F486135

General Info

Members Datasets Scaffolds Average Seq Length
934 543 1868 235

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0182216|Ga0495625_0182216_254_997
Length 247
Sequence LKLGLLETGAPPPALSPRFGDYPAMFRRLLGEDAYDYTTWRVDAGELPDRAEACDAYLVTGSSAGVYDPLPWIGPLKDFLVAAKGRAALVGVCFGHQVMAEAFGGRVVKSPKGWGVGLQSYAVSRSEPWMDPADRIRIAASHQDQVIEAPPGAEVLAASDFTPFAMLAYRDQPAISLQPHPEFEPDYAKALIRGRSGDRFRADLADPAIRSLDQPNDRVRVGGWIKAGRRLARGLRPGPRTKTGGRR

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
105 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
106 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
107 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
174 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
176 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
337 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
338 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
339 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
342 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
343 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
344 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
347 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
350 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
353 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
354 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
355 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
358 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
359 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
362 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
363 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
364 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
365 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
366 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
367 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
368 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
369 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
370 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
371 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
372 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
373 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
374 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
375 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
376 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
377 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
378 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
379 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
380 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
381 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
382 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
383 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
384 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
385 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
386 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
387 2643221640 Caulobacter sp. Root342 Isolate Unclassified
388 2643221642 Caulobacter sp. Root343 Isolate Unclassified
389 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
390 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
391 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
392 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
393 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
394 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
395 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
396 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
397 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
398 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
399 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
400 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
401 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
402 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
403 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
404 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
405 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
406 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
407 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
408 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
409 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
410 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
411 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
412 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
413 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
414 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
415 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
416 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
417 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
418 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
419 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
420 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
421 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
422 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
423 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
424 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
425 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
426 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
427 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
428 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
429 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
430 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
431 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
432 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
433 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
434 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
435 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
436 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
437 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
438 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
439 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
440 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
441 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
442 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
443 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
444 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
445 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
446 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
447 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
448 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
449 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
450 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
451 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
452 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
453 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
454 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
455 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
456 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
457 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
458 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
459 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
460 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
461 2922368715
462 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
463 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
464 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
465 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
466 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
467 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
468 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
469 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
470 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
471 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
472 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
473 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
474 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
475 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
476 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
477 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
478 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
479 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
480 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
481 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
482 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
483 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
484 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
485 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
486 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
487 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
488 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
489 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
490 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
491 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
492 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
493 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
494 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
495 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
496 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
497 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
498 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
499 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
500 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
501 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
502 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
503 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
504 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
505 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
506 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
507 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
508 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
509 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
510 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
511 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
512 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
513 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
514 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
515 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
516 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
517 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
518 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
519 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
520 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
521 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
522 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
523 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
524 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
525 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
526 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
527 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
528 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
529 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
530 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
531 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
532 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
533 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
534 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
535 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
536 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
537 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
538 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
539 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
540 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
541 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
542 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
543 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.24
Metatranscriptomes 0
Isolates 18.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.24
Nodule 13.92
Rhizoplane 4.93
Rhizosphere 56.21
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0182216 3300046660 Bacteria 1396
2 JGI24739J22299_10019620 3300001989 Bacteria 2419
3 JGI25153J46596_10000732 3300003215 Bacteria 20120
4 JGI25153J46596_10004233 3300003215 Bacteria 7763
5 JGI25153J46596_10008565 3300003215 Bacteria 4874
6 JGI25153J46596_10009899 3300003215 Bacteria 4368
7 rootH2_10044168 3300003320 Bacteria 1419
8 rootL2_10058382 3300003322 Bacteria 5962
9 JGI25160J50197_1001947 3300003354 Bacteria 9864
10 JGI25160J50197_1011819 3300003354 Bacteria 3066
11 JGI25160J50197_1030521 3300003354 Bacteria 1403
12 Ga0055542_1003059 3300003762 Bacteria 4827
13 Ga0055536_1000576 3300003781 Bacteria 25026
14 Ga0055536_1000606 3300003781 Bacteria 24402
15 Ga0055530_10004098 3300003791 Bacteria 7757
16 Ga0055530_10009857 3300003791 Bacteria 3606
17 Ga0055540_1024409 3300003792 Bacteria 1500
18 Ga0055531_10000294 3300003794 Bacteria 49839
19 Ga0055531_10012403 3300003794 Bacteria 4013
20 Ga0055543_1003066 3300004625 Bacteria 5135
21 Ga0065165_1002046 3300005262 Bacteria 18689
22 Ga0065165_1002144 3300005262 Bacteria 17883
23 Ga0065712_10075409 3300005290 Bacteria 3869
24 Ga0065712_10166263 3300005290 Bacteria 1271
25 Ga0070658_10286389 3300005327 Bacteria 1403
26 Ga0070690_100021139 3300005330 Bacteria 3971
27 Ga0070690_100483710 3300005330 Unclassified 923
28 Ga0070670_100000032 3300005331 Bacteria 158514
29 Ga0070670_100004709 3300005331 Bacteria 11450
30 Ga0070670_100123191 3300005331 Bacteria 2237
31 Ga0070670_100217269 3300005331 Bacteria 1663
32 Ga0068869_100015582 3300005334 Bacteria 5105
33 Ga0068869_100059446 3300005334 Bacteria 2798
34 Ga0070666_10047736 3300005335 Bacteria 2875
35 Ga0070666_10456853 3300005335 Bacteria 923
36 Ga0070680_100050255 3300005336 Bacteria 3400
37 Ga0068868_100439293 3300005338 Bacteria 1133
38 Ga0070660_100054341 3300005339 Bacteria 3092
39 Ga0070689_100000337 3300005340 Bacteria 27384
40 Ga0070687_100081866 3300005343 Bacteria 1764
41 Ga0070661_100127898 3300005344 Bacteria 1907
42 Ga0070668_100000975 3300005347 Bacteria 20042
43 Ga0070668_100004762 3300005347 Bacteria 10066
44 Ga0070668_100007849 3300005347 Bacteria 7925
45 Ga0070668_100007904 3300005347 Bacteria 7896
46 Ga0070668_100088866 3300005347 Bacteria 2433
47 Ga0070669_100015826 3300005353 Bacteria 5378
48 Ga0070669_100079827 3300005353 Bacteria 2434
49 Ga0070669_100089976 3300005353 Bacteria 2300
50 Ga0070675_100000590 3300005354 Bacteria 24895
51 Ga0070675_100242533 3300005354 Bacteria 1575
52 Ga0070671_100019456 3300005355 Bacteria 5526
53 Ga0070671_100055425 3300005355 Bacteria 3298
54 Ga0070671_100058724 3300005355 Bacteria 3201
55 Ga0070671_100065351 3300005355 Bacteria 3030
56 Ga0070671_100083308 3300005355 Bacteria 2674
57 Ga0070674_100027551 3300005356 Bacteria 3724
58 Ga0070674_100151164 3300005356 Unclassified 1752
59 Ga0070674_100156508 3300005356 Bacteria 1725
60 Ga0070674_100691939 3300005356 Bacteria 871
61 Ga0070673_100059214 3300005364 Bacteria 3031
62 Ga0070688_100013340 3300005365 Bacteria 4630
63 Ga0070659_100545920 3300005366 Bacteria 992
64 Ga0070667_100000110 3300005367 Bacteria 105201
65 Ga0070667_100015527 3300005367 Bacteria 6295
66 Ga0070667_100053948 3300005367 Bacteria 3394
67 Ga0070667_100094456 3300005367 Bacteria 2577
68 Ga0070667_100441689 3300005367 Bacteria 1188
69 Ga0070667_100448697 3300005367 Bacteria 1178
70 Ga0070667_100650934 3300005367 Bacteria 973
71 Ga0070701_10075713 3300005438 Bacteria 1810
72 Ga0070705_100022249 3300005440 Bacteria 3386
73 Ga0070700_100049110 3300005441 Bacteria 2618
74 Ga0070700_100111925 3300005441 Unclassified 1816
75 Ga0070663_100015157 3300005455 Bacteria 4966
76 Ga0070663_100287292 3300005455 Bacteria 1312
77 Ga0070662_100063311 3300005457 Bacteria 2705
78 Ga0070662_100086619 3300005457 Bacteria 2343
79 Ga0070662_100091604 3300005457 Bacteria 2283
80 Ga0070662_100201929 3300005457 Bacteria 1578
81 Ga0070662_100240675 3300005457 Bacteria 1451
82 Ga0070681_10025372 3300005458 Bacteria 5962
83 Ga0070681_10126415 3300005458 Bacteria 2489
84 Ga0068867_100000827 3300005459 Bacteria 20846
85 Ga0070685_10067918 3300005466 Bacteria 2104
86 Ga0070706_100231801 3300005467 Bacteria 1724
87 Ga0070679_100258365 3300005530 Unclassified 1697
88 Ga0070679_100387290 3300005530 Bacteria 1344
89 Ga0070684_100001718 3300005535 Bacteria 15952
90 Ga0070684_100173377 3300005535 Bacteria 1959
91 Ga0068853_100180329 3300005539 Bacteria 1915
92 Ga0068853_100226820 3300005539 Bacteria 1708
93 Ga0070672_100027336 3300005543 Bacteria 4253
94 Ga0070686_100023073 3300005544 Bacteria 3715
95 Ga0070665_100000232 3300005548 Bacteria 92207
96 Ga0070665_100002174 3300005548 Bacteria 21852
97 Ga0070665_100022111 3300005548 Bacteria 6397
98 Ga0070665_100033123 3300005548 Bacteria 5199
99 Ga0070665_100035301 3300005548 Bacteria 5027
100 Ga0070665_100093379 3300005548 Bacteria 3014
101 Ga0068855_100122020 3300005563 Bacteria 2982
102 Ga0068855_100209575 3300005563 Bacteria 2191
103 Ga0070664_100000397 3300005564 Bacteria 32538
104 Ga0070664_100268400 3300005564 Bacteria 1536
105 Ga0068857_100007163 3300005577 Bacteria 9608
106 Ga0068857_100054907 3300005577 Bacteria 3535
107 Ga0068857_100190180 3300005577 Bacteria 1869
108 Ga0068854_100108066 3300005578 Bacteria 2094
109 Ga0068854_100122520 3300005578 Bacteria 1976
110 Ga0070702_100011407 3300005615 Bacteria 4420
111 Ga0068852_100039336 3300005616 Bacteria 3981
112 Ga0068852_100096846 3300005616 Bacteria 2653
113 Ga0068852_100218124 3300005616 Bacteria 1813
114 Ga0068859_100001635 3300005617 Bacteria 22899
115 Ga0068859_100007383 3300005617 Bacteria 11152
116 Ga0068859_100029735 3300005617 Bacteria 5481
117 Ga0068859_100082233 3300005617 Bacteria 3263
118 Ga0068864_100000673 3300005618 Bacteria 28561
119 Ga0068864_100005130 3300005618 Bacteria 10724
120 Ga0068864_100011767 3300005618 Bacteria 7227
121 Ga0068864_100083027 3300005618 Bacteria 2813
122 Ga0068866_10168052 3300005718 Bacteria 1285
123 Ga0068861_100013434 3300005719 Bacteria 5733
124 Ga0068861_100016431 3300005719 Bacteria 5238
125 Ga0068861_100638392 3300005719 Bacteria 982
126 Ga0068870_10164351 3300005840 Unclassified 1319
127 Ga0068870_10273525 3300005840 Bacteria 1056
128 Ga0068863_100000998 3300005841 Bacteria 28350
129 Ga0068863_100001377 3300005841 Bacteria 24126
130 Ga0068863_100010242 3300005841 Bacteria 9115
131 Ga0068863_100121361 3300005841 Bacteria 2492
132 Ga0068863_100435273 3300005841 Bacteria 1286
133 Ga0068863_100493703 3300005841 Bacteria 1205
134 Ga0068858_100006036 3300005842 Bacteria 11808
135 Ga0068858_100433894 3300005842 Bacteria 1264
136 Ga0068860_100000100 3300005843 Bacteria 144580
137 Ga0068860_100000167 3300005843 Bacteria 108234
138 Ga0068860_100005700 3300005843 Bacteria 12574
139 Ga0068860_100007072 3300005843 Bacteria 11232
140 Ga0068860_100016951 3300005843 Bacteria 7101
141 Ga0068862_100000542 3300005844 Bacteria 39532
142 Ga0068862_100001288 3300005844 Bacteria 23450
143 Ga0068862_100001632 3300005844 Bacteria 20403
144 Ga0068862_100004915 3300005844 Bacteria 11255
145 Ga0068862_100057617 3300005844 Bacteria 3333
146 Ga0081540_1014591 3300005983 Bacteria 5023
147 Ga0075365_10032298 3300006038 Bacteria 3363
148 Ga0075365_10039062 3300006038 Bacteria 3088
149 Ga0075365_10151974 3300006038 Bacteria 1611
150 Ga0075365_10174020 3300006038 Bacteria 1503
151 Ga0075365_10318181 3300006038 Bacteria 1096
152 Ga0075363_100000252 3300006048 Bacteria 15249
153 Ga0075364_10028984 3300006051 Bacteria 3547
154 Ga0075364_10078364 3300006051 Bacteria 2182
155 Ga0075367_10013385 3300006178 Bacteria 4408
156 Ga0075369_10005684 3300006186 Bacteria 4675
157 Ga0075369_10117694 3300006186 Bacteria 1201
158 Ga0075366_10010251 3300006195 Bacteria 5257
159 Ga0097621_100180647 3300006237 Bacteria 1823
160 Ga0075370_10012820 3300006353 Bacteria 4440
161 Ga0075370_10220971 3300006353 Bacteria 1120
162 Ga0068871_100359251 3300006358 Bacteria 1290
163 Ga0075428_100000382 3300006844 Bacteria 43854
164 Ga0075428_100008063 3300006844 Bacteria 11697
165 Ga0075428_100162246 3300006844 Bacteria 2426
166 Ga0075430_100005192 3300006846 Bacteria 10972
167 Ga0075430_100005806 3300006846 Bacteria 10412
168 Ga0075430_100167185 3300006846 Bacteria 1830
169 Ga0075430_100616617 3300006846 Bacteria 895
170 Ga0075431_100000837 3300006847 Bacteria 26929
171 Ga0075431_100003681 3300006847 Bacteria 14887
172 Ga0075431_100021183 3300006847 Bacteria 6643
173 Ga0075431_100076181 3300006847 Bacteria 3462
174 Ga0075434_100179045 3300006871 Bacteria 2140
175 Ga0075429_100002408 3300006880 Bacteria 15757
176 Ga0075429_100010168 3300006880 Bacteria 8146
177 Ga0068865_100389892 3300006881 Unclassified 1138
178 Ga0097620_100001635 3300006931 Bacteria 22899
179 Ga0097620_100007383 3300006931 Bacteria 11152
180 Ga0097620_100029735 3300006931 Bacteria 5481
181 Ga0097620_100082233 3300006931 Bacteria 3263
182 Ga0099824_1029721 3300006942 Bacteria 2287
183 Ga0105240_10004052 3300009093 Bacteria 22539
184 Ga0105240_10016708 3300009093 Bacteria 9926
185 Ga0105240_10185697 3300009093 Bacteria 2449
186 Ga0105240_10790256 3300009093 Bacteria 1029
187 Ga0111539_10006149 3300009094 Bacteria 15500
188 Ga0111539_10007063 3300009094 Bacteria 14405
189 Ga0111539_10133087 3300009094 Bacteria 2911
190 Ga0111539_10152287 3300009094 Bacteria 2707
191 Ga0105245_10170180 3300009098 Bacteria 2074
192 Ga0105247_10018785 3300009101 Bacteria 4150
193 Ga0105247_10092762 3300009101 Bacteria 1919
194 Ga0114129_10007216 3300009147 Bacteria 15821
195 Ga0114129_10012199 3300009147 Bacteria 12228
196 Ga0105243_10099448 3300009148 Bacteria 2411
197 Ga0105243_10636025 3300009148 Bacteria 1032
198 Ga0105243_11053955 3300009148 Bacteria 819
199 Ga0105241_10052901 3300009174 Bacteria 3103
200 Ga0105241_10125246 3300009174 Bacteria 2074
201 Ga0105241_10183787 3300009174 Bacteria 1736
202 Ga0105248_10001405 3300009177 Bacteria 26896
203 Ga0105248_10004080 3300009177 Bacteria 16149
204 Ga0105248_10191218 3300009177 Bacteria 2306
205 Ga0105248_10610343 3300009177 Bacteria 1231
206 Ga0105248_10698718 3300009177 Bacteria 1144
207 Ga0105237_10001506 3300009545 Bacteria 30623
208 Ga0105237_10471021 3300009545 Bacteria 1262
209 Ga0105237_10667673 3300009545 Bacteria 1046
210 Ga0105238_10214574 3300009551 Bacteria 1901
211 Ga0105238_10373764 3300009551 Bacteria 1416
212 Ga0105238_10435445 3300009551 Bacteria 1307
213 Ga0105238_10649232 3300009551 Bacteria 1065
214 Ga0105249_10015977 3300009553 Bacteria 6654
215 Ga0105249_10067710 3300009553 Bacteria 3290
216 Ga0105239_10036592 3300010375 Bacteria 5389
217 Ga0105239_10040350 3300010375 Bacteria 5114
218 Ga0105239_10051145 3300010375 Bacteria 4530
219 Ga0105239_11198645 3300010375 Bacteria 875
220 Ga0105246_10055226 3300011119 Bacteria 2740
221 Ga0157369_10782482 3300013105 Bacteria 981
222 Ga0157374_10094982 3300013296 Bacteria 2850
223 Ga0157378_10868436 3300013297 Bacteria 931
224 Ga0163162_10018051 3300013306 Bacteria 6903
225 Ga0163162_10188520 3300013306 Bacteria 2190
226 Ga0163162_10297220 3300013306 Bacteria 1746
227 Ga0163162_10515824 3300013306 Bacteria 1325
228 Ga0163162_11306555 3300013306 Bacteria 824
229 Ga0163163_10000628 3300014325 Bacteria 30437
230 Ga0163163_10005530 3300014325 Bacteria 10941
231 Ga0163163_10091778 3300014325 Bacteria 3052
232 Ga0163163_10324097 3300014325 Bacteria 1594
233 Ga0157380_10321421 3300014326 Bacteria 1435
234 Ga0157379_10002605 3300014968 Bacteria 15162
235 Ga0157379_10182197 3300014968 Bacteria 1897
236 Ga0157379_10250412 3300014968 Bacteria 1608
237 Ga0157379_10298665 3300014968 Bacteria 1467
238 Ga0157376_10782234 3300014969 Bacteria 966
239 Ga0214544_1021932 3300021320 Bacteria 4014
240 Ga0214544_1039874 3300021320 Bacteria 1058
241 Ga0214542_1000004 3300021321 Bacteria 415597
242 Ga0214545_1000005 3300021324 Bacteria 415590
243 Ga0214543_1000111 3300021327 Bacteria 106517
244 Ga0213874_10035051 3300021377 Bacteria 1472
245 Ga0213876_10000772 3300021384 Bacteria 21985
246 Ga0213876_10025619 3300021384 Bacteria 3111
247 Ga0209563_101874 3300025230 Bacteria 5103
248 Ga0209677_101271 3300025253 Bacteria 11324
249 Ga0209148_1000235 3300025254 Bacteria 90398
250 Ga0209148_1008186 3300025254 Bacteria 2116
251 Ga0209233_1001018 3300025261 Bacteria 11960
252 Ga0209233_1016165 3300025261 Bacteria 2061
253 Ga0209233_1040449 3300025261 Bacteria 1014
254 Ga0209455_1001985 3300025272 Bacteria 8387
255 Ga0209455_1002071 3300025272 Bacteria 8097
256 Ga0209455_1020389 3300025272 Bacteria 1313
257 Ga0209130_1028066 3300025284 Bacteria 1187
258 Ga0209676_1000295 3300025292 Bacteria 100711
259 Ga0209676_1000392 3300025292 Bacteria 79950
260 Ga0209564_1013288 3300025295 Bacteria 3513
261 Ga0209758_1000102 3300025297 Bacteria 224851
262 Ga0209758_1000680 3300025297 Bacteria 50663
263 Ga0209758_1000867 3300025297 Bacteria 41694
264 Ga0209758_1002379 3300025297 Bacteria 19359
265 Ga0209758_1004754 3300025297 Bacteria 11021
266 Ga0209758_1015190 3300025297 Bacteria 4013
267 Ga0209050_1000362 3300025298 Bacteria 87030
268 Ga0209050_1000411 3300025298 Bacteria 79805
269 Ga0209256_1006004 3300025299 Bacteria 6653
270 Ga0209256_1032768 3300025299 Bacteria 1406
271 Ga0207426_1000532 3300025302 Bacteria 54755
272 Ga0207426_1000644 3300025302 Bacteria 43409
273 Ga0209051_1002168 3300025303 Bacteria 14552
274 Ga0209051_1063369 3300025303 Bacteria 1151
275 Ga0209257_1000513 3300025304 Bacteria 67348
276 Ga0209257_1003364 3300025304 Bacteria 13812
277 Ga0209257_1016145 3300025304 Bacteria 3045
278 Ga0207642_10308122 3300025899 Bacteria 920
279 Ga0207680_10026661 3300025903 Bacteria 3206
280 Ga0207680_10031694 3300025903 Bacteria 2997
281 Ga0207680_10397820 3300025903 Bacteria 973
282 Ga0207647_10011108 3300025904 Bacteria 6326
283 Ga0207643_10134752 3300025908 Bacteria 1472
284 Ga0207643_10333842 3300025908 Bacteria 949
285 Ga0207705_10033457 3300025909 Bacteria 3672
286 Ga0207705_10227182 3300025909 Bacteria 1419
287 Ga0207684_10199588 3300025910 Bacteria 1726
288 Ga0207654_10021126 3300025911 Bacteria 3458
289 Ga0207654_10022953 3300025911 Bacteria 3336
290 Ga0207707_10009506 3300025912 Bacteria 8434
291 Ga0207707_10114888 3300025912 Bacteria 2352
292 Ga0207707_10137271 3300025912 Bacteria 2138
293 Ga0207695_10000006 3300025913 Bacteria 1135309
294 Ga0207695_10011375 3300025913 Bacteria 10785
295 Ga0207695_10246184 3300025913 Bacteria 1688
296 Ga0207671_10002697 3300025914 Bacteria 18613
297 Ga0207671_10098843 3300025914 Bacteria 2208
298 Ga0207660_10008941 3300025917 Bacteria 6481
299 Ga0207662_10000523 3300025918 Bacteria 17038
300 Ga0207657_10099254 3300025919 Bacteria 2419
301 Ga0207657_10553588 3300025919 Bacteria 899
302 Ga0207649_10149142 3300025920 Bacteria 1609
303 Ga0207649_10236833 3300025920 Bacteria 1308
304 Ga0207652_10094527 3300025921 Bacteria 2632
305 Ga0207681_10004224 3300025923 Bacteria 8870
306 Ga0207681_10015571 3300025923 Bacteria 4744
307 Ga0207694_10322096 3300025924 Bacteria 1276
308 Ga0207650_10000074 3300025925 Bacteria 134837
309 Ga0207659_10003387 3300025926 Bacteria 9557
310 Ga0207659_10580325 3300025926 Bacteria 955
311 Ga0207687_10080108 3300025927 Bacteria 2356
312 Ga0207644_10017073 3300025931 Bacteria 4894
313 Ga0207644_10045867 3300025931 Bacteria 3111
314 Ga0207644_10056221 3300025931 Bacteria 2839
315 Ga0207690_10167658 3300025932 Bacteria 1643
316 Ga0207690_10250048 3300025932 Bacteria 1369
317 Ga0207706_10077202 3300025933 Bacteria 2929
318 Ga0207706_10174802 3300025933 Bacteria 1887
319 Ga0207706_10314734 3300025933 Bacteria 1363
320 Ga0207706_10363574 3300025933 Bacteria 1257
321 Ga0207706_10372136 3300025933 Bacteria 1241
322 Ga0207709_10066830 3300025935 Bacteria 2266
323 Ga0207709_10651468 3300025935 Bacteria 839
324 Ga0207670_10113213 3300025936 Bacteria 1959
325 Ga0207669_10024061 3300025937 Bacteria 3267
326 Ga0207669_10223773 3300025937 Bacteria 1383
327 Ga0207704_10280754 3300025938 Unclassified 1266
328 Ga0207691_10308175 3300025940 Bacteria 1359
329 Ga0207711_10011313 3300025941 Bacteria 7412
330 Ga0207689_10005367 3300025942 Bacteria 11475
331 Ga0207689_10415141 3300025942 Bacteria 1123
332 Ga0207661_10022137 3300025944 Bacteria 4779
333 Ga0207679_10046433 3300025945 Bacteria 3148
334 Ga0207679_10135693 3300025945 Bacteria 1981
335 Ga0207651_10006946 3300025960 Bacteria 5987
336 Ga0207651_10033145 3300025960 Bacteria 3328
337 Ga0207712_10042674 3300025961 Bacteria 3125
338 Ga0207712_10075500 3300025961 Bacteria 2437
339 Ga0207712_10734899 3300025961 Bacteria 864
340 Ga0207668_10000246 3300025972 Bacteria 36387
341 Ga0207668_10012632 3300025972 Bacteria 5176
342 Ga0207668_10022658 3300025972 Bacteria 4025
343 Ga0207668_10046069 3300025972 Bacteria 2977
344 Ga0207668_10071593 3300025972 Bacteria 2477
345 Ga0207668_10073452 3300025972 Bacteria 2451
346 Ga0207668_10098235 3300025972 Bacteria 2169
347 Ga0207668_10537758 3300025972 Bacteria 1010
348 Ga0207640_10529115 3300025981 Bacteria 987
349 Ga0207658_10000275 3300025986 Bacteria 53906
350 Ga0207658_10032463 3300025986 Bacteria 3716
351 Ga0207658_10068281 3300025986 Bacteria 2681
352 Ga0207658_10338414 3300025986 Bacteria 1307
353 Ga0207658_10400481 3300025986 Bacteria 1206
354 Ga0207658_10444788 3300025986 Bacteria 1146
355 Ga0207677_10061033 3300026023 Bacteria 2609
356 Ga0207703_10008423 3300026035 Bacteria 8151
357 Ga0207703_10017891 3300026035 Bacteria 5535
358 Ga0207703_10028520 3300026035 Bacteria 4401
359 Ga0207703_10473244 3300026035 Bacteria 1173
360 Ga0207678_10027717 3300026067 Bacteria 4945
361 Ga0207678_10309452 3300026067 Bacteria 1358
362 Ga0207708_10170748 3300026075 Bacteria 1722
363 Ga0207702_10055422 3300026078 Bacteria 3362
364 Ga0207641_10001197 3300026088 Bacteria 26009
365 Ga0207641_10001917 3300026088 Bacteria 19953
366 Ga0207641_10023476 3300026088 Bacteria 5081
367 Ga0207641_10025033 3300026088 Bacteria 4921
368 Ga0207641_10064420 3300026088 Bacteria 3133
369 Ga0207641_10417998 3300026088 Bacteria 1290
370 Ga0207648_10244395 3300026089 Bacteria 1599
371 Ga0207648_10309264 3300026089 Bacteria 1418
372 Ga0207676_10001101 3300026095 Bacteria 20425
373 Ga0207676_10011927 3300026095 Bacteria 6219
374 Ga0207676_10029351 3300026095 Bacteria 4116
375 Ga0207676_10147427 3300026095 Bacteria 2022
376 Ga0207674_10010840 3300026116 Bacteria 10276
377 Ga0207674_10118682 3300026116 Bacteria 2615
378 Ga0207674_10374703 3300026116 Bacteria 1376
379 Ga0207675_100000884 3300026118 Bacteria 29908
380 Ga0207675_100017209 3300026118 Bacteria 6751
381 Ga0207675_100050397 3300026118 Bacteria 3885
382 Ga0207675_100130509 3300026118 Bacteria 2383
383 Ga0207675_100214396 3300026118 Bacteria 1853
384 Ga0207675_100240750 3300026118 Bacteria 1748
385 Ga0207683_10127875 3300026121 Bacteria 2284
386 Ga0207683_10296555 3300026121 Bacteria 1479
387 Ga0207698_10041962 3300026142 Bacteria 3414
388 Ga0207698_10321725 3300026142 Bacteria 1449
389 Ga0209389_1000021 3300027296 Bacteria 169506
390 Ga0209389_1000120 3300027296 Bacteria 70535
391 Ga0209589_1000027 3300027357 Bacteria 155295
392 Ga0209489_100023 3300027361 Bacteria 198829
393 Ga0209489_100742 3300027361 Bacteria 64218
394 Ga0209700_100134 3300027363 Bacteria 112846
395 Ga0207428_10049333 3300027907 Bacteria 3374
396 Ga0268266_10007665 3300028379 Bacteria 9701
397 Ga0268266_10060849 3300028379 Bacteria 3256
398 Ga0268266_10099484 3300028379 Bacteria 2560
399 Ga0268266_10131320 3300028379 Bacteria 2240
400 Ga0268266_10242709 3300028379 Bacteria 1663
401 Ga0268266_10264440 3300028379 Bacteria 1595
402 Ga0268265_10000648 3300028380 Bacteria 34549
403 Ga0268265_10004684 3300028380 Bacteria 9448
404 Ga0268265_10004973 3300028380 Bacteria 9134
405 Ga0268265_10056714 3300028380 Bacteria 2982
406 Ga0268265_10211950 3300028380 Bacteria 1688
407 Ga0268265_10313288 3300028380 Bacteria 1418
408 Ga0268264_10000002 3300028381 Bacteria 1153045
409 Ga0268264_10000068 3300028381 Bacteria 275708
410 Ga0268264_10043258 3300028381 Bacteria 3731
411 Ga0268264_10099707 3300028381 Bacteria 2521
412 Ga0268264_10104501 3300028381 Bacteria 2468
413 Ga0265334_10037050 3300028573 Bacteria 1924
414 Ga0307517_10002267 3300028786 Bacteria 31005
415 Ga0265340_10145949 3300031247 Bacteria 1080
416 Ga0265327_10029069 3300031251 Bacteria 3149
417 Ga0307513_10000790 3300031456 Bacteria 45976
418 Ga0307513_10036360 3300031456 Bacteria 5494
419 Ga0307513_10050711 3300031456 Bacteria 4483
420 Ga0307408_100012876 3300031548 Bacteria 5545
421 Ga0307408_100049476 3300031548 Bacteria 3019
422 Ga0307514_10133737 3300031649 Bacteria 1702
423 Ga0307516_10012892 3300031730 Bacteria 8969
424 Ga0307413_10338197 3300031824 Bacteria 1157
425 Ga0307413_10357599 3300031824 Bacteria 1129
426 Ga0307406_10304065 3300031901 Bacteria 1227
427 Ga0307416_100142406 3300032002 Bacteria 2182
428 Ga0307416_100642141 3300032002 Unclassified 1145
429 Ga0307411_10390981 3300032005 Bacteria 1147
430 Ga0307510_10085858 3300033180 Bacteria 3021
431 Ga0373934_0025698 3300035086 Bacteria 2283
432 Ga0373944_0065369 3300035089 Bacteria 1175
433 Ga0373923_0021889 3300035111 Bacteria 2500
434 Ga0373953_0053465 3300035117 Bacteria 1637
435 Ga0373954_0040952 3300035118 Bacteria 2159
436 Ga0373960_0069379 3300035121 Bacteria 1087
437 Ga0373943_0012866 3300035170 Bacteria 3772
438 Ga0373946_0050711 3300035171 Bacteria 1734
439 Ga0373935_0121699 3300035692 Bacteria 1744
440 Ga0373927_0028404 3300035695 Bacteria 3648
441 Ga0373927_0155270 3300035695 Bacteria 1498
442 Ga0373925_0088388 3300037068 Bacteria 2366
443 Ga0395899_0000004 3300037312 Bacteria 874267
444 Ga0395900_0001491 3300037418 Bacteria 27848
445 Ga0395898_0064645 3300037466 Bacteria 3548
446 Ga0395905_0002891 3300037471 Bacteria 18767
447 Ga0395905_0122266 3300037471 Bacteria 2448
448 Ga0395905_0172822 3300037471 Bacteria 2029
449 Ga0436364_0162632 3300037853 Bacteria 2741
450 Ga0395901_0189967 3300038443 Bacteria 2154
451 Ga0395901_0199391 3300038443 Bacteria 2098
452 Ga0395901_0216211 3300038443 Bacteria 2005
453 Ga0436365_0608786 3300039437 Bacteria 20013
454 Ga0436365_0925275 3300039437 Bacteria 5894
455 Ga0436365_1234333 3300039437 Bacteria 1224
456 Ga0436365_1378879 3300039437 Bacteria 1355
457 Ga0436365_1556579 3300039437 Bacteria 1117
458 Ga0436361_1177038 3300039447 Bacteria 2086
459 Ga0451791_1620488 3300041451 Bacteria 1241
460 Ga0451839_0850209 3300041496 Bacteria 1186
461 Ga0439448_0169788 3300042005 Bacteria 761
462 Ga0466969_0045176 3300044656 Bacteria 2188
463 Ga0466972_0000126 3300044658 Bacteria 64766
464 Ga0466972_0006136 3300044658 Bacteria 6039
465 Ga0466972_0194704 3300044658 Bacteria 950
466 Ga0466966_0000159 3300044684 Bacteria 43912
467 Ga0466961_0000025 3300044693 Bacteria 96344
468 Ga0466961_0180999 3300044693 Bacteria 1309
469 Ga0466963_0070322 3300044694 Bacteria 2354
470 Ga0466963_0121763 3300044694 Bacteria 1796
471 Ga0466964_0080772 3300044706 Bacteria 1395
472 Ga0466968_0030347 3300044735 Bacteria 2239
473 Ga0466968_0047509 3300044735 Bacteria 1825
474 Ga0466968_0157754 3300044735 Bacteria 1046
475 Ga0466970_0069185 3300044765 Bacteria 1897
476 Ga0466970_0102296 3300044765 Bacteria 1561
477 Ga0466957_0028301 3300044842 Bacteria 3337
478 Ga0466957_0039822 3300044842 Bacteria 2837
479 Ga0466957_0210607 3300044842 Bacteria 1280
480 Ga0466959_0002316 3300045049 Bacteria 12148
481 Ga0466959_0059173 3300045049 Bacteria 2790
482 Ga0466959_0434021 3300045049 Bacteria 891
483 Ga0451576_0007632 3300045051 Bacteria 12867
484 Ga0466958_0035133 3300045836 Bacteria 2994
485 Ga0466967_0080886 3300045976 Bacteria 2933
486 Ga0466967_0196012 3300045976 Bacteria 1911
487 Ga0466967_0296752 3300045976 Bacteria 1554
488 Ga0495592_0294438 3300046454 Bacteria 1057
489 Ga0495603_0219521 3300046455 Bacteria 1097
490 Ga0495590_0140051 3300046457 Bacteria 873
491 Ga0495629_0207081 3300046459 Bacteria 1355
492 Ga0495638_0003450 3300046460 Bacteria 12448
493 Ga0495638_0019828 3300046460 Bacteria 4446
494 Ga0495638_0084663 3300046460 Bacteria 1919
495 Ga0495651_0005468 3300046462 Bacteria 9691
496 Ga0495651_0018419 3300046462 Bacteria 5409
497 Ga0495580_0145684 3300046472 Bacteria 1641
498 Ga0495582_0069077 3300046473 Bacteria 1953
499 Ga0495605_0045387 3300046474 Bacteria 2166
500 Ga0495605_0124819 3300046474 Bacteria 1165
501 Ga0495664_0013167 3300046477 Bacteria 4691
502 Ga0495585_0231634 3300046492 Bacteria 928
503 Ga0495583_0082007 3300046506 Bacteria 1400
504 Ga0495583_0138259 3300046506 Bacteria 1016
505 Ga0495583_0152608 3300046506 Bacteria 957
506 Ga0495583_0154616 3300046506 Bacteria 949
507 Ga0495606_0031088 3300046507 Bacteria 3717
508 Ga0495606_0054529 3300046507 Bacteria 2589
509 Ga0495606_0057985 3300046507 Bacteria 2491
510 Ga0495606_0196122 3300046507 Bacteria 1154
511 Ga0495608_0009005 3300046511 Bacteria 6981
512 Ga0495608_0094160 3300046511 Bacteria 1935
513 Ga0495610_0114022 3300046512 Unclassified 1193
514 Ga0495616_0164131 3300046513 Bacteria 997
515 Ga0495618_0008100 3300046514 Bacteria 6364
516 Ga0495620_0118080 3300046515 Bacteria 1047
517 Ga0495628_0023385 3300046516 Bacteria 5073
518 Ga0495628_0295057 3300046516 Bacteria 1201
519 Ga0495630_0110501 3300046517 Bacteria 2082
520 Ga0495630_0124728 3300046517 Bacteria 1954
521 Ga0495630_0247564 3300046517 Bacteria 1362
522 Ga0495631_0126064 3300046518 Bacteria 1101
523 Ga0495643_0046702 3300046522 Bacteria 2346
524 Ga0495643_0085071 3300046522 Bacteria 1640
525 Ga0495648_0051189 3300046524 Bacteria 2518
526 Ga0495648_0104093 3300046524 Bacteria 1559
527 Ga0495642_0010536 3300046528 Bacteria 3540
528 Ga0495652_0005378 3300046529 Bacteria 12071
529 Ga0495652_0098033 3300046529 Bacteria 2383
530 Ga0495640_0004432 3300046533 Bacteria 11205
531 Ga0495640_0007111 3300046533 Bacteria 8806
532 Ga0495640_0070245 3300046533 Bacteria 2353
533 Ga0495587_0009387 3300046536 Bacteria 6271
534 Ga0495597_0021261 3300046542 Bacteria 3017
535 Ga0495597_0093289 3300046542 Bacteria 1275
536 Ga0495645_0002598 3300046543 Bacteria 12276
537 Ga0495622_0050561 3300046557 Bacteria 1928
538 Ga0495622_0095509 3300046557 Bacteria 1364
539 Ga0495667_0003765 3300046559 Bacteria 10192
540 Ga0495667_0255556 3300046559 Bacteria 1115
541 Ga0495668_0000034 3300046616 Bacteria 254171
542 Ga0495668_0007075 3300046616 Bacteria 7223
543 Ga0495668_0083754 3300046616 Bacteria 1749
544 Ga0495634_0029484 3300046642 Bacteria 3799
545 Ga0495634_0147419 3300046642 Bacteria 1490
546 Ga0495611_0057507 3300046648 Bacteria 1762
547 Ga0495611_0205929 3300046648 Bacteria 917
548 Ga0495625_0015738 3300046660 Bacteria 5974
549 Ga0495625_0230508 3300046660 Bacteria 1210
550 Ga0495625_0396261 3300046660 Bacteria 863
551 Ga0495635_0013279 3300046663 Bacteria 5763
552 Ga0495635_0165135 3300046663 Bacteria 1506
553 Ga0495659_0167861 3300046664 Bacteria 889
554 Ga0495588_0038051 3300046674 Bacteria 2446
555 Ga0495588_0049869 3300046674 Bacteria 2154
556 Ga0495657_0003405 3300046675 Bacteria 12988
557 Ga0495657_0006555 3300046675 Bacteria 9098
558 Ga0495599_0070928 3300046678 Bacteria 2175
559 Ga0495623_0049425 3300046679 Bacteria 2665
560 Ga0495646_0057843 3300046680 Bacteria 2319
561 Ga0495669_0000012 3300046684 Bacteria 157373
562 Ga0495669_0000329 3300046684 Bacteria 25520
563 Ga0495613_0003009 3300046689 Bacteria 12624
564 Ga0495613_0102176 3300046689 Bacteria 2070
565 Ga0495624_0034987 3300046690 Bacteria 3245
566 Ga0495624_0099482 3300046690 Bacteria 1791
567 Ga0495624_0146512 3300046690 Bacteria 1445
568 Ga0495624_0196764 3300046690 Bacteria 1225
569 Ga0495649_0026228 3300046694 Bacteria 3243
570 Ga0495649_0134072 3300046694 Bacteria 1306
571 Ga0495600_0001163 3300046809 Bacteria 14343
572 Ga0495600_0002699 3300046809 Bacteria 10259
573 Ga0495581_0035817 3300047315 Bacteria 2871
574 Ga0495604_0004948 3300047317 Bacteria 10560
575 Ga0495604_0007447 3300047317 Bacteria 8668
576 Ga0495674_0005194 3300047319 Bacteria 12504
577 Ga0495674_0114771 3300047319 Bacteria 2280
578 Ga0495674_0550661 3300047319 Bacteria 918
579 Ga0495676_0057442 3300047321 Bacteria 3069
580 Ga0495676_0184398 3300047321 Bacteria 1460
581 Ga0495680_0003348 3300047322 Bacteria 15847
582 Ga0495687_014030 3300047443 Bacteria 4146
583 Ga0495687_057524 3300047443 Bacteria 1617
584 Ga0495687_070661 3300047443 Bacteria 1401
585 Ga0495673_0005594 3300047469 Bacteria 7566
586 Ga0495684_0075157 3300047471 Bacteria 2567
587 Ga0495684_0087920 3300047471 Bacteria 2355
588 Ga0495686_0171195 3300047472 Bacteria 1263
589 Ga0495686_0271905 3300047472 Bacteria 945
590 Ga0495593_0044852 3300047673 Bacteria 2363
591 Ga0495602_0122294 3300048088 Bacteria 2092
592 Ga0495602_0130280 3300048088 Bacteria 2007
593 Ga0496100_0025256 3300048903 Bacteria 3633
594 Ga0496100_0032143 3300048903 Bacteria 3269
595 Ga0496100_0096777 3300048903 Bacteria 2026
596 Ga0496100_0125231 3300048903 Bacteria 1803
597 Ga0496101_0070728 3300048904 Bacteria 2556
598 Ga0496101_0484307 3300048904 Bacteria 977
599 Ga0496102_0015458 3300048905 Bacteria 6648
600 Ga0496102_0035768 3300048905 Bacteria 4472
601 Ga0496103_0005690 3300048906 Bacteria 7449
602 Ga0496103_0101212 3300048906 Bacteria 1824
603 Ga0496103_0183173 3300048906 Bacteria 1346
604 Ga0496104_0003185 3300048907 Bacteria 14108
605 Ga0496104_0008463 3300048907 Bacteria 9147
606 Ga0496104_0114232 3300048907 Bacteria 2589
607 Ga0496104_0197406 3300048907 Bacteria 1924
608 Ga0496105_0018799 3300048908 Bacteria 5564
609 Ga0496105_0035775 3300048908 Bacteria 4089
610 Ga0496105_0079740 3300048908 Bacteria 2703
611 Ga0496105_0514935 3300048908 Bacteria 938
612 Ga0496106_0044673 3300048909 Bacteria 3326
613 Ga0496106_0124404 3300048909 Bacteria 2018
614 Ga0496108_0019640 3300048911 Bacteria 5550
615 Ga0496108_0105662 3300048911 Bacteria 2404
616 Ga0496109_0013914 3300048912 Bacteria 6995
617 Ga0496109_0016209 3300048912 Bacteria 6513
618 Ga0496109_0165494 3300048912 Bacteria 2073
619 Ga0496109_0204509 3300048912 Bacteria 1856
620 Ga0496109_0793397 3300048912 Bacteria 885
621 Ga0496110_0067641 3300048913 Bacteria 3161
622 Ga0496110_0503799 3300048913 Bacteria 1102
623 Ga0496112_0050449 3300048915 Bacteria 4081
624 Ga0496112_0130692 3300048915 Bacteria 2482
625 Ga0496112_0150261 3300048915 Bacteria 2296
626 Ga0496112_0184840 3300048915 Bacteria 2048
627 Ga0496112_0253686 3300048915 Bacteria 1710
628 Ga0496113_0009710 3300048916 Bacteria 6322
629 Ga0496113_0033695 3300048916 Bacteria 3732
630 Ga0496113_0040589 3300048916 Bacteria 3430
631 Ga0496113_0116713 3300048916 Bacteria 2083
632 Ga0496113_0178684 3300048916 Bacteria 1682
633 Ga0496114_0146077 3300048917 Bacteria 2050
634 Ga0496114_0313912 3300048917 Bacteria 1385
635 Ga0496115_0140239 3300048918 Bacteria 1994
636 Ga0496115_0288105 3300048918 Bacteria 1347
637 Ga0496115_0619866 3300048918 Bacteria 858
638 Ga0496116_0033293 3300048919 Bacteria 3659
639 Ga0496117_0025029 3300048920 Bacteria 4702
640 Ga0496118_0005681 3300048921 Bacteria 14053
641 Ga0496118_0041059 3300048921 Bacteria 3669
642 Ga0496118_0055902 3300048921 Bacteria 2972
643 Ga0496118_0125404 3300048921 Bacteria 1663
644 Ga0496118_0193079 3300048921 Bacteria 1215
645 Ga0496119_0021805 3300048922 Bacteria 4612
646 Ga0496119_0026130 3300048922 Bacteria 4056
647 Ga0496121_0001066 3300048924 Bacteria 48544
648 Ga0496121_0066696 3300048924 Bacteria 2920
649 Ga0496121_0157466 3300048924 Bacteria 1665
650 Ga0496121_0197403 3300048924 Bacteria 1437
651 Ga0496121_0411687 3300048924 Bacteria 882
652 Ga0496121_0513545 3300048924 Bacteria 758
653 Ga0496124_0016356 3300048927 Bacteria 7058
654 Ga0496124_0080458 3300048927 Bacteria 2681
655 Ga0496124_0237763 3300048927 Bacteria 1357
656 Ga0496125_0028152 3300048928 Bacteria 5081
657 Ga0496125_0072992 3300048928 Bacteria 2671
658 Ga0496125_0119781 3300048928 Bacteria 1881
659 Ga0496125_0285277 3300048928 Bacteria 1020
660 Ga0496126_0010533 3300048929 Bacteria 9681
661 Ga0496126_0198828 3300048929 Bacteria 1694
662 Ga0496126_0428478 3300048929 Bacteria 1068
663 Ga0496126_0442614 3300048929 Bacteria 1047
664 Ga0495682_0087758 3300049460 Bacteria 1118
665 Ga0501033_0757333 3300049570 Bacteria 658
666 Ga0501034_0636591 3300049571 Bacteria 969
667 Ga0501047_0023878 3300049581 Bacteria 5872
668 Ga0501257_000824 3300049686 Bacteria 6198
669 nmdc:mga03683_7412_c1 3300050489 Bacteria 3809
670 nmdc:mga03n38_14325_c1 3300050490 Bacteria 3036
671 nmdc:mga00v17_201692_c1 3300050491 Bacteria 1286
672 nmdc:mga00v17_95984_c1 3300050491 Bacteria 1867
673 nmdc:mga0yw44_26093_c1 3300050492 Bacteria 3333
674 nmdc:mga0yw44_27511_c1 3300050492 Bacteria 3258
675 nmdc:mga0yw44_52080_c1 3300050492 Bacteria 2481
676 nmdc:mga0yw44_9882_c1 3300050492 Bacteria 4846
677 nmdc:mga06z11_29475_c1 3300050494 Bacteria 2645
678 nmdc:mga07m45_14663_c1 3300050496 Bacteria 4180
679 nmdc:mga07m45_82834_c1 3300050496 Bacteria 1832
680 nmdc:mga05p37_65585_c1 3300050507 Bacteria 4467
681 nmdc:mga09592_17751_c1 3300050508 Bacteria 5832
682 nmdc:mga09592_217857_c1 3300050508 Bacteria 1654
683 nmdc:mga09592_9742_c1 3300050508 Bacteria 7804
684 nmdc:mga0qj67_195654_c1 3300050509 Bacteria 1643
685 nmdc:mga0qj67_203108_c1 3300050509 Bacteria 1610
686 nmdc:mga0qj67_570786_c1 3300050509 Bacteria 906
687 nmdc:mga0qj67_581213_c1 3300050509 Bacteria 897
688 nmdc:mga0qj67_8245_c1 3300050509 Bacteria 7724
689 nmdc:mga06r32_170149_c1 3300050510 Bacteria 2162
690 nmdc:mga06r32_5432_c1 3300050510 Bacteria 11470
691 nmdc:mga06r32_6743_c1 3300050510 Bacteria 10321
692 nmdc:mga06r32_6843_c1 3300050510 Bacteria 10245
693 nmdc:mga08y16_107902_c1 3300050511 Bacteria 2898
694 nmdc:mga08y16_33755_c1 3300050511 Bacteria 5374
695 nmdc:mga0n895_308020_c1 3300050512 Bacteria 1605
696 nmdc:mga0n895_607555_c1 3300050512 Bacteria 1095
697 nmdc:mga0sz30_100590_c1 3300050516 Bacteria 1263
698 nmdc:mga0sz30_155091_c1 3300050516 Bacteria 1014
699 nmdc:mga0sz30_49302_c2 3300050516 Bacteria 1449
700 nmdc:mga0sz30_57533_c1 3300050516 Bacteria 1657
701 Ga0495601_0044885 3300053077 Bacteria 2778
702 Ga0500635_0000045 3300053080 Bacteria 87314
703 Ga0495595_0007151 3300053084 Bacteria 4561
704 Ga0495619_0028832 3300053085 Bacteria 3582
705 Ga0500578_0333277 3300053086 Bacteria 891
706 Ga0500643_000016 3300053087 Bacteria 309502
707 Ga0500647_0011504 3300053091 Bacteria 3954
708 Ga0500647_0076024 3300053091 Bacteria 1611
709 Ga0500583_0119470 3300053092 Bacteria 1303
710 Ga0500651_0040865 3300053093 Bacteria 2922
711 Ga0500651_0319200 3300053093 Bacteria 887
712 Ga0500566_0029401 3300053094 Bacteria 3210
713 Ga0500641_0017462 3300053096 Bacteria 2683
714 Ga0500555_002104 3300053103 Bacteria 5843
715 Ga0500556_0194460 3300053104 Bacteria 801
716 Ga0500557_000011 3300053105 Bacteria 117471
717 Ga0500562_003210 3300053108 Bacteria 4078
718 Ga0500569_003209 3300053109 Bacteria 3311
719 Ga0500569_021786 3300053109 Bacteria 1698
720 Ga0500592_016601 3300053116 Bacteria 1182
721 Ga0500595_015325 3300053119 Bacteria 2881
722 Ga0500595_032316 3300053119 Bacteria 1748
723 Ga0500595_054221 3300053119 Bacteria 1231
724 Ga0500597_166015 3300053120 Bacteria 943
725 Ga0500608_001733 3300053122 Bacteria 7792
726 Ga0500617_073850 3300053124 Bacteria 1489
727 Ga0500642_0000301 3300053130 Bacteria 17687
728 Ga0500642_0008296 3300053130 Bacteria 3548
729 Ga0500559_0007118 3300053136 Bacteria 4987
730 Ga0500559_0051187 3300053136 Bacteria 1823
731 Ga0500588_0004033 3300053146 Unclassified 3148
732 Ga0500590_021318 3300053148 Bacteria 3363
733 Ga0500590_047676 3300053148 Bacteria 2186
734 Ga0500616_0024396 3300053153 Bacteria 3361
735 Ga0500619_001544 3300053154 Bacteria 4120
736 Ga0500619_057392 3300053154 Bacteria 1273
737 Ga0500622_0005376 3300053156 Bacteria 7713
738 Ga0500622_0018371 3300053156 Bacteria 3719
739 Ga0500638_066433 3300053162 Bacteria 1728
740 Ga0500638_068604 3300053162 Bacteria 1697
741 Ga0500639_091414 3300053163 Bacteria 1515
742 Ga0500636_0001919 3300053177 Bacteria 11418
743 Ga0500636_0019470 3300053177 Bacteria 4017
744 Ga0500636_0055172 3300053177 Bacteria 2329
745 Ga0500636_0094100 3300053177 Bacteria 1712
746 Ga0500636_0235116 3300053177 Bacteria 945
747 Ga0500636_0255736 3300053177 Bacteria 890
748 Ga0500637_0042240 3300053178 Bacteria 2577
749 Ga0500576_074544 3300053725 Bacteria 1450
750 Ga0500625_000880 3300053729 Bacteria 9315
751 Ga0500645_054817 3300053730 Bacteria 1159
752 Ga0500609_000528 3300053731 Bacteria 5735
753 Ga0500552_003952 3300053733 Bacteria 1534
754 Ga0500596_004770 3300053735 Bacteria 2452
755 Ga0500599_010576 3300053736 Bacteria 1220
756 Ga0500601_000238 3300053737 Bacteria 10761
757 Ga0500587_000787 3300053739 Bacteria 4124
758 Ga0500661_015862 3300055283 Bacteria 1350
759 2507511517 2507262055 Bacteria 8048963
760 2508545324 2508501009 Bacteria 7784016
761 2508694153 2508501042 Bacteria 8719808
762 2513625445 2513237092 Bacteria 8341956
763 2513640957 2513237094 Bacteria 8789602
764 2513648367 2513237095 Bacteria 8976980
765 2513705038 2513237102 Bacteria 7703324
766 2513716331 2513237104 Bacteria 10034502
767 2513875120 2513237139 Bacteria 8737671
768 2514013806 2513237161 Bacteria 8871253
769 2515624912 2515154112 Bacteria 8294334
770 2517101284 2517093001 Bacteria 9002274
771 2524440697 2524023205 Bacteria 8918781
772 2528854483 2528768022 Bacteria 10457665
773 2587918915 2585428106 Bacteria 5179711
774 2617348316 2617270735 Bacteria 9163226
775 2617374858 2617270741 Bacteria 8201522
776 2643998399 2643221598 Bacteria 4578346
777 2644086736 2643221614 Bacteria 4260023
778 2644227658 2643221640 Bacteria 5258820
779 2644236824 2643221642 Bacteria 5357871
780 2644341690 2643221661 Bacteria 4267604
781 2644367977 2643221666 Bacteria 4265935
782 2745075937 2744054633 Bacteria 8678936
783 2793061406 2791355196 Bacteria 7323613
784 2793069797 2791355197 Bacteria 8420563
785 2805916289 2802429603 Bacteria 8777136
786 2818239949 2816332527 Bacteria 8933356
787 2824607646 2824600985 Bacteria 8488197
788 2824614347 2824609381 Bacteria 8672835
789 2824622354 2824617872 Bacteria 8814715
790 2824631433 2824626560 Bacteria 8813858
791 2824637953 2824635225 Bacteria 8785348
792 2824652425 2824644064 Bacteria 8743947
793 2824656791 2824653114 Bacteria 8493680
794 2824664197 2824661429 Bacteria 9877870
795 2824678370 2824671348 Bacteria 8369588
796 2824683590 2824679649 Bacteria 8248951
797 2824690580 2824687955 Bacteria 8360029
798 2824697839 2824696289 Bacteria 8335049
799 2824710469 2824704595 Bacteria 9667483
800 2824723394 2824714736 Bacteria 8717648
801 2824731872 2824723954 Bacteria 8758240
802 2824736452 2824732956 Bacteria 7810675
803 2824748873 2824746037 Bacteria 7911610
804 2824760877 2824753945 Bacteria 9787441
805 2824770331 2824763712 Bacteria 9792355
806 2824776283 2824773399 Bacteria 8360218
807 2838130699 2838122688 Bacteria 8803140
808 2841947087 2841941048 Bacteria 8688029
809 2841954982 2841949485 Bacteria 8680857
810 2841965006 2841957949 Bacteria 8652217
811 2841969940 2841966195 Bacteria 8673214
812 2841981868 2841974524 Bacteria 8931498
813 2841990166 2841983080 Bacteria 8395090
814 2842042180 2842038055 Bacteria 8002051
815 2842050223 2842045827 Bacteria 8006841
816 2844316399 2844315083 Bacteria 8138177
817 2847939300 2847930680 Bacteria 9342022
818 2847943727 2847939898 Bacteria 8606328
819 2849082039 2849076700 Bacteria 7039503
820 2857513481 2857509624 Bacteria 7472071
821 2874594729 2874590934 Bacteria 8299676
822 2874615847 2874612657 Bacteria 8252029
823 2874622612 2874620515 Bacteria 8290088
824 2874633545 2874628541 Bacteria 8630250
825 2874647307 2874645413 Bacteria 8214782
826 2876765362 2876761206 Bacteria 10111113
827 2876773861 2876771140 Bacteria 8287509
828 2876819901 2876818435 Bacteria 8274608
829 2879076020 2879074833 Bacteria 8279565
830 2879086973 2879083081 Bacteria 8587928
831 2879104268 2879099564 Bacteria 10442239
832 2879129374 2879127579 Bacteria 8294491
833 2879144052 2879142872 Bacteria 8267021
834 2881369464 2881364244 Bacteria 7710352
835 2881668308 2881665667 Bacteria 8175609
836 2884961425 2884960567 Bacteria 5437054
837 2885373610 2885366525 Bacteria 8326213
838 2885380148 2885374607 Bacteria 8927485
839 2885412564 2885409591 Bacteria 9235467
840 2888387100 2888378607 Bacteria 9652610
841 2888389778 2888388044 Bacteria 7304136
842 2888421318 2888419890 Bacteria 7857137
843 2903728267 2903727486 Bacteria 8281579
844 2904671381 2904666416 Bacteria 8226587
845 2904693825 2904690495 Bacteria 9412302
846 2904719670 2904711408 Bacteria 9771557
847 2906606407 2906602504 Bacteria 8295279
848 2906629101 2906626472 Bacteria 8826946
849 2906644621 2906643746 Bacteria 8722424
850 2908758393 2908756301 Bacteria 8864324
851 2908777340 2908775508 Bacteria 8092255
852 2922377244
853 2922398376 2922393267 Bacteria 8285685
854 2928531643 2928531327 Bacteria 5101314
855 2929623641 2929615660 Bacteria 9193770
856 2929632656 2929624759 Bacteria 9339455
857 2932793085 2932784394 Bacteria 9704911
858 2932795892 2932794094 Bacteria 7915132
859 2932802130 2932801729 Bacteria 7987968
860 2932814647 2932809354 Bacteria 9135765
861 2932823502 2932818245 Bacteria 9955613
862 2932832940 2932828146 Bacteria 9745859
863 2933585545 2933577622 Bacteria 9116884
864 2935616293 2935608549 Bacteria 8203142
865 2935623670 2935616580 Bacteria 9032984
866 2935639440 2935638405 Bacteria 10015038
867 2935650690 2935648319 Bacteria 8801166
868 2935662070 2935656913 Bacteria 8965014
869 2935670387 2935665750 Bacteria 9571747
870 2935679815 2935675223 Bacteria 9928132
871 2935687386 2935684952 Bacteria 9590419
872 2935696643 2935694250 Bacteria 9291695
873 2935705461 2935703347 Bacteria 10242284
874 2935718845 2935713505 Bacteria 9608509
875 2935728497 2935722832 Bacteria 9608746
876 2935736906 2935732158 Bacteria 9706831
877 2935746091 2935741537 Bacteria 9707219
878 2935753352 2935750917 Bacteria 9590372
879 2935766254 2935760218 Bacteria 9817913
880 2935807204 2935801545 Bacteria 9301974
881 2935813883 2935810662 Bacteria 9401221
882 2935827090 2935819856 Bacteria 8261050
883 2935828923 2935827899 Bacteria 10038562
884 2935844097 2935837841 Bacteria 9454360
885 2935854271 2935847175 Bacteria 8228321
886 2935862105 2935855204 Bacteria 9035059
887 2935871669 2935864058 Bacteria 9784707
888 2935880220 2935873716 Bacteria 9632195
889 2935886318 2935883170 Bacteria 7964738
890 2935913636 2935908558 Bacteria 8568796
891 2935923534 2935916978 Bacteria 9113783
892 2935931047 2935926038 Bacteria 8601059
893 2935935329 2935934488 Bacteria 8602579
894 2935946895 2935942939 Bacteria 8599779
895 2935954010 2935951376 Bacteria 8602333
896 2935961345 2935959822 Bacteria 7869783
897 2935969036 2935967501 Bacteria 8603075
898 2935983558 2935975950 Bacteria 8347125
899 2935985776 2935984226 Bacteria 8302647
900 2935996886 2935992306 Bacteria 9802711
901 2936005920 2936002035 Bacteria 9362176
902 2936016348 2936011229 Bacteria 8801034
903 2936025004 2936019824 Bacteria 8804134
904 2936033653 2936028420 Bacteria 8965941
905 2936039438 2936037263 Bacteria 9446081
906 2936050915 2936046547 Bacteria 8903709
907 2936057663 2936055302 Bacteria 8785755
908 2940559265 2940556831 Bacteria 9590747
909 2941536883 2941531003 Bacteria 7653939
910 2941541959 2941538514 Bacteria 9402094
911 3005491204 3005483717 Bacteria 7877331
912 3005511049 3005506211 Bacteria 6943378
913 3005591888 3005587118 Bacteria 7794411
914 3005596005 3005594810 Bacteria 8716512
915 3005711962 3005710791 Bacteria 7622528
916 3005719205 3005718088 Bacteria 8283608
917 8006927826 8006926726 Bacteria 6749210
918 8016517113 8016511872 Bacteria 9921665
919 8016588451 8016583857 Bacteria 10421953
920 8016637505 8016630954 Bacteria 9217207
921 8017059470 8017057580 Bacteria 10023680
922 8019578929 8019576017 Bacteria 10049540
923 8019596975 8019586578 Bacteria 10212056
924 8019604706 8019597564 Bacteria 10041141
925 8019613819 8019608314 Bacteria 10042931
926 8019624405 8019619141 Bacteria 9218857
927 8019637633 8019629233 Bacteria 8687553
928 8019641984 8019638758 Bacteria 9062356
929 8019650566 8019648815 Bacteria 10014479
930 8019665560 8019659431 Bacteria 8577854
931 8019675107 8019668869 Bacteria 8791617
932 8019680998 8019678201 Bacteria 8863603
933 8055749802 8055742211 Bacteria 9226248
934 8056974012 8056967851 Bacteria 9038162
935 Ga0495625_0182216
936 JGI24739J22299_10019620
937 JGI25153J46596_10000732
938 JGI25153J46596_10004233
939 JGI25153J46596_10008565
940 JGI25153J46596_10009899
941 rootH2_10044168
942 rootL2_10058382
943 JGI25160J50197_1001947
944 JGI25160J50197_1011819
945 JGI25160J50197_1030521
946 Ga0055542_1003059
947 Ga0055536_1000576
948 Ga0055536_1000606
949 Ga0055530_10004098
950 Ga0055530_10009857
951 Ga0055540_1024409
952 Ga0055531_10000294
953 Ga0055531_10012403
954 Ga0055543_1003066
955 Ga0065165_1002046
956 Ga0065165_1002144
957 Ga0065712_10075409
958 Ga0065712_10166263
959 Ga0070658_10286389
960 Ga0070690_100021139
961 Ga0070690_100483710
962 Ga0070670_100000032
963 Ga0070670_100004709
964 Ga0070670_100123191
965 Ga0070670_100217269
966 Ga0068869_100015582
967 Ga0068869_100059446
968 Ga0070666_10047736
969 Ga0070666_10456853
970 Ga0070680_100050255
971 Ga0068868_100439293
972 Ga0070660_100054341
973 Ga0070689_100000337
974 Ga0070687_100081866
975 Ga0070661_100127898
976 Ga0070668_100000975
977 Ga0070668_100004762
978 Ga0070668_100007849
979 Ga0070668_100007904
980 Ga0070668_100088866
981 Ga0070669_100015826
982 Ga0070669_100079827
983 Ga0070669_100089976
984 Ga0070675_100000590
985 Ga0070675_100242533
986 Ga0070671_100019456
987 Ga0070671_100055425
988 Ga0070671_100058724
989 Ga0070671_100065351
990 Ga0070671_100083308
991 Ga0070674_100027551
992 Ga0070674_100151164
993 Ga0070674_100156508
994 Ga0070674_100691939
995 Ga0070673_100059214
996 Ga0070688_100013340
997 Ga0070659_100545920
998 Ga0070667_100000110
999 Ga0070667_100015527
1000 Ga0070667_100053948
1001 Ga0070667_100094456
1002 Ga0070667_100441689
1003 Ga0070667_100448697
1004 Ga0070667_100650934
1005 Ga0070701_10075713
1006 Ga0070705_100022249
1007 Ga0070700_100049110
1008 Ga0070700_100111925
1009 Ga0070663_100015157
1010 Ga0070663_100287292
1011 Ga0070662_100063311
1012 Ga0070662_100086619
1013 Ga0070662_100091604
1014 Ga0070662_100201929
1015 Ga0070662_100240675
1016 Ga0070681_10025372
1017 Ga0070681_10126415
1018 Ga0068867_100000827
1019 Ga0070685_10067918
1020 Ga0070706_100231801
1021 Ga0070679_100258365
1022 Ga0070679_100387290
1023 Ga0070684_100001718
1024 Ga0070684_100173377
1025 Ga0068853_100180329
1026 Ga0068853_100226820
1027 Ga0070672_100027336
1028 Ga0070686_100023073
1029 Ga0070665_100000232
1030 Ga0070665_100002174
1031 Ga0070665_100022111
1032 Ga0070665_100033123
1033 Ga0070665_100035301
1034 Ga0070665_100093379
1035 Ga0068855_100122020
1036 Ga0068855_100209575
1037 Ga0070664_100000397
1038 Ga0070664_100268400
1039 Ga0068857_100007163
1040 Ga0068857_100054907
1041 Ga0068857_100190180
1042 Ga0068854_100108066
1043 Ga0068854_100122520
1044 Ga0070702_100011407
1045 Ga0068852_100039336
1046 Ga0068852_100096846
1047 Ga0068852_100218124
1048 Ga0068859_100001635
1049 Ga0068859_100007383
1050 Ga0068859_100029735
1051 Ga0068859_100082233
1052 Ga0068864_100000673
1053 Ga0068864_100005130
1054 Ga0068864_100011767
1055 Ga0068864_100083027
1056 Ga0068866_10168052
1057 Ga0068861_100013434
1058 Ga0068861_100016431
1059 Ga0068861_100638392
1060 Ga0068870_10164351
1061 Ga0068870_10273525
1062 Ga0068863_100000998
1063 Ga0068863_100001377
1064 Ga0068863_100010242
1065 Ga0068863_100121361
1066 Ga0068863_100435273
1067 Ga0068863_100493703
1068 Ga0068858_100006036
1069 Ga0068858_100433894
1070 Ga0068860_100000100
1071 Ga0068860_100000167
1072 Ga0068860_100005700
1073 Ga0068860_100007072
1074 Ga0068860_100016951
1075 Ga0068862_100000542
1076 Ga0068862_100001288
1077 Ga0068862_100001632
1078 Ga0068862_100004915
1079 Ga0068862_100057617
1080 Ga0081540_1014591
1081 Ga0075365_10032298
1082 Ga0075365_10039062
1083 Ga0075365_10151974
1084 Ga0075365_10174020
1085 Ga0075365_10318181
1086 Ga0075363_100000252
1087 Ga0075364_10028984
1088 Ga0075364_10078364
1089 Ga0075367_10013385
1090 Ga0075369_10005684
1091 Ga0075369_10117694
1092 Ga0075366_10010251
1093 Ga0097621_100180647
1094 Ga0075370_10012820
1095 Ga0075370_10220971
1096 Ga0068871_100359251
1097 Ga0075428_100000382
1098 Ga0075428_100008063
1099 Ga0075428_100162246
1100 Ga0075430_100005192
1101 Ga0075430_100005806
1102 Ga0075430_100167185
1103 Ga0075430_100616617
1104 Ga0075431_100000837
1105 Ga0075431_100003681
1106 Ga0075431_100021183
1107 Ga0075431_100076181
1108 Ga0075434_100179045
1109 Ga0075429_100002408
1110 Ga0075429_100010168
1111 Ga0068865_100389892
1112 Ga0097620_100001635
1113 Ga0097620_100007383
1114 Ga0097620_100029735
1115 Ga0097620_100082233
1116 Ga0099824_1029721
1117 Ga0105240_10004052
1118 Ga0105240_10016708
1119 Ga0105240_10185697
1120 Ga0105240_10790256
1121 Ga0111539_10006149
1122 Ga0111539_10007063
1123 Ga0111539_10133087
1124 Ga0111539_10152287
1125 Ga0105245_10170180
1126 Ga0105247_10018785
1127 Ga0105247_10092762
1128 Ga0114129_10007216
1129 Ga0114129_10012199
1130 Ga0105243_10099448
1131 Ga0105243_10636025
1132 Ga0105243_11053955
1133 Ga0105241_10052901
1134 Ga0105241_10125246
1135 Ga0105241_10183787
1136 Ga0105248_10001405
1137 Ga0105248_10004080
1138 Ga0105248_10191218
1139 Ga0105248_10610343
1140 Ga0105248_10698718
1141 Ga0105237_10001506
1142 Ga0105237_10471021
1143 Ga0105237_10667673
1144 Ga0105238_10214574
1145 Ga0105238_10373764
1146 Ga0105238_10435445
1147 Ga0105238_10649232
1148 Ga0105249_10015977
1149 Ga0105249_10067710
1150 Ga0105239_10036592
1151 Ga0105239_10040350
1152 Ga0105239_10051145
1153 Ga0105239_11198645
1154 Ga0105246_10055226
1155 Ga0157369_10782482
1156 Ga0157374_10094982
1157 Ga0157378_10868436
1158 Ga0163162_10018051
1159 Ga0163162_10188520
1160 Ga0163162_10297220
1161 Ga0163162_10515824
1162 Ga0163162_11306555
1163 Ga0163163_10000628
1164 Ga0163163_10005530
1165 Ga0163163_10091778
1166 Ga0163163_10324097
1167 Ga0157380_10321421
1168 Ga0157379_10002605
1169 Ga0157379_10182197
1170 Ga0157379_10250412
1171 Ga0157379_10298665
1172 Ga0157376_10782234
1173 Ga0214544_1021932
1174 Ga0214544_1039874
1175 Ga0214542_1000004
1176 Ga0214545_1000005
1177 Ga0214543_1000111
1178 Ga0213874_10035051
1179 Ga0213876_10000772
1180 Ga0213876_10025619
1181 Ga0209563_101874
1182 Ga0209677_101271
1183 Ga0209148_1000235
1184 Ga0209148_1008186
1185 Ga0209233_1001018
1186 Ga0209233_1016165
1187 Ga0209233_1040449
1188 Ga0209455_1001985
1189 Ga0209455_1002071
1190 Ga0209455_1020389
1191 Ga0209130_1028066
1192 Ga0209676_1000295
1193 Ga0209676_1000392
1194 Ga0209564_1013288
1195 Ga0209758_1000102
1196 Ga0209758_1000680
1197 Ga0209758_1000867
1198 Ga0209758_1002379
1199 Ga0209758_1004754
1200 Ga0209758_1015190
1201 Ga0209050_1000362
1202 Ga0209050_1000411
1203 Ga0209256_1006004
1204 Ga0209256_1032768
1205 Ga0207426_1000532
1206 Ga0207426_1000644
1207 Ga0209051_1002168
1208 Ga0209051_1063369
1209 Ga0209257_1000513
1210 Ga0209257_1003364
1211 Ga0209257_1016145
1212 Ga0207642_10308122
1213 Ga0207680_10026661
1214 Ga0207680_10031694
1215 Ga0207680_10397820
1216 Ga0207647_10011108
1217 Ga0207643_10134752
1218 Ga0207643_10333842
1219 Ga0207705_10033457
1220 Ga0207705_10227182
1221 Ga0207684_10199588
1222 Ga0207654_10021126
1223 Ga0207654_10022953
1224 Ga0207707_10009506
1225 Ga0207707_10114888
1226 Ga0207707_10137271
1227 Ga0207695_10000006
1228 Ga0207695_10011375
1229 Ga0207695_10246184
1230 Ga0207671_10002697
1231 Ga0207671_10098843
1232 Ga0207660_10008941
1233 Ga0207662_10000523
1234 Ga0207657_10099254
1235 Ga0207657_10553588
1236 Ga0207649_10149142
1237 Ga0207649_10236833
1238 Ga0207652_10094527
1239 Ga0207681_10004224
1240 Ga0207681_10015571
1241 Ga0207694_10322096
1242 Ga0207650_10000074
1243 Ga0207659_10003387
1244 Ga0207659_10580325
1245 Ga0207687_10080108
1246 Ga0207644_10017073
1247 Ga0207644_10045867
1248 Ga0207644_10056221
1249 Ga0207690_10167658
1250 Ga0207690_10250048
1251 Ga0207706_10077202
1252 Ga0207706_10174802
1253 Ga0207706_10314734
1254 Ga0207706_10363574
1255 Ga0207706_10372136
1256 Ga0207709_10066830
1257 Ga0207709_10651468
1258 Ga0207670_10113213
1259 Ga0207669_10024061
1260 Ga0207669_10223773
1261 Ga0207704_10280754
1262 Ga0207691_10308175
1263 Ga0207711_10011313
1264 Ga0207689_10005367
1265 Ga0207689_10415141
1266 Ga0207661_10022137
1267 Ga0207679_10046433
1268 Ga0207679_10135693
1269 Ga0207651_10006946
1270 Ga0207651_10033145
1271 Ga0207712_10042674
1272 Ga0207712_10075500
1273 Ga0207712_10734899
1274 Ga0207668_10000246
1275 Ga0207668_10012632
1276 Ga0207668_10022658
1277 Ga0207668_10046069
1278 Ga0207668_10071593
1279 Ga0207668_10073452
1280 Ga0207668_10098235
1281 Ga0207668_10537758
1282 Ga0207640_10529115
1283 Ga0207658_10000275
1284 Ga0207658_10032463
1285 Ga0207658_10068281
1286 Ga0207658_10338414
1287 Ga0207658_10400481
1288 Ga0207658_10444788
1289 Ga0207677_10061033
1290 Ga0207703_10008423
1291 Ga0207703_10017891
1292 Ga0207703_10028520
1293 Ga0207703_10473244
1294 Ga0207678_10027717
1295 Ga0207678_10309452
1296 Ga0207708_10170748
1297 Ga0207702_10055422
1298 Ga0207641_10001197
1299 Ga0207641_10001917
1300 Ga0207641_10023476
1301 Ga0207641_10025033
1302 Ga0207641_10064420
1303 Ga0207641_10417998
1304 Ga0207648_10244395
1305 Ga0207648_10309264
1306 Ga0207676_10001101
1307 Ga0207676_10011927
1308 Ga0207676_10029351
1309 Ga0207676_10147427
1310 Ga0207674_10010840
1311 Ga0207674_10118682
1312 Ga0207674_10374703
1313 Ga0207675_100000884
1314 Ga0207675_100017209
1315 Ga0207675_100050397
1316 Ga0207675_100130509
1317 Ga0207675_100214396
1318 Ga0207675_100240750
1319 Ga0207683_10127875
1320 Ga0207683_10296555
1321 Ga0207698_10041962
1322 Ga0207698_10321725
1323 Ga0209389_1000021
1324 Ga0209389_1000120
1325 Ga0209589_1000027
1326 Ga0209489_100023
1327 Ga0209489_100742
1328 Ga0209700_100134
1329 Ga0207428_10049333
1330 Ga0268266_10007665
1331 Ga0268266_10060849
1332 Ga0268266_10099484
1333 Ga0268266_10131320
1334 Ga0268266_10242709
1335 Ga0268266_10264440
1336 Ga0268265_10000648
1337 Ga0268265_10004684
1338 Ga0268265_10004973
1339 Ga0268265_10056714
1340 Ga0268265_10211950
1341 Ga0268265_10313288
1342 Ga0268264_10000002
1343 Ga0268264_10000068
1344 Ga0268264_10043258
1345 Ga0268264_10099707
1346 Ga0268264_10104501
1347 Ga0265334_10037050
1348 Ga0307517_10002267
1349 Ga0265340_10145949
1350 Ga0265327_10029069
1351 Ga0307513_10000790
1352 Ga0307513_10036360
1353 Ga0307513_10050711
1354 Ga0307408_100012876
1355 Ga0307408_100049476
1356 Ga0307514_10133737
1357 Ga0307516_10012892
1358 Ga0307413_10338197
1359 Ga0307413_10357599
1360 Ga0307406_10304065
1361 Ga0307416_100142406
1362 Ga0307416_100642141
1363 Ga0307411_10390981
1364 Ga0307510_10085858
1365 Ga0373934_0025698
1366 Ga0373944_0065369
1367 Ga0373923_0021889
1368 Ga0373953_0053465
1369 Ga0373954_0040952
1370 Ga0373960_0069379
1371 Ga0373943_0012866
1372 Ga0373946_0050711
1373 Ga0373935_0121699
1374 Ga0373927_0028404
1375 Ga0373927_0155270
1376 Ga0373925_0088388
1377 Ga0395899_0000004
1378 Ga0395900_0001491
1379 Ga0395898_0064645
1380 Ga0395905_0002891
1381 Ga0395905_0122266
1382 Ga0395905_0172822
1383 Ga0436364_0162632
1384 Ga0395901_0189967
1385 Ga0395901_0199391
1386 Ga0395901_0216211
1387 Ga0436365_0608786
1388 Ga0436365_0925275
1389 Ga0436365_1234333
1390 Ga0436365_1378879
1391 Ga0436365_1556579
1392 Ga0436361_1177038
1393 Ga0451791_1620488
1394 Ga0451839_0850209
1395 Ga0439448_0169788
1396 Ga0466969_0045176
1397 Ga0466972_0000126
1398 Ga0466972_0006136
1399 Ga0466972_0194704
1400 Ga0466966_0000159
1401 Ga0466961_0000025
1402 Ga0466961_0180999
1403 Ga0466963_0070322
1404 Ga0466963_0121763
1405 Ga0466964_0080772
1406 Ga0466968_0030347
1407 Ga0466968_0047509
1408 Ga0466968_0157754
1409 Ga0466970_0069185
1410 Ga0466970_0102296
1411 Ga0466957_0028301
1412 Ga0466957_0039822
1413 Ga0466957_0210607
1414 Ga0466959_0002316
1415 Ga0466959_0059173
1416 Ga0466959_0434021
1417 Ga0451576_0007632
1418 Ga0466958_0035133
1419 Ga0466967_0080886
1420 Ga0466967_0196012
1421 Ga0466967_0296752
1422 Ga0495592_0294438
1423 Ga0495603_0219521
1424 Ga0495590_0140051
1425 Ga0495629_0207081
1426 Ga0495638_0003450
1427 Ga0495638_0019828
1428 Ga0495638_0084663
1429 Ga0495651_0005468
1430 Ga0495651_0018419
1431 Ga0495580_0145684
1432 Ga0495582_0069077
1433 Ga0495605_0045387
1434 Ga0495605_0124819
1435 Ga0495664_0013167
1436 Ga0495585_0231634
1437 Ga0495583_0082007
1438 Ga0495583_0138259
1439 Ga0495583_0152608
1440 Ga0495583_0154616
1441 Ga0495606_0031088
1442 Ga0495606_0054529
1443 Ga0495606_0057985
1444 Ga0495606_0196122
1445 Ga0495608_0009005
1446 Ga0495608_0094160
1447 Ga0495610_0114022
1448 Ga0495616_0164131
1449 Ga0495618_0008100
1450 Ga0495620_0118080
1451 Ga0495628_0023385
1452 Ga0495628_0295057
1453 Ga0495630_0110501
1454 Ga0495630_0124728
1455 Ga0495630_0247564
1456 Ga0495631_0126064
1457 Ga0495643_0046702
1458 Ga0495643_0085071
1459 Ga0495648_0051189
1460 Ga0495648_0104093
1461 Ga0495642_0010536
1462 Ga0495652_0005378
1463 Ga0495652_0098033
1464 Ga0495640_0004432
1465 Ga0495640_0007111
1466 Ga0495640_0070245
1467 Ga0495587_0009387
1468 Ga0495597_0021261
1469 Ga0495597_0093289
1470 Ga0495645_0002598
1471 Ga0495622_0050561
1472 Ga0495622_0095509
1473 Ga0495667_0003765
1474 Ga0495667_0255556
1475 Ga0495668_0000034
1476 Ga0495668_0007075
1477 Ga0495668_0083754
1478 Ga0495634_0029484
1479 Ga0495634_0147419
1480 Ga0495611_0057507
1481 Ga0495611_0205929
1482 Ga0495625_0015738
1483 Ga0495625_0230508
1484 Ga0495625_0396261
1485 Ga0495635_0013279
1486 Ga0495635_0165135
1487 Ga0495659_0167861
1488 Ga0495588_0038051
1489 Ga0495588_0049869
1490 Ga0495657_0003405
1491 Ga0495657_0006555
1492 Ga0495599_0070928
1493 Ga0495623_0049425
1494 Ga0495646_0057843
1495 Ga0495669_0000012
1496 Ga0495669_0000329
1497 Ga0495613_0003009
1498 Ga0495613_0102176
1499 Ga0495624_0034987
1500 Ga0495624_0099482
1501 Ga0495624_0146512
1502 Ga0495624_0196764
1503 Ga0495649_0026228
1504 Ga0495649_0134072
1505 Ga0495600_0001163
1506 Ga0495600_0002699
1507 Ga0495581_0035817
1508 Ga0495604_0004948
1509 Ga0495604_0007447
1510 Ga0495674_0005194
1511 Ga0495674_0114771
1512 Ga0495674_0550661
1513 Ga0495676_0057442
1514 Ga0495676_0184398
1515 Ga0495680_0003348
1516 Ga0495687_014030
1517 Ga0495687_057524
1518 Ga0495687_070661
1519 Ga0495673_0005594
1520 Ga0495684_0075157
1521 Ga0495684_0087920
1522 Ga0495686_0171195
1523 Ga0495686_0271905
1524 Ga0495593_0044852
1525 Ga0495602_0122294
1526 Ga0495602_0130280
1527 Ga0496100_0025256
1528 Ga0496100_0032143
1529 Ga0496100_0096777
1530 Ga0496100_0125231
1531 Ga0496101_0070728
1532 Ga0496101_0484307
1533 Ga0496102_0015458
1534 Ga0496102_0035768
1535 Ga0496103_0005690
1536 Ga0496103_0101212
1537 Ga0496103_0183173
1538 Ga0496104_0003185
1539 Ga0496104_0008463
1540 Ga0496104_0114232
1541 Ga0496104_0197406
1542 Ga0496105_0018799
1543 Ga0496105_0035775
1544 Ga0496105_0079740
1545 Ga0496105_0514935
1546 Ga0496106_0044673
1547 Ga0496106_0124404
1548 Ga0496108_0019640
1549 Ga0496108_0105662
1550 Ga0496109_0013914
1551 Ga0496109_0016209
1552 Ga0496109_0165494
1553 Ga0496109_0204509
1554 Ga0496109_0793397
1555 Ga0496110_0067641
1556 Ga0496110_0503799
1557 Ga0496112_0050449
1558 Ga0496112_0130692
1559 Ga0496112_0150261
1560 Ga0496112_0184840
1561 Ga0496112_0253686
1562 Ga0496113_0009710
1563 Ga0496113_0033695
1564 Ga0496113_0040589
1565 Ga0496113_0116713
1566 Ga0496113_0178684
1567 Ga0496114_0146077
1568 Ga0496114_0313912
1569 Ga0496115_0140239
1570 Ga0496115_0288105
1571 Ga0496115_0619866
1572 Ga0496116_0033293
1573 Ga0496117_0025029
1574 Ga0496118_0005681
1575 Ga0496118_0041059
1576 Ga0496118_0055902
1577 Ga0496118_0125404
1578 Ga0496118_0193079
1579 Ga0496119_0021805
1580 Ga0496119_0026130
1581 Ga0496121_0001066
1582 Ga0496121_0066696
1583 Ga0496121_0157466
1584 Ga0496121_0197403
1585 Ga0496121_0411687
1586 Ga0496121_0513545
1587 Ga0496124_0016356
1588 Ga0496124_0080458
1589 Ga0496124_0237763
1590 Ga0496125_0028152
1591 Ga0496125_0072992
1592 Ga0496125_0119781
1593 Ga0496125_0285277
1594 Ga0496126_0010533
1595 Ga0496126_0198828
1596 Ga0496126_0428478
1597 Ga0496126_0442614
1598 Ga0495682_0087758
1599 Ga0501033_0757333
1600 Ga0501034_0636591
1601 Ga0501047_0023878
1602 Ga0501257_000824
1603 nmdc:mga03683_7412_c1
1604 nmdc:mga03n38_14325_c1
1605 nmdc:mga00v17_201692_c1
1606 nmdc:mga00v17_95984_c1
1607 nmdc:mga0yw44_26093_c1
1608 nmdc:mga0yw44_27511_c1
1609 nmdc:mga0yw44_52080_c1
1610 nmdc:mga0yw44_9882_c1
1611 nmdc:mga06z11_29475_c1
1612 nmdc:mga07m45_14663_c1
1613 nmdc:mga07m45_82834_c1
1614 nmdc:mga05p37_65585_c1
1615 nmdc:mga09592_17751_c1
1616 nmdc:mga09592_217857_c1
1617 nmdc:mga09592_9742_c1
1618 nmdc:mga0qj67_195654_c1
1619 nmdc:mga0qj67_203108_c1
1620 nmdc:mga0qj67_570786_c1
1621 nmdc:mga0qj67_581213_c1
1622 nmdc:mga0qj67_8245_c1
1623 nmdc:mga06r32_170149_c1
1624 nmdc:mga06r32_5432_c1
1625 nmdc:mga06r32_6743_c1
1626 nmdc:mga06r32_6843_c1
1627 nmdc:mga08y16_107902_c1
1628 nmdc:mga08y16_33755_c1
1629 nmdc:mga0n895_308020_c1
1630 nmdc:mga0n895_607555_c1
1631 nmdc:mga0sz30_100590_c1
1632 nmdc:mga0sz30_155091_c1
1633 nmdc:mga0sz30_49302_c2
1634 nmdc:mga0sz30_57533_c1
1635 Ga0495601_0044885
1636 Ga0500635_0000045
1637 Ga0495595_0007151
1638 Ga0495619_0028832
1639 Ga0500578_0333277
1640 Ga0500643_000016
1641 Ga0500647_0011504
1642 Ga0500647_0076024
1643 Ga0500583_0119470
1644 Ga0500651_0040865
1645 Ga0500651_0319200
1646 Ga0500566_0029401
1647 Ga0500641_0017462
1648 Ga0500555_002104
1649 Ga0500556_0194460
1650 Ga0500557_000011
1651 Ga0500562_003210
1652 Ga0500569_003209
1653 Ga0500569_021786
1654 Ga0500592_016601
1655 Ga0500595_015325
1656 Ga0500595_032316
1657 Ga0500595_054221
1658 Ga0500597_166015
1659 Ga0500608_001733
1660 Ga0500617_073850
1661 Ga0500642_0000301
1662 Ga0500642_0008296
1663 Ga0500559_0007118
1664 Ga0500559_0051187
1665 Ga0500588_0004033
1666 Ga0500590_021318
1667 Ga0500590_047676
1668 Ga0500616_0024396
1669 Ga0500619_001544
1670 Ga0500619_057392
1671 Ga0500622_0005376
1672 Ga0500622_0018371
1673 Ga0500638_066433
1674 Ga0500638_068604
1675 Ga0500639_091414
1676 Ga0500636_0001919
1677 Ga0500636_0019470
1678 Ga0500636_0055172
1679 Ga0500636_0094100
1680 Ga0500636_0235116
1681 Ga0500636_0255736
1682 Ga0500637_0042240
1683 Ga0500576_074544
1684 Ga0500625_000880
1685 Ga0500645_054817
1686 Ga0500609_000528
1687 Ga0500552_003952
1688 Ga0500596_004770
1689 Ga0500599_010576
1690 Ga0500601_000238
1691 Ga0500587_000787
1692 Ga0500661_015862
1693 2507511517
1694 2508545324
1695 2508694153
1696 2513625445
1697 2513640957
1698 2513648367
1699 2513705038
1700 2513716331
1701 2513875120
1702 2514013806
1703 2515624912
1704 2517101284
1705 2524440697
1706 2528854483
1707 2587918915
1708 2617348316
1709 2617374858
1710 2643998399
1711 2644086736
1712 2644227658
1713 2644236824
1714 2644341690
1715 2644367977
1716 2745075937
1717 2793061406
1718 2793069797
1719 2805916289
1720 2818239949
1721 2824607646
1722 2824614347
1723 2824622354
1724 2824631433
1725 2824637953
1726 2824652425
1727 2824656791
1728 2824664197
1729 2824678370
1730 2824683590
1731 2824690580
1732 2824697839
1733 2824710469
1734 2824723394
1735 2824731872
1736 2824736452
1737 2824748873
1738 2824760877
1739 2824770331
1740 2824776283
1741 2838130699
1742 2841947087
1743 2841954982
1744 2841965006
1745 2841969940
1746 2841981868
1747 2841990166
1748 2842042180
1749 2842050223
1750 2844316399
1751 2847939300
1752 2847943727
1753 2849082039
1754 2857513481
1755 2874594729
1756 2874615847
1757 2874622612
1758 2874633545
1759 2874647307
1760 2876765362
1761 2876773861
1762 2876819901
1763 2879076020
1764 2879086973
1765 2879104268
1766 2879129374
1767 2879144052
1768 2881369464
1769 2881668308
1770 2884961425
1771 2885373610
1772 2885380148
1773 2885412564
1774 2888387100
1775 2888389778
1776 2888421318
1777 2903728267
1778 2904671381
1779 2904693825
1780 2904719670
1781 2906606407
1782 2906629101
1783 2906644621
1784 2908758393
1785 2908777340
1786 2922377244
1787 2922398376
1788 2928531643
1789 2929623641
1790 2929632656
1791 2932793085
1792 2932795892
1793 2932802130
1794 2932814647
1795 2932823502
1796 2932832940
1797 2933585545
1798 2935616293
1799 2935623670
1800 2935639440
1801 2935650690
1802 2935662070
1803 2935670387
1804 2935679815
1805 2935687386
1806 2935696643
1807 2935705461
1808 2935718845
1809 2935728497
1810 2935736906
1811 2935746091
1812 2935753352
1813 2935766254
1814 2935807204
1815 2935813883
1816 2935827090
1817 2935828923
1818 2935844097
1819 2935854271
1820 2935862105
1821 2935871669
1822 2935880220
1823 2935886318
1824 2935913636
1825 2935923534
1826 2935931047
1827 2935935329
1828 2935946895
1829 2935954010
1830 2935961345
1831 2935969036
1832 2935983558
1833 2935985776
1834 2935996886
1835 2936005920
1836 2936016348
1837 2936025004
1838 2936033653
1839 2936039438
1840 2936050915
1841 2936057663
1842 2940559265
1843 2941536883
1844 2941541959
1845 3005491204
1846 3005511049
1847 3005591888
1848 3005596005
1849 3005711962
1850 3005719205
1851 8006927826
1852 8016517113
1853 8016588451
1854 8016637505
1855 8017059470
1856 8019578929
1857 8019596975
1858 8019604706
1859 8019613819
1860 8019624405
1861 8019637633
1862 8019641984
1863 8019650566
1864 8019665560
1865 8019675107
1866 8019680998
1867 8055749802
1868 8056974012

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

24

193

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.8145 1 231
6uel-assembly1.cif.gz_A cps1 bound to allosteric inhibitor h3b-193 0.8044 1 185
5tw7-assembly1.cif.gz_D crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae 0.7895 2 186
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.7879 3 234
2ywb-assembly3.cif.gz_B crystal structure of gmp synthetase from thermus thermophilus 0.7873 4 185
ID Description Score Start End Superfamily
af_Q9M0A7_16_246_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9225 13 231 3.40.50.880
af_Q09686_33_241_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.915 47 225 3.40.50.880
af_A0A1D6KZL1_41_285_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9139 16 231 3.40.50.880
af_Q69QJ1_44_268_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9075 46 231 3.40.50.880
af_I1MSY9_21_250_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.903 13 231 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A5D3KIX4-F1-model_v4 Type 1 glutamine amidotransferase 1.002 1 234 GO:0005829
GO:0006541
GO:0016740
AF-A0A7S7Q091-F1-model_v4 Type 1 glutamine amidotransferase 1.002 1 234 GO:0005829
GO:0006541
GO:0016740
AF-A0A5D3KIX4-F1-model_v4 Type 1 glutamine amidotransferase 0.9982 1 234 GO:0005829
GO:0006541
GO:0016740
AF-A0A7S7Q091-F1-model_v4 Type 1 glutamine amidotransferase 0.9979 1 234 GO:0005829
GO:0006541
GO:0016740
AF-A0A1I5HD40-F1-model_v4 Glutamine amidotransferase class-I 0.9879 1 123 GO:0005829
GO:0016740

Map