |
| 293 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 294 | Ga0207695_10011375 | 3300025913 | Bacteria | 10785 |
| 295 | Ga0207695_10246184 | 3300025913 | Bacteria | 1688 |
| 296 | Ga0207671_10002697 | 3300025914 | Bacteria | 18613 |
| 297 | Ga0207671_10098843 | 3300025914 | Bacteria | 2208 |
| 298 | Ga0207660_10008941 | 3300025917 | Bacteria | 6481 |
| 299 | Ga0207662_10000523 | 3300025918 | Bacteria | 17038 |
| 300 | Ga0207657_10099254 | 3300025919 | Bacteria | 2419 |
| 301 | Ga0207657_10553588 | 3300025919 | Bacteria | 899 |
| 302 | Ga0207649_10149142 | 3300025920 | Bacteria | 1609 |
| 303 | Ga0207649_10236833 | 3300025920 | Bacteria | 1308 |
| 304 | Ga0207652_10094527 | 3300025921 | Bacteria | 2632 |
| 305 | Ga0207681_10004224 | 3300025923 | Bacteria | 8870 |
| 306 | Ga0207681_10015571 | 3300025923 | Bacteria | 4744 |
| 307 | Ga0207694_10322096 | 3300025924 | Bacteria | 1276 |
| 308 | Ga0207650_10000074 | 3300025925 | Bacteria | 134837 |
| 309 | Ga0207659_10003387 | 3300025926 | Bacteria | 9557 |
| 310 | Ga0207659_10580325 | 3300025926 | Bacteria | 955 |
| 311 | Ga0207687_10080108 | 3300025927 | Bacteria | 2356 |
| 312 | Ga0207644_10017073 | 3300025931 | Bacteria | 4894 |
| 313 | Ga0207644_10045867 | 3300025931 | Bacteria | 3111 |
| 314 | Ga0207644_10056221 | 3300025931 | Bacteria | 2839 |
| 315 | Ga0207690_10167658 | 3300025932 | Bacteria | 1643 |
| 316 | Ga0207690_10250048 | 3300025932 | Bacteria | 1369 |
| 317 | Ga0207706_10077202 | 3300025933 | Bacteria | 2929 |
| 318 | Ga0207706_10174802 | 3300025933 | Bacteria | 1887 |
| 319 | Ga0207706_10314734 | 3300025933 | Bacteria | 1363 |
| 320 | Ga0207706_10363574 | 3300025933 | Bacteria | 1257 |
| 321 | Ga0207706_10372136 | 3300025933 | Bacteria | 1241 |
| 322 | Ga0207709_10066830 | 3300025935 | Bacteria | 2266 |
| 323 | Ga0207709_10651468 | 3300025935 | Bacteria | 839 |
| 324 | Ga0207670_10113213 | 3300025936 | Bacteria | 1959 |
| 325 | Ga0207669_10024061 | 3300025937 | Bacteria | 3267 |
| 326 | Ga0207669_10223773 | 3300025937 | Bacteria | 1383 |
| 327 | Ga0207704_10280754 | 3300025938 | Unclassified | 1266 |
| 328 | Ga0207691_10308175 | 3300025940 | Bacteria | 1359 |
| 329 | Ga0207711_10011313 | 3300025941 | Bacteria | 7412 |
| 330 | Ga0207689_10005367 | 3300025942 | Bacteria | 11475 |
| 331 | Ga0207689_10415141 | 3300025942 | Bacteria | 1123 |
| 332 | Ga0207661_10022137 | 3300025944 | Bacteria | 4779 |
| 333 | Ga0207679_10046433 | 3300025945 | Bacteria | 3148 |
| 334 | Ga0207679_10135693 | 3300025945 | Bacteria | 1981 |
| 335 | Ga0207651_10006946 | 3300025960 | Bacteria | 5987 |
| 336 | Ga0207651_10033145 | 3300025960 | Bacteria | 3328 |
| 337 | Ga0207712_10042674 | 3300025961 | Bacteria | 3125 |
| 338 | Ga0207712_10075500 | 3300025961 | Bacteria | 2437 |
| 339 | Ga0207712_10734899 | 3300025961 | Bacteria | 864 |
| 340 | Ga0207668_10000246 | 3300025972 | Bacteria | 36387 |
| 341 | Ga0207668_10012632 | 3300025972 | Bacteria | 5176 |
| 342 | Ga0207668_10022658 | 3300025972 | Bacteria | 4025 |
| 343 | Ga0207668_10046069 | 3300025972 | Bacteria | 2977 |
| 344 | Ga0207668_10071593 | 3300025972 | Bacteria | 2477 |
| 345 | Ga0207668_10073452 | 3300025972 | Bacteria | 2451 |
| 346 | Ga0207668_10098235 | 3300025972 | Bacteria | 2169 |
| 347 | Ga0207668_10537758 | 3300025972 | Bacteria | 1010 |
| 348 | Ga0207640_10529115 | 3300025981 | Bacteria | 987 |
| 349 | Ga0207658_10000275 | 3300025986 | Bacteria | 53906 |
| 350 | Ga0207658_10032463 | 3300025986 | Bacteria | 3716 |
| 351 | Ga0207658_10068281 | 3300025986 | Bacteria | 2681 |
| 352 | Ga0207658_10338414 | 3300025986 | Bacteria | 1307 |
| 353 | Ga0207658_10400481 | 3300025986 | Bacteria | 1206 |
| 354 | Ga0207658_10444788 | 3300025986 | Bacteria | 1146 |
| 355 | Ga0207677_10061033 | 3300026023 | Bacteria | 2609 |
| 356 | Ga0207703_10008423 | 3300026035 | Bacteria | 8151 |
| 357 | Ga0207703_10017891 | 3300026035 | Bacteria | 5535 |
| 358 | Ga0207703_10028520 | 3300026035 | Bacteria | 4401 |
| 359 | Ga0207703_10473244 | 3300026035 | Bacteria | 1173 |
| 360 | Ga0207678_10027717 | 3300026067 | Bacteria | 4945 |
| 361 | Ga0207678_10309452 | 3300026067 | Bacteria | 1358 |
| 362 | Ga0207708_10170748 | 3300026075 | Bacteria | 1722 |
| 363 | Ga0207702_10055422 | 3300026078 | Bacteria | 3362 |
| 364 | Ga0207641_10001197 | 3300026088 | Bacteria | 26009 |
| 365 | Ga0207641_10001917 | 3300026088 | Bacteria | 19953 |
| 366 | Ga0207641_10023476 | 3300026088 | Bacteria | 5081 |
| 367 | Ga0207641_10025033 | 3300026088 | Bacteria | 4921 |
| 368 | Ga0207641_10064420 | 3300026088 | Bacteria | 3133 |
| 369 | Ga0207641_10417998 | 3300026088 | Bacteria | 1290 |
| 370 | Ga0207648_10244395 | 3300026089 | Bacteria | 1599 |
| 371 | Ga0207648_10309264 | 3300026089 | Bacteria | 1418 |
| 372 | Ga0207676_10001101 | 3300026095 | Bacteria | 20425 |
| 373 | Ga0207676_10011927 | 3300026095 | Bacteria | 6219 |
| 374 | Ga0207676_10029351 | 3300026095 | Bacteria | 4116 |
| 375 | Ga0207676_10147427 | 3300026095 | Bacteria | 2022 |
| 376 | Ga0207674_10010840 | 3300026116 | Bacteria | 10276 |
| 377 | Ga0207674_10118682 | 3300026116 | Bacteria | 2615 |
| 378 | Ga0207674_10374703 | 3300026116 | Bacteria | 1376 |
| 379 | Ga0207675_100000884 | 3300026118 | Bacteria | 29908 |
| 380 | Ga0207675_100017209 | 3300026118 | Bacteria | 6751 |
| 381 | Ga0207675_100050397 | 3300026118 | Bacteria | 3885 |
| 382 | Ga0207675_100130509 | 3300026118 | Bacteria | 2383 |
| 383 | Ga0207675_100214396 | 3300026118 | Bacteria | 1853 |
| 384 | Ga0207675_100240750 | 3300026118 | Bacteria | 1748 |
| 385 | Ga0207683_10127875 | 3300026121 | Bacteria | 2284 |
| 386 | Ga0207683_10296555 | 3300026121 | Bacteria | 1479 |
| 387 | Ga0207698_10041962 | 3300026142 | Bacteria | 3414 |
| 388 | Ga0207698_10321725 | 3300026142 | Bacteria | 1449 |
| 389 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 390 | Ga0209389_1000120 | 3300027296 | Bacteria | 70535 |
| 391 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 392 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 393 | Ga0209489_100742 | 3300027361 | Bacteria | 64218 |
| 394 | Ga0209700_100134 | 3300027363 | Bacteria | 112846 |
| 395 | Ga0207428_10049333 | 3300027907 | Bacteria | 3374 |
| 396 | Ga0268266_10007665 | 3300028379 | Bacteria | 9701 |
| 397 | Ga0268266_10060849 | 3300028379 | Bacteria | 3256 |
| 398 | Ga0268266_10099484 | 3300028379 | Bacteria | 2560 |
| 399 | Ga0268266_10131320 | 3300028379 | Bacteria | 2240 |
| 400 | Ga0268266_10242709 | 3300028379 | Bacteria | 1663 |
| 401 | Ga0268266_10264440 | 3300028379 | Bacteria | 1595 |
| 402 | Ga0268265_10000648 | 3300028380 | Bacteria | 34549 |
| 403 | Ga0268265_10004684 | 3300028380 | Bacteria | 9448 |
| 404 | Ga0268265_10004973 | 3300028380 | Bacteria | 9134 |
| 405 | Ga0268265_10056714 | 3300028380 | Bacteria | 2982 |
| 406 | Ga0268265_10211950 | 3300028380 | Bacteria | 1688 |
| 407 | Ga0268265_10313288 | 3300028380 | Bacteria | 1418 |
| 408 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 409 | Ga0268264_10000068 | 3300028381 | Bacteria | 275708 |
| 410 | Ga0268264_10043258 | 3300028381 | Bacteria | 3731 |
| 411 | Ga0268264_10099707 | 3300028381 | Bacteria | 2521 |
| 412 | Ga0268264_10104501 | 3300028381 | Bacteria | 2468 |
| 413 | Ga0265334_10037050 | 3300028573 | Bacteria | 1924 |
| 414 | Ga0307517_10002267 | 3300028786 | Bacteria | 31005 |
| 415 | Ga0265340_10145949 | 3300031247 | Bacteria | 1080 |
| 416 | Ga0265327_10029069 | 3300031251 | Bacteria | 3149 |
| 417 | Ga0307513_10000790 | 3300031456 | Bacteria | 45976 |
| 418 | Ga0307513_10036360 | 3300031456 | Bacteria | 5494 |
| 419 | Ga0307513_10050711 | 3300031456 | Bacteria | 4483 |
| 420 | Ga0307408_100012876 | 3300031548 | Bacteria | 5545 |
| 421 | Ga0307408_100049476 | 3300031548 | Bacteria | 3019 |
| 422 | Ga0307514_10133737 | 3300031649 | Bacteria | 1702 |
| 423 | Ga0307516_10012892 | 3300031730 | Bacteria | 8969 |
| 424 | Ga0307413_10338197 | 3300031824 | Bacteria | 1157 |
| 425 | Ga0307413_10357599 | 3300031824 | Bacteria | 1129 |
| 426 | Ga0307406_10304065 | 3300031901 | Bacteria | 1227 |
| 427 | Ga0307416_100142406 | 3300032002 | Bacteria | 2182 |
| 428 | Ga0307416_100642141 | 3300032002 | Unclassified | 1145 |
| 429 | Ga0307411_10390981 | 3300032005 | Bacteria | 1147 |
| 430 | Ga0307510_10085858 | 3300033180 | Bacteria | 3021 |
| 431 | Ga0373934_0025698 | 3300035086 | Bacteria | 2283 |
| 432 | Ga0373944_0065369 | 3300035089 | Bacteria | 1175 |
| 433 | Ga0373923_0021889 | 3300035111 | Bacteria | 2500 |
| 434 | Ga0373953_0053465 | 3300035117 | Bacteria | 1637 |
| 435 | Ga0373954_0040952 | 3300035118 | Bacteria | 2159 |
| 436 | Ga0373960_0069379 | 3300035121 | Bacteria | 1087 |
| 437 | Ga0373943_0012866 | 3300035170 | Bacteria | 3772 |
| 438 | Ga0373946_0050711 | 3300035171 | Bacteria | 1734 |
| 439 | Ga0373935_0121699 | 3300035692 | Bacteria | 1744 |
| 440 | Ga0373927_0028404 | 3300035695 | Bacteria | 3648 |
| 441 | Ga0373927_0155270 | 3300035695 | Bacteria | 1498 |
| 442 | Ga0373925_0088388 | 3300037068 | Bacteria | 2366 |
| 443 | Ga0395899_0000004 | 3300037312 | Bacteria | 874267 |
| 444 | Ga0395900_0001491 | 3300037418 | Bacteria | 27848 |
| 445 | Ga0395898_0064645 | 3300037466 | Bacteria | 3548 |
| 446 | Ga0395905_0002891 | 3300037471 | Bacteria | 18767 |
| 447 | Ga0395905_0122266 | 3300037471 | Bacteria | 2448 |
| 448 | Ga0395905_0172822 | 3300037471 | Bacteria | 2029 |
| 449 | Ga0436364_0162632 | 3300037853 | Bacteria | 2741 |
| 450 | Ga0395901_0189967 | 3300038443 | Bacteria | 2154 |
| 451 | Ga0395901_0199391 | 3300038443 | Bacteria | 2098 |
| 452 | Ga0395901_0216211 | 3300038443 | Bacteria | 2005 |
| 453 | Ga0436365_0608786 | 3300039437 | Bacteria | 20013 |
| 454 | Ga0436365_0925275 | 3300039437 | Bacteria | 5894 |
| 455 | Ga0436365_1234333 | 3300039437 | Bacteria | 1224 |
| 456 | Ga0436365_1378879 | 3300039437 | Bacteria | 1355 |
| 457 | Ga0436365_1556579 | 3300039437 | Bacteria | 1117 |
| 458 | Ga0436361_1177038 | 3300039447 | Bacteria | 2086 |
| 459 | Ga0451791_1620488 | 3300041451 | Bacteria | 1241 |
| 460 | Ga0451839_0850209 | 3300041496 | Bacteria | 1186 |
| 461 | Ga0439448_0169788 | 3300042005 | Bacteria | 761 |
| 462 | Ga0466969_0045176 | 3300044656 | Bacteria | 2188 |
| 463 | Ga0466972_0000126 | 3300044658 | Bacteria | 64766 |
| 464 | Ga0466972_0006136 | 3300044658 | Bacteria | 6039 |
| 465 | Ga0466972_0194704 | 3300044658 | Bacteria | 950 |
| 466 | Ga0466966_0000159 | 3300044684 | Bacteria | 43912 |
| 467 | Ga0466961_0000025 | 3300044693 | Bacteria | 96344 |
| 468 | Ga0466961_0180999 | 3300044693 | Bacteria | 1309 |
| 469 | Ga0466963_0070322 | 3300044694 | Bacteria | 2354 |
| 470 | Ga0466963_0121763 | 3300044694 | Bacteria | 1796 |
| 471 | Ga0466964_0080772 | 3300044706 | Bacteria | 1395 |
| 472 | Ga0466968_0030347 | 3300044735 | Bacteria | 2239 |
| 473 | Ga0466968_0047509 | 3300044735 | Bacteria | 1825 |
| 474 | Ga0466968_0157754 | 3300044735 | Bacteria | 1046 |
| 475 | Ga0466970_0069185 | 3300044765 | Bacteria | 1897 |
| 476 | Ga0466970_0102296 | 3300044765 | Bacteria | 1561 |
| 477 | Ga0466957_0028301 | 3300044842 | Bacteria | 3337 |
| 478 | Ga0466957_0039822 | 3300044842 | Bacteria | 2837 |
| 479 | Ga0466957_0210607 | 3300044842 | Bacteria | 1280 |
| 480 | Ga0466959_0002316 | 3300045049 | Bacteria | 12148 |
| 481 | Ga0466959_0059173 | 3300045049 | Bacteria | 2790 |
| 482 | Ga0466959_0434021 | 3300045049 | Bacteria | 891 |
| 483 | Ga0451576_0007632 | 3300045051 | Bacteria | 12867 |
| 484 | Ga0466958_0035133 | 3300045836 | Bacteria | 2994 |
| 485 | Ga0466967_0080886 | 3300045976 | Bacteria | 2933 |
| 486 | Ga0466967_0196012 | 3300045976 | Bacteria | 1911 |
| 487 | Ga0466967_0296752 | 3300045976 | Bacteria | 1554 |
| 488 | Ga0495592_0294438 | 3300046454 | Bacteria | 1057 |
| 489 | Ga0495603_0219521 | 3300046455 | Bacteria | 1097 |
| 490 | Ga0495590_0140051 | 3300046457 | Bacteria | 873 |
| 491 | Ga0495629_0207081 | 3300046459 | Bacteria | 1355 |
| 492 | Ga0495638_0003450 | 3300046460 | Bacteria | 12448 |
| 493 | Ga0495638_0019828 | 3300046460 | Bacteria | 4446 |
| 494 | Ga0495638_0084663 | 3300046460 | Bacteria | 1919 |
| 495 | Ga0495651_0005468 | 3300046462 | Bacteria | 9691 |
| 496 | Ga0495651_0018419 | 3300046462 | Bacteria | 5409 |
| 497 | Ga0495580_0145684 | 3300046472 | Bacteria | 1641 |
| 498 | Ga0495582_0069077 | 3300046473 | Bacteria | 1953 |
| 499 | Ga0495605_0045387 | 3300046474 | Bacteria | 2166 |
| 500 | Ga0495605_0124819 | 3300046474 | Bacteria | 1165 |
| 501 | Ga0495664_0013167 | 3300046477 | Bacteria | 4691 |
| 502 | Ga0495585_0231634 | 3300046492 | Bacteria | 928 |
| 503 | Ga0495583_0082007 | 3300046506 | Bacteria | 1400 |
| 504 | Ga0495583_0138259 | 3300046506 | Bacteria | 1016 |
| 505 | Ga0495583_0152608 | 3300046506 | Bacteria | 957 |
| 506 | Ga0495583_0154616 | 3300046506 | Bacteria | 949 |
| 507 | Ga0495606_0031088 | 3300046507 | Bacteria | 3717 |
| 508 | Ga0495606_0054529 | 3300046507 | Bacteria | 2589 |
| 509 | Ga0495606_0057985 | 3300046507 | Bacteria | 2491 |
| 510 | Ga0495606_0196122 | 3300046507 | Bacteria | 1154 |
| 511 | Ga0495608_0009005 | 3300046511 | Bacteria | 6981 |
| 512 | Ga0495608_0094160 | 3300046511 | Bacteria | 1935 |
| 513 | Ga0495610_0114022 | 3300046512 | Unclassified | 1193 |
| 514 | Ga0495616_0164131 | 3300046513 | Bacteria | 997 |
| 515 | Ga0495618_0008100 | 3300046514 | Bacteria | 6364 |
| 516 | Ga0495620_0118080 | 3300046515 | Bacteria | 1047 |
| 517 | Ga0495628_0023385 | 3300046516 | Bacteria | 5073 |
| 518 | Ga0495628_0295057 | 3300046516 | Bacteria | 1201 |
| 519 | Ga0495630_0110501 | 3300046517 | Bacteria | 2082 |
| 520 | Ga0495630_0124728 | 3300046517 | Bacteria | 1954 |
| 521 | Ga0495630_0247564 | 3300046517 | Bacteria | 1362 |
| 522 | Ga0495631_0126064 | 3300046518 | Bacteria | 1101 |
| 523 | Ga0495643_0046702 | 3300046522 | Bacteria | 2346 |
| 524 | Ga0495643_0085071 | 3300046522 | Bacteria | 1640 |
| 525 | Ga0495648_0051189 | 3300046524 | Bacteria | 2518 |
| 526 | Ga0495648_0104093 | 3300046524 | Bacteria | 1559 |
| 527 | Ga0495642_0010536 | 3300046528 | Bacteria | 3540 |
| 528 | Ga0495652_0005378 | 3300046529 | Bacteria | 12071 |
| 529 | Ga0495652_0098033 | 3300046529 | Bacteria | 2383 |
| 530 | Ga0495640_0004432 | 3300046533 | Bacteria | 11205 |
| 531 | Ga0495640_0007111 | 3300046533 | Bacteria | 8806 |
| 532 | Ga0495640_0070245 | 3300046533 | Bacteria | 2353 |
| 533 | Ga0495587_0009387 | 3300046536 | Bacteria | 6271 |
| 534 | Ga0495597_0021261 | 3300046542 | Bacteria | 3017 |
| 535 | Ga0495597_0093289 | 3300046542 | Bacteria | 1275 |
| 536 | Ga0495645_0002598 | 3300046543 | Bacteria | 12276 |
| 537 | Ga0495622_0050561 | 3300046557 | Bacteria | 1928 |
| 538 | Ga0495622_0095509 | 3300046557 | Bacteria | 1364 |
| 539 | Ga0495667_0003765 | 3300046559 | Bacteria | 10192 |
| 540 | Ga0495667_0255556 | 3300046559 | Bacteria | 1115 |
| 541 | Ga0495668_0000034 | 3300046616 | Bacteria | 254171 |
| 542 | Ga0495668_0007075 | 3300046616 | Bacteria | 7223 |
| 543 | Ga0495668_0083754 | 3300046616 | Bacteria | 1749 |
| 544 | Ga0495634_0029484 | 3300046642 | Bacteria | 3799 |
| 545 | Ga0495634_0147419 | 3300046642 | Bacteria | 1490 |
| 546 | Ga0495611_0057507 | 3300046648 | Bacteria | 1762 |
| 547 | Ga0495611_0205929 | 3300046648 | Bacteria | 917 |
| 548 | Ga0495625_0015738 | 3300046660 | Bacteria | 5974 |
| 549 | Ga0495625_0230508 | 3300046660 | Bacteria | 1210 |
| 550 | Ga0495625_0396261 | 3300046660 | Bacteria | 863 |
| 551 | Ga0495635_0013279 | 3300046663 | Bacteria | 5763 |
| 552 | Ga0495635_0165135 | 3300046663 | Bacteria | 1506 |
| 553 | Ga0495659_0167861 | 3300046664 | Bacteria | 889 |
| 554 | Ga0495588_0038051 | 3300046674 | Bacteria | 2446 |
| 555 | Ga0495588_0049869 | 3300046674 | Bacteria | 2154 |
| 556 | Ga0495657_0003405 | 3300046675 | Bacteria | 12988 |
| 557 | Ga0495657_0006555 | 3300046675 | Bacteria | 9098 |
| 558 | Ga0495599_0070928 | 3300046678 | Bacteria | 2175 |
| 559 | Ga0495623_0049425 | 3300046679 | Bacteria | 2665 |
| 560 | Ga0495646_0057843 | 3300046680 | Bacteria | 2319 |
| 561 | Ga0495669_0000012 | 3300046684 | Bacteria | 157373 |
| 562 | Ga0495669_0000329 | 3300046684 | Bacteria | 25520 |
| 563 | Ga0495613_0003009 | 3300046689 | Bacteria | 12624 |
| 564 | Ga0495613_0102176 | 3300046689 | Bacteria | 2070 |
| 565 | Ga0495624_0034987 | 3300046690 | Bacteria | 3245 |
| 566 | Ga0495624_0099482 | 3300046690 | Bacteria | 1791 |
| 567 | Ga0495624_0146512 | 3300046690 | Bacteria | 1445 |
| 568 | Ga0495624_0196764 | 3300046690 | Bacteria | 1225 |
| 569 | Ga0495649_0026228 | 3300046694 | Bacteria | 3243 |
| 570 | Ga0495649_0134072 | 3300046694 | Bacteria | 1306 |
| 571 | Ga0495600_0001163 | 3300046809 | Bacteria | 14343 |
| 572 | Ga0495600_0002699 | 3300046809 | Bacteria | 10259 |
| 573 | Ga0495581_0035817 | 3300047315 | Bacteria | 2871 |
| 574 | Ga0495604_0004948 | 3300047317 | Bacteria | 10560 |
| 575 | Ga0495604_0007447 | 3300047317 | Bacteria | 8668 |
| 576 | Ga0495674_0005194 | 3300047319 | Bacteria | 12504 |
| 577 | Ga0495674_0114771 | 3300047319 | Bacteria | 2280 |
| 578 | Ga0495674_0550661 | 3300047319 | Bacteria | 918 |
| 579 | Ga0495676_0057442 | 3300047321 | Bacteria | 3069 |
| 580 | Ga0495676_0184398 | 3300047321 | Bacteria | 1460 |
| 581 | Ga0495680_0003348 | 3300047322 | Bacteria | 15847 |
| 582 | Ga0495687_014030 | 3300047443 | Bacteria | 4146 |
| 583 | Ga0495687_057524 | 3300047443 | Bacteria | 1617 |
| 584 | Ga0495687_070661 | 3300047443 | Bacteria | 1401 |
| 585 | Ga0495673_0005594 | 3300047469 | Bacteria | 7566 |
| 586 | Ga0495684_0075157 | 3300047471 | Bacteria | 2567 |
| 587 | Ga0495684_0087920 | 3300047471 | Bacteria | 2355 |
| 588 | Ga0495686_0171195 | 3300047472 | Bacteria | 1263 |
| 589 | Ga0495686_0271905 | 3300047472 | Bacteria | 945 |
| 590 | Ga0495593_0044852 | 3300047673 | Bacteria | 2363 |
| 591 | Ga0495602_0122294 | 3300048088 | Bacteria | 2092 |
| 592 | Ga0495602_0130280 | 3300048088 | Bacteria | 2007 |
| 593 | Ga0496100_0025256 | 3300048903 | Bacteria | 3633 |
| 594 | Ga0496100_0032143 | 3300048903 | Bacteria | 3269 |
| 595 | Ga0496100_0096777 | 3300048903 | Bacteria | 2026 |
| 596 | Ga0496100_0125231 | 3300048903 | Bacteria | 1803 |
| 597 | Ga0496101_0070728 | 3300048904 | Bacteria | 2556 |
| 598 | Ga0496101_0484307 | 3300048904 | Bacteria | 977 |
| 599 | Ga0496102_0015458 | 3300048905 | Bacteria | 6648 |
| 600 | Ga0496102_0035768 | 3300048905 | Bacteria | 4472 |
| 601 | Ga0496103_0005690 | 3300048906 | Bacteria | 7449 |
| 602 | Ga0496103_0101212 | 3300048906 | Bacteria | 1824 |
| 603 | Ga0496103_0183173 | 3300048906 | Bacteria | 1346 |
| 604 | Ga0496104_0003185 | 3300048907 | Bacteria | 14108 |
| 605 | Ga0496104_0008463 | 3300048907 | Bacteria | 9147 |
| 606 | Ga0496104_0114232 | 3300048907 | Bacteria | 2589 |
| 607 | Ga0496104_0197406 | 3300048907 | Bacteria | 1924 |
| 608 | Ga0496105_0018799 | 3300048908 | Bacteria | 5564 |
| 609 | Ga0496105_0035775 | 3300048908 | Bacteria | 4089 |
| 610 | Ga0496105_0079740 | 3300048908 | Bacteria | 2703 |
| 611 | Ga0496105_0514935 | 3300048908 | Bacteria | 938 |
| 612 | Ga0496106_0044673 | 3300048909 | Bacteria | 3326 |
| 613 | Ga0496106_0124404 | 3300048909 | Bacteria | 2018 |
| 614 | Ga0496108_0019640 | 3300048911 | Bacteria | 5550 |
| 615 | Ga0496108_0105662 | 3300048911 | Bacteria | 2404 |
| 616 | Ga0496109_0013914 | 3300048912 | Bacteria | 6995 |
| 617 | Ga0496109_0016209 | 3300048912 | Bacteria | 6513 |
| 618 | Ga0496109_0165494 | 3300048912 | Bacteria | 2073 |
| 619 | Ga0496109_0204509 | 3300048912 | Bacteria | 1856 |
| 620 | Ga0496109_0793397 | 3300048912 | Bacteria | 885 |
| 621 | Ga0496110_0067641 | 3300048913 | Bacteria | 3161 |
| 622 | Ga0496110_0503799 | 3300048913 | Bacteria | 1102 |
| 623 | Ga0496112_0050449 | 3300048915 | Bacteria | 4081 |
| 624 | Ga0496112_0130692 | 3300048915 | Bacteria | 2482 |
| 625 | Ga0496112_0150261 | 3300048915 | Bacteria | 2296 |
| 626 | Ga0496112_0184840 | 3300048915 | Bacteria | 2048 |
| 627 | Ga0496112_0253686 | 3300048915 | Bacteria | 1710 |
| 628 | Ga0496113_0009710 | 3300048916 | Bacteria | 6322 |
| 629 | Ga0496113_0033695 | 3300048916 | Bacteria | 3732 |
| 630 | Ga0496113_0040589 | 3300048916 | Bacteria | 3430 |
| 631 | Ga0496113_0116713 | 3300048916 | Bacteria | 2083 |
| 632 | Ga0496113_0178684 | 3300048916 | Bacteria | 1682 |
| 633 | Ga0496114_0146077 | 3300048917 | Bacteria | 2050 |
| 634 | Ga0496114_0313912 | 3300048917 | Bacteria | 1385 |
| 635 | Ga0496115_0140239 | 3300048918 | Bacteria | 1994 |
| 636 | Ga0496115_0288105 | 3300048918 | Bacteria | 1347 |
| 637 | Ga0496115_0619866 | 3300048918 | Bacteria | 858 |
| 638 | Ga0496116_0033293 | 3300048919 | Bacteria | 3659 |
| 639 | Ga0496117_0025029 | 3300048920 | Bacteria | 4702 |
| 640 | Ga0496118_0005681 | 3300048921 | Bacteria | 14053 |
| 641 | Ga0496118_0041059 | 3300048921 | Bacteria | 3669 |
| 642 | Ga0496118_0055902 | 3300048921 | Bacteria | 2972 |
| 643 | Ga0496118_0125404 | 3300048921 | Bacteria | 1663 |
| 644 | Ga0496118_0193079 | 3300048921 | Bacteria | 1215 |
| 645 | Ga0496119_0021805 | 3300048922 | Bacteria | 4612 |
| 646 | Ga0496119_0026130 | 3300048922 | Bacteria | 4056 |
| 647 | Ga0496121_0001066 | 3300048924 | Bacteria | 48544 |
| 648 | Ga0496121_0066696 | 3300048924 | Bacteria | 2920 |
| 649 | Ga0496121_0157466 | 3300048924 | Bacteria | 1665 |
| 650 | Ga0496121_0197403 | 3300048924 | Bacteria | 1437 |
| 651 | Ga0496121_0411687 | 3300048924 | Bacteria | 882 |
| 652 | Ga0496121_0513545 | 3300048924 | Bacteria | 758 |
| 653 | Ga0496124_0016356 | 3300048927 | Bacteria | 7058 |
| 654 | Ga0496124_0080458 | 3300048927 | Bacteria | 2681 |
| 655 | Ga0496124_0237763 | 3300048927 | Bacteria | 1357 |
| 656 | Ga0496125_0028152 | 3300048928 | Bacteria | 5081 |
| 657 | Ga0496125_0072992 | 3300048928 | Bacteria | 2671 |
| 658 | Ga0496125_0119781 | 3300048928 | Bacteria | 1881 |
| 659 | Ga0496125_0285277 | 3300048928 | Bacteria | 1020 |
| 660 | Ga0496126_0010533 | 3300048929 | Bacteria | 9681 |
| 661 | Ga0496126_0198828 | 3300048929 | Bacteria | 1694 |
| 662 | Ga0496126_0428478 | 3300048929 | Bacteria | 1068 |
| 663 | Ga0496126_0442614 | 3300048929 | Bacteria | 1047 |
| 664 | Ga0495682_0087758 | 3300049460 | Bacteria | 1118 |
| 665 | Ga0501033_0757333 | 3300049570 | Bacteria | 658 |
| 666 | Ga0501034_0636591 | 3300049571 | Bacteria | 969 |
| 667 | Ga0501047_0023878 | 3300049581 | Bacteria | 5872 |
| 668 | Ga0501257_000824 | 3300049686 | Bacteria | 6198 |
| 669 | nmdc:mga03683_7412_c1 | 3300050489 | Bacteria | 3809 |
| 670 | nmdc:mga03n38_14325_c1 | 3300050490 | Bacteria | 3036 |
| 671 | nmdc:mga00v17_201692_c1 | 3300050491 | Bacteria | 1286 |
| 672 | nmdc:mga00v17_95984_c1 | 3300050491 | Bacteria | 1867 |
| 673 | nmdc:mga0yw44_26093_c1 | 3300050492 | Bacteria | 3333 |
| 674 | nmdc:mga0yw44_27511_c1 | 3300050492 | Bacteria | 3258 |
| 675 | nmdc:mga0yw44_52080_c1 | 3300050492 | Bacteria | 2481 |
| 676 | nmdc:mga0yw44_9882_c1 | 3300050492 | Bacteria | 4846 |
| 677 | nmdc:mga06z11_29475_c1 | 3300050494 | Bacteria | 2645 |
| 678 | nmdc:mga07m45_14663_c1 | 3300050496 | Bacteria | 4180 |
| 679 | nmdc:mga07m45_82834_c1 | 3300050496 | Bacteria | 1832 |
| 680 | nmdc:mga05p37_65585_c1 | 3300050507 | Bacteria | 4467 |
| 681 | nmdc:mga09592_17751_c1 | 3300050508 | Bacteria | 5832 |
| 682 | nmdc:mga09592_217857_c1 | 3300050508 | Bacteria | 1654 |
| 683 | nmdc:mga09592_9742_c1 | 3300050508 | Bacteria | 7804 |
| 684 | nmdc:mga0qj67_195654_c1 | 3300050509 | Bacteria | 1643 |
| 685 | nmdc:mga0qj67_203108_c1 | 3300050509 | Bacteria | 1610 |
| 686 | nmdc:mga0qj67_570786_c1 | 3300050509 | Bacteria | 906 |
| 687 | nmdc:mga0qj67_581213_c1 | 3300050509 | Bacteria | 897 |
| 688 | nmdc:mga0qj67_8245_c1 | 3300050509 | Bacteria | 7724 |
| 689 | nmdc:mga06r32_170149_c1 | 3300050510 | Bacteria | 2162 |
| 690 | nmdc:mga06r32_5432_c1 | 3300050510 | Bacteria | 11470 |
| 691 | nmdc:mga06r32_6743_c1 | 3300050510 | Bacteria | 10321 |
| 692 | nmdc:mga06r32_6843_c1 | 3300050510 | Bacteria | 10245 |
| 693 | nmdc:mga08y16_107902_c1 | 3300050511 | Bacteria | 2898 |
| 694 | nmdc:mga08y16_33755_c1 | 3300050511 | Bacteria | 5374 |
| 695 | nmdc:mga0n895_308020_c1 | 3300050512 | Bacteria | 1605 |
| 696 | nmdc:mga0n895_607555_c1 | 3300050512 | Bacteria | 1095 |
| 697 | nmdc:mga0sz30_100590_c1 | 3300050516 | Bacteria | 1263 |
| 698 | nmdc:mga0sz30_155091_c1 | 3300050516 | Bacteria | 1014 |
| 699 | nmdc:mga0sz30_49302_c2 | 3300050516 | Bacteria | 1449 |
| 700 | nmdc:mga0sz30_57533_c1 | 3300050516 | Bacteria | 1657 |
| 701 | Ga0495601_0044885 | 3300053077 | Bacteria | 2778 |
| 702 | Ga0500635_0000045 | 3300053080 | Bacteria | 87314 |
| 703 | Ga0495595_0007151 | 3300053084 | Bacteria | 4561 |
| 704 | Ga0495619_0028832 | 3300053085 | Bacteria | 3582 |
| 705 | Ga0500578_0333277 | 3300053086 | Bacteria | 891 |
| 706 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 707 | Ga0500647_0011504 | 3300053091 | Bacteria | 3954 |
| 708 | Ga0500647_0076024 | 3300053091 | Bacteria | 1611 |
| 709 | Ga0500583_0119470 | 3300053092 | Bacteria | 1303 |
| 710 | Ga0500651_0040865 | 3300053093 | Bacteria | 2922 |
| 711 | Ga0500651_0319200 | 3300053093 | Bacteria | 887 |
| 712 | Ga0500566_0029401 | 3300053094 | Bacteria | 3210 |
| 713 | Ga0500641_0017462 | 3300053096 | Bacteria | 2683 |
| 714 | Ga0500555_002104 | 3300053103 | Bacteria | 5843 |
| 715 | Ga0500556_0194460 | 3300053104 | Bacteria | 801 |
| 716 | Ga0500557_000011 | 3300053105 | Bacteria | 117471 |
| 717 | Ga0500562_003210 | 3300053108 | Bacteria | 4078 |
| 718 | Ga0500569_003209 | 3300053109 | Bacteria | 3311 |
| 719 | Ga0500569_021786 | 3300053109 | Bacteria | 1698 |
| 720 | Ga0500592_016601 | 3300053116 | Bacteria | 1182 |
| 721 | Ga0500595_015325 | 3300053119 | Bacteria | 2881 |
| 722 | Ga0500595_032316 | 3300053119 | Bacteria | 1748 |
| 723 | Ga0500595_054221 | 3300053119 | Bacteria | 1231 |
| 724 | Ga0500597_166015 | 3300053120 | Bacteria | 943 |
| 725 | Ga0500608_001733 | 3300053122 | Bacteria | 7792 |
| 726 | Ga0500617_073850 | 3300053124 | Bacteria | 1489 |
| 727 | Ga0500642_0000301 | 3300053130 | Bacteria | 17687 |
| 728 | Ga0500642_0008296 | 3300053130 | Bacteria | 3548 |
| 729 | Ga0500559_0007118 | 3300053136 | Bacteria | 4987 |
| 730 | Ga0500559_0051187 | 3300053136 | Bacteria | 1823 |
| 731 | Ga0500588_0004033 | 3300053146 | Unclassified | 3148 |
| 732 | Ga0500590_021318 | 3300053148 | Bacteria | 3363 |
| 733 | Ga0500590_047676 | 3300053148 | Bacteria | 2186 |
| 734 | Ga0500616_0024396 | 3300053153 | Bacteria | 3361 |
| 735 | Ga0500619_001544 | 3300053154 | Bacteria | 4120 |
| 736 | Ga0500619_057392 | 3300053154 | Bacteria | 1273 |
| 737 | Ga0500622_0005376 | 3300053156 | Bacteria | 7713 |
| 738 | Ga0500622_0018371 | 3300053156 | Bacteria | 3719 |
| 739 | Ga0500638_066433 | 3300053162 | Bacteria | 1728 |
| 740 | Ga0500638_068604 | 3300053162 | Bacteria | 1697 |
| 741 | Ga0500639_091414 | 3300053163 | Bacteria | 1515 |
| 742 | Ga0500636_0001919 | 3300053177 | Bacteria | 11418 |
| 743 | Ga0500636_0019470 | 3300053177 | Bacteria | 4017 |
| 744 | Ga0500636_0055172 | 3300053177 | Bacteria | 2329 |
| 745 | Ga0500636_0094100 | 3300053177 | Bacteria | 1712 |
| 746 | Ga0500636_0235116 | 3300053177 | Bacteria | 945 |
| 747 | Ga0500636_0255736 | 3300053177 | Bacteria | 890 |
| 748 | Ga0500637_0042240 | 3300053178 | Bacteria | 2577 |
| 749 | Ga0500576_074544 | 3300053725 | Bacteria | 1450 |
| 750 | Ga0500625_000880 | 3300053729 | Bacteria | 9315 |
| 751 | Ga0500645_054817 | 3300053730 | Bacteria | 1159 |
| 752 | Ga0500609_000528 | 3300053731 | Bacteria | 5735 |
| 753 | Ga0500552_003952 | 3300053733 | Bacteria | 1534 |
| 754 | Ga0500596_004770 | 3300053735 | Bacteria | 2452 |
| 755 | Ga0500599_010576 | 3300053736 | Bacteria | 1220 |
| 756 | Ga0500601_000238 | 3300053737 | Bacteria | 10761 |
| 757 | Ga0500587_000787 | 3300053739 | Bacteria | 4124 |
| 758 | Ga0500661_015862 | 3300055283 | Bacteria | 1350 |
| 759 | 2507511517 | 2507262055 | Bacteria | 8048963 |
| 760 | 2508545324 | 2508501009 | Bacteria | 7784016 |
| 761 | 2508694153 | 2508501042 | Bacteria | 8719808 |
| 762 | 2513625445 | 2513237092 | Bacteria | 8341956 |
| 763 | 2513640957 | 2513237094 | Bacteria | 8789602 |
| 764 | 2513648367 | 2513237095 | Bacteria | 8976980 |
| 765 | 2513705038 | 2513237102 | Bacteria | 7703324 |
| 766 | 2513716331 | 2513237104 | Bacteria | 10034502 |
| 767 | 2513875120 | 2513237139 | Bacteria | 8737671 |
| 768 | 2514013806 | 2513237161 | Bacteria | 8871253 |
| 769 | 2515624912 | 2515154112 | Bacteria | 8294334 |
| 770 | 2517101284 | 2517093001 | Bacteria | 9002274 |
| 771 | 2524440697 | 2524023205 | Bacteria | 8918781 |
| 772 | 2528854483 | 2528768022 | Bacteria | 10457665 |
| 773 | 2587918915 | 2585428106 | Bacteria | 5179711 |
| 774 | 2617348316 | 2617270735 | Bacteria | 9163226 |
| 775 | 2617374858 | 2617270741 | Bacteria | 8201522 |
| 776 | 2643998399 | 2643221598 | Bacteria | 4578346 |
| 777 | 2644086736 | 2643221614 | Bacteria | 4260023 |
| 778 | 2644227658 | 2643221640 | Bacteria | 5258820 |
| 779 | 2644236824 | 2643221642 | Bacteria | 5357871 |
| 780 | 2644341690 | 2643221661 | Bacteria | 4267604 |
| 781 | 2644367977 | 2643221666 | Bacteria | 4265935 |
| 782 | 2745075937 | 2744054633 | Bacteria | 8678936 |
| 783 | 2793061406 | 2791355196 | Bacteria | 7323613 |
| 784 | 2793069797 | 2791355197 | Bacteria | 8420563 |
| 785 | 2805916289 | 2802429603 | Bacteria | 8777136 |
| 786 | 2818239949 | 2816332527 | Bacteria | 8933356 |
| 787 | 2824607646 | 2824600985 | Bacteria | 8488197 |
| 788 | 2824614347 | 2824609381 | Bacteria | 8672835 |
| 789 | 2824622354 | 2824617872 | Bacteria | 8814715 |
| 790 | 2824631433 | 2824626560 | Bacteria | 8813858 |
| 791 | 2824637953 | 2824635225 | Bacteria | 8785348 |
| 792 | 2824652425 | 2824644064 | Bacteria | 8743947 |
| 793 | 2824656791 | 2824653114 | Bacteria | 8493680 |
| 794 | 2824664197 | 2824661429 | Bacteria | 9877870 |
| 795 | 2824678370 | 2824671348 | Bacteria | 8369588 |
| 796 | 2824683590 | 2824679649 | Bacteria | 8248951 |
| 797 | 2824690580 | 2824687955 | Bacteria | 8360029 |
| 798 | 2824697839 | 2824696289 | Bacteria | 8335049 |
| 799 | 2824710469 | 2824704595 | Bacteria | 9667483 |
| 800 | 2824723394 | 2824714736 | Bacteria | 8717648 |
| 801 | 2824731872 | 2824723954 | Bacteria | 8758240 |
| 802 | 2824736452 | 2824732956 | Bacteria | 7810675 |
| 803 | 2824748873 | 2824746037 | Bacteria | 7911610 |
| 804 | 2824760877 | 2824753945 | Bacteria | 9787441 |
| 805 | 2824770331 | 2824763712 | Bacteria | 9792355 |
| 806 | 2824776283 | 2824773399 | Bacteria | 8360218 |
| 807 | 2838130699 | 2838122688 | Bacteria | 8803140 |
| 808 | 2841947087 | 2841941048 | Bacteria | 8688029 |
| 809 | 2841954982 | 2841949485 | Bacteria | 8680857 |
| 810 | 2841965006 | 2841957949 | Bacteria | 8652217 |
| 811 | 2841969940 | 2841966195 | Bacteria | 8673214 |
| 812 | 2841981868 | 2841974524 | Bacteria | 8931498 |
| 813 | 2841990166 | 2841983080 | Bacteria | 8395090 |
| 814 | 2842042180 | 2842038055 | Bacteria | 8002051 |
| 815 | 2842050223 | 2842045827 | Bacteria | 8006841 |
| 816 | 2844316399 | 2844315083 | Bacteria | 8138177 |
| 817 | 2847939300 | 2847930680 | Bacteria | 9342022 |
| 818 | 2847943727 | 2847939898 | Bacteria | 8606328 |
| 819 | 2849082039 | 2849076700 | Bacteria | 7039503 |
| 820 | 2857513481 | 2857509624 | Bacteria | 7472071 |
| 821 | 2874594729 | 2874590934 | Bacteria | 8299676 |
| 822 | 2874615847 | 2874612657 | Bacteria | 8252029 |
| 823 | 2874622612 | 2874620515 | Bacteria | 8290088 |
| 824 | 2874633545 | 2874628541 | Bacteria | 8630250 |
| 825 | 2874647307 | 2874645413 | Bacteria | 8214782 |
| 826 | 2876765362 | 2876761206 | Bacteria | 10111113 |
| 827 | 2876773861 | 2876771140 | Bacteria | 8287509 |
| 828 | 2876819901 | 2876818435 | Bacteria | 8274608 |
| 829 | 2879076020 | 2879074833 | Bacteria | 8279565 |
| 830 | 2879086973 | 2879083081 | Bacteria | 8587928 |
| 831 | 2879104268 | 2879099564 | Bacteria | 10442239 |
| 832 | 2879129374 | 2879127579 | Bacteria | 8294491 |
| 833 | 2879144052 | 2879142872 | Bacteria | 8267021 |
| 834 | 2881369464 | 2881364244 | Bacteria | 7710352 |
| 835 | 2881668308 | 2881665667 | Bacteria | 8175609 |
| 836 | 2884961425 | 2884960567 | Bacteria | 5437054 |
| 837 | 2885373610 | 2885366525 | Bacteria | 8326213 |
| 838 | 2885380148 | 2885374607 | Bacteria | 8927485 |
| 839 | 2885412564 | 2885409591 | Bacteria | 9235467 |
| 840 | 2888387100 | 2888378607 | Bacteria | 9652610 |
| 841 | 2888389778 | 2888388044 | Bacteria | 7304136 |
| 842 | 2888421318 | 2888419890 | Bacteria | 7857137 |
| 843 | 2903728267 | 2903727486 | Bacteria | 8281579 |
| 844 | 2904671381 | 2904666416 | Bacteria | 8226587 |
| 845 | 2904693825 | 2904690495 | Bacteria | 9412302 |
| 846 | 2904719670 | 2904711408 | Bacteria | 9771557 |
| 847 | 2906606407 | 2906602504 | Bacteria | 8295279 |
| 848 | 2906629101 | 2906626472 | Bacteria | 8826946 |
| 849 | 2906644621 | 2906643746 | Bacteria | 8722424 |
| 850 | 2908758393 | 2908756301 | Bacteria | 8864324 |
| 851 | 2908777340 | 2908775508 | Bacteria | 8092255 |
| 852 | 2922377244 | |||
| 853 | 2922398376 | 2922393267 | Bacteria | 8285685 |
| 854 | 2928531643 | 2928531327 | Bacteria | 5101314 |
| 855 | 2929623641 | 2929615660 | Bacteria | 9193770 |
| 856 | 2929632656 | 2929624759 | Bacteria | 9339455 |
| 857 | 2932793085 | 2932784394 | Bacteria | 9704911 |
| 858 | 2932795892 | 2932794094 | Bacteria | 7915132 |
| 859 | 2932802130 | 2932801729 | Bacteria | 7987968 |
| 860 | 2932814647 | 2932809354 | Bacteria | 9135765 |
| 861 | 2932823502 | 2932818245 | Bacteria | 9955613 |
| 862 | 2932832940 | 2932828146 | Bacteria | 9745859 |
| 863 | 2933585545 | 2933577622 | Bacteria | 9116884 |
| 864 | 2935616293 | 2935608549 | Bacteria | 8203142 |
| 865 | 2935623670 | 2935616580 | Bacteria | 9032984 |
| 866 | 2935639440 | 2935638405 | Bacteria | 10015038 |
| 867 | 2935650690 | 2935648319 | Bacteria | 8801166 |
| 868 | 2935662070 | 2935656913 | Bacteria | 8965014 |
| 869 | 2935670387 | 2935665750 | Bacteria | 9571747 |
| 870 | 2935679815 | 2935675223 | Bacteria | 9928132 |
| 871 | 2935687386 | 2935684952 | Bacteria | 9590419 |
| 872 | 2935696643 | 2935694250 | Bacteria | 9291695 |
| 873 | 2935705461 | 2935703347 | Bacteria | 10242284 |
| 874 | 2935718845 | 2935713505 | Bacteria | 9608509 |
| 875 | 2935728497 | 2935722832 | Bacteria | 9608746 |
| 876 | 2935736906 | 2935732158 | Bacteria | 9706831 |
| 877 | 2935746091 | 2935741537 | Bacteria | 9707219 |
| 878 | 2935753352 | 2935750917 | Bacteria | 9590372 |
| 879 | 2935766254 | 2935760218 | Bacteria | 9817913 |
| 880 | 2935807204 | 2935801545 | Bacteria | 9301974 |
| 881 | 2935813883 | 2935810662 | Bacteria | 9401221 |
| 882 | 2935827090 | 2935819856 | Bacteria | 8261050 |
| 883 | 2935828923 | 2935827899 | Bacteria | 10038562 |
| 884 | 2935844097 | 2935837841 | Bacteria | 9454360 |
| 885 | 2935854271 | 2935847175 | Bacteria | 8228321 |
| 886 | 2935862105 | 2935855204 | Bacteria | 9035059 |
| 887 | 2935871669 | 2935864058 | Bacteria | 9784707 |
| 888 | 2935880220 | 2935873716 | Bacteria | 9632195 |
| 889 | 2935886318 | 2935883170 | Bacteria | 7964738 |
| 890 | 2935913636 | 2935908558 | Bacteria | 8568796 |
| 891 | 2935923534 | 2935916978 | Bacteria | 9113783 |
| 892 | 2935931047 | 2935926038 | Bacteria | 8601059 |
| 893 | 2935935329 | 2935934488 | Bacteria | 8602579 |
| 894 | 2935946895 | 2935942939 | Bacteria | 8599779 |
| 895 | 2935954010 | 2935951376 | Bacteria | 8602333 |
| 896 | 2935961345 | 2935959822 | Bacteria | 7869783 |
| 897 | 2935969036 | 2935967501 | Bacteria | 8603075 |
| 898 | 2935983558 | 2935975950 | Bacteria | 8347125 |
| 899 | 2935985776 | 2935984226 | Bacteria | 8302647 |
| 900 | 2935996886 | 2935992306 | Bacteria | 9802711 |
| 901 | 2936005920 | 2936002035 | Bacteria | 9362176 |
| 902 | 2936016348 | 2936011229 | Bacteria | 8801034 |
| 903 | 2936025004 | 2936019824 | Bacteria | 8804134 |
| 904 | 2936033653 | 2936028420 | Bacteria | 8965941 |
| 905 | 2936039438 | 2936037263 | Bacteria | 9446081 |
| 906 | 2936050915 | 2936046547 | Bacteria | 8903709 |
| 907 | 2936057663 | 2936055302 | Bacteria | 8785755 |
| 908 | 2940559265 | 2940556831 | Bacteria | 9590747 |
| 909 | 2941536883 | 2941531003 | Bacteria | 7653939 |
| 910 | 2941541959 | 2941538514 | Bacteria | 9402094 |
| 911 | 3005491204 | 3005483717 | Bacteria | 7877331 |
| 912 | 3005511049 | 3005506211 | Bacteria | 6943378 |
| 913 | 3005591888 | 3005587118 | Bacteria | 7794411 |
| 914 | 3005596005 | 3005594810 | Bacteria | 8716512 |
| 915 | 3005711962 | 3005710791 | Bacteria | 7622528 |
| 916 | 3005719205 | 3005718088 | Bacteria | 8283608 |
| 917 | 8006927826 | 8006926726 | Bacteria | 6749210 |
| 918 | 8016517113 | 8016511872 | Bacteria | 9921665 |
| 919 | 8016588451 | 8016583857 | Bacteria | 10421953 |
| 920 | 8016637505 | 8016630954 | Bacteria | 9217207 |
| 921 | 8017059470 | 8017057580 | Bacteria | 10023680 |
| 922 | 8019578929 | 8019576017 | Bacteria | 10049540 |
| 923 | 8019596975 | 8019586578 | Bacteria | 10212056 |
| 924 | 8019604706 | 8019597564 | Bacteria | 10041141 |
| 925 | 8019613819 | 8019608314 | Bacteria | 10042931 |
| 926 | 8019624405 | 8019619141 | Bacteria | 9218857 |
| 927 | 8019637633 | 8019629233 | Bacteria | 8687553 |
| 928 | 8019641984 | 8019638758 | Bacteria | 9062356 |
| 929 | 8019650566 | 8019648815 | Bacteria | 10014479 |
| 930 | 8019665560 | 8019659431 | Bacteria | 8577854 |
| 931 | 8019675107 | 8019668869 | Bacteria | 8791617 |
| 932 | 8019680998 | 8019678201 | Bacteria | 8863603 |
| 933 | 8055749802 | 8055742211 | Bacteria | 9226248 |
| 934 | 8056974012 | 8056967851 | Bacteria | 9038162 |
| 935 | Ga0495625_0182216 | |||
| 936 | JGI24739J22299_10019620 | |||
| 937 | JGI25153J46596_10000732 | |||
| 938 | JGI25153J46596_10004233 | |||
| 939 | JGI25153J46596_10008565 | |||
| 940 | JGI25153J46596_10009899 | |||
| 941 | rootH2_10044168 | |||
| 942 | rootL2_10058382 | |||
| 943 | JGI25160J50197_1001947 | |||
| 944 | JGI25160J50197_1011819 | |||
| 945 | JGI25160J50197_1030521 | |||
| 946 | Ga0055542_1003059 | |||
| 947 | Ga0055536_1000576 | |||
| 948 | Ga0055536_1000606 | |||
| 949 | Ga0055530_10004098 | |||
| 950 | Ga0055530_10009857 | |||
| 951 | Ga0055540_1024409 | |||
| 952 | Ga0055531_10000294 | |||
| 953 | Ga0055531_10012403 | |||
| 954 | Ga0055543_1003066 | |||
| 955 | Ga0065165_1002046 | |||
| 956 | Ga0065165_1002144 | |||
| 957 | Ga0065712_10075409 | |||
| 958 | Ga0065712_10166263 | |||
| 959 | Ga0070658_10286389 | |||
| 960 | Ga0070690_100021139 | |||
| 961 | Ga0070690_100483710 | |||
| 962 | Ga0070670_100000032 | |||
| 963 | Ga0070670_100004709 | |||
| 964 | Ga0070670_100123191 | |||
| 965 | Ga0070670_100217269 | |||
| 966 | Ga0068869_100015582 | |||
| 967 | Ga0068869_100059446 | |||
| 968 | Ga0070666_10047736 | |||
| 969 | Ga0070666_10456853 | |||
| 970 | Ga0070680_100050255 | |||
| 971 | Ga0068868_100439293 | |||
| 972 | Ga0070660_100054341 | |||
| 973 | Ga0070689_100000337 | |||
| 974 | Ga0070687_100081866 | |||
| 975 | Ga0070661_100127898 | |||
| 976 | Ga0070668_100000975 | |||
| 977 | Ga0070668_100004762 | |||
| 978 | Ga0070668_100007849 | |||
| 979 | Ga0070668_100007904 | |||
| 980 | Ga0070668_100088866 | |||
| 981 | Ga0070669_100015826 | |||
| 982 | Ga0070669_100079827 | |||
| 983 | Ga0070669_100089976 | |||
| 984 | Ga0070675_100000590 | |||
| 985 | Ga0070675_100242533 | |||
| 986 | Ga0070671_100019456 | |||
| 987 | Ga0070671_100055425 | |||
| 988 | Ga0070671_100058724 | |||
| 989 | Ga0070671_100065351 | |||
| 990 | Ga0070671_100083308 | |||
| 991 | Ga0070674_100027551 | |||
| 992 | Ga0070674_100151164 | |||
| 993 | Ga0070674_100156508 | |||
| 994 | Ga0070674_100691939 | |||
| 995 | Ga0070673_100059214 | |||
| 996 | Ga0070688_100013340 | |||
| 997 | Ga0070659_100545920 | |||
| 998 | Ga0070667_100000110 | |||
| 999 | Ga0070667_100015527 | |||
| 1000 | Ga0070667_100053948 | |||
| 1001 | Ga0070667_100094456 | |||
| 1002 | Ga0070667_100441689 | |||
| 1003 | Ga0070667_100448697 | |||
| 1004 | Ga0070667_100650934 | |||
| 1005 | Ga0070701_10075713 | |||
| 1006 | Ga0070705_100022249 | |||
| 1007 | Ga0070700_100049110 | |||
| 1008 | Ga0070700_100111925 | |||
| 1009 | Ga0070663_100015157 | |||
| 1010 | Ga0070663_100287292 | |||
| 1011 | Ga0070662_100063311 | |||
| 1012 | Ga0070662_100086619 | |||
| 1013 | Ga0070662_100091604 | |||
| 1014 | Ga0070662_100201929 | |||
| 1015 | Ga0070662_100240675 | |||
| 1016 | Ga0070681_10025372 | |||
| 1017 | Ga0070681_10126415 | |||
| 1018 | Ga0068867_100000827 | |||
| 1019 | Ga0070685_10067918 | |||
| 1020 | Ga0070706_100231801 | |||
| 1021 | Ga0070679_100258365 | |||
| 1022 | Ga0070679_100387290 | |||
| 1023 | Ga0070684_100001718 | |||
| 1024 | Ga0070684_100173377 | |||
| 1025 | Ga0068853_100180329 | |||
| 1026 | Ga0068853_100226820 | |||
| 1027 | Ga0070672_100027336 | |||
| 1028 | Ga0070686_100023073 | |||
| 1029 | Ga0070665_100000232 | |||
| 1030 | Ga0070665_100002174 | |||
| 1031 | Ga0070665_100022111 | |||
| 1032 | Ga0070665_100033123 | |||
| 1033 | Ga0070665_100035301 | |||
| 1034 | Ga0070665_100093379 | |||
| 1035 | Ga0068855_100122020 | |||
| 1036 | Ga0068855_100209575 | |||
| 1037 | Ga0070664_100000397 | |||
| 1038 | Ga0070664_100268400 | |||
| 1039 | Ga0068857_100007163 | |||
| 1040 | Ga0068857_100054907 | |||
| 1041 | Ga0068857_100190180 | |||
| 1042 | Ga0068854_100108066 | |||
| 1043 | Ga0068854_100122520 | |||
| 1044 | Ga0070702_100011407 | |||
| 1045 | Ga0068852_100039336 | |||
| 1046 | Ga0068852_100096846 | |||
| 1047 | Ga0068852_100218124 | |||
| 1048 | Ga0068859_100001635 | |||
| 1049 | Ga0068859_100007383 | |||
| 1050 | Ga0068859_100029735 | |||
| 1051 | Ga0068859_100082233 | |||
| 1052 | Ga0068864_100000673 | |||
| 1053 | Ga0068864_100005130 | |||
| 1054 | Ga0068864_100011767 | |||
| 1055 | Ga0068864_100083027 | |||
| 1056 | Ga0068866_10168052 | |||
| 1057 | Ga0068861_100013434 | |||
| 1058 | Ga0068861_100016431 | |||
| 1059 | Ga0068861_100638392 | |||
| 1060 | Ga0068870_10164351 | |||
| 1061 | Ga0068870_10273525 | |||
| 1062 | Ga0068863_100000998 | |||
| 1063 | Ga0068863_100001377 | |||
| 1064 | Ga0068863_100010242 | |||
| 1065 | Ga0068863_100121361 | |||
| 1066 | Ga0068863_100435273 | |||
| 1067 | Ga0068863_100493703 | |||
| 1068 | Ga0068858_100006036 | |||
| 1069 | Ga0068858_100433894 | |||
| 1070 | Ga0068860_100000100 | |||
| 1071 | Ga0068860_100000167 | |||
| 1072 | Ga0068860_100005700 | |||
| 1073 | Ga0068860_100007072 | |||
| 1074 | Ga0068860_100016951 | |||
| 1075 | Ga0068862_100000542 | |||
| 1076 | Ga0068862_100001288 | |||
| 1077 | Ga0068862_100001632 | |||
| 1078 | Ga0068862_100004915 | |||
| 1079 | Ga0068862_100057617 | |||
| 1080 | Ga0081540_1014591 | |||
| 1081 | Ga0075365_10032298 | |||
| 1082 | Ga0075365_10039062 | |||
| 1083 | Ga0075365_10151974 | |||
| 1084 | Ga0075365_10174020 | |||
| 1085 | Ga0075365_10318181 | |||
| 1086 | Ga0075363_100000252 | |||
| 1087 | Ga0075364_10028984 | |||
| 1088 | Ga0075364_10078364 | |||
| 1089 | Ga0075367_10013385 | |||
| 1090 | Ga0075369_10005684 | |||
| 1091 | Ga0075369_10117694 | |||
| 1092 | Ga0075366_10010251 | |||
| 1093 | Ga0097621_100180647 | |||
| 1094 | Ga0075370_10012820 | |||
| 1095 | Ga0075370_10220971 | |||
| 1096 | Ga0068871_100359251 | |||
| 1097 | Ga0075428_100000382 | |||
| 1098 | Ga0075428_100008063 | |||
| 1099 | Ga0075428_100162246 | |||
| 1100 | Ga0075430_100005192 | |||
| 1101 | Ga0075430_100005806 | |||
| 1102 | Ga0075430_100167185 | |||
| 1103 | Ga0075430_100616617 | |||
| 1104 | Ga0075431_100000837 | |||
| 1105 | Ga0075431_100003681 | |||
| 1106 | Ga0075431_100021183 | |||
| 1107 | Ga0075431_100076181 | |||
| 1108 | Ga0075434_100179045 | |||
| 1109 | Ga0075429_100002408 | |||
| 1110 | Ga0075429_100010168 | |||
| 1111 | Ga0068865_100389892 | |||
| 1112 | Ga0097620_100001635 | |||
| 1113 | Ga0097620_100007383 | |||
| 1114 | Ga0097620_100029735 | |||
| 1115 | Ga0097620_100082233 | |||
| 1116 | Ga0099824_1029721 | |||
| 1117 | Ga0105240_10004052 | |||
| 1118 | Ga0105240_10016708 | |||
| 1119 | Ga0105240_10185697 | |||
| 1120 | Ga0105240_10790256 | |||
| 1121 | Ga0111539_10006149 | |||
| 1122 | Ga0111539_10007063 | |||
| 1123 | Ga0111539_10133087 | |||
| 1124 | Ga0111539_10152287 | |||
| 1125 | Ga0105245_10170180 | |||
| 1126 | Ga0105247_10018785 | |||
| 1127 | Ga0105247_10092762 | |||
| 1128 | Ga0114129_10007216 | |||
| 1129 | Ga0114129_10012199 | |||
| 1130 | Ga0105243_10099448 | |||
| 1131 | Ga0105243_10636025 | |||
| 1132 | Ga0105243_11053955 | |||
| 1133 | Ga0105241_10052901 | |||
| 1134 | Ga0105241_10125246 | |||
| 1135 | Ga0105241_10183787 | |||
| 1136 | Ga0105248_10001405 | |||
| 1137 | Ga0105248_10004080 | |||
| 1138 | Ga0105248_10191218 | |||
| 1139 | Ga0105248_10610343 | |||
| 1140 | Ga0105248_10698718 | |||
| 1141 | Ga0105237_10001506 | |||
| 1142 | Ga0105237_10471021 | |||
| 1143 | Ga0105237_10667673 | |||
| 1144 | Ga0105238_10214574 | |||
| 1145 | Ga0105238_10373764 | |||
| 1146 | Ga0105238_10435445 | |||
| 1147 | Ga0105238_10649232 | |||
| 1148 | Ga0105249_10015977 | |||
| 1149 | Ga0105249_10067710 | |||
| 1150 | Ga0105239_10036592 | |||
| 1151 | Ga0105239_10040350 | |||
| 1152 | Ga0105239_10051145 | |||
| 1153 | Ga0105239_11198645 | |||
| 1154 | Ga0105246_10055226 | |||
| 1155 | Ga0157369_10782482 | |||
| 1156 | Ga0157374_10094982 | |||
| 1157 | Ga0157378_10868436 | |||
| 1158 | Ga0163162_10018051 | |||
| 1159 | Ga0163162_10188520 | |||
| 1160 | Ga0163162_10297220 | |||
| 1161 | Ga0163162_10515824 | |||
| 1162 | Ga0163162_11306555 | |||
| 1163 | Ga0163163_10000628 | |||
| 1164 | Ga0163163_10005530 | |||
| 1165 | Ga0163163_10091778 | |||
| 1166 | Ga0163163_10324097 | |||
| 1167 | Ga0157380_10321421 | |||
| 1168 | Ga0157379_10002605 | |||
| 1169 | Ga0157379_10182197 | |||
| 1170 | Ga0157379_10250412 | |||
| 1171 | Ga0157379_10298665 | |||
| 1172 | Ga0157376_10782234 | |||
| 1173 | Ga0214544_1021932 | |||
| 1174 | Ga0214544_1039874 | |||
| 1175 | Ga0214542_1000004 | |||
| 1176 | Ga0214545_1000005 | |||
| 1177 | Ga0214543_1000111 | |||
| 1178 | Ga0213874_10035051 | |||
| 1179 | Ga0213876_10000772 | |||
| 1180 | Ga0213876_10025619 | |||
| 1181 | Ga0209563_101874 | |||
| 1182 | Ga0209677_101271 | |||
| 1183 | Ga0209148_1000235 | |||
| 1184 | Ga0209148_1008186 | |||
| 1185 | Ga0209233_1001018 | |||
| 1186 | Ga0209233_1016165 | |||
| 1187 | Ga0209233_1040449 | |||
| 1188 | Ga0209455_1001985 | |||
| 1189 | Ga0209455_1002071 | |||
| 1190 | Ga0209455_1020389 | |||
| 1191 | Ga0209130_1028066 | |||
| 1192 | Ga0209676_1000295 | |||
| 1193 | Ga0209676_1000392 | |||
| 1194 | Ga0209564_1013288 | |||
| 1195 | Ga0209758_1000102 | |||
| 1196 | Ga0209758_1000680 | |||
| 1197 | Ga0209758_1000867 | |||
| 1198 | Ga0209758_1002379 | |||
| 1199 | Ga0209758_1004754 | |||
| 1200 | Ga0209758_1015190 | |||
| 1201 | Ga0209050_1000362 | |||
| 1202 | Ga0209050_1000411 | |||
| 1203 | Ga0209256_1006004 | |||
| 1204 | Ga0209256_1032768 | |||
| 1205 | Ga0207426_1000532 | |||
| 1206 | Ga0207426_1000644 | |||
| 1207 | Ga0209051_1002168 | |||
| 1208 | Ga0209051_1063369 | |||
| 1209 | Ga0209257_1000513 | |||
| 1210 | Ga0209257_1003364 | |||
| 1211 | Ga0209257_1016145 | |||
| 1212 | Ga0207642_10308122 | |||
| 1213 | Ga0207680_10026661 | |||
| 1214 | Ga0207680_10031694 | |||
| 1215 | Ga0207680_10397820 | |||
| 1216 | Ga0207647_10011108 | |||
| 1217 | Ga0207643_10134752 | |||
| 1218 | Ga0207643_10333842 | |||
| 1219 | Ga0207705_10033457 | |||
| 1220 | Ga0207705_10227182 | |||
| 1221 | Ga0207684_10199588 | |||
| 1222 | Ga0207654_10021126 | |||
| 1223 | Ga0207654_10022953 | |||
| 1224 | Ga0207707_10009506 | |||
| 1225 | Ga0207707_10114888 | |||
| 1226 | Ga0207707_10137271 | |||
| 1227 | Ga0207695_10000006 | |||
| 1228 | Ga0207695_10011375 | |||
| 1229 | Ga0207695_10246184 | |||
| 1230 | Ga0207671_10002697 | |||
| 1231 | Ga0207671_10098843 | |||
| 1232 | Ga0207660_10008941 | |||
| 1233 | Ga0207662_10000523 | |||
| 1234 | Ga0207657_10099254 | |||
| 1235 | Ga0207657_10553588 | |||
| 1236 | Ga0207649_10149142 | |||
| 1237 | Ga0207649_10236833 | |||
| 1238 | Ga0207652_10094527 | |||
| 1239 | Ga0207681_10004224 | |||
| 1240 | Ga0207681_10015571 | |||
| 1241 | Ga0207694_10322096 | |||
| 1242 | Ga0207650_10000074 | |||
| 1243 | Ga0207659_10003387 | |||
| 1244 | Ga0207659_10580325 | |||
| 1245 | Ga0207687_10080108 | |||
| 1246 | Ga0207644_10017073 | |||
| 1247 | Ga0207644_10045867 | |||
| 1248 | Ga0207644_10056221 | |||
| 1249 | Ga0207690_10167658 | |||
| 1250 | Ga0207690_10250048 | |||
| 1251 | Ga0207706_10077202 | |||
| 1252 | Ga0207706_10174802 | |||
| 1253 | Ga0207706_10314734 | |||
| 1254 | Ga0207706_10363574 | |||
| 1255 | Ga0207706_10372136 | |||
| 1256 | Ga0207709_10066830 | |||
| 1257 | Ga0207709_10651468 | |||
| 1258 | Ga0207670_10113213 | |||
| 1259 | Ga0207669_10024061 | |||
| 1260 | Ga0207669_10223773 | |||
| 1261 | Ga0207704_10280754 | |||
| 1262 | Ga0207691_10308175 | |||
| 1263 | Ga0207711_10011313 | |||
| 1264 | Ga0207689_10005367 | |||
| 1265 | Ga0207689_10415141 | |||
| 1266 | Ga0207661_10022137 | |||
| 1267 | Ga0207679_10046433 | |||
| 1268 | Ga0207679_10135693 | |||
| 1269 | Ga0207651_10006946 | |||
| 1270 | Ga0207651_10033145 | |||
| 1271 | Ga0207712_10042674 | |||
| 1272 | Ga0207712_10075500 | |||
| 1273 | Ga0207712_10734899 | |||
| 1274 | Ga0207668_10000246 | |||
| 1275 | Ga0207668_10012632 | |||
| 1276 | Ga0207668_10022658 | |||
| 1277 | Ga0207668_10046069 | |||
| 1278 | Ga0207668_10071593 | |||
| 1279 | Ga0207668_10073452 | |||
| 1280 | Ga0207668_10098235 | |||
| 1281 | Ga0207668_10537758 | |||
| 1282 | Ga0207640_10529115 | |||
| 1283 | Ga0207658_10000275 | |||
| 1284 | Ga0207658_10032463 | |||
| 1285 | Ga0207658_10068281 | |||
| 1286 | Ga0207658_10338414 | |||
| 1287 | Ga0207658_10400481 | |||
| 1288 | Ga0207658_10444788 | |||
| 1289 | Ga0207677_10061033 | |||
| 1290 | Ga0207703_10008423 | |||
| 1291 | Ga0207703_10017891 | |||
| 1292 | Ga0207703_10028520 | |||
| 1293 | Ga0207703_10473244 | |||
| 1294 | Ga0207678_10027717 | |||
| 1295 | Ga0207678_10309452 | |||
| 1296 | Ga0207708_10170748 | |||
| 1297 | Ga0207702_10055422 | |||
| 1298 | Ga0207641_10001197 | |||
| 1299 | Ga0207641_10001917 | |||
| 1300 | Ga0207641_10023476 | |||
| 1301 | Ga0207641_10025033 | |||
| 1302 | Ga0207641_10064420 | |||
| 1303 | Ga0207641_10417998 | |||
| 1304 | Ga0207648_10244395 | |||
| 1305 | Ga0207648_10309264 | |||
| 1306 | Ga0207676_10001101 | |||
| 1307 | Ga0207676_10011927 | |||
| 1308 | Ga0207676_10029351 | |||
| 1309 | Ga0207676_10147427 | |||
| 1310 | Ga0207674_10010840 | |||
| 1311 | Ga0207674_10118682 | |||
| 1312 | Ga0207674_10374703 | |||
| 1313 | Ga0207675_100000884 | |||
| 1314 | Ga0207675_100017209 | |||
| 1315 | Ga0207675_100050397 | |||
| 1316 | Ga0207675_100130509 | |||
| 1317 | Ga0207675_100214396 | |||
| 1318 | Ga0207675_100240750 | |||
| 1319 | Ga0207683_10127875 | |||
| 1320 | Ga0207683_10296555 | |||
| 1321 | Ga0207698_10041962 | |||
| 1322 | Ga0207698_10321725 | |||
| 1323 | Ga0209389_1000021 | |||
| 1324 | Ga0209389_1000120 | |||
| 1325 | Ga0209589_1000027 | |||
| 1326 | Ga0209489_100023 | |||
| 1327 | Ga0209489_100742 | |||
| 1328 | Ga0209700_100134 | |||
| 1329 | Ga0207428_10049333 | |||
| 1330 | Ga0268266_10007665 | |||
| 1331 | Ga0268266_10060849 | |||
| 1332 | Ga0268266_10099484 | |||
| 1333 | Ga0268266_10131320 | |||
| 1334 | Ga0268266_10242709 | |||
| 1335 | Ga0268266_10264440 | |||
| 1336 | Ga0268265_10000648 | |||
| 1337 | Ga0268265_10004684 | |||
| 1338 | Ga0268265_10004973 | |||
| 1339 | Ga0268265_10056714 | |||
| 1340 | Ga0268265_10211950 | |||
| 1341 | Ga0268265_10313288 | |||
| 1342 | Ga0268264_10000002 | |||
| 1343 | Ga0268264_10000068 | |||
| 1344 | Ga0268264_10043258 | |||
| 1345 | Ga0268264_10099707 | |||
| 1346 | Ga0268264_10104501 | |||
| 1347 | Ga0265334_10037050 | |||
| 1348 | Ga0307517_10002267 | |||
| 1349 | Ga0265340_10145949 | |||
| 1350 | Ga0265327_10029069 | |||
| 1351 | Ga0307513_10000790 | |||
| 1352 | Ga0307513_10036360 | |||
| 1353 | Ga0307513_10050711 | |||
| 1354 | Ga0307408_100012876 | |||
| 1355 | Ga0307408_100049476 | |||
| 1356 | Ga0307514_10133737 | |||
| 1357 | Ga0307516_10012892 | |||
| 1358 | Ga0307413_10338197 | |||
| 1359 | Ga0307413_10357599 | |||
| 1360 | Ga0307406_10304065 | |||
| 1361 | Ga0307416_100142406 | |||
| 1362 | Ga0307416_100642141 | |||
| 1363 | Ga0307411_10390981 | |||
| 1364 | Ga0307510_10085858 | |||
| 1365 | Ga0373934_0025698 | |||
| 1366 | Ga0373944_0065369 | |||
| 1367 | Ga0373923_0021889 | |||
| 1368 | Ga0373953_0053465 | |||
| 1369 | Ga0373954_0040952 | |||
| 1370 | Ga0373960_0069379 | |||
| 1371 | Ga0373943_0012866 | |||
| 1372 | Ga0373946_0050711 | |||
| 1373 | Ga0373935_0121699 | |||
| 1374 | Ga0373927_0028404 | |||
| 1375 | Ga0373927_0155270 | |||
| 1376 | Ga0373925_0088388 | |||
| 1377 | Ga0395899_0000004 | |||
| 1378 | Ga0395900_0001491 | |||
| 1379 | Ga0395898_0064645 | |||
| 1380 | Ga0395905_0002891 | |||
| 1381 | Ga0395905_0122266 | |||
| 1382 | Ga0395905_0172822 | |||
| 1383 | Ga0436364_0162632 | |||
| 1384 | Ga0395901_0189967 | |||
| 1385 | Ga0395901_0199391 | |||
| 1386 | Ga0395901_0216211 | |||
| 1387 | Ga0436365_0608786 | |||
| 1388 | Ga0436365_0925275 | |||
| 1389 | Ga0436365_1234333 | |||
| 1390 | Ga0436365_1378879 | |||
| 1391 | Ga0436365_1556579 | |||
| 1392 | Ga0436361_1177038 | |||
| 1393 | Ga0451791_1620488 | |||
| 1394 | Ga0451839_0850209 | |||
| 1395 | Ga0439448_0169788 | |||
| 1396 | Ga0466969_0045176 | |||
| 1397 | Ga0466972_0000126 | |||
| 1398 | Ga0466972_0006136 | |||
| 1399 | Ga0466972_0194704 | |||
| 1400 | Ga0466966_0000159 | |||
| 1401 | Ga0466961_0000025 | |||
| 1402 | Ga0466961_0180999 | |||
| 1403 | Ga0466963_0070322 | |||
| 1404 | Ga0466963_0121763 | |||
| 1405 | Ga0466964_0080772 | |||
| 1406 | Ga0466968_0030347 | |||
| 1407 | Ga0466968_0047509 | |||
| 1408 | Ga0466968_0157754 | |||
| 1409 | Ga0466970_0069185 | |||
| 1410 | Ga0466970_0102296 | |||
| 1411 | Ga0466957_0028301 | |||
| 1412 | Ga0466957_0039822 | |||
| 1413 | Ga0466957_0210607 | |||
| 1414 | Ga0466959_0002316 | |||
| 1415 | Ga0466959_0059173 | |||
| 1416 | Ga0466959_0434021 | |||
| 1417 | Ga0451576_0007632 | |||
| 1418 | Ga0466958_0035133 | |||
| 1419 | Ga0466967_0080886 | |||
| 1420 | Ga0466967_0196012 | |||
| 1421 | Ga0466967_0296752 | |||
| 1422 | Ga0495592_0294438 | |||
| 1423 | Ga0495603_0219521 | |||
| 1424 | Ga0495590_0140051 | |||
| 1425 | Ga0495629_0207081 | |||
| 1426 | Ga0495638_0003450 | |||
| 1427 | Ga0495638_0019828 | |||
| 1428 | Ga0495638_0084663 | |||
| 1429 | Ga0495651_0005468 | |||
| 1430 | Ga0495651_0018419 | |||
| 1431 | Ga0495580_0145684 | |||
| 1432 | Ga0495582_0069077 | |||
| 1433 | Ga0495605_0045387 | |||
| 1434 | Ga0495605_0124819 | |||
| 1435 | Ga0495664_0013167 | |||
| 1436 | Ga0495585_0231634 | |||
| 1437 | Ga0495583_0082007 | |||
| 1438 | Ga0495583_0138259 | |||
| 1439 | Ga0495583_0152608 | |||
| 1440 | Ga0495583_0154616 | |||
| 1441 | Ga0495606_0031088 | |||
| 1442 | Ga0495606_0054529 | |||
| 1443 | Ga0495606_0057985 | |||
| 1444 | Ga0495606_0196122 | |||
| 1445 | Ga0495608_0009005 | |||
| 1446 | Ga0495608_0094160 | |||
| 1447 | Ga0495610_0114022 | |||
| 1448 | Ga0495616_0164131 | |||
| 1449 | Ga0495618_0008100 | |||
| 1450 | Ga0495620_0118080 | |||
| 1451 | Ga0495628_0023385 | |||
| 1452 | Ga0495628_0295057 | |||
| 1453 | Ga0495630_0110501 | |||
| 1454 | Ga0495630_0124728 | |||
| 1455 | Ga0495630_0247564 | |||
| 1456 | Ga0495631_0126064 | |||
| 1457 | Ga0495643_0046702 | |||
| 1458 | Ga0495643_0085071 | |||
| 1459 | Ga0495648_0051189 | |||
| 1460 | Ga0495648_0104093 | |||
| 1461 | Ga0495642_0010536 | |||
| 1462 | Ga0495652_0005378 | |||
| 1463 | Ga0495652_0098033 | |||
| 1464 | Ga0495640_0004432 | |||
| 1465 | Ga0495640_0007111 | |||
| 1466 | Ga0495640_0070245 | |||
| 1467 | Ga0495587_0009387 | |||
| 1468 | Ga0495597_0021261 | |||
| 1469 | Ga0495597_0093289 | |||
| 1470 | Ga0495645_0002598 | |||
| 1471 | Ga0495622_0050561 | |||
| 1472 | Ga0495622_0095509 | |||
| 1473 | Ga0495667_0003765 | |||
| 1474 | Ga0495667_0255556 | |||
| 1475 | Ga0495668_0000034 | |||
| 1476 | Ga0495668_0007075 | |||
| 1477 | Ga0495668_0083754 | |||
| 1478 | Ga0495634_0029484 | |||
| 1479 | Ga0495634_0147419 | |||
| 1480 | Ga0495611_0057507 | |||
| 1481 | Ga0495611_0205929 | |||
| 1482 | Ga0495625_0015738 | |||
| 1483 | Ga0495625_0230508 | |||
| 1484 | Ga0495625_0396261 | |||
| 1485 | Ga0495635_0013279 | |||
| 1486 | Ga0495635_0165135 | |||
| 1487 | Ga0495659_0167861 | |||
| 1488 | Ga0495588_0038051 | |||
| 1489 | Ga0495588_0049869 | |||
| 1490 | Ga0495657_0003405 | |||
| 1491 | Ga0495657_0006555 | |||
| 1492 | Ga0495599_0070928 | |||
| 1493 | Ga0495623_0049425 | |||
| 1494 | Ga0495646_0057843 | |||
| 1495 | Ga0495669_0000012 | |||
| 1496 | Ga0495669_0000329 | |||
| 1497 | Ga0495613_0003009 | |||
| 1498 | Ga0495613_0102176 | |||
| 1499 | Ga0495624_0034987 | |||
| 1500 | Ga0495624_0099482 | |||
| 1501 | Ga0495624_0146512 | |||
| 1502 | Ga0495624_0196764 | |||
| 1503 | Ga0495649_0026228 | |||
| 1504 | Ga0495649_0134072 | |||
| 1505 | Ga0495600_0001163 | |||
| 1506 | Ga0495600_0002699 | |||
| 1507 | Ga0495581_0035817 | |||
| 1508 | Ga0495604_0004948 | |||
| 1509 | Ga0495604_0007447 | |||
| 1510 | Ga0495674_0005194 | |||
| 1511 | Ga0495674_0114771 | |||
| 1512 | Ga0495674_0550661 | |||
| 1513 | Ga0495676_0057442 | |||
| 1514 | Ga0495676_0184398 | |||
| 1515 | Ga0495680_0003348 | |||
| 1516 | Ga0495687_014030 | |||
| 1517 | Ga0495687_057524 | |||
| 1518 | Ga0495687_070661 | |||
| 1519 | Ga0495673_0005594 | |||
| 1520 | Ga0495684_0075157 | |||
| 1521 | Ga0495684_0087920 | |||
| 1522 | Ga0495686_0171195 | |||
| 1523 | Ga0495686_0271905 | |||
| 1524 | Ga0495593_0044852 | |||
| 1525 | Ga0495602_0122294 | |||
| 1526 | Ga0495602_0130280 | |||
| 1527 | Ga0496100_0025256 | |||
| 1528 | Ga0496100_0032143 | |||
| 1529 | Ga0496100_0096777 | |||
| 1530 | Ga0496100_0125231 | |||
| 1531 | Ga0496101_0070728 | |||
| 1532 | Ga0496101_0484307 | |||
| 1533 | Ga0496102_0015458 | |||
| 1534 | Ga0496102_0035768 | |||
| 1535 | Ga0496103_0005690 | |||
| 1536 | Ga0496103_0101212 | |||
| 1537 | Ga0496103_0183173 | |||
| 1538 | Ga0496104_0003185 | |||
| 1539 | Ga0496104_0008463 | |||
| 1540 | Ga0496104_0114232 | |||
| 1541 | Ga0496104_0197406 | |||
| 1542 | Ga0496105_0018799 | |||
| 1543 | Ga0496105_0035775 | |||
| 1544 | Ga0496105_0079740 | |||
| 1545 | Ga0496105_0514935 | |||
| 1546 | Ga0496106_0044673 | |||
| 1547 | Ga0496106_0124404 | |||
| 1548 | Ga0496108_0019640 | |||
| 1549 | Ga0496108_0105662 | |||
| 1550 | Ga0496109_0013914 | |||
| 1551 | Ga0496109_0016209 | |||
| 1552 | Ga0496109_0165494 | |||
| 1553 | Ga0496109_0204509 | |||
| 1554 | Ga0496109_0793397 | |||
| 1555 | Ga0496110_0067641 | |||
| 1556 | Ga0496110_0503799 | |||
| 1557 | Ga0496112_0050449 | |||
| 1558 | Ga0496112_0130692 | |||
| 1559 | Ga0496112_0150261 | |||
| 1560 | Ga0496112_0184840 | |||
| 1561 | Ga0496112_0253686 | |||
| 1562 | Ga0496113_0009710 | |||
| 1563 | Ga0496113_0033695 | |||
| 1564 | Ga0496113_0040589 | |||
| 1565 | Ga0496113_0116713 | |||
| 1566 | Ga0496113_0178684 | |||
| 1567 | Ga0496114_0146077 | |||
| 1568 | Ga0496114_0313912 | |||
| 1569 | Ga0496115_0140239 | |||
| 1570 | Ga0496115_0288105 | |||
| 1571 | Ga0496115_0619866 | |||
| 1572 | Ga0496116_0033293 | |||
| 1573 | Ga0496117_0025029 | |||
| 1574 | Ga0496118_0005681 | |||
| 1575 | Ga0496118_0041059 | |||
| 1576 | Ga0496118_0055902 | |||
| 1577 | Ga0496118_0125404 | |||
| 1578 | Ga0496118_0193079 | |||
| 1579 | Ga0496119_0021805 | |||
| 1580 | Ga0496119_0026130 | |||
| 1581 | Ga0496121_0001066 | |||
| 1582 | Ga0496121_0066696 | |||
| 1583 | Ga0496121_0157466 | |||
| 1584 | Ga0496121_0197403 | |||
| 1585 | Ga0496121_0411687 | |||
| 1586 | Ga0496121_0513545 | |||
| 1587 | Ga0496124_0016356 | |||
| 1588 | Ga0496124_0080458 | |||
| 1589 | Ga0496124_0237763 | |||
| 1590 | Ga0496125_0028152 | |||
| 1591 | Ga0496125_0072992 | |||
| 1592 | Ga0496125_0119781 | |||
| 1593 | Ga0496125_0285277 | |||
| 1594 | Ga0496126_0010533 | |||
| 1595 | Ga0496126_0198828 | |||
| 1596 | Ga0496126_0428478 | |||
| 1597 | Ga0496126_0442614 | |||
| 1598 | Ga0495682_0087758 | |||
| 1599 | Ga0501033_0757333 | |||
| 1600 | Ga0501034_0636591 | |||
| 1601 | Ga0501047_0023878 | |||
| 1602 | Ga0501257_000824 | |||
| 1603 | nmdc:mga03683_7412_c1 | |||
| 1604 | nmdc:mga03n38_14325_c1 | |||
| 1605 | nmdc:mga00v17_201692_c1 | |||
| 1606 | nmdc:mga00v17_95984_c1 | |||
| 1607 | nmdc:mga0yw44_26093_c1 | |||
| 1608 | nmdc:mga0yw44_27511_c1 | |||
| 1609 | nmdc:mga0yw44_52080_c1 | |||
| 1610 | nmdc:mga0yw44_9882_c1 | |||
| 1611 | nmdc:mga06z11_29475_c1 | |||
| 1612 | nmdc:mga07m45_14663_c1 | |||
| 1613 | nmdc:mga07m45_82834_c1 | |||
| 1614 | nmdc:mga05p37_65585_c1 | |||
| 1615 | nmdc:mga09592_17751_c1 | |||
| 1616 | nmdc:mga09592_217857_c1 | |||
| 1617 | nmdc:mga09592_9742_c1 | |||
| 1618 | nmdc:mga0qj67_195654_c1 | |||
| 1619 | nmdc:mga0qj67_203108_c1 | |||
| 1620 | nmdc:mga0qj67_570786_c1 | |||
| 1621 | nmdc:mga0qj67_581213_c1 | |||
| 1622 | nmdc:mga0qj67_8245_c1 | |||
| 1623 | nmdc:mga06r32_170149_c1 | |||
| 1624 | nmdc:mga06r32_5432_c1 | |||
| 1625 | nmdc:mga06r32_6743_c1 | |||
| 1626 | nmdc:mga06r32_6843_c1 | |||
| 1627 | nmdc:mga08y16_107902_c1 | |||
| 1628 | nmdc:mga08y16_33755_c1 | |||
| 1629 | nmdc:mga0n895_308020_c1 | |||
| 1630 | nmdc:mga0n895_607555_c1 | |||
| 1631 | nmdc:mga0sz30_100590_c1 | |||
| 1632 | nmdc:mga0sz30_155091_c1 | |||
| 1633 | nmdc:mga0sz30_49302_c2 | |||
| 1634 | nmdc:mga0sz30_57533_c1 | |||
| 1635 | Ga0495601_0044885 | |||
| 1636 | Ga0500635_0000045 | |||
| 1637 | Ga0495595_0007151 | |||
| 1638 | Ga0495619_0028832 | |||
| 1639 | Ga0500578_0333277 | |||
| 1640 | Ga0500643_000016 | |||
| 1641 | Ga0500647_0011504 | |||
| 1642 | Ga0500647_0076024 | |||
| 1643 | Ga0500583_0119470 | |||
| 1644 | Ga0500651_0040865 | |||
| 1645 | Ga0500651_0319200 | |||
| 1646 | Ga0500566_0029401 | |||
| 1647 | Ga0500641_0017462 | |||
| 1648 | Ga0500555_002104 | |||
| 1649 | Ga0500556_0194460 | |||
| 1650 | Ga0500557_000011 | |||
| 1651 | Ga0500562_003210 | |||
| 1652 | Ga0500569_003209 | |||
| 1653 | Ga0500569_021786 | |||
| 1654 | Ga0500592_016601 | |||
| 1655 | Ga0500595_015325 | |||
| 1656 | Ga0500595_032316 | |||
| 1657 | Ga0500595_054221 | |||
| 1658 | Ga0500597_166015 | |||
| 1659 | Ga0500608_001733 | |||
| 1660 | Ga0500617_073850 | |||
| 1661 | Ga0500642_0000301 | |||
| 1662 | Ga0500642_0008296 | |||
| 1663 | Ga0500559_0007118 | |||
| 1664 | Ga0500559_0051187 | |||
| 1665 | Ga0500588_0004033 | |||
| 1666 | Ga0500590_021318 | |||
| 1667 | Ga0500590_047676 | |||
| 1668 | Ga0500616_0024396 | |||
| 1669 | Ga0500619_001544 | |||
| 1670 | Ga0500619_057392 | |||
| 1671 | Ga0500622_0005376 | |||
| 1672 | Ga0500622_0018371 | |||
| 1673 | Ga0500638_066433 | |||
| 1674 | Ga0500638_068604 | |||
| 1675 | Ga0500639_091414 | |||
| 1676 | Ga0500636_0001919 | |||
| 1677 | Ga0500636_0019470 | |||
| 1678 | Ga0500636_0055172 | |||
| 1679 | Ga0500636_0094100 | |||
| 1680 | Ga0500636_0235116 | |||
| 1681 | Ga0500636_0255736 | |||
| 1682 | Ga0500637_0042240 | |||
| 1683 | Ga0500576_074544 | |||
| 1684 | Ga0500625_000880 | |||
| 1685 | Ga0500645_054817 | |||
| 1686 | Ga0500609_000528 | |||
| 1687 | Ga0500552_003952 | |||
| 1688 | Ga0500596_004770 | |||
| 1689 | Ga0500599_010576 | |||
| 1690 | Ga0500601_000238 | |||
| 1691 | Ga0500587_000787 | |||
| 1692 | Ga0500661_015862 | |||
| 1693 | 2507511517 | |||
| 1694 | 2508545324 | |||
| 1695 | 2508694153 | |||
| 1696 | 2513625445 | |||
| 1697 | 2513640957 | |||
| 1698 | 2513648367 | |||
| 1699 | 2513705038 | |||
| 1700 | 2513716331 | |||
| 1701 | 2513875120 | |||
| 1702 | 2514013806 | |||
| 1703 | 2515624912 | |||
| 1704 | 2517101284 | |||
| 1705 | 2524440697 | |||
| 1706 | 2528854483 | |||
| 1707 | 2587918915 | |||
| 1708 | 2617348316 | |||
| 1709 | 2617374858 | |||
| 1710 | 2643998399 | |||
| 1711 | 2644086736 | |||
| 1712 | 2644227658 | |||
| 1713 | 2644236824 | |||
| 1714 | 2644341690 | |||
| 1715 | 2644367977 | |||
| 1716 | 2745075937 | |||
| 1717 | 2793061406 | |||
| 1718 | 2793069797 | |||
| 1719 | 2805916289 | |||
| 1720 | 2818239949 | |||
| 1721 | 2824607646 | |||
| 1722 | 2824614347 | |||
| 1723 | 2824622354 | |||
| 1724 | 2824631433 | |||
| 1725 | 2824637953 | |||
| 1726 | 2824652425 | |||
| 1727 | 2824656791 | |||
| 1728 | 2824664197 | |||
| 1729 | 2824678370 | |||
| 1730 | 2824683590 | |||
| 1731 | 2824690580 | |||
| 1732 | 2824697839 | |||
| 1733 | 2824710469 | |||
| 1734 | 2824723394 | |||
| 1735 | 2824731872 | |||
| 1736 | 2824736452 | |||
| 1737 | 2824748873 | |||
| 1738 | 2824760877 | |||
| 1739 | 2824770331 | |||
| 1740 | 2824776283 | |||
| 1741 | 2838130699 | |||
| 1742 | 2841947087 | |||
| 1743 | 2841954982 | |||
| 1744 | 2841965006 | |||
| 1745 | 2841969940 | |||
| 1746 | 2841981868 | |||
| 1747 | 2841990166 | |||
| 1748 | 2842042180 | |||
| 1749 | 2842050223 | |||
| 1750 | 2844316399 | |||
| 1751 | 2847939300 | |||
| 1752 | 2847943727 | |||
| 1753 | 2849082039 | |||
| 1754 | 2857513481 | |||
| 1755 | 2874594729 | |||
| 1756 | 2874615847 | |||
| 1757 | 2874622612 | |||
| 1758 | 2874633545 | |||
| 1759 | 2874647307 | |||
| 1760 | 2876765362 | |||
| 1761 | 2876773861 | |||
| 1762 | 2876819901 | |||
| 1763 | 2879076020 | |||
| 1764 | 2879086973 | |||
| 1765 | 2879104268 | |||
| 1766 | 2879129374 | |||
| 1767 | 2879144052 | |||
| 1768 | 2881369464 | |||
| 1769 | 2881668308 | |||
| 1770 | 2884961425 | |||
| 1771 | 2885373610 | |||
| 1772 | 2885380148 | |||
| 1773 | 2885412564 | |||
| 1774 | 2888387100 | |||
| 1775 | 2888389778 | |||
| 1776 | 2888421318 | |||
| 1777 | 2903728267 | |||
| 1778 | 2904671381 | |||
| 1779 | 2904693825 | |||
| 1780 | 2904719670 | |||
| 1781 | 2906606407 | |||
| 1782 | 2906629101 | |||
| 1783 | 2906644621 | |||
| 1784 | 2908758393 | |||
| 1785 | 2908777340 | |||
| 1786 | 2922377244 | |||
| 1787 | 2922398376 | |||
| 1788 | 2928531643 | |||
| 1789 | 2929623641 | |||
| 1790 | 2929632656 | |||
| 1791 | 2932793085 | |||
| 1792 | 2932795892 | |||
| 1793 | 2932802130 | |||
| 1794 | 2932814647 | |||
| 1795 | 2932823502 | |||
| 1796 | 2932832940 | |||
| 1797 | 2933585545 | |||
| 1798 | 2935616293 | |||
| 1799 | 2935623670 | |||
| 1800 | 2935639440 | |||
| 1801 | 2935650690 | |||
| 1802 | 2935662070 | |||
| 1803 | 2935670387 | |||
| 1804 | 2935679815 | |||
| 1805 | 2935687386 | |||
| 1806 | 2935696643 | |||
| 1807 | 2935705461 | |||
| 1808 | 2935718845 | |||
| 1809 | 2935728497 | |||
| 1810 | 2935736906 | |||
| 1811 | 2935746091 | |||
| 1812 | 2935753352 | |||
| 1813 | 2935766254 | |||
| 1814 | 2935807204 | |||
| 1815 | 2935813883 | |||
| 1816 | 2935827090 | |||
| 1817 | 2935828923 | |||
| 1818 | 2935844097 | |||
| 1819 | 2935854271 | |||
| 1820 | 2935862105 | |||
| 1821 | 2935871669 | |||
| 1822 | 2935880220 | |||
| 1823 | 2935886318 | |||
| 1824 | 2935913636 | |||
| 1825 | 2935923534 | |||
| 1826 | 2935931047 | |||
| 1827 | 2935935329 | |||
| 1828 | 2935946895 | |||
| 1829 | 2935954010 | |||
| 1830 | 2935961345 | |||
| 1831 | 2935969036 | |||
| 1832 | 2935983558 | |||
| 1833 | 2935985776 | |||
| 1834 | 2935996886 | |||
| 1835 | 2936005920 | |||
| 1836 | 2936016348 | |||
| 1837 | 2936025004 | |||
| 1838 | 2936033653 | |||
| 1839 | 2936039438 | |||
| 1840 | 2936050915 | |||
| 1841 | 2936057663 | |||
| 1842 | 2940559265 | |||
| 1843 | 2941536883 | |||
| 1844 | 2941541959 | |||
| 1845 | 3005491204 | |||
| 1846 | 3005511049 | |||
| 1847 | 3005591888 | |||
| 1848 | 3005596005 | |||
| 1849 | 3005711962 | |||
| 1850 | 3005719205 | |||
| 1851 | 8006927826 | |||
| 1852 | 8016517113 | |||
| 1853 | 8016588451 | |||
| 1854 | 8016637505 | |||
| 1855 | 8017059470 | |||
| 1856 | 8019578929 | |||
| 1857 | 8019596975 | |||
| 1858 | 8019604706 | |||
| 1859 | 8019613819 | |||
| 1860 | 8019624405 | |||
| 1861 | 8019637633 | |||
| 1862 | 8019641984 | |||
| 1863 | 8019650566 | |||
| 1864 | 8019665560 | |||
| 1865 | 8019675107 | |||
| 1866 | 8019680998 | |||
| 1867 | 8055749802 | |||
| 1868 | 8056974012 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c30-assembly1.cif.gz_B | crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s | 0.8145 | 1 | 231 |
| 6uel-assembly1.cif.gz_A | cps1 bound to allosteric inhibitor h3b-193 | 0.8044 | 1 | 185 |
| 5tw7-assembly1.cif.gz_D | crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae | 0.7895 | 2 | 186 |
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.7879 | 3 | 234 |
| 2ywb-assembly3.cif.gz_B | crystal structure of gmp synthetase from thermus thermophilus | 0.7873 | 4 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9M0A7_16_246_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9225 | 13 | 231 | 3.40.50.880 |
| af_Q09686_33_241_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.915 | 47 | 225 | 3.40.50.880 |
| af_A0A1D6KZL1_41_285_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9139 | 16 | 231 | 3.40.50.880 |
| af_Q69QJ1_44_268_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9075 | 46 | 231 | 3.40.50.880 |
| af_I1MSY9_21_250_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.903 | 13 | 231 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D3KIX4-F1-model_v4 | Type 1 glutamine amidotransferase | 1.002 | 1 | 234 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A7S7Q091-F1-model_v4 | Type 1 glutamine amidotransferase | 1.002 | 1 | 234 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A5D3KIX4-F1-model_v4 | Type 1 glutamine amidotransferase | 0.9982 | 1 | 234 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A7S7Q091-F1-model_v4 | Type 1 glutamine amidotransferase | 0.9979 | 1 | 234 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A1I5HD40-F1-model_v4 | Glutamine amidotransferase class-I | 0.9879 | 1 | 123 |
GO:0005829
GO:0016740 |