F485998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 929 | 342 | 1858 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300046473|Ga0495582_0073631|Ga0495582_0073631_884_1438 |
| Length | 184 |
| Sequence | MSGPYSLFVVDLTPADQLTIARAASVPLVVVLYAWDFPNHNYWATAVFCVAMTTDWFDGRLARRHGRSSSVGTLLDPIADKVLVLAALVMLVGQGVIPAWMVAVIVVREVLVTGLRQAAIERDLGKLKTWAQAVAAAVAGFAAAGAWTDRVAWWTLLVAVILTWISGLDYARAAPRLFSRAQPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 212 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 213 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 214 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 215 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 216 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 217 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 218 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 337 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 1.94 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 9.9 |
| Rhizosphere | 89.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495582_0073631 | 3300046473 | Bacteria | 1891 |
| 2 | ARcpr5yngRDRAFT_c002030 | 3300000043 | Bacteria | 2146 |
| 3 | ARSoilOldRDRAFT_c001912 | 3300000044 | Bacteria | 1896 |
| 4 | ARCol0yngRDRAFT_1005082 | 3300000652 | Bacteria | 948 |
| 5 | JGI24743J22301_10001647 | 3300001991 | Bacteria | 3168 |
| 6 | JGI24738J21930_10002659 | 3300002075 | Bacteria | 4609 |
| 7 | JGI24744J21845_10019723 | 3300002077 | Bacteria | 1333 |
| 8 | JGI24742J22300_10006830 | 3300002244 | Bacteria | 1882 |
| 9 | Ga0070658_10051390 | 3300005327 | Bacteria | 3341 |
| 10 | Ga0070658_10290962 | 3300005327 | Bacteria | 1392 |
| 11 | Ga0070658_10296131 | 3300005327 | Bacteria | 1379 |
| 12 | Ga0070658_10381145 | 3300005327 | Bacteria | 1210 |
| 13 | Ga0070683_100048760 | 3300005329 | Bacteria | 3916 |
| 14 | Ga0070683_100079161 | 3300005329 | Bacteria | 3076 |
| 15 | Ga0070683_100088306 | 3300005329 | Bacteria | 2909 |
| 16 | Ga0070683_100224117 | 3300005329 | Bacteria | 1787 |
| 17 | Ga0070683_100235593 | 3300005329 | Bacteria | 1741 |
| 18 | Ga0070683_100484845 | 3300005329 | Bacteria | 1181 |
| 19 | Ga0070690_100360531 | 3300005330 | Bacteria | 1058 |
| 20 | Ga0070670_100003070 | 3300005331 | Bacteria | 13807 |
| 21 | Ga0070677_10104905 | 3300005333 | Bacteria | 1253 |
| 22 | Ga0070680_100014374 | 3300005336 | Bacteria | 6185 |
| 23 | Ga0070680_100026406 | 3300005336 | Bacteria | 4645 |
| 24 | Ga0070680_100075357 | 3300005336 | Bacteria | 2777 |
| 25 | Ga0070682_100008149 | 3300005337 | Bacteria | 5909 |
| 26 | Ga0070682_100049064 | 3300005337 | Bacteria | 2631 |
| 27 | Ga0070682_100125229 | 3300005337 | Bacteria | 1731 |
| 28 | Ga0068868_100010861 | 3300005338 | Bacteria | 6608 |
| 29 | Ga0068868_100749909 | 3300005338 | Bacteria | 877 |
| 30 | Ga0068868_101166608 | 3300005338 | Bacteria | 711 |
| 31 | Ga0070660_100003439 | 3300005339 | Bacteria | 10894 |
| 32 | Ga0070660_100003653 | 3300005339 | Bacteria | 10621 |
| 33 | Ga0070660_100004935 | 3300005339 | Bacteria | 9228 |
| 34 | Ga0070660_100005782 | 3300005339 | Bacteria | 8568 |
| 35 | Ga0070660_100029453 | 3300005339 | Bacteria | 4114 |
| 36 | Ga0070660_100091419 | 3300005339 | Bacteria | 2401 |
| 37 | Ga0070660_100288454 | 3300005339 | Bacteria | 1344 |
| 38 | Ga0070660_100302068 | 3300005339 | Bacteria | 1312 |
| 39 | Ga0070689_100096939 | 3300005340 | Bacteria | 2331 |
| 40 | Ga0070691_10136131 | 3300005341 | Bacteria | 1248 |
| 41 | Ga0070687_100030630 | 3300005343 | Bacteria | 2632 |
| 42 | Ga0070661_100063228 | 3300005344 | Bacteria | 2718 |
| 43 | Ga0070661_100189912 | 3300005344 | Bacteria | 1566 |
| 44 | Ga0070675_100002606 | 3300005354 | Bacteria | 13531 |
| 45 | Ga0070675_100212399 | 3300005354 | Bacteria | 1682 |
| 46 | Ga0070671_100050404 | 3300005355 | Bacteria | 3462 |
| 47 | Ga0070671_100153955 | 3300005355 | Bacteria | 1942 |
| 48 | Ga0070671_100270756 | 3300005355 | Bacteria | 1444 |
| 49 | Ga0070674_100013526 | 3300005356 | Bacteria | 5048 |
| 50 | Ga0070674_100141730 | 3300005356 | Bacteria | 1804 |
| 51 | Ga0070673_100002400 | 3300005364 | Bacteria | 11403 |
| 52 | Ga0070688_100015903 | 3300005365 | Bacteria | 4290 |
| 53 | Ga0070659_100050579 | 3300005366 | Bacteria | 3266 |
| 54 | Ga0070659_100208719 | 3300005366 | Bacteria | 1609 |
| 55 | Ga0070659_100687546 | 3300005366 | Bacteria | 884 |
| 56 | Ga0070709_10126935 | 3300005434 | Bacteria | 1736 |
| 57 | Ga0070714_100186419 | 3300005435 | Bacteria | 1891 |
| 58 | Ga0070714_100187444 | 3300005435 | Bacteria | 1886 |
| 59 | Ga0070714_100262833 | 3300005435 | Bacteria | 1598 |
| 60 | Ga0070714_100297472 | 3300005435 | Bacteria | 1504 |
| 61 | Ga0070714_100764734 | 3300005435 | Bacteria | 934 |
| 62 | Ga0070713_100017769 | 3300005436 | Bacteria | 5391 |
| 63 | Ga0070713_100241011 | 3300005436 | Bacteria | 1647 |
| 64 | Ga0070710_10008475 | 3300005437 | Bacteria | 5005 |
| 65 | Ga0070710_10186547 | 3300005437 | Bacteria | 1302 |
| 66 | Ga0070701_10020632 | 3300005438 | Bacteria | 3131 |
| 67 | Ga0070711_100052341 | 3300005439 | Bacteria | 2809 |
| 68 | Ga0070700_100097204 | 3300005441 | Bacteria | 1933 |
| 69 | Ga0070694_100130058 | 3300005444 | Bacteria | 1817 |
| 70 | Ga0070694_100141864 | 3300005444 | Bacteria | 1746 |
| 71 | Ga0070694_100228041 | 3300005444 | Bacteria | 1400 |
| 72 | Ga0070708_100194058 | 3300005445 | Bacteria | 1900 |
| 73 | Ga0070708_100535654 | 3300005445 | Bacteria | 1105 |
| 74 | Ga0070708_100634710 | 3300005445 | Bacteria | 1007 |
| 75 | Ga0070663_100074103 | 3300005455 | Bacteria | 2485 |
| 76 | Ga0070678_100048173 | 3300005456 | Bacteria | 3067 |
| 77 | Ga0070662_100035332 | 3300005457 | Bacteria | 3529 |
| 78 | Ga0070662_100118930 | 3300005457 | Bacteria | 2023 |
| 79 | Ga0070681_10006867 | 3300005458 | Bacteria | 11075 |
| 80 | Ga0070681_10007960 | 3300005458 | Bacteria | 10374 |
| 81 | Ga0070681_10098671 | 3300005458 | Bacteria | 2867 |
| 82 | Ga0070681_10152178 | 3300005458 | Bacteria | 2240 |
| 83 | Ga0070681_10218704 | 3300005458 | Bacteria | 1820 |
| 84 | Ga0070681_10411779 | 3300005458 | Bacteria | 1263 |
| 85 | Ga0068867_100286573 | 3300005459 | Bacteria | 1352 |
| 86 | Ga0070685_10018092 | 3300005466 | Bacteria | 3785 |
| 87 | Ga0070706_100539330 | 3300005467 | Bacteria | 1085 |
| 88 | Ga0070707_100000130 | 3300005468 | Bacteria | 70270 |
| 89 | Ga0070707_100143167 | 3300005468 | Bacteria | 2327 |
| 90 | Ga0070707_100432890 | 3300005468 | Bacteria | 1276 |
| 91 | Ga0070698_100173167 | 3300005471 | Bacteria | 2098 |
| 92 | Ga0070698_100219147 | 3300005471 | Bacteria | 1837 |
| 93 | Ga0070679_100004227 | 3300005530 | Bacteria | 13254 |
| 94 | Ga0070679_100021342 | 3300005530 | Bacteria | 6321 |
| 95 | Ga0070679_100055671 | 3300005530 | Bacteria | 3939 |
| 96 | Ga0070679_100071359 | 3300005530 | Bacteria | 3464 |
| 97 | Ga0070679_100150924 | 3300005530 | Bacteria | 2300 |
| 98 | Ga0070679_100236484 | 3300005530 | Bacteria | 1785 |
| 99 | Ga0070679_100320084 | 3300005530 | Bacteria | 1500 |
| 100 | Ga0070679_100414926 | 3300005530 | Bacteria | 1292 |
| 101 | Ga0070679_100789486 | 3300005530 | Bacteria | 893 |
| 102 | Ga0070679_100868081 | 3300005530 | Bacteria | 846 |
| 103 | Ga0070684_100008448 | 3300005535 | Bacteria | 8050 |
| 104 | Ga0070684_100018156 | 3300005535 | Bacteria | 5788 |
| 105 | Ga0070684_100092625 | 3300005535 | Bacteria | 2689 |
| 106 | Ga0070684_100154414 | 3300005535 | Bacteria | 2081 |
| 107 | Ga0070684_100221064 | 3300005535 | Bacteria | 1728 |
| 108 | Ga0068853_100032587 | 3300005539 | Bacteria | 4415 |
| 109 | Ga0068853_100270009 | 3300005539 | Bacteria | 1566 |
| 110 | Ga0068853_100473246 | 3300005539 | Bacteria | 1180 |
| 111 | Ga0068853_100801663 | 3300005539 | Bacteria | 902 |
| 112 | Ga0070672_100004040 | 3300005543 | Bacteria | 9574 |
| 113 | Ga0070672_100079477 | 3300005543 | Bacteria | 2625 |
| 114 | Ga0070686_100016241 | 3300005544 | Bacteria | 4326 |
| 115 | Ga0070696_100098049 | 3300005546 | Bacteria | 2096 |
| 116 | Ga0070693_100141656 | 3300005547 | Bacteria | 1514 |
| 117 | Ga0070693_100275803 | 3300005547 | Bacteria | 1124 |
| 118 | Ga0070665_100012709 | 3300005548 | Bacteria | 8479 |
| 119 | Ga0068855_100020955 | 3300005563 | Bacteria | 7839 |
| 120 | Ga0068855_100041510 | 3300005563 | Bacteria | 5452 |
| 121 | Ga0068855_100176699 | 3300005563 | Bacteria | 2416 |
| 122 | Ga0068855_100180225 | 3300005563 | Bacteria | 2389 |
| 123 | Ga0068855_100193327 | 3300005563 | Bacteria | 2294 |
| 124 | Ga0068855_100245052 | 3300005563 | Bacteria | 2000 |
| 125 | Ga0068855_101332719 | 3300005563 | Bacteria | 742 |
| 126 | Ga0070664_101492311 | 3300005564 | Bacteria | 640 |
| 127 | Ga0068854_100003957 | 3300005578 | Bacteria | 9283 |
| 128 | Ga0068854_100191980 | 3300005578 | Bacteria | 1601 |
| 129 | Ga0068856_100125995 | 3300005614 | Bacteria | 2564 |
| 130 | Ga0068856_100225010 | 3300005614 | Bacteria | 1892 |
| 131 | Ga0070702_100062128 | 3300005615 | Bacteria | 2177 |
| 132 | Ga0068852_100022536 | 3300005616 | Bacteria | 5052 |
| 133 | Ga0068859_100363299 | 3300005617 | Bacteria | 1543 |
| 134 | Ga0068864_100027803 | 3300005618 | Bacteria | 4779 |
| 135 | Ga0068864_100225994 | 3300005618 | Bacteria | 1729 |
| 136 | Ga0068866_10449722 | 3300005718 | Bacteria | 842 |
| 137 | Ga0068870_10020138 | 3300005840 | Bacteria | 3244 |
| 138 | Ga0068870_10108600 | 3300005840 | Bacteria | 1580 |
| 139 | Ga0068870_10300572 | 3300005840 | Bacteria | 1013 |
| 140 | Ga0068863_100553336 | 3300005841 | Bacteria | 1136 |
| 141 | Ga0068858_100149247 | 3300005842 | Bacteria | 2197 |
| 142 | Ga0068858_100232001 | 3300005842 | Bacteria | 1750 |
| 143 | Ga0068862_100678088 | 3300005844 | Bacteria | 996 |
| 144 | Ga0081455_10181262 | 3300005937 | Bacteria | 1594 |
| 145 | Ga0081455_10219666 | 3300005937 | Bacteria | 1409 |
| 146 | Ga0081540_1003759 | 3300005983 | Bacteria | 11899 |
| 147 | Ga0081539_10000936 | 3300005985 | Bacteria | 54722 |
| 148 | Ga0081539_10099948 | 3300005985 | Bacteria | 1481 |
| 149 | Ga0070717_10010121 | 3300006028 | Bacteria | 7100 |
| 150 | Ga0070717_10205367 | 3300006028 | Bacteria | 1727 |
| 151 | Ga0070717_10246011 | 3300006028 | Bacteria | 1579 |
| 152 | Ga0075432_10000691 | 3300006058 | Bacteria | 10386 |
| 153 | Ga0070715_10019851 | 3300006163 | Bacteria | 2583 |
| 154 | Ga0070712_100145401 | 3300006175 | Bacteria | 1814 |
| 155 | Ga0070712_100214074 | 3300006175 | Bacteria | 1521 |
| 156 | Ga0070712_101263265 | 3300006175 | Bacteria | 643 |
| 157 | Ga0097621_100513490 | 3300006237 | Bacteria | 1087 |
| 158 | Ga0068871_100093166 | 3300006358 | Bacteria | 2513 |
| 159 | Ga0068871_100177788 | 3300006358 | Bacteria | 1827 |
| 160 | Ga0075428_100000211 | 3300006844 | Bacteria | 56062 |
| 161 | Ga0075428_100163657 | 3300006844 | Bacteria | 2414 |
| 162 | Ga0075428_100163799 | 3300006844 | Bacteria | 2412 |
| 163 | Ga0075428_100486299 | 3300006844 | Unclassified | 1321 |
| 164 | Ga0075428_101353251 | 3300006844 | Bacteria | 748 |
| 165 | Ga0075430_100035483 | 3300006846 | Bacteria | 4231 |
| 166 | Ga0075431_100005342 | 3300006847 | Bacteria | 12672 |
| 167 | Ga0075431_100023728 | 3300006847 | Bacteria | 6279 |
| 168 | Ga0075431_100543209 | 3300006847 | Bacteria | 1150 |
| 169 | Ga0075433_10118505 | 3300006852 | Bacteria | 2350 |
| 170 | Ga0075433_10351301 | 3300006852 | Bacteria | 1303 |
| 171 | Ga0075434_100410337 | 3300006871 | Bacteria | 1375 |
| 172 | Ga0075429_100008731 | 3300006880 | Bacteria | 8814 |
| 173 | Ga0075429_100238616 | 3300006880 | Bacteria | 1592 |
| 174 | Ga0068865_100003910 | 3300006881 | Bacteria | 8936 |
| 175 | Ga0068865_100327017 | 3300006881 | Bacteria | 1235 |
| 176 | Ga0068865_100909233 | 3300006881 | Bacteria | 766 |
| 177 | Ga0075436_100169785 | 3300006914 | Bacteria | 1540 |
| 178 | Ga0097620_100363267 | 3300006931 | Bacteria | 1543 |
| 179 | Ga0105244_10145690 | 3300009036 | Bacteria | 1137 |
| 180 | Ga0105240_10057753 | 3300009093 | Bacteria | 4845 |
| 181 | Ga0105240_10399629 | 3300009093 | Bacteria | 1548 |
| 182 | Ga0105240_10424854 | 3300009093 | Bacteria | 1492 |
| 183 | Ga0105240_10428875 | 3300009093 | Bacteria | 1484 |
| 184 | Ga0111539_10003281 | 3300009094 | Bacteria | 21391 |
| 185 | Ga0111539_10027044 | 3300009094 | Bacteria | 7006 |
| 186 | Ga0111539_10042595 | 3300009094 | Bacteria | 5450 |
| 187 | Ga0111539_10053723 | 3300009094 | Bacteria | 4795 |
| 188 | Ga0111539_10112012 | 3300009094 | Bacteria | 3201 |
| 189 | Ga0111539_10231567 | 3300009094 | Bacteria | 2151 |
| 190 | Ga0111539_10281108 | 3300009094 | Bacteria | 1937 |
| 191 | Ga0105245_10005748 | 3300009098 | Bacteria | 10885 |
| 192 | Ga0105245_10021850 | 3300009098 | Bacteria | 5616 |
| 193 | Ga0105245_10032601 | 3300009098 | Bacteria | 4612 |
| 194 | Ga0105245_10071534 | 3300009098 | Bacteria | 3150 |
| 195 | Ga0105245_11177253 | 3300009098 | Bacteria | 814 |
| 196 | Ga0105245_11285814 | 3300009098 | Bacteria | 780 |
| 197 | Ga0105247_10380763 | 3300009101 | Bacteria | 1000 |
| 198 | Ga0114129_10002058 | 3300009147 | Bacteria | 27627 |
| 199 | Ga0114129_10028091 | 3300009147 | Bacteria | 7970 |
| 200 | Ga0114129_10047834 | 3300009147 | Bacteria | 6010 |
| 201 | Ga0114129_10051864 | 3300009147 | Bacteria | 5758 |
| 202 | Ga0114129_10063810 | 3300009147 | Bacteria | 5141 |
| 203 | Ga0114129_10184982 | 3300009147 | Bacteria | 2832 |
| 204 | Ga0114129_10380344 | 3300009147 | Bacteria | 1865 |
| 205 | Ga0114129_10867860 | 3300009147 | Bacteria | 1146 |
| 206 | Ga0114129_11442252 | 3300009147 | Bacteria | 848 |
| 207 | Ga0105243_10006179 | 3300009148 | Bacteria | 9262 |
| 208 | Ga0105243_10102417 | 3300009148 | Bacteria | 2379 |
| 209 | Ga0105248_10845239 | 3300009177 | Bacteria | 1033 |
| 210 | Ga0105248_11847506 | 3300009177 | Bacteria | 685 |
| 211 | Ga0105237_10100645 | 3300009545 | Bacteria | 2882 |
| 212 | Ga0105237_10877850 | 3300009545 | Bacteria | 904 |
| 213 | Ga0105237_11826097 | 3300009545 | Bacteria | 615 |
| 214 | Ga0105238_10042991 | 3300009551 | Bacteria | 4573 |
| 215 | Ga0105238_10209828 | 3300009551 | Bacteria | 1923 |
| 216 | Ga0105238_10222010 | 3300009551 | Bacteria | 1866 |
| 217 | Ga0105249_10298391 | 3300009553 | Bacteria | 1615 |
| 218 | Ga0099796_10091842 | 3300010159 | Bacteria | 1129 |
| 219 | Ga0105239_10030506 | 3300010375 | Bacteria | 5927 |
| 220 | Ga0105239_10231941 | 3300010375 | Bacteria | 2071 |
| 221 | Ga0105239_10699700 | 3300010375 | Bacteria | 1159 |
| 222 | Ga0105239_11660183 | 3300010375 | Bacteria | 739 |
| 223 | Ga0105246_10007165 | 3300011119 | Bacteria | 6832 |
| 224 | Ga0157373_10051540 | 3300013100 | Bacteria | 2931 |
| 225 | Ga0157373_10159986 | 3300013100 | Bacteria | 1584 |
| 226 | Ga0157371_10901717 | 3300013102 | Bacteria | 670 |
| 227 | Ga0157370_10013050 | 3300013104 | Bacteria | 8580 |
| 228 | Ga0157370_10179447 | 3300013104 | Bacteria | 1968 |
| 229 | Ga0157370_10209499 | 3300013104 | Bacteria | 1807 |
| 230 | Ga0157370_11044416 | 3300013104 | Bacteria | 739 |
| 231 | Ga0157369_10127621 | 3300013105 | Bacteria | 2696 |
| 232 | Ga0157369_10234326 | 3300013105 | Bacteria | 1919 |
| 233 | Ga0157369_10333192 | 3300013105 | Bacteria | 1576 |
| 234 | Ga0157369_10617048 | 3300013105 | Bacteria | 1119 |
| 235 | Ga0157374_10052327 | 3300013296 | Bacteria | 3802 |
| 236 | Ga0157374_10455749 | 3300013296 | Bacteria | 1281 |
| 237 | Ga0157374_10861206 | 3300013296 | Bacteria | 923 |
| 238 | Ga0163162_10285878 | 3300013306 | Bacteria | 1781 |
| 239 | Ga0157372_10038066 | 3300013307 | Bacteria | 5307 |
| 240 | Ga0157372_10043170 | 3300013307 | Bacteria | 4991 |
| 241 | Ga0157372_10078218 | 3300013307 | Bacteria | 3737 |
| 242 | Ga0157372_10126302 | 3300013307 | Bacteria | 2941 |
| 243 | Ga0157372_10699395 | 3300013307 | Bacteria | 1180 |
| 244 | Ga0157375_10007284 | 3300013308 | Bacteria | 9684 |
| 245 | Ga0157375_10049114 | 3300013308 | Bacteria | 4132 |
| 246 | Ga0163163_10010982 | 3300014325 | Bacteria | 8185 |
| 247 | Ga0163163_10068283 | 3300014325 | Bacteria | 3537 |
| 248 | Ga0163163_10268372 | 3300014325 | Bacteria | 1758 |
| 249 | Ga0163163_10498094 | 3300014325 | Bacteria | 1280 |
| 250 | Ga0157380_11182293 | 3300014326 | Bacteria | 808 |
| 251 | Ga0157380_11502433 | 3300014326 | Bacteria | 727 |
| 252 | Ga0157377_10465298 | 3300014745 | Bacteria | 876 |
| 253 | Ga0157377_10818049 | 3300014745 | Bacteria | 688 |
| 254 | Ga0157376_11656559 | 3300014969 | Bacteria | 674 |
| 255 | Ga0197907_10245269 | 3300020069 | Bacteria | 1527 |
| 256 | Ga0197907_10895271 | 3300020069 | Bacteria | 1065 |
| 257 | Ga0206356_10020052 | 3300020070 | Bacteria | 1356 |
| 258 | Ga0206356_10066164 | 3300020070 | Bacteria | 1484 |
| 259 | Ga0206356_11790278 | 3300020070 | Bacteria | 3623 |
| 260 | Ga0206349_1009049 | 3300020075 | Bacteria | 931 |
| 261 | Ga0206349_1336972 | 3300020075 | Bacteria | 897 |
| 262 | Ga0206349_1381541 | 3300020075 | Bacteria | 868 |
| 263 | Ga0206350_11314925 | 3300020080 | Bacteria | 960 |
| 264 | Ga0206354_10511371 | 3300020081 | Bacteria | 2598 |
| 265 | Ga0206354_11094613 | 3300020081 | Bacteria | 1828 |
| 266 | Ga0206354_11409774 | 3300020081 | Bacteria | 2662 |
| 267 | Ga0206353_10004677 | 3300020082 | Bacteria | 1318 |
| 268 | Ga0206353_10955572 | 3300020082 | Bacteria | 21653 |
| 269 | Ga0206353_11754650 | 3300020082 | Bacteria | 3229 |
| 270 | Ga0224712_10027220 | 3300022467 | Bacteria | 2032 |
| 271 | Ga0224712_10078849 | 3300022467 | Bacteria | 1355 |
| 272 | Ga0224712_10245850 | 3300022467 | Bacteria | 825 |
| 273 | Ga0207692_10018769 | 3300025898 | Bacteria | 3111 |
| 274 | Ga0207692_10206497 | 3300025898 | Bacteria | 1158 |
| 275 | Ga0207710_10223308 | 3300025900 | Bacteria | 936 |
| 276 | Ga0207688_10013911 | 3300025901 | Bacteria | 4374 |
| 277 | Ga0207685_10001854 | 3300025905 | Bacteria | 4631 |
| 278 | Ga0207699_10042613 | 3300025906 | Bacteria | 2631 |
| 279 | Ga0207645_10013805 | 3300025907 | Bacteria | 5421 |
| 280 | Ga0207643_10041214 | 3300025908 | Bacteria | 2602 |
| 281 | Ga0207705_10068241 | 3300025909 | Bacteria | 2574 |
| 282 | Ga0207705_10129843 | 3300025909 | Bacteria | 1875 |
| 283 | Ga0207705_10843946 | 3300025909 | Bacteria | 710 |
| 284 | Ga0207684_10097337 | 3300025910 | Bacteria | 2512 |
| 285 | Ga0207684_10342673 | 3300025910 | Bacteria | 1287 |
| 286 | Ga0207654_10187494 | 3300025911 | Bacteria | 1353 |
| 287 | Ga0207707_10004893 | 3300025912 | Bacteria | 11769 |
| 288 | Ga0207707_10020368 | 3300025912 | Bacteria | 5791 |
| 289 | Ga0207707_10035546 | 3300025912 | Bacteria | 4356 |
| 290 | Ga0207707_10048652 | 3300025912 | Bacteria | 3693 |
| 291 | Ga0207707_10255763 | 3300025912 | Bacteria | 1520 |
| 292 | Ga0207707_10300010 | 3300025912 | Bacteria | 1389 |
| 293 | Ga0207707_10497153 | 3300025912 | Bacteria | 1040 |
| 294 | Ga0207695_10304824 | 3300025913 | Bacteria | 1484 |
| 295 | Ga0207671_10496660 | 3300025914 | Bacteria | 973 |
| 296 | Ga0207671_10923130 | 3300025914 | Bacteria | 690 |
| 297 | Ga0207671_11042592 | 3300025914 | Bacteria | 644 |
| 298 | Ga0207693_10009952 | 3300025915 | Bacteria | 7730 |
| 299 | Ga0207693_10139410 | 3300025915 | Bacteria | 1907 |
| 300 | Ga0207693_10232178 | 3300025915 | Bacteria | 1449 |
| 301 | Ga0207693_10299187 | 3300025915 | Bacteria | 1260 |
| 302 | Ga0207693_10622931 | 3300025915 | Bacteria | 839 |
| 303 | Ga0207663_10093320 | 3300025916 | Bacteria | 2003 |
| 304 | Ga0207660_10034278 | 3300025917 | Bacteria | 3517 |
| 305 | Ga0207660_10038685 | 3300025917 | Bacteria | 3330 |
| 306 | Ga0207660_10143480 | 3300025917 | Bacteria | 1827 |
| 307 | Ga0207660_10568917 | 3300025917 | Bacteria | 922 |
| 308 | Ga0207662_10040148 | 3300025918 | Bacteria | 2749 |
| 309 | Ga0207662_10158030 | 3300025918 | Bacteria | 1446 |
| 310 | Ga0207657_10000397 | 3300025919 | Bacteria | 46007 |
| 311 | Ga0207657_10001143 | 3300025919 | Bacteria | 28211 |
| 312 | Ga0207657_10009590 | 3300025919 | Bacteria | 9717 |
| 313 | Ga0207657_10014231 | 3300025919 | Bacteria | 7776 |
| 314 | Ga0207657_10017687 | 3300025919 | Bacteria | 6829 |
| 315 | Ga0207657_10043122 | 3300025919 | Bacteria | 3976 |
| 316 | Ga0207657_10343621 | 3300025919 | Bacteria | 1178 |
| 317 | Ga0207649_10059197 | 3300025920 | Bacteria | 2402 |
| 318 | Ga0207649_10094896 | 3300025920 | Bacteria | 1961 |
| 319 | Ga0207649_10906614 | 3300025920 | Bacteria | 691 |
| 320 | Ga0207652_10057679 | 3300025921 | Bacteria | 3344 |
| 321 | Ga0207652_10077734 | 3300025921 | Bacteria | 2896 |
| 322 | Ga0207652_10080698 | 3300025921 | Bacteria | 2844 |
| 323 | Ga0207652_10202065 | 3300025921 | Bacteria | 1788 |
| 324 | Ga0207652_10361220 | 3300025921 | Bacteria | 1311 |
| 325 | Ga0207652_10366131 | 3300025921 | Bacteria | 1301 |
| 326 | Ga0207652_10397932 | 3300025921 | Bacteria | 1243 |
| 327 | Ga0207652_10650520 | 3300025921 | Bacteria | 943 |
| 328 | Ga0207646_10002873 | 3300025922 | Bacteria | 19985 |
| 329 | Ga0207646_10294733 | 3300025922 | Bacteria | 1466 |
| 330 | Ga0207646_10328798 | 3300025922 | Bacteria | 1381 |
| 331 | Ga0207646_10499456 | 3300025922 | Bacteria | 1096 |
| 332 | Ga0207694_10504994 | 3300025924 | Bacteria | 1013 |
| 333 | Ga0207694_10564667 | 3300025924 | Bacteria | 956 |
| 334 | Ga0207650_10204879 | 3300025925 | Bacteria | 1582 |
| 335 | Ga0207650_10308399 | 3300025925 | Bacteria | 1294 |
| 336 | Ga0207659_10535532 | 3300025926 | Bacteria | 994 |
| 337 | Ga0207687_10060681 | 3300025927 | Bacteria | 2668 |
| 338 | Ga0207687_10129586 | 3300025927 | Bacteria | 1899 |
| 339 | Ga0207700_10201113 | 3300025928 | Bacteria | 1679 |
| 340 | Ga0207700_10226274 | 3300025928 | Bacteria | 1588 |
| 341 | Ga0207664_10031566 | 3300025929 | Bacteria | 4054 |
| 342 | Ga0207664_10032743 | 3300025929 | Bacteria | 3987 |
| 343 | Ga0207664_10101351 | 3300025929 | Bacteria | 2379 |
| 344 | Ga0207664_10127187 | 3300025929 | Bacteria | 2141 |
| 345 | Ga0207644_10044725 | 3300025931 | Bacteria | 3147 |
| 346 | Ga0207644_10127851 | 3300025931 | Bacteria | 1942 |
| 347 | Ga0207690_10208725 | 3300025932 | Bacteria | 1488 |
| 348 | Ga0207690_10401755 | 3300025932 | Bacteria | 1093 |
| 349 | Ga0207690_10473382 | 3300025932 | Bacteria | 1010 |
| 350 | Ga0207706_10060023 | 3300025933 | Bacteria | 3349 |
| 351 | Ga0207706_10145510 | 3300025933 | Bacteria | 2084 |
| 352 | Ga0207686_10053181 | 3300025934 | Bacteria | 2530 |
| 353 | Ga0207686_10269478 | 3300025934 | Bacteria | 1252 |
| 354 | Ga0207709_10038216 | 3300025935 | Bacteria | 2857 |
| 355 | Ga0207709_10296744 | 3300025935 | Bacteria | 1200 |
| 356 | Ga0207669_10008831 | 3300025937 | Bacteria | 4755 |
| 357 | Ga0207669_10156669 | 3300025937 | Bacteria | 1603 |
| 358 | Ga0207669_10767678 | 3300025937 | Bacteria | 797 |
| 359 | Ga0207704_10010524 | 3300025938 | Bacteria | 4518 |
| 360 | Ga0207704_10078601 | 3300025938 | Bacteria | 2122 |
| 361 | Ga0207665_10004921 | 3300025939 | Bacteria | 8904 |
| 362 | Ga0207665_10910150 | 3300025939 | Bacteria | 698 |
| 363 | Ga0207691_10011097 | 3300025940 | Bacteria | 8649 |
| 364 | Ga0207691_10405998 | 3300025940 | Bacteria | 1162 |
| 365 | Ga0207689_10077680 | 3300025942 | Bacteria | 2728 |
| 366 | Ga0207661_10002498 | 3300025944 | Bacteria | 12663 |
| 367 | Ga0207661_10066714 | 3300025944 | Bacteria | 2924 |
| 368 | Ga0207661_10100134 | 3300025944 | Bacteria | 2432 |
| 369 | Ga0207661_10119407 | 3300025944 | Bacteria | 2242 |
| 370 | Ga0207661_10321748 | 3300025944 | Bacteria | 1390 |
| 371 | Ga0207661_10434759 | 3300025944 | Bacteria | 1193 |
| 372 | Ga0207661_10598410 | 3300025944 | Bacteria | 1012 |
| 373 | Ga0207661_10870653 | 3300025944 | Bacteria | 830 |
| 374 | Ga0207679_10167386 | 3300025945 | Bacteria | 1806 |
| 375 | Ga0207679_10574250 | 3300025945 | Bacteria | 1014 |
| 376 | Ga0207667_10103935 | 3300025949 | Bacteria | 2929 |
| 377 | Ga0207667_10156941 | 3300025949 | Bacteria | 2341 |
| 378 | Ga0207667_10167388 | 3300025949 | Bacteria | 2259 |
| 379 | Ga0207667_10293161 | 3300025949 | Bacteria | 1662 |
| 380 | Ga0207667_10505327 | 3300025949 | Bacteria | 1226 |
| 381 | Ga0207667_10511472 | 3300025949 | Bacteria | 1217 |
| 382 | Ga0207651_10269776 | 3300025960 | Bacteria | 1401 |
| 383 | Ga0207651_10313204 | 3300025960 | Bacteria | 1309 |
| 384 | Ga0207712_10450395 | 3300025961 | Bacteria | 1091 |
| 385 | Ga0207668_10365417 | 3300025972 | Bacteria | 1210 |
| 386 | Ga0207640_10051618 | 3300025981 | Bacteria | 2674 |
| 387 | Ga0207640_10799341 | 3300025981 | Bacteria | 817 |
| 388 | Ga0207658_10006107 | 3300025986 | Bacteria | 8224 |
| 389 | Ga0207677_10145516 | 3300026023 | Bacteria | 1820 |
| 390 | Ga0207703_10225503 | 3300026035 | Bacteria | 1677 |
| 391 | Ga0207703_10242246 | 3300026035 | Bacteria | 1622 |
| 392 | Ga0207639_10059052 | 3300026041 | Bacteria | 2953 |
| 393 | Ga0207639_10062427 | 3300026041 | Bacteria | 2881 |
| 394 | Ga0207639_10110993 | 3300026041 | Bacteria | 2235 |
| 395 | Ga0207639_10340827 | 3300026041 | Bacteria | 1336 |
| 396 | Ga0207678_10227731 | 3300026067 | Bacteria | 1596 |
| 397 | Ga0207708_10077777 | 3300026075 | Bacteria | 2547 |
| 398 | Ga0207702_10105047 | 3300026078 | Bacteria | 2501 |
| 399 | Ga0207702_10511851 | 3300026078 | Bacteria | 1171 |
| 400 | Ga0207641_10448717 | 3300026088 | Bacteria | 1246 |
| 401 | Ga0207648_10034103 | 3300026089 | Bacteria | 4488 |
| 402 | Ga0207648_11112792 | 3300026089 | Bacteria | 741 |
| 403 | Ga0207676_10061544 | 3300026095 | Bacteria | 2973 |
| 404 | Ga0207676_10074523 | 3300026095 | Bacteria | 2735 |
| 405 | Ga0207674_10055636 | 3300026116 | Bacteria | 4021 |
| 406 | Ga0207675_100157035 | 3300026118 | Bacteria | 2168 |
| 407 | Ga0207675_100251136 | 3300026118 | Bacteria | 1712 |
| 408 | Ga0207683_10244410 | 3300026121 | Bacteria | 1637 |
| 409 | Ga0207683_11226365 | 3300026121 | Bacteria | 695 |
| 410 | Ga0207698_10023564 | 3300026142 | Bacteria | 4302 |
| 411 | Ga0207698_10287229 | 3300026142 | Bacteria | 1524 |
| 412 | Ga0207428_10000315 | 3300027907 | Bacteria | 63531 |
| 413 | Ga0207428_10004700 | 3300027907 | Bacteria | 12927 |
| 414 | Ga0207428_10238546 | 3300027907 | Bacteria | 1359 |
| 415 | Ga0207428_10455239 | 3300027907 | Unclassified | 933 |
| 416 | Ga0268266_10122844 | 3300028379 | Bacteria | 2312 |
| 417 | Ga0265319_1024519 | 3300028563 | Bacteria | 2170 |
| 418 | Ga0265319_1033374 | 3300028563 | Unclassified | 1778 |
| 419 | Ga0265334_10051162 | 3300028573 | Bacteria | 1584 |
| 420 | Ga0265336_10001260 | 3300028666 | Bacteria | 11992 |
| 421 | Ga0265336_10037732 | 3300028666 | Bacteria | 1484 |
| 422 | Ga0265338_10003476 | 3300028800 | Bacteria | 22134 |
| 423 | Ga0265338_10037177 | 3300028800 | Bacteria | 4641 |
| 424 | Ga0265338_10195457 | 3300028800 | Bacteria | 1529 |
| 425 | Ga0265338_10353808 | 3300028800 | Bacteria | 1055 |
| 426 | Ga0265320_10109255 | 3300031240 | Bacteria | 1268 |
| 427 | Ga0265327_10016919 | 3300031251 | Bacteria | 4603 |
| 428 | Ga0265327_10095302 | 3300031251 | Bacteria | 1445 |
| 429 | Ga0265316_10262086 | 3300031344 | Bacteria | 1267 |
| 430 | Ga0265342_10090737 | 3300031712 | Bacteria | 1752 |
| 431 | Ga0307409_100007779 | 3300031995 | Bacteria | 6445 |
| 432 | Ga0307416_100360326 | 3300032002 | Bacteria | 1476 |
| 433 | Ga0307416_100495773 | 3300032002 | Bacteria | 1285 |
| 434 | Ga0307415_100218757 | 3300032126 | Bacteria | 1525 |
| 435 | Ga0307415_100425693 | 3300032126 | Bacteria | 1141 |
| 436 | Ga0307415_100791294 | 3300032126 | Bacteria | 865 |
| 437 | Ga0373926_0012298 | 3300035083 | Bacteria | 2892 |
| 438 | Ga0373949_0116307 | 3300035090 | Bacteria | 746 |
| 439 | Ga0373951_0111732 | 3300035091 | Bacteria | 736 |
| 440 | Ga0373936_0108453 | 3300035113 | Bacteria | 1177 |
| 441 | Ga0373945_0004384 | 3300035116 | Bacteria | 4482 |
| 442 | Ga0373953_0335464 | 3300035117 | Bacteria | 662 |
| 443 | Ga0373954_0222893 | 3300035118 | Bacteria | 928 |
| 444 | Ga0373943_0005115 | 3300035170 | Bacteria | 5903 |
| 445 | Ga0373943_0035978 | 3300035170 | Bacteria | 2369 |
| 446 | Ga0373946_0018009 | 3300035171 | Bacteria | 2707 |
| 447 | Ga0373946_0163301 | 3300035171 | Bacteria | 1047 |
| 448 | Ga0373962_0039053 | 3300035242 | Bacteria | 1331 |
| 449 | Ga0373931_0098725 | 3300035691 | Bacteria | 1639 |
| 450 | Ga0373927_0129048 | 3300035695 | Bacteria | 1651 |
| 451 | Ga0373947_0009102 | 3300035725 | Bacteria | 5707 |
| 452 | Ga0373937_0405753 | 3300036401 | Bacteria | 1293 |
| 453 | Ga0373925_0001980 | 3300037068 | Bacteria | 16963 |
| 454 | Ga0373925_0028194 | 3300037068 | Bacteria | 4113 |
| 455 | Ga0395899_0339374 | 3300037312 | Bacteria | 1008 |
| 456 | Ga0395899_0359419 | 3300037312 | Bacteria | 972 |
| 457 | Ga0395900_0006404 | 3300037418 | Bacteria | 12270 |
| 458 | Ga0395900_0057305 | 3300037418 | Bacteria | 4011 |
| 459 | Ga0395900_0137755 | 3300037418 | Bacteria | 2501 |
| 460 | Ga0395900_0172203 | 3300037418 | Bacteria | 2203 |
| 461 | Ga0395900_0740603 | 3300037418 | Bacteria | 914 |
| 462 | Ga0395900_1215126 | 3300037418 | Bacteria | 669 |
| 463 | Ga0395898_0002446 | 3300037466 | Bacteria | 21955 |
| 464 | Ga0395898_0027980 | 3300037466 | Bacteria | 5653 |
| 465 | Ga0395898_0053603 | 3300037466 | Bacteria | 3939 |
| 466 | Ga0395898_0183546 | 3300037466 | Bacteria | 1999 |
| 467 | Ga0395898_0290799 | 3300037466 | Bacteria | 1559 |
| 468 | Ga0395898_0691336 | 3300037466 | Bacteria | 962 |
| 469 | Ga0395905_0018015 | 3300037471 | Bacteria | 6705 |
| 470 | Ga0395905_0148305 | 3300037471 | Bacteria | 2207 |
| 471 | Ga0395905_0293111 | 3300037471 | Bacteria | 1514 |
| 472 | Ga0395905_0568252 | 3300037471 | Bacteria | 1035 |
| 473 | Ga0395905_0689600 | 3300037471 | Bacteria | 924 |
| 474 | Ga0395901_0016324 | 3300038443 | Bacteria | 7563 |
| 475 | Ga0395901_0034152 | 3300038443 | Bacteria | 5252 |
| 476 | Ga0395901_0035074 | 3300038443 | Bacteria | 5184 |
| 477 | Ga0395901_0036163 | 3300038443 | Bacteria | 5102 |
| 478 | Ga0395901_0045468 | 3300038443 | Bacteria | 4556 |
| 479 | Ga0395901_0110981 | 3300038443 | Bacteria | 2880 |
| 480 | Ga0395901_0201765 | 3300038443 | Bacteria | 2085 |
| 481 | Ga0395901_0272037 | 3300038443 | Bacteria | 1762 |
| 482 | Ga0395901_0481925 | 3300038443 | Bacteria | 1265 |
| 483 | Ga0395901_0694311 | 3300038443 | Bacteria | 1016 |
| 484 | Ga0395901_0809252 | 3300038443 | Bacteria | 925 |
| 485 | Ga0395901_1023675 | 3300038443 | Bacteria | 800 |
| 486 | Ga0439465_0185336 | 3300041413 | Bacteria | 754 |
| 487 | Ga0451807_0050806 | 3300041486 | Bacteria | 708 |
| 488 | Ga0451839_1632841 | 3300041496 | Bacteria | 906 |
| 489 | Ga0451843_0626845 | 3300041509 | Bacteria | 601 |
| 490 | Ga0439462_0002841 | 3300042015 | Bacteria | 4090 |
| 491 | Ga0450911_033115 | 3300042115 | Bacteria | 670 |
| 492 | Ga0450906_016269 | 3300042145 | Bacteria | 1348 |
| 493 | Ga0439446_0006094 | 3300042156 | Bacteria | 3129 |
| 494 | Ga0450909_023848 | 3300042185 | Bacteria | 918 |
| 495 | Ga0439459_0122220 | 3300042438 | Bacteria | 657 |
| 496 | Ga0466972_0115229 | 3300044658 | Bacteria | 1269 |
| 497 | Ga0466966_0004844 | 3300044684 | Bacteria | 8858 |
| 498 | Ga0466966_0062501 | 3300044684 | Bacteria | 2347 |
| 499 | Ga0466961_0014918 | 3300044693 | Bacteria | 4990 |
| 500 | Ga0466961_0065391 | 3300044693 | Bacteria | 2310 |
| 501 | Ga0466963_0000349 | 3300044694 | Bacteria | 20897 |
| 502 | Ga0466963_0004320 | 3300044694 | Bacteria | 8247 |
| 503 | Ga0466963_0005837 | 3300044694 | Bacteria | 7247 |
| 504 | Ga0466963_0013372 | 3300044694 | Bacteria | 5039 |
| 505 | Ga0466963_0052917 | 3300044694 | Bacteria | 2695 |
| 506 | Ga0466963_0074313 | 3300044694 | Bacteria | 2292 |
| 507 | Ga0466963_0147139 | 3300044694 | Bacteria | 1635 |
| 508 | Ga0466963_0517641 | 3300044694 | Bacteria | 842 |
| 509 | Ga0466963_0533311 | 3300044694 | Bacteria | 829 |
| 510 | Ga0466964_0028161 | 3300044706 | Bacteria | 2211 |
| 511 | Ga0466964_0032373 | 3300044706 | Bacteria | 2077 |
| 512 | Ga0466964_0194829 | 3300044706 | Bacteria | 969 |
| 513 | Ga0466964_0240747 | 3300044706 | Bacteria | 887 |
| 514 | Ga0466964_0269662 | 3300044706 | Bacteria | 846 |
| 515 | Ga0466971_0001730 | 3300044719 | Bacteria | 9249 |
| 516 | Ga0466971_0003176 | 3300044719 | Bacteria | 7009 |
| 517 | Ga0466968_0031437 | 3300044735 | Bacteria | 2202 |
| 518 | Ga0466968_0063517 | 3300044735 | Bacteria | 1596 |
| 519 | Ga0466968_0220585 | 3300044735 | Bacteria | 893 |
| 520 | Ga0466968_0674338 | 3300044735 | Unclassified | 526 |
| 521 | Ga0466970_0404586 | 3300044765 | Bacteria | 779 |
| 522 | Ga0466957_0000496 | 3300044842 | Bacteria | 19676 |
| 523 | Ga0466957_0043665 | 3300044842 | Bacteria | 2715 |
| 524 | Ga0466957_0050161 | 3300044842 | Bacteria | 2539 |
| 525 | Ga0466957_0114340 | 3300044842 | Bacteria | 1714 |
| 526 | Ga0466957_0168838 | 3300044842 | Bacteria | 1424 |
| 527 | Ga0466957_0201627 | 3300044842 | Bacteria | 1307 |
| 528 | Ga0466960_0043760 | 3300044901 | Bacteria | 2132 |
| 529 | Ga0466960_0686337 | 3300044901 | Bacteria | 613 |
| 530 | Ga0466959_0004065 | 3300045049 | Bacteria | 9734 |
| 531 | Ga0466959_0220385 | 3300045049 | Bacteria | 1316 |
| 532 | Ga0466959_0269365 | 3300045049 | Bacteria | 1171 |
| 533 | Ga0451576_1289851 | 3300045051 | Bacteria | 761 |
| 534 | Ga0466958_0008665 | 3300045836 | Bacteria | 5648 |
| 535 | Ga0466958_0011373 | 3300045836 | Bacteria | 5012 |
| 536 | Ga0466958_0013008 | 3300045836 | Bacteria | 4728 |
| 537 | Ga0466958_0036360 | 3300045836 | Bacteria | 2947 |
| 538 | Ga0466958_0054429 | 3300045836 | Bacteria | 2427 |
| 539 | Ga0466958_0058311 | 3300045836 | Bacteria | 2347 |
| 540 | Ga0466967_0001380 | 3300045976 | Bacteria | 14002 |
| 541 | Ga0466967_0001932 | 3300045976 | Bacteria | 12531 |
| 542 | Ga0466967_0004782 | 3300045976 | Bacteria | 9221 |
| 543 | Ga0466967_0005410 | 3300045976 | Bacteria | 8844 |
| 544 | Ga0466967_0007542 | 3300045976 | Bacteria | 7858 |
| 545 | Ga0466967_0007862 | 3300045976 | Bacteria | 7748 |
| 546 | Ga0466967_0056002 | 3300045976 | Bacteria | 3475 |
| 547 | Ga0466967_0080229 | 3300045976 | Bacteria | 2943 |
| 548 | Ga0466967_0109795 | 3300045976 | Bacteria | 2532 |
| 549 | Ga0466967_0149138 | 3300045976 | Bacteria | 2184 |
| 550 | Ga0466967_0186559 | 3300045976 | Bacteria | 1958 |
| 551 | Ga0466967_0347319 | 3300045976 | Bacteria | 1435 |
| 552 | Ga0466967_0385925 | 3300045976 | Bacteria | 1360 |
| 553 | Ga0466967_0437594 | 3300045976 | Bacteria | 1276 |
| 554 | Ga0466967_0488953 | 3300045976 | Bacteria | 1206 |
| 555 | Ga0495592_0012241 | 3300046454 | Bacteria | 6511 |
| 556 | Ga0495603_0018565 | 3300046455 | Bacteria | 4207 |
| 557 | Ga0495603_0077304 | 3300046455 | Bacteria | 1953 |
| 558 | Ga0495603_0230732 | 3300046455 | Bacteria | 1067 |
| 559 | Ga0495641_0026447 | 3300046461 | Bacteria | 2831 |
| 560 | Ga0495641_0129454 | 3300046461 | Bacteria | 1126 |
| 561 | Ga0495651_0090139 | 3300046462 | Bacteria | 2300 |
| 562 | Ga0495651_0195311 | 3300046462 | Bacteria | 1421 |
| 563 | Ga0495651_0253359 | 3300046462 | Bacteria | 1201 |
| 564 | Ga0495653_0012029 | 3300046463 | Bacteria | 7064 |
| 565 | Ga0495653_0040647 | 3300046463 | Bacteria | 3633 |
| 566 | Ga0495653_0062333 | 3300046463 | Bacteria | 2817 |
| 567 | Ga0495582_0039340 | 3300046473 | Bacteria | 2603 |
| 568 | Ga0495582_0067951 | 3300046473 | Bacteria | 1970 |
| 569 | Ga0495582_0106900 | 3300046473 | Bacteria | 1570 |
| 570 | Ga0495582_0482277 | 3300046473 | Bacteria | 716 |
| 571 | Ga0495639_0032553 | 3300046475 | Bacteria | 2325 |
| 572 | Ga0495664_0090394 | 3300046477 | Bacteria | 1840 |
| 573 | Ga0495664_0099858 | 3300046477 | Bacteria | 1748 |
| 574 | Ga0495664_0249063 | 3300046477 | Bacteria | 1074 |
| 575 | Ga0495596_0203529 | 3300046500 | Bacteria | 769 |
| 576 | Ga0495608_0048009 | 3300046511 | Bacteria | 2837 |
| 577 | Ga0495608_0147237 | 3300046511 | Bacteria | 1502 |
| 578 | Ga0495618_0110910 | 3300046514 | Bacteria | 1756 |
| 579 | Ga0495628_0071009 | 3300046516 | Bacteria | 2714 |
| 580 | Ga0495628_0727755 | 3300046516 | Bacteria | 699 |
| 581 | Ga0495630_0269461 | 3300046517 | Bacteria | 1301 |
| 582 | Ga0495630_0301483 | 3300046517 | Bacteria | 1224 |
| 583 | Ga0495630_0648005 | 3300046517 | Bacteria | 809 |
| 584 | Ga0495630_0708830 | 3300046517 | Bacteria | 770 |
| 585 | Ga0495630_0891802 | 3300046517 | Bacteria | 678 |
| 586 | Ga0495644_0183847 | 3300046523 | Bacteria | 804 |
| 587 | Ga0495663_0017289 | 3300046525 | Bacteria | 2046 |
| 588 | Ga0495666_0000682 | 3300046526 | Bacteria | 15403 |
| 589 | Ga0495652_0081122 | 3300046529 | Bacteria | 2677 |
| 590 | Ga0495652_0112466 | 3300046529 | Bacteria | 2187 |
| 591 | Ga0495652_0768042 | 3300046529 | Bacteria | 644 |
| 592 | Ga0495640_0040071 | 3300046533 | Bacteria | 3282 |
| 593 | Ga0495587_0309161 | 3300046536 | Bacteria | 883 |
| 594 | Ga0495598_0052073 | 3300046537 | Bacteria | 1236 |
| 595 | Ga0495609_0117532 | 3300046538 | Bacteria | 1145 |
| 596 | Ga0495645_0032991 | 3300046543 | Bacteria | 3776 |
| 597 | Ga0495645_0206436 | 3300046543 | Bacteria | 1329 |
| 598 | Ga0495645_0302298 | 3300046543 | Bacteria | 1045 |
| 599 | Ga0495622_0150835 | 3300046557 | Bacteria | 1052 |
| 600 | Ga0495667_0011353 | 3300046559 | Bacteria | 6030 |
| 601 | Ga0495667_0204416 | 3300046559 | Bacteria | 1263 |
| 602 | Ga0495668_0174170 | 3300046616 | Bacteria | 1179 |
| 603 | Ga0495634_0022570 | 3300046642 | Bacteria | 4434 |
| 604 | Ga0495634_0244838 | 3300046642 | Bacteria | 1098 |
| 605 | Ga0495635_0037753 | 3300046663 | Bacteria | 3344 |
| 606 | Ga0495635_0101149 | 3300046663 | Bacteria | 1970 |
| 607 | Ga0495635_0171889 | 3300046663 | Bacteria | 1473 |
| 608 | Ga0495588_0223039 | 3300046674 | Bacteria | 995 |
| 609 | Ga0495588_0261843 | 3300046674 | Bacteria | 911 |
| 610 | Ga0495599_0004120 | 3300046678 | Bacteria | 8581 |
| 611 | Ga0495623_0067345 | 3300046679 | Bacteria | 2235 |
| 612 | Ga0495658_0030519 | 3300046683 | Bacteria | 2927 |
| 613 | Ga0495613_0064370 | 3300046689 | Bacteria | 2681 |
| 614 | Ga0495613_0182191 | 3300046689 | Bacteria | 1487 |
| 615 | Ga0495624_0095357 | 3300046690 | Bacteria | 1834 |
| 616 | Ga0495624_0537109 | 3300046690 | Bacteria | 698 |
| 617 | Ga0495600_0222497 | 3300046809 | Bacteria | 1207 |
| 618 | Ga0495600_0229472 | 3300046809 | Bacteria | 1185 |
| 619 | Ga0495581_0006348 | 3300047315 | Bacteria | 6855 |
| 620 | Ga0495581_0306366 | 3300047315 | Bacteria | 928 |
| 621 | Ga0495604_0283573 | 3300047317 | Bacteria | 1118 |
| 622 | Ga0495674_0239603 | 3300047319 | Bacteria | 1495 |
| 623 | Ga0495676_0130400 | 3300047321 | Bacteria | 1815 |
| 624 | Ga0495680_0038138 | 3300047322 | Bacteria | 3843 |
| 625 | Ga0495680_0096766 | 3300047322 | Bacteria | 2204 |
| 626 | Ga0495680_0141397 | 3300047322 | Bacteria | 1761 |
| 627 | Ga0495680_0320255 | 3300047322 | Bacteria | 1085 |
| 628 | Ga0495675_0296583 | 3300047444 | Bacteria | 961 |
| 629 | Ga0495684_0015235 | 3300047471 | Bacteria | 5923 |
| 630 | Ga0495684_0206606 | 3300047471 | Bacteria | 1446 |
| 631 | Ga0495593_0007261 | 3300047673 | Bacteria | 6490 |
| 632 | Ga0495602_0367200 | 3300048088 | Bacteria | 1034 |
| 633 | Ga0495614_0153250 | 3300048089 | Bacteria | 1028 |
| 634 | Ga0495614_0169254 | 3300048089 | Bacteria | 980 |
| 635 | Ga0496100_0001031 | 3300048903 | Bacteria | 13477 |
| 636 | Ga0496100_0031410 | 3300048903 | Bacteria | 3302 |
| 637 | Ga0496100_0581646 | 3300048903 | Bacteria | 868 |
| 638 | Ga0496100_0919240 | 3300048903 | Bacteria | 687 |
| 639 | Ga0496101_0004568 | 3300048904 | Bacteria | 8740 |
| 640 | Ga0496101_0078017 | 3300048904 | Bacteria | 2442 |
| 641 | Ga0496101_0110087 | 3300048904 | Bacteria | 2072 |
| 642 | Ga0496101_0329804 | 3300048904 | Bacteria | 1198 |
| 643 | Ga0496101_0348350 | 3300048904 | Bacteria | 1164 |
| 644 | Ga0496101_0932521 | 3300048904 | Bacteria | 683 |
| 645 | Ga0496102_0085385 | 3300048905 | Bacteria | 2914 |
| 646 | Ga0496102_0131778 | 3300048905 | Bacteria | 2341 |
| 647 | Ga0496102_0272488 | 3300048905 | Bacteria | 1596 |
| 648 | Ga0496102_0327937 | 3300048905 | Bacteria | 1442 |
| 649 | Ga0496102_0342098 | 3300048905 | Bacteria | 1409 |
| 650 | Ga0496102_0368285 | 3300048905 | Bacteria | 1352 |
| 651 | Ga0496103_0013565 | 3300048906 | Bacteria | 4833 |
| 652 | Ga0496103_0109748 | 3300048906 | Bacteria | 1752 |
| 653 | Ga0496103_0151068 | 3300048906 | Bacteria | 1488 |
| 654 | Ga0496103_0219226 | 3300048906 | Bacteria | 1224 |
| 655 | Ga0496103_0538535 | 3300048906 | Bacteria | 746 |
| 656 | Ga0496104_0001384 | 3300048907 | Bacteria | 20964 |
| 657 | Ga0496104_0003476 | 3300048907 | Bacteria | 13585 |
| 658 | Ga0496104_0026716 | 3300048907 | Bacteria | 5334 |
| 659 | Ga0496104_0192435 | 3300048907 | Bacteria | 1952 |
| 660 | Ga0496104_0868124 | 3300048907 | Bacteria | 807 |
| 661 | Ga0496104_1305150 | 3300048907 | Unclassified | 629 |
| 662 | Ga0496105_0000946 | 3300048908 | Bacteria | 19869 |
| 663 | Ga0496105_0002590 | 3300048908 | Bacteria | 13147 |
| 664 | Ga0496105_0040101 | 3300048908 | Bacteria | 3860 |
| 665 | Ga0496105_0044056 | 3300048908 | Bacteria | 3679 |
| 666 | Ga0496105_0505007 | 3300048908 | Bacteria | 949 |
| 667 | Ga0496105_0643289 | 3300048908 | Bacteria | 819 |
| 668 | Ga0496106_0010566 | 3300048909 | Bacteria | 6818 |
| 669 | Ga0496106_0085628 | 3300048909 | Bacteria | 2427 |
| 670 | Ga0496106_0090642 | 3300048909 | Bacteria | 2359 |
| 671 | Ga0496106_0220266 | 3300048909 | Bacteria | 1513 |
| 672 | Ga0496106_0307313 | 3300048909 | Bacteria | 1272 |
| 673 | Ga0496106_0743762 | 3300048909 | Bacteria | 780 |
| 674 | Ga0496107_0024167 | 3300048910 | Bacteria | 4298 |
| 675 | Ga0496107_0024265 | 3300048910 | Bacteria | 4290 |
| 676 | Ga0496107_0028166 | 3300048910 | Bacteria | 3991 |
| 677 | Ga0496107_0040242 | 3300048910 | Bacteria | 3355 |
| 678 | Ga0496107_0094728 | 3300048910 | Bacteria | 2184 |
| 679 | Ga0496107_0222588 | 3300048910 | Bacteria | 1404 |
| 680 | Ga0496108_0000183 | 3300048911 | Bacteria | 58046 |
| 681 | Ga0496108_0006148 | 3300048911 | Bacteria | 9712 |
| 682 | Ga0496108_0029311 | 3300048911 | Bacteria | 4556 |
| 683 | Ga0496108_0057680 | 3300048911 | Bacteria | 3262 |
| 684 | Ga0496108_0356004 | 3300048911 | Bacteria | 1277 |
| 685 | Ga0496108_0374896 | 3300048911 | Bacteria | 1242 |
| 686 | Ga0496108_0403110 | 3300048911 | Bacteria | 1194 |
| 687 | Ga0496108_0679341 | 3300048911 | Bacteria | 894 |
| 688 | Ga0496108_0960544 | 3300048911 | Bacteria | 731 |
| 689 | Ga0496109_0011674 | 3300048912 | Bacteria | 7555 |
| 690 | Ga0496109_0016518 | 3300048912 | Bacteria | 6453 |
| 691 | Ga0496109_0192878 | 3300048912 | Bacteria | 1914 |
| 692 | Ga0496109_0324345 | 3300048912 | Bacteria | 1453 |
| 693 | Ga0496109_0877081 | 3300048912 | Bacteria | 835 |
| 694 | Ga0496110_0000162 | 3300048913 | Bacteria | 40324 |
| 695 | Ga0496110_0001826 | 3300048913 | Bacteria | 15695 |
| 696 | Ga0496110_0003635 | 3300048913 | Bacteria | 11860 |
| 697 | Ga0496110_0133520 | 3300048913 | Bacteria | 2242 |
| 698 | Ga0496110_0265563 | 3300048913 | Bacteria | 1562 |
| 699 | Ga0496111_0000301 | 3300048914 | Bacteria | 24161 |
| 700 | Ga0496111_0003782 | 3300048914 | Bacteria | 9434 |
| 701 | Ga0496111_0040598 | 3300048914 | Bacteria | 3338 |
| 702 | Ga0496111_0078683 | 3300048914 | Bacteria | 2404 |
| 703 | Ga0496111_0270858 | 3300048914 | Bacteria | 1260 |
| 704 | Ga0496112_0003382 | 3300048915 | Bacteria | 13173 |
| 705 | Ga0496112_0005177 | 3300048915 | Bacteria | 11213 |
| 706 | Ga0496112_0024134 | 3300048915 | Bacteria | 5820 |
| 707 | Ga0496112_0027031 | 3300048915 | Bacteria | 5530 |
| 708 | Ga0496112_0460379 | 3300048915 | Bacteria | 1209 |
| 709 | Ga0496112_0498421 | 3300048915 | Bacteria | 1153 |
| 710 | Ga0496112_0583070 | 3300048915 | Bacteria | 1051 |
| 711 | Ga0496112_0630882 | 3300048915 | Bacteria | 1002 |
| 712 | Ga0496113_0008645 | 3300048916 | Bacteria | 6642 |
| 713 | Ga0496113_0023182 | 3300048916 | Bacteria | 4400 |
| 714 | Ga0496113_0115238 | 3300048916 | Bacteria | 2096 |
| 715 | Ga0496113_0160206 | 3300048916 | Bacteria | 1779 |
| 716 | Ga0496113_0349011 | 3300048916 | Bacteria | 1187 |
| 717 | Ga0496114_0007233 | 3300048917 | Bacteria | 8769 |
| 718 | Ga0496114_0038987 | 3300048917 | Bacteria | 3932 |
| 719 | Ga0496114_0041890 | 3300048917 | Bacteria | 3794 |
| 720 | Ga0496114_0043826 | 3300048917 | Bacteria | 3710 |
| 721 | Ga0496114_0099789 | 3300048917 | Bacteria | 2477 |
| 722 | Ga0496114_0208880 | 3300048917 | Bacteria | 1712 |
| 723 | Ga0496114_0452714 | 3300048917 | Bacteria | 1137 |
| 724 | Ga0496114_0844568 | 3300048917 | Bacteria | 796 |
| 725 | Ga0496115_0500980 | 3300048918 | Bacteria | 976 |
| 726 | Ga0501031_0014870 | 3300049568 | Bacteria | 5057 |
| 727 | Ga0501031_0039662 | 3300049568 | Bacteria | 3074 |
| 728 | Ga0501031_0131981 | 3300049568 | Bacteria | 1632 |
| 729 | Ga0501031_0159349 | 3300049568 | Bacteria | 1475 |
| 730 | Ga0501031_0390355 | 3300049568 | Bacteria | 900 |
| 731 | Ga0501032_0277912 | 3300049569 | Bacteria | 1084 |
| 732 | Ga0501033_0027648 | 3300049570 | Bacteria | 4265 |
| 733 | Ga0501033_0324420 | 3300049570 | Bacteria | 1081 |
| 734 | Ga0501034_0014867 | 3300049571 | Bacteria | 8008 |
| 735 | Ga0501034_0492624 | 3300049571 | Bacteria | 1140 |
| 736 | Ga0501036_0013111 | 3300049572 | Bacteria | 6885 |
| 737 | Ga0501036_0026689 | 3300049572 | Bacteria | 4879 |
| 738 | Ga0501036_0063626 | 3300049572 | Bacteria | 3123 |
| 739 | Ga0501037_0039807 | 3300049573 | Bacteria | 3459 |
| 740 | Ga0501037_0076652 | 3300049573 | Bacteria | 2427 |
| 741 | Ga0501037_0365189 | 3300049573 | Bacteria | 994 |
| 742 | Ga0501037_0489947 | 3300049573 | Bacteria | 835 |
| 743 | Ga0501037_0518955 | 3300049573 | Bacteria | 807 |
| 744 | Ga0501038_0011886 | 3300049574 | Bacteria | 7945 |
| 745 | Ga0501038_0102219 | 3300049574 | Bacteria | 2385 |
| 746 | Ga0501038_0163075 | 3300049574 | Bacteria | 1809 |
| 747 | Ga0501038_0247242 | 3300049574 | Bacteria | 1414 |
| 748 | Ga0501039_0009873 | 3300049575 | Bacteria | 7279 |
| 749 | Ga0501039_0050571 | 3300049575 | Bacteria | 3216 |
| 750 | Ga0501039_0108712 | 3300049575 | Bacteria | 2167 |
| 751 | Ga0501039_0393886 | 3300049575 | Bacteria | 1088 |
| 752 | Ga0501039_0678617 | 3300049575 | Bacteria | 806 |
| 753 | Ga0501039_0700320 | 3300049575 | Bacteria | 792 |
| 754 | Ga0501040_0010156 | 3300049576 | Bacteria | 6153 |
| 755 | Ga0501040_0056840 | 3300049576 | Bacteria | 2685 |
| 756 | Ga0501040_0132887 | 3300049576 | Bacteria | 1751 |
| 757 | Ga0501040_0160269 | 3300049576 | Bacteria | 1590 |
| 758 | Ga0501041_0000694 | 3300049577 | Bacteria | 17879 |
| 759 | Ga0501041_0008614 | 3300049577 | Bacteria | 6009 |
| 760 | Ga0501041_0129235 | 3300049577 | Bacteria | 1574 |
| 761 | Ga0501041_0233909 | 3300049577 | Bacteria | 1154 |
| 762 | Ga0501042_0006891 | 3300049578 | Bacteria | 7412 |
| 763 | Ga0501042_0019193 | 3300049578 | Bacteria | 4744 |
| 764 | Ga0501042_0045784 | 3300049578 | Bacteria | 3119 |
| 765 | Ga0501042_0269744 | 3300049578 | Bacteria | 1229 |
| 766 | Ga0501043_0072804 | 3300049579 | Bacteria | 2699 |
| 767 | Ga0501043_0653344 | 3300049579 | Bacteria | 772 |
| 768 | Ga0501046_0004125 | 3300049580 | Bacteria | 13243 |
| 769 | Ga0501046_0178548 | 3300049580 | Bacteria | 1589 |
| 770 | Ga0501046_0416663 | 3300049580 | Bacteria | 969 |
| 771 | Ga0501047_0345177 | 3300049581 | Bacteria | 1326 |
| 772 | Ga0501048_0005782 | 3300049582 | Bacteria | 9400 |
| 773 | Ga0501048_0086776 | 3300049582 | Bacteria | 2207 |
| 774 | Ga0501067_0021535 | 3300049583 | Bacteria | 3567 |
| 775 | Ga0501067_0027146 | 3300049583 | Bacteria | 3172 |
| 776 | Ga0501067_0037016 | 3300049583 | Bacteria | 2710 |
| 777 | Ga0501067_0041219 | 3300049583 | Bacteria | 2564 |
| 778 | Ga0501067_0049531 | 3300049583 | Bacteria | 2327 |
| 779 | Ga0501067_0057538 | 3300049583 | Bacteria | 2153 |
| 780 | Ga0501067_0120849 | 3300049583 | Bacteria | 1457 |
| 781 | Ga0501068_0017528 | 3300049584 | Bacteria | 4143 |
| 782 | Ga0501068_0057150 | 3300049584 | Bacteria | 2365 |
| 783 | Ga0501068_0104300 | 3300049584 | Bacteria | 1759 |
| 784 | Ga0501068_0173843 | 3300049584 | Bacteria | 1360 |
| 785 | Ga0501069_0001809 | 3300049585 | Bacteria | 10694 |
| 786 | Ga0501069_0016825 | 3300049585 | Bacteria | 3928 |
| 787 | Ga0501069_0021938 | 3300049585 | Bacteria | 3469 |
| 788 | Ga0501069_0045498 | 3300049585 | Bacteria | 2432 |
| 789 | Ga0501069_0168762 | 3300049585 | Bacteria | 1262 |
| 790 | Ga0501069_0223083 | 3300049585 | Bacteria | 1096 |
| 791 | Ga0501069_0270849 | 3300049585 | Bacteria | 993 |
| 792 | Ga0501069_0380019 | 3300049585 | Bacteria | 834 |
| 793 | Ga0501070_0010658 | 3300049586 | Bacteria | 7773 |
| 794 | Ga0501070_0026277 | 3300049586 | Bacteria | 4887 |
| 795 | Ga0501070_0037548 | 3300049586 | Bacteria | 4043 |
| 796 | Ga0501070_0041199 | 3300049586 | Bacteria | 3847 |
| 797 | Ga0501071_0004664 | 3300049587 | Bacteria | 8707 |
| 798 | Ga0501071_0017493 | 3300049587 | Bacteria | 4945 |
| 799 | Ga0501071_0050154 | 3300049587 | Bacteria | 3006 |
| 800 | Ga0501071_0130814 | 3300049587 | Bacteria | 1864 |
| 801 | Ga0501071_0139436 | 3300049587 | Unclassified | 1805 |
| 802 | Ga0501071_0472080 | 3300049587 | Bacteria | 961 |
| 803 | Ga0501072_0004572 | 3300049588 | Bacteria | 10530 |
| 804 | Ga0501072_0012618 | 3300049588 | Bacteria | 6459 |
| 805 | Ga0501072_0025293 | 3300049588 | Bacteria | 4624 |
| 806 | Ga0501072_0051200 | 3300049588 | Bacteria | 3252 |
| 807 | Ga0501072_0060505 | 3300049588 | Bacteria | 2986 |
| 808 | Ga0501072_0363220 | 3300049588 | Bacteria | 1149 |
| 809 | Ga0501072_0386459 | 3300049588 | Bacteria | 1110 |
| 810 | Ga0501072_0408713 | 3300049588 | Bacteria | 1076 |
| 811 | Ga0501073_0037841 | 3300049589 | Bacteria | 3424 |
| 812 | Ga0501073_0128135 | 3300049589 | Bacteria | 1759 |
| 813 | Ga0501073_0196859 | 3300049589 | Bacteria | 1394 |
| 814 | Ga0501074_0026545 | 3300049590 | Bacteria | 4199 |
| 815 | Ga0501074_0052098 | 3300049590 | Bacteria | 2954 |
| 816 | Ga0501074_0099191 | 3300049590 | Bacteria | 2085 |
| 817 | Ga0501074_0112694 | 3300049590 | Bacteria | 1946 |
| 818 | Ga0501074_0181257 | 3300049590 | Bacteria | 1502 |
| 819 | Ga0501074_0223815 | 3300049590 | Bacteria | 1339 |
| 820 | Ga0501075_0006386 | 3300049591 | Bacteria | 8114 |
| 821 | Ga0501075_0013924 | 3300049591 | Bacteria | 5754 |
| 822 | Ga0501075_0054348 | 3300049591 | Bacteria | 3012 |
| 823 | Ga0501075_0056646 | 3300049591 | Bacteria | 2951 |
| 824 | Ga0501075_0149283 | 3300049591 | Bacteria | 1782 |
| 825 | Ga0501075_0162250 | 3300049591 | Bacteria | 1705 |
| 826 | Ga0501075_0673838 | 3300049591 | Bacteria | 788 |
| 827 | Ga0501076_0003251 | 3300049592 | Bacteria | 11373 |
| 828 | Ga0501076_0060531 | 3300049592 | Bacteria | 3012 |
| 829 | Ga0501076_0082734 | 3300049592 | Bacteria | 2577 |
| 830 | Ga0501076_0082975 | 3300049592 | Bacteria | 2573 |
| 831 | Ga0501076_0112821 | 3300049592 | Bacteria | 2199 |
| 832 | Ga0501077_0005795 | 3300049593 | Bacteria | 7525 |
| 833 | Ga0501077_0013276 | 3300049593 | Bacteria | 5163 |
| 834 | Ga0501077_0060625 | 3300049593 | Bacteria | 2401 |
| 835 | Ga0501077_0155334 | 3300049593 | Bacteria | 1452 |
| 836 | Ga0501077_0563854 | 3300049593 | Bacteria | 731 |
| 837 | Ga0501079_0014641 | 3300049741 | Bacteria | 5981 |
| 838 | Ga0501079_0021169 | 3300049741 | Bacteria | 4972 |
| 839 | Ga0501079_0021307 | 3300049741 | Bacteria | 4957 |
| 840 | Ga0501079_0025061 | 3300049741 | Bacteria | 4576 |
| 841 | Ga0501079_0030717 | 3300049741 | Bacteria | 4129 |
| 842 | Ga0501079_0088131 | 3300049741 | Bacteria | 2403 |
| 843 | Ga0501079_0107964 | 3300049741 | Bacteria | 2161 |
| 844 | Ga0501079_0174715 | 3300049741 | Bacteria | 1675 |
| 845 | Ga0501079_0360170 | 3300049741 | Bacteria | 1140 |
| 846 | Ga0501079_0544851 | 3300049741 | Bacteria | 912 |
| 847 | Ga0501079_0559162 | 3300049741 | Bacteria | 900 |
| 848 | Ga0501080_0002996 | 3300049742 | Bacteria | 14890 |
| 849 | Ga0501080_0005470 | 3300049742 | Bacteria | 11337 |
| 850 | Ga0501080_0008372 | 3300049742 | Bacteria | 9367 |
| 851 | Ga0501080_0052373 | 3300049742 | Bacteria | 3799 |
| 852 | Ga0501080_0127790 | 3300049742 | Bacteria | 2353 |
| 853 | Ga0501080_0179086 | 3300049742 | Bacteria | 1951 |
| 854 | Ga0501080_0226625 | 3300049742 | Bacteria | 1709 |
| 855 | Ga0501080_0490856 | 3300049742 | Bacteria | 1098 |
| 856 | Ga0501080_0690509 | 3300049742 | Bacteria | 901 |
| 857 | Ga0501081_0011882 | 3300049743 | Bacteria | 5704 |
| 858 | Ga0501081_0054457 | 3300049743 | Bacteria | 2764 |
| 859 | Ga0501081_0058456 | 3300049743 | Bacteria | 2667 |
| 860 | Ga0501081_0148121 | 3300049743 | Bacteria | 1685 |
| 861 | Ga0501081_0447317 | 3300049743 | Bacteria | 960 |
| 862 | Ga0501083_0001554 | 3300049744 | Bacteria | 15682 |
| 863 | Ga0501083_0046361 | 3300049744 | Bacteria | 2939 |
| 864 | Ga0501083_0099877 | 3300049744 | Bacteria | 1914 |
| 865 | Ga0501035_0006199 | 3300049822 | Bacteria | 11250 |
| 866 | Ga0501035_0225158 | 3300049822 | Bacteria | 1600 |
| 867 | Ga0501035_0665373 | 3300049822 | Bacteria | 843 |
| 868 | Ga0501044_0136092 | 3300049823 | Bacteria | 2448 |
| 869 | Ga0501045_0011268 | 3300049824 | Bacteria | 6275 |
| 870 | Ga0501045_0019236 | 3300049824 | Bacteria | 4865 |
| 871 | Ga0501045_0039351 | 3300049824 | Bacteria | 3440 |
| 872 | Ga0501045_0334110 | 3300049824 | Bacteria | 1128 |
| 873 | nmdc:mga05p37_20006_c1 | 3300050507 | Bacteria | 8099 |
| 874 | nmdc:mga05p37_312219_c1 | 3300050507 | Unclassified | 1863 |
| 875 | nmdc:mga05p37_6234_c1 | 3300050507 | Bacteria | 14041 |
| 876 | nmdc:mga05p37_854906_c1 | 3300050507 | Bacteria | 987 |
| 877 | nmdc:mga05p37_885_c1 | 3300050507 | Bacteria | 33780 |
| 878 | nmdc:mga09592_4849_c1 | 3300050508 | Bacteria | 10892 |
| 879 | nmdc:mga09592_60620_c1 | 3300050508 | Bacteria | 3199 |
| 880 | nmdc:mga0qj67_24145_c1 | 3300050509 | Bacteria | 4684 |
| 881 | nmdc:mga06r32_36445_c1 | 3300050510 | Bacteria | 4648 |
| 882 | nmdc:mga08y16_1003_c1 | 3300050511 | Bacteria | 27574 |
| 883 | nmdc:mga08y16_125008_c1 | 3300050511 | Bacteria | 2676 |
| 884 | nmdc:mga08y16_12611_c1 | 3300050511 | Bacteria | 8891 |
| 885 | nmdc:mga08y16_1683885_c1 | 3300050511 | Bacteria | 590 |
| 886 | nmdc:mga08y16_404540_c1 | 3300050511 | Bacteria | 1397 |
| 887 | nmdc:mga0n895_239708_c1 | 3300050512 | Bacteria | 1840 |
| 888 | nmdc:mga0rr50_303143_c1 | 3300050513 | Bacteria | 1337 |
| 889 | nmdc:mga08x19_258229_c1 | 3300050514 | Bacteria | 1204 |
| 890 | nmdc:mga0a205_351684_c1 | 3300050515 | Bacteria | 1341 |
| 891 | nmdc:mga0a205_50961_c1 | 3300050515 | Bacteria | 3996 |
| 892 | Ga0495601_0157056 | 3300053077 | Bacteria | 1485 |
| 893 | Ga0495601_0503004 | 3300053077 | Bacteria | 782 |
| 894 | Ga0495612_0028068 | 3300053078 | Bacteria | 2265 |
| 895 | Ga0495612_0158128 | 3300053078 | Bacteria | 988 |
| 896 | Ga0500635_0182221 | 3300053080 | Bacteria | 812 |
| 897 | Ga0495655_0030257 | 3300053083 | Bacteria | 1308 |
| 898 | Ga0495655_0206950 | 3300053083 | Bacteria | 644 |
| 899 | Ga0495595_0020664 | 3300053084 | Bacteria | 2867 |
| 900 | Ga0495595_0259361 | 3300053084 | Bacteria | 871 |
| 901 | Ga0501084_0008834 | 3300054114 | Bacteria | 8337 |
| 902 | Ga0501084_0016468 | 3300054114 | Bacteria | 6140 |
| 903 | Ga0501084_0019805 | 3300054114 | Bacteria | 5608 |
| 904 | Ga0501084_0022799 | 3300054114 | Bacteria | 5226 |
| 905 | Ga0501084_0033799 | 3300054114 | Bacteria | 4278 |
| 906 | Ga0501084_0078132 | 3300054114 | Bacteria | 2774 |
| 907 | Ga0501084_0136167 | 3300054114 | Bacteria | 2067 |
| 908 | Ga0501084_0166827 | 3300054114 | Bacteria | 1858 |
| 909 | Ga0501084_0504265 | 3300054114 | Bacteria | 1023 |
| 910 | Ga0501084_0831999 | 3300054114 | Bacteria | 777 |
| 911 | Ga0501082_0003852 | 3300060353 | Bacteria | 13113 |
| 912 | Ga0501082_0083099 | 3300060353 | Bacteria | 2763 |
| 913 | Ga0501082_0129470 | 3300060353 | Bacteria | 2189 |
| 914 | Ga0501082_0172225 | 3300060353 | Bacteria | 1882 |
| 915 | Ga0501082_0255308 | 3300060353 | Bacteria | 1525 |
| 916 | Ga0501082_0384777 | 3300060353 | Bacteria | 1224 |
| 917 | Ga0501082_0709374 | 3300060353 | Bacteria | 880 |
| 918 | Ga0501082_0709466 | 3300060353 | Bacteria | 880 |
| 919 | Ga0501082_1064728 | 3300060353 | Bacteria | 707 |
| 920 | Ga0466962_0002194 | 3300061719 | Bacteria | 9233 |
| 921 | Ga0466962_0006777 | 3300061719 | Bacteria | 5496 |
| 922 | Ga0466962_0082915 | 3300061719 | Bacteria | 1534 |
| 923 | Ga0530510_0004085 | 3300061734 | Bacteria | 10070 |
| 924 | Ga0530510_0071572 | 3300061734 | Bacteria | 2517 |
| 925 | Ga0530510_0156885 | 3300061734 | Bacteria | 1682 |
| 926 | Ga0530510_0162706 | 3300061734 | Bacteria | 1651 |
| 927 | Ga0530510_0319809 | 3300061734 | Bacteria | 1163 |
| 928 | Ga0530510_0403617 | 3300061734 | Bacteria | 1030 |
| 929 | Ga0530510_0595747 | 3300061734 | Bacteria | 840 |
| 930 | Ga0495582_0073631 | |||
| 931 | ARcpr5yngRDRAFT_c002030 | |||
| 932 | ARSoilOldRDRAFT_c001912 | |||
| 933 | ARCol0yngRDRAFT_1005082 | |||
| 934 | JGI24743J22301_10001647 | |||
| 935 | JGI24738J21930_10002659 | |||
| 936 | JGI24744J21845_10019723 | |||
| 937 | JGI24742J22300_10006830 | |||
| 938 | Ga0070658_10051390 | |||
| 939 | Ga0070658_10290962 | |||
| 940 | Ga0070658_10296131 | |||
| 941 | Ga0070658_10381145 | |||
| 942 | Ga0070683_100048760 | |||
| 943 | Ga0070683_100079161 | |||
| 944 | Ga0070683_100088306 | |||
| 945 | Ga0070683_100224117 | |||
| 946 | Ga0070683_100235593 | |||
| 947 | Ga0070683_100484845 | |||
| 948 | Ga0070690_100360531 | |||
| 949 | Ga0070670_100003070 | |||
| 950 | Ga0070677_10104905 | |||
| 951 | Ga0070680_100014374 | |||
| 952 | Ga0070680_100026406 | |||
| 953 | Ga0070680_100075357 | |||
| 954 | Ga0070682_100008149 | |||
| 955 | Ga0070682_100049064 | |||
| 956 | Ga0070682_100125229 | |||
| 957 | Ga0068868_100010861 | |||
| 958 | Ga0068868_100749909 | |||
| 959 | Ga0068868_101166608 | |||
| 960 | Ga0070660_100003439 | |||
| 961 | Ga0070660_100003653 | |||
| 962 | Ga0070660_100004935 | |||
| 963 | Ga0070660_100005782 | |||
| 964 | Ga0070660_100029453 | |||
| 965 | Ga0070660_100091419 | |||
| 966 | Ga0070660_100288454 | |||
| 967 | Ga0070660_100302068 | |||
| 968 | Ga0070689_100096939 | |||
| 969 | Ga0070691_10136131 | |||
| 970 | Ga0070687_100030630 | |||
| 971 | Ga0070661_100063228 | |||
| 972 | Ga0070661_100189912 | |||
| 973 | Ga0070675_100002606 | |||
| 974 | Ga0070675_100212399 | |||
| 975 | Ga0070671_100050404 | |||
| 976 | Ga0070671_100153955 | |||
| 977 | Ga0070671_100270756 | |||
| 978 | Ga0070674_100013526 | |||
| 979 | Ga0070674_100141730 | |||
| 980 | Ga0070673_100002400 | |||
| 981 | Ga0070688_100015903 | |||
| 982 | Ga0070659_100050579 | |||
| 983 | Ga0070659_100208719 | |||
| 984 | Ga0070659_100687546 | |||
| 985 | Ga0070709_10126935 | |||
| 986 | Ga0070714_100186419 | |||
| 987 | Ga0070714_100187444 | |||
| 988 | Ga0070714_100262833 | |||
| 989 | Ga0070714_100297472 | |||
| 990 | Ga0070714_100764734 | |||
| 991 | Ga0070713_100017769 | |||
| 992 | Ga0070713_100241011 | |||
| 993 | Ga0070710_10008475 | |||
| 994 | Ga0070710_10186547 | |||
| 995 | Ga0070701_10020632 | |||
| 996 | Ga0070711_100052341 | |||
| 997 | Ga0070700_100097204 | |||
| 998 | Ga0070694_100130058 | |||
| 999 | Ga0070694_100141864 | |||
| 1000 | Ga0070694_100228041 | |||
| 1001 | Ga0070708_100194058 | |||
| 1002 | Ga0070708_100535654 | |||
| 1003 | Ga0070708_100634710 | |||
| 1004 | Ga0070663_100074103 | |||
| 1005 | Ga0070678_100048173 | |||
| 1006 | Ga0070662_100035332 | |||
| 1007 | Ga0070662_100118930 | |||
| 1008 | Ga0070681_10006867 | |||
| 1009 | Ga0070681_10007960 | |||
| 1010 | Ga0070681_10098671 | |||
| 1011 | Ga0070681_10152178 | |||
| 1012 | Ga0070681_10218704 | |||
| 1013 | Ga0070681_10411779 | |||
| 1014 | Ga0068867_100286573 | |||
| 1015 | Ga0070685_10018092 | |||
| 1016 | Ga0070706_100539330 | |||
| 1017 | Ga0070707_100000130 | |||
| 1018 | Ga0070707_100143167 | |||
| 1019 | Ga0070707_100432890 | |||
| 1020 | Ga0070698_100173167 | |||
| 1021 | Ga0070698_100219147 | |||
| 1022 | Ga0070679_100004227 | |||
| 1023 | Ga0070679_100021342 | |||
| 1024 | Ga0070679_100055671 | |||
| 1025 | Ga0070679_100071359 | |||
| 1026 | Ga0070679_100150924 | |||
| 1027 | Ga0070679_100236484 | |||
| 1028 | Ga0070679_100320084 | |||
| 1029 | Ga0070679_100414926 | |||
| 1030 | Ga0070679_100789486 | |||
| 1031 | Ga0070679_100868081 | |||
| 1032 | Ga0070684_100008448 | |||
| 1033 | Ga0070684_100018156 | |||
| 1034 | Ga0070684_100092625 | |||
| 1035 | Ga0070684_100154414 | |||
| 1036 | Ga0070684_100221064 | |||
| 1037 | Ga0068853_100032587 | |||
| 1038 | Ga0068853_100270009 | |||
| 1039 | Ga0068853_100473246 | |||
| 1040 | Ga0068853_100801663 | |||
| 1041 | Ga0070672_100004040 | |||
| 1042 | Ga0070672_100079477 | |||
| 1043 | Ga0070686_100016241 | |||
| 1044 | Ga0070696_100098049 | |||
| 1045 | Ga0070693_100141656 | |||
| 1046 | Ga0070693_100275803 | |||
| 1047 | Ga0070665_100012709 | |||
| 1048 | Ga0068855_100020955 | |||
| 1049 | Ga0068855_100041510 | |||
| 1050 | Ga0068855_100176699 | |||
| 1051 | Ga0068855_100180225 | |||
| 1052 | Ga0068855_100193327 | |||
| 1053 | Ga0068855_100245052 | |||
| 1054 | Ga0068855_101332719 | |||
| 1055 | Ga0070664_101492311 | |||
| 1056 | Ga0068854_100003957 | |||
| 1057 | Ga0068854_100191980 | |||
| 1058 | Ga0068856_100125995 | |||
| 1059 | Ga0068856_100225010 | |||
| 1060 | Ga0070702_100062128 | |||
| 1061 | Ga0068852_100022536 | |||
| 1062 | Ga0068859_100363299 | |||
| 1063 | Ga0068864_100027803 | |||
| 1064 | Ga0068864_100225994 | |||
| 1065 | Ga0068866_10449722 | |||
| 1066 | Ga0068870_10020138 | |||
| 1067 | Ga0068870_10108600 | |||
| 1068 | Ga0068870_10300572 | |||
| 1069 | Ga0068863_100553336 | |||
| 1070 | Ga0068858_100149247 | |||
| 1071 | Ga0068858_100232001 | |||
| 1072 | Ga0068862_100678088 | |||
| 1073 | Ga0081455_10181262 | |||
| 1074 | Ga0081455_10219666 | |||
| 1075 | Ga0081540_1003759 | |||
| 1076 | Ga0081539_10000936 | |||
| 1077 | Ga0081539_10099948 | |||
| 1078 | Ga0070717_10010121 | |||
| 1079 | Ga0070717_10205367 | |||
| 1080 | Ga0070717_10246011 | |||
| 1081 | Ga0075432_10000691 | |||
| 1082 | Ga0070715_10019851 | |||
| 1083 | Ga0070712_100145401 | |||
| 1084 | Ga0070712_100214074 | |||
| 1085 | Ga0070712_101263265 | |||
| 1086 | Ga0097621_100513490 | |||
| 1087 | Ga0068871_100093166 | |||
| 1088 | Ga0068871_100177788 | |||
| 1089 | Ga0075428_100000211 | |||
| 1090 | Ga0075428_100163657 | |||
| 1091 | Ga0075428_100163799 | |||
| 1092 | Ga0075428_100486299 | |||
| 1093 | Ga0075428_101353251 | |||
| 1094 | Ga0075430_100035483 | |||
| 1095 | Ga0075431_100005342 | |||
| 1096 | Ga0075431_100023728 | |||
| 1097 | Ga0075431_100543209 | |||
| 1098 | Ga0075433_10118505 | |||
| 1099 | Ga0075433_10351301 | |||
| 1100 | Ga0075434_100410337 | |||
| 1101 | Ga0075429_100008731 | |||
| 1102 | Ga0075429_100238616 | |||
| 1103 | Ga0068865_100003910 | |||
| 1104 | Ga0068865_100327017 | |||
| 1105 | Ga0068865_100909233 | |||
| 1106 | Ga0075436_100169785 | |||
| 1107 | Ga0097620_100363267 | |||
| 1108 | Ga0105244_10145690 | |||
| 1109 | Ga0105240_10057753 | |||
| 1110 | Ga0105240_10399629 | |||
| 1111 | Ga0105240_10424854 | |||
| 1112 | Ga0105240_10428875 | |||
| 1113 | Ga0111539_10003281 | |||
| 1114 | Ga0111539_10027044 | |||
| 1115 | Ga0111539_10042595 | |||
| 1116 | Ga0111539_10053723 | |||
| 1117 | Ga0111539_10112012 | |||
| 1118 | Ga0111539_10231567 | |||
| 1119 | Ga0111539_10281108 | |||
| 1120 | Ga0105245_10005748 | |||
| 1121 | Ga0105245_10021850 | |||
| 1122 | Ga0105245_10032601 | |||
| 1123 | Ga0105245_10071534 | |||
| 1124 | Ga0105245_11177253 | |||
| 1125 | Ga0105245_11285814 | |||
| 1126 | Ga0105247_10380763 | |||
| 1127 | Ga0114129_10002058 | |||
| 1128 | Ga0114129_10028091 | |||
| 1129 | Ga0114129_10047834 | |||
| 1130 | Ga0114129_10051864 | |||
| 1131 | Ga0114129_10063810 | |||
| 1132 | Ga0114129_10184982 | |||
| 1133 | Ga0114129_10380344 | |||
| 1134 | Ga0114129_10867860 | |||
| 1135 | Ga0114129_11442252 | |||
| 1136 | Ga0105243_10006179 | |||
| 1137 | Ga0105243_10102417 | |||
| 1138 | Ga0105248_10845239 | |||
| 1139 | Ga0105248_11847506 | |||
| 1140 | Ga0105237_10100645 | |||
| 1141 | Ga0105237_10877850 | |||
| 1142 | Ga0105237_11826097 | |||
| 1143 | Ga0105238_10042991 | |||
| 1144 | Ga0105238_10209828 | |||
| 1145 | Ga0105238_10222010 | |||
| 1146 | Ga0105249_10298391 | |||
| 1147 | Ga0099796_10091842 | |||
| 1148 | Ga0105239_10030506 | |||
| 1149 | Ga0105239_10231941 | |||
| 1150 | Ga0105239_10699700 | |||
| 1151 | Ga0105239_11660183 | |||
| 1152 | Ga0105246_10007165 | |||
| 1153 | Ga0157373_10051540 | |||
| 1154 | Ga0157373_10159986 | |||
| 1155 | Ga0157371_10901717 | |||
| 1156 | Ga0157370_10013050 | |||
| 1157 | Ga0157370_10179447 | |||
| 1158 | Ga0157370_10209499 | |||
| 1159 | Ga0157370_11044416 | |||
| 1160 | Ga0157369_10127621 | |||
| 1161 | Ga0157369_10234326 | |||
| 1162 | Ga0157369_10333192 | |||
| 1163 | Ga0157369_10617048 | |||
| 1164 | Ga0157374_10052327 | |||
| 1165 | Ga0157374_10455749 | |||
| 1166 | Ga0157374_10861206 | |||
| 1167 | Ga0163162_10285878 | |||
| 1168 | Ga0157372_10038066 | |||
| 1169 | Ga0157372_10043170 | |||
| 1170 | Ga0157372_10078218 | |||
| 1171 | Ga0157372_10126302 | |||
| 1172 | Ga0157372_10699395 | |||
| 1173 | Ga0157375_10007284 | |||
| 1174 | Ga0157375_10049114 | |||
| 1175 | Ga0163163_10010982 | |||
| 1176 | Ga0163163_10068283 | |||
| 1177 | Ga0163163_10268372 | |||
| 1178 | Ga0163163_10498094 | |||
| 1179 | Ga0157380_11182293 | |||
| 1180 | Ga0157380_11502433 | |||
| 1181 | Ga0157377_10465298 | |||
| 1182 | Ga0157377_10818049 | |||
| 1183 | Ga0157376_11656559 | |||
| 1184 | Ga0197907_10245269 | |||
| 1185 | Ga0197907_10895271 | |||
| 1186 | Ga0206356_10020052 | |||
| 1187 | Ga0206356_10066164 | |||
| 1188 | Ga0206356_11790278 | |||
| 1189 | Ga0206349_1009049 | |||
| 1190 | Ga0206349_1336972 | |||
| 1191 | Ga0206349_1381541 | |||
| 1192 | Ga0206350_11314925 | |||
| 1193 | Ga0206354_10511371 | |||
| 1194 | Ga0206354_11094613 | |||
| 1195 | Ga0206354_11409774 | |||
| 1196 | Ga0206353_10004677 | |||
| 1197 | Ga0206353_10955572 | |||
| 1198 | Ga0206353_11754650 | |||
| 1199 | Ga0224712_10027220 | |||
| 1200 | Ga0224712_10078849 | |||
| 1201 | Ga0224712_10245850 | |||
| 1202 | Ga0207692_10018769 | |||
| 1203 | Ga0207692_10206497 | |||
| 1204 | Ga0207710_10223308 | |||
| 1205 | Ga0207688_10013911 | |||
| 1206 | Ga0207685_10001854 | |||
| 1207 | Ga0207699_10042613 | |||
| 1208 | Ga0207645_10013805 | |||
| 1209 | Ga0207643_10041214 | |||
| 1210 | Ga0207705_10068241 | |||
| 1211 | Ga0207705_10129843 | |||
| 1212 | Ga0207705_10843946 | |||
| 1213 | Ga0207684_10097337 | |||
| 1214 | Ga0207684_10342673 | |||
| 1215 | Ga0207654_10187494 | |||
| 1216 | Ga0207707_10004893 | |||
| 1217 | Ga0207707_10020368 | |||
| 1218 | Ga0207707_10035546 | |||
| 1219 | Ga0207707_10048652 | |||
| 1220 | Ga0207707_10255763 | |||
| 1221 | Ga0207707_10300010 | |||
| 1222 | Ga0207707_10497153 | |||
| 1223 | Ga0207695_10304824 | |||
| 1224 | Ga0207671_10496660 | |||
| 1225 | Ga0207671_10923130 | |||
| 1226 | Ga0207671_11042592 | |||
| 1227 | Ga0207693_10009952 | |||
| 1228 | Ga0207693_10139410 | |||
| 1229 | Ga0207693_10232178 | |||
| 1230 | Ga0207693_10299187 | |||
| 1231 | Ga0207693_10622931 | |||
| 1232 | Ga0207663_10093320 | |||
| 1233 | Ga0207660_10034278 | |||
| 1234 | Ga0207660_10038685 | |||
| 1235 | Ga0207660_10143480 | |||
| 1236 | Ga0207660_10568917 | |||
| 1237 | Ga0207662_10040148 | |||
| 1238 | Ga0207662_10158030 | |||
| 1239 | Ga0207657_10000397 | |||
| 1240 | Ga0207657_10001143 | |||
| 1241 | Ga0207657_10009590 | |||
| 1242 | Ga0207657_10014231 | |||
| 1243 | Ga0207657_10017687 | |||
| 1244 | Ga0207657_10043122 | |||
| 1245 | Ga0207657_10343621 | |||
| 1246 | Ga0207649_10059197 | |||
| 1247 | Ga0207649_10094896 | |||
| 1248 | Ga0207649_10906614 | |||
| 1249 | Ga0207652_10057679 | |||
| 1250 | Ga0207652_10077734 | |||
| 1251 | Ga0207652_10080698 | |||
| 1252 | Ga0207652_10202065 | |||
| 1253 | Ga0207652_10361220 | |||
| 1254 | Ga0207652_10366131 | |||
| 1255 | Ga0207652_10397932 | |||
| 1256 | Ga0207652_10650520 | |||
| 1257 | Ga0207646_10002873 | |||
| 1258 | Ga0207646_10294733 | |||
| 1259 | Ga0207646_10328798 | |||
| 1260 | Ga0207646_10499456 | |||
| 1261 | Ga0207694_10504994 | |||
| 1262 | Ga0207694_10564667 | |||
| 1263 | Ga0207650_10204879 | |||
| 1264 | Ga0207650_10308399 | |||
| 1265 | Ga0207659_10535532 | |||
| 1266 | Ga0207687_10060681 | |||
| 1267 | Ga0207687_10129586 | |||
| 1268 | Ga0207700_10201113 | |||
| 1269 | Ga0207700_10226274 | |||
| 1270 | Ga0207664_10031566 | |||
| 1271 | Ga0207664_10032743 | |||
| 1272 | Ga0207664_10101351 | |||
| 1273 | Ga0207664_10127187 | |||
| 1274 | Ga0207644_10044725 | |||
| 1275 | Ga0207644_10127851 | |||
| 1276 | Ga0207690_10208725 | |||
| 1277 | Ga0207690_10401755 | |||
| 1278 | Ga0207690_10473382 | |||
| 1279 | Ga0207706_10060023 | |||
| 1280 | Ga0207706_10145510 | |||
| 1281 | Ga0207686_10053181 | |||
| 1282 | Ga0207686_10269478 | |||
| 1283 | Ga0207709_10038216 | |||
| 1284 | Ga0207709_10296744 | |||
| 1285 | Ga0207669_10008831 | |||
| 1286 | Ga0207669_10156669 | |||
| 1287 | Ga0207669_10767678 | |||
| 1288 | Ga0207704_10010524 | |||
| 1289 | Ga0207704_10078601 | |||
| 1290 | Ga0207665_10004921 | |||
| 1291 | Ga0207665_10910150 | |||
| 1292 | Ga0207691_10011097 | |||
| 1293 | Ga0207691_10405998 | |||
| 1294 | Ga0207689_10077680 | |||
| 1295 | Ga0207661_10002498 | |||
| 1296 | Ga0207661_10066714 | |||
| 1297 | Ga0207661_10100134 | |||
| 1298 | Ga0207661_10119407 | |||
| 1299 | Ga0207661_10321748 | |||
| 1300 | Ga0207661_10434759 | |||
| 1301 | Ga0207661_10598410 | |||
| 1302 | Ga0207661_10870653 | |||
| 1303 | Ga0207679_10167386 | |||
| 1304 | Ga0207679_10574250 | |||
| 1305 | Ga0207667_10103935 | |||
| 1306 | Ga0207667_10156941 | |||
| 1307 | Ga0207667_10167388 | |||
| 1308 | Ga0207667_10293161 | |||
| 1309 | Ga0207667_10505327 | |||
| 1310 | Ga0207667_10511472 | |||
| 1311 | Ga0207651_10269776 | |||
| 1312 | Ga0207651_10313204 | |||
| 1313 | Ga0207712_10450395 | |||
| 1314 | Ga0207668_10365417 | |||
| 1315 | Ga0207640_10051618 | |||
| 1316 | Ga0207640_10799341 | |||
| 1317 | Ga0207658_10006107 | |||
| 1318 | Ga0207677_10145516 | |||
| 1319 | Ga0207703_10225503 | |||
| 1320 | Ga0207703_10242246 | |||
| 1321 | Ga0207639_10059052 | |||
| 1322 | Ga0207639_10062427 | |||
| 1323 | Ga0207639_10110993 | |||
| 1324 | Ga0207639_10340827 | |||
| 1325 | Ga0207678_10227731 | |||
| 1326 | Ga0207708_10077777 | |||
| 1327 | Ga0207702_10105047 | |||
| 1328 | Ga0207702_10511851 | |||
| 1329 | Ga0207641_10448717 | |||
| 1330 | Ga0207648_10034103 | |||
| 1331 | Ga0207648_11112792 | |||
| 1332 | Ga0207676_10061544 | |||
| 1333 | Ga0207676_10074523 | |||
| 1334 | Ga0207674_10055636 | |||
| 1335 | Ga0207675_100157035 | |||
| 1336 | Ga0207675_100251136 | |||
| 1337 | Ga0207683_10244410 | |||
| 1338 | Ga0207683_11226365 | |||
| 1339 | Ga0207698_10023564 | |||
| 1340 | Ga0207698_10287229 | |||
| 1341 | Ga0207428_10000315 | |||
| 1342 | Ga0207428_10004700 | |||
| 1343 | Ga0207428_10238546 | |||
| 1344 | Ga0207428_10455239 | |||
| 1345 | Ga0268266_10122844 | |||
| 1346 | Ga0265319_1024519 | |||
| 1347 | Ga0265319_1033374 | |||
| 1348 | Ga0265334_10051162 | |||
| 1349 | Ga0265336_10001260 | |||
| 1350 | Ga0265336_10037732 | |||
| 1351 | Ga0265338_10003476 | |||
| 1352 | Ga0265338_10037177 | |||
| 1353 | Ga0265338_10195457 | |||
| 1354 | Ga0265338_10353808 | |||
| 1355 | Ga0265320_10109255 | |||
| 1356 | Ga0265327_10016919 | |||
| 1357 | Ga0265327_10095302 | |||
| 1358 | Ga0265316_10262086 | |||
| 1359 | Ga0265342_10090737 | |||
| 1360 | Ga0307409_100007779 | |||
| 1361 | Ga0307416_100360326 | |||
| 1362 | Ga0307416_100495773 | |||
| 1363 | Ga0307415_100218757 | |||
| 1364 | Ga0307415_100425693 | |||
| 1365 | Ga0307415_100791294 | |||
| 1366 | Ga0373926_0012298 | |||
| 1367 | Ga0373949_0116307 | |||
| 1368 | Ga0373951_0111732 | |||
| 1369 | Ga0373936_0108453 | |||
| 1370 | Ga0373945_0004384 | |||
| 1371 | Ga0373953_0335464 | |||
| 1372 | Ga0373954_0222893 | |||
| 1373 | Ga0373943_0005115 | |||
| 1374 | Ga0373943_0035978 | |||
| 1375 | Ga0373946_0018009 | |||
| 1376 | Ga0373946_0163301 | |||
| 1377 | Ga0373962_0039053 | |||
| 1378 | Ga0373931_0098725 | |||
| 1379 | Ga0373927_0129048 | |||
| 1380 | Ga0373947_0009102 | |||
| 1381 | Ga0373937_0405753 | |||
| 1382 | Ga0373925_0001980 | |||
| 1383 | Ga0373925_0028194 | |||
| 1384 | Ga0395899_0339374 | |||
| 1385 | Ga0395899_0359419 | |||
| 1386 | Ga0395900_0006404 | |||
| 1387 | Ga0395900_0057305 | |||
| 1388 | Ga0395900_0137755 | |||
| 1389 | Ga0395900_0172203 | |||
| 1390 | Ga0395900_0740603 | |||
| 1391 | Ga0395900_1215126 | |||
| 1392 | Ga0395898_0002446 | |||
| 1393 | Ga0395898_0027980 | |||
| 1394 | Ga0395898_0053603 | |||
| 1395 | Ga0395898_0183546 | |||
| 1396 | Ga0395898_0290799 | |||
| 1397 | Ga0395898_0691336 | |||
| 1398 | Ga0395905_0018015 | |||
| 1399 | Ga0395905_0148305 | |||
| 1400 | Ga0395905_0293111 | |||
| 1401 | Ga0395905_0568252 | |||
| 1402 | Ga0395905_0689600 | |||
| 1403 | Ga0395901_0016324 | |||
| 1404 | Ga0395901_0034152 | |||
| 1405 | Ga0395901_0035074 | |||
| 1406 | Ga0395901_0036163 | |||
| 1407 | Ga0395901_0045468 | |||
| 1408 | Ga0395901_0110981 | |||
| 1409 | Ga0395901_0201765 | |||
| 1410 | Ga0395901_0272037 | |||
| 1411 | Ga0395901_0481925 | |||
| 1412 | Ga0395901_0694311 | |||
| 1413 | Ga0395901_0809252 | |||
| 1414 | Ga0395901_1023675 | |||
| 1415 | Ga0439465_0185336 | |||
| 1416 | Ga0451807_0050806 | |||
| 1417 | Ga0451839_1632841 | |||
| 1418 | Ga0451843_0626845 | |||
| 1419 | Ga0439462_0002841 | |||
| 1420 | Ga0450911_033115 | |||
| 1421 | Ga0450906_016269 | |||
| 1422 | Ga0439446_0006094 | |||
| 1423 | Ga0450909_023848 | |||
| 1424 | Ga0439459_0122220 | |||
| 1425 | Ga0466972_0115229 | |||
| 1426 | Ga0466966_0004844 | |||
| 1427 | Ga0466966_0062501 | |||
| 1428 | Ga0466961_0014918 | |||
| 1429 | Ga0466961_0065391 | |||
| 1430 | Ga0466963_0000349 | |||
| 1431 | Ga0466963_0004320 | |||
| 1432 | Ga0466963_0005837 | |||
| 1433 | Ga0466963_0013372 | |||
| 1434 | Ga0466963_0052917 | |||
| 1435 | Ga0466963_0074313 | |||
| 1436 | Ga0466963_0147139 | |||
| 1437 | Ga0466963_0517641 | |||
| 1438 | Ga0466963_0533311 | |||
| 1439 | Ga0466964_0028161 | |||
| 1440 | Ga0466964_0032373 | |||
| 1441 | Ga0466964_0194829 | |||
| 1442 | Ga0466964_0240747 | |||
| 1443 | Ga0466964_0269662 | |||
| 1444 | Ga0466971_0001730 | |||
| 1445 | Ga0466971_0003176 | |||
| 1446 | Ga0466968_0031437 | |||
| 1447 | Ga0466968_0063517 | |||
| 1448 | Ga0466968_0220585 | |||
| 1449 | Ga0466968_0674338 | |||
| 1450 | Ga0466970_0404586 | |||
| 1451 | Ga0466957_0000496 | |||
| 1452 | Ga0466957_0043665 | |||
| 1453 | Ga0466957_0050161 | |||
| 1454 | Ga0466957_0114340 | |||
| 1455 | Ga0466957_0168838 | |||
| 1456 | Ga0466957_0201627 | |||
| 1457 | Ga0466960_0043760 | |||
| 1458 | Ga0466960_0686337 | |||
| 1459 | Ga0466959_0004065 | |||
| 1460 | Ga0466959_0220385 | |||
| 1461 | Ga0466959_0269365 | |||
| 1462 | Ga0451576_1289851 | |||
| 1463 | Ga0466958_0008665 | |||
| 1464 | Ga0466958_0011373 | |||
| 1465 | Ga0466958_0013008 | |||
| 1466 | Ga0466958_0036360 | |||
| 1467 | Ga0466958_0054429 | |||
| 1468 | Ga0466958_0058311 | |||
| 1469 | Ga0466967_0001380 | |||
| 1470 | Ga0466967_0001932 | |||
| 1471 | Ga0466967_0004782 | |||
| 1472 | Ga0466967_0005410 | |||
| 1473 | Ga0466967_0007542 | |||
| 1474 | Ga0466967_0007862 | |||
| 1475 | Ga0466967_0056002 | |||
| 1476 | Ga0466967_0080229 | |||
| 1477 | Ga0466967_0109795 | |||
| 1478 | Ga0466967_0149138 | |||
| 1479 | Ga0466967_0186559 | |||
| 1480 | Ga0466967_0347319 | |||
| 1481 | Ga0466967_0385925 | |||
| 1482 | Ga0466967_0437594 | |||
| 1483 | Ga0466967_0488953 | |||
| 1484 | Ga0495592_0012241 | |||
| 1485 | Ga0495603_0018565 | |||
| 1486 | Ga0495603_0077304 | |||
| 1487 | Ga0495603_0230732 | |||
| 1488 | Ga0495641_0026447 | |||
| 1489 | Ga0495641_0129454 | |||
| 1490 | Ga0495651_0090139 | |||
| 1491 | Ga0495651_0195311 | |||
| 1492 | Ga0495651_0253359 | |||
| 1493 | Ga0495653_0012029 | |||
| 1494 | Ga0495653_0040647 | |||
| 1495 | Ga0495653_0062333 | |||
| 1496 | Ga0495582_0039340 | |||
| 1497 | Ga0495582_0067951 | |||
| 1498 | Ga0495582_0106900 | |||
| 1499 | Ga0495582_0482277 | |||
| 1500 | Ga0495639_0032553 | |||
| 1501 | Ga0495664_0090394 | |||
| 1502 | Ga0495664_0099858 | |||
| 1503 | Ga0495664_0249063 | |||
| 1504 | Ga0495596_0203529 | |||
| 1505 | Ga0495608_0048009 | |||
| 1506 | Ga0495608_0147237 | |||
| 1507 | Ga0495618_0110910 | |||
| 1508 | Ga0495628_0071009 | |||
| 1509 | Ga0495628_0727755 | |||
| 1510 | Ga0495630_0269461 | |||
| 1511 | Ga0495630_0301483 | |||
| 1512 | Ga0495630_0648005 | |||
| 1513 | Ga0495630_0708830 | |||
| 1514 | Ga0495630_0891802 | |||
| 1515 | Ga0495644_0183847 | |||
| 1516 | Ga0495663_0017289 | |||
| 1517 | Ga0495666_0000682 | |||
| 1518 | Ga0495652_0081122 | |||
| 1519 | Ga0495652_0112466 | |||
| 1520 | Ga0495652_0768042 | |||
| 1521 | Ga0495640_0040071 | |||
| 1522 | Ga0495587_0309161 | |||
| 1523 | Ga0495598_0052073 | |||
| 1524 | Ga0495609_0117532 | |||
| 1525 | Ga0495645_0032991 | |||
| 1526 | Ga0495645_0206436 | |||
| 1527 | Ga0495645_0302298 | |||
| 1528 | Ga0495622_0150835 | |||
| 1529 | Ga0495667_0011353 | |||
| 1530 | Ga0495667_0204416 | |||
| 1531 | Ga0495668_0174170 | |||
| 1532 | Ga0495634_0022570 | |||
| 1533 | Ga0495634_0244838 | |||
| 1534 | Ga0495635_0037753 | |||
| 1535 | Ga0495635_0101149 | |||
| 1536 | Ga0495635_0171889 | |||
| 1537 | Ga0495588_0223039 | |||
| 1538 | Ga0495588_0261843 | |||
| 1539 | Ga0495599_0004120 | |||
| 1540 | Ga0495623_0067345 | |||
| 1541 | Ga0495658_0030519 | |||
| 1542 | Ga0495613_0064370 | |||
| 1543 | Ga0495613_0182191 | |||
| 1544 | Ga0495624_0095357 | |||
| 1545 | Ga0495624_0537109 | |||
| 1546 | Ga0495600_0222497 | |||
| 1547 | Ga0495600_0229472 | |||
| 1548 | Ga0495581_0006348 | |||
| 1549 | Ga0495581_0306366 | |||
| 1550 | Ga0495604_0283573 | |||
| 1551 | Ga0495674_0239603 | |||
| 1552 | Ga0495676_0130400 | |||
| 1553 | Ga0495680_0038138 | |||
| 1554 | Ga0495680_0096766 | |||
| 1555 | Ga0495680_0141397 | |||
| 1556 | Ga0495680_0320255 | |||
| 1557 | Ga0495675_0296583 | |||
| 1558 | Ga0495684_0015235 | |||
| 1559 | Ga0495684_0206606 | |||
| 1560 | Ga0495593_0007261 | |||
| 1561 | Ga0495602_0367200 | |||
| 1562 | Ga0495614_0153250 | |||
| 1563 | Ga0495614_0169254 | |||
| 1564 | Ga0496100_0001031 | |||
| 1565 | Ga0496100_0031410 | |||
| 1566 | Ga0496100_0581646 | |||
| 1567 | Ga0496100_0919240 | |||
| 1568 | Ga0496101_0004568 | |||
| 1569 | Ga0496101_0078017 | |||
| 1570 | Ga0496101_0110087 | |||
| 1571 | Ga0496101_0329804 | |||
| 1572 | Ga0496101_0348350 | |||
| 1573 | Ga0496101_0932521 | |||
| 1574 | Ga0496102_0085385 | |||
| 1575 | Ga0496102_0131778 | |||
| 1576 | Ga0496102_0272488 | |||
| 1577 | Ga0496102_0327937 | |||
| 1578 | Ga0496102_0342098 | |||
| 1579 | Ga0496102_0368285 | |||
| 1580 | Ga0496103_0013565 | |||
| 1581 | Ga0496103_0109748 | |||
| 1582 | Ga0496103_0151068 | |||
| 1583 | Ga0496103_0219226 | |||
| 1584 | Ga0496103_0538535 | |||
| 1585 | Ga0496104_0001384 | |||
| 1586 | Ga0496104_0003476 | |||
| 1587 | Ga0496104_0026716 | |||
| 1588 | Ga0496104_0192435 | |||
| 1589 | Ga0496104_0868124 | |||
| 1590 | Ga0496104_1305150 | |||
| 1591 | Ga0496105_0000946 | |||
| 1592 | Ga0496105_0002590 | |||
| 1593 | Ga0496105_0040101 | |||
| 1594 | Ga0496105_0044056 | |||
| 1595 | Ga0496105_0505007 | |||
| 1596 | Ga0496105_0643289 | |||
| 1597 | Ga0496106_0010566 | |||
| 1598 | Ga0496106_0085628 | |||
| 1599 | Ga0496106_0090642 | |||
| 1600 | Ga0496106_0220266 | |||
| 1601 | Ga0496106_0307313 | |||
| 1602 | Ga0496106_0743762 | |||
| 1603 | Ga0496107_0024167 | |||
| 1604 | Ga0496107_0024265 | |||
| 1605 | Ga0496107_0028166 | |||
| 1606 | Ga0496107_0040242 | |||
| 1607 | Ga0496107_0094728 | |||
| 1608 | Ga0496107_0222588 | |||
| 1609 | Ga0496108_0000183 | |||
| 1610 | Ga0496108_0006148 | |||
| 1611 | Ga0496108_0029311 | |||
| 1612 | Ga0496108_0057680 | |||
| 1613 | Ga0496108_0356004 | |||
| 1614 | Ga0496108_0374896 | |||
| 1615 | Ga0496108_0403110 | |||
| 1616 | Ga0496108_0679341 | |||
| 1617 | Ga0496108_0960544 | |||
| 1618 | Ga0496109_0011674 | |||
| 1619 | Ga0496109_0016518 | |||
| 1620 | Ga0496109_0192878 | |||
| 1621 | Ga0496109_0324345 | |||
| 1622 | Ga0496109_0877081 | |||
| 1623 | Ga0496110_0000162 | |||
| 1624 | Ga0496110_0001826 | |||
| 1625 | Ga0496110_0003635 | |||
| 1626 | Ga0496110_0133520 | |||
| 1627 | Ga0496110_0265563 | |||
| 1628 | Ga0496111_0000301 | |||
| 1629 | Ga0496111_0003782 | |||
| 1630 | Ga0496111_0040598 | |||
| 1631 | Ga0496111_0078683 | |||
| 1632 | Ga0496111_0270858 | |||
| 1633 | Ga0496112_0003382 | |||
| 1634 | Ga0496112_0005177 | |||
| 1635 | Ga0496112_0024134 | |||
| 1636 | Ga0496112_0027031 | |||
| 1637 | Ga0496112_0460379 | |||
| 1638 | Ga0496112_0498421 | |||
| 1639 | Ga0496112_0583070 | |||
| 1640 | Ga0496112_0630882 | |||
| 1641 | Ga0496113_0008645 | |||
| 1642 | Ga0496113_0023182 | |||
| 1643 | Ga0496113_0115238 | |||
| 1644 | Ga0496113_0160206 | |||
| 1645 | Ga0496113_0349011 | |||
| 1646 | Ga0496114_0007233 | |||
| 1647 | Ga0496114_0038987 | |||
| 1648 | Ga0496114_0041890 | |||
| 1649 | Ga0496114_0043826 | |||
| 1650 | Ga0496114_0099789 | |||
| 1651 | Ga0496114_0208880 | |||
| 1652 | Ga0496114_0452714 | |||
| 1653 | Ga0496114_0844568 | |||
| 1654 | Ga0496115_0500980 | |||
| 1655 | Ga0501031_0014870 | |||
| 1656 | Ga0501031_0039662 | |||
| 1657 | Ga0501031_0131981 | |||
| 1658 | Ga0501031_0159349 | |||
| 1659 | Ga0501031_0390355 | |||
| 1660 | Ga0501032_0277912 | |||
| 1661 | Ga0501033_0027648 | |||
| 1662 | Ga0501033_0324420 | |||
| 1663 | Ga0501034_0014867 | |||
| 1664 | Ga0501034_0492624 | |||
| 1665 | Ga0501036_0013111 | |||
| 1666 | Ga0501036_0026689 | |||
| 1667 | Ga0501036_0063626 | |||
| 1668 | Ga0501037_0039807 | |||
| 1669 | Ga0501037_0076652 | |||
| 1670 | Ga0501037_0365189 | |||
| 1671 | Ga0501037_0489947 | |||
| 1672 | Ga0501037_0518955 | |||
| 1673 | Ga0501038_0011886 | |||
| 1674 | Ga0501038_0102219 | |||
| 1675 | Ga0501038_0163075 | |||
| 1676 | Ga0501038_0247242 | |||
| 1677 | Ga0501039_0009873 | |||
| 1678 | Ga0501039_0050571 | |||
| 1679 | Ga0501039_0108712 | |||
| 1680 | Ga0501039_0393886 | |||
| 1681 | Ga0501039_0678617 | |||
| 1682 | Ga0501039_0700320 | |||
| 1683 | Ga0501040_0010156 | |||
| 1684 | Ga0501040_0056840 | |||
| 1685 | Ga0501040_0132887 | |||
| 1686 | Ga0501040_0160269 | |||
| 1687 | Ga0501041_0000694 | |||
| 1688 | Ga0501041_0008614 | |||
| 1689 | Ga0501041_0129235 | |||
| 1690 | Ga0501041_0233909 | |||
| 1691 | Ga0501042_0006891 | |||
| 1692 | Ga0501042_0019193 | |||
| 1693 | Ga0501042_0045784 | |||
| 1694 | Ga0501042_0269744 | |||
| 1695 | Ga0501043_0072804 | |||
| 1696 | Ga0501043_0653344 | |||
| 1697 | Ga0501046_0004125 | |||
| 1698 | Ga0501046_0178548 | |||
| 1699 | Ga0501046_0416663 | |||
| 1700 | Ga0501047_0345177 | |||
| 1701 | Ga0501048_0005782 | |||
| 1702 | Ga0501048_0086776 | |||
| 1703 | Ga0501067_0021535 | |||
| 1704 | Ga0501067_0027146 | |||
| 1705 | Ga0501067_0037016 | |||
| 1706 | Ga0501067_0041219 | |||
| 1707 | Ga0501067_0049531 | |||
| 1708 | Ga0501067_0057538 | |||
| 1709 | Ga0501067_0120849 | |||
| 1710 | Ga0501068_0017528 | |||
| 1711 | Ga0501068_0057150 | |||
| 1712 | Ga0501068_0104300 | |||
| 1713 | Ga0501068_0173843 | |||
| 1714 | Ga0501069_0001809 | |||
| 1715 | Ga0501069_0016825 | |||
| 1716 | Ga0501069_0021938 | |||
| 1717 | Ga0501069_0045498 | |||
| 1718 | Ga0501069_0168762 | |||
| 1719 | Ga0501069_0223083 | |||
| 1720 | Ga0501069_0270849 | |||
| 1721 | Ga0501069_0380019 | |||
| 1722 | Ga0501070_0010658 | |||
| 1723 | Ga0501070_0026277 | |||
| 1724 | Ga0501070_0037548 | |||
| 1725 | Ga0501070_0041199 | |||
| 1726 | Ga0501071_0004664 | |||
| 1727 | Ga0501071_0017493 | |||
| 1728 | Ga0501071_0050154 | |||
| 1729 | Ga0501071_0130814 | |||
| 1730 | Ga0501071_0139436 | |||
| 1731 | Ga0501071_0472080 | |||
| 1732 | Ga0501072_0004572 | |||
| 1733 | Ga0501072_0012618 | |||
| 1734 | Ga0501072_0025293 | |||
| 1735 | Ga0501072_0051200 | |||
| 1736 | Ga0501072_0060505 | |||
| 1737 | Ga0501072_0363220 | |||
| 1738 | Ga0501072_0386459 | |||
| 1739 | Ga0501072_0408713 | |||
| 1740 | Ga0501073_0037841 | |||
| 1741 | Ga0501073_0128135 | |||
| 1742 | Ga0501073_0196859 | |||
| 1743 | Ga0501074_0026545 | |||
| 1744 | Ga0501074_0052098 | |||
| 1745 | Ga0501074_0099191 | |||
| 1746 | Ga0501074_0112694 | |||
| 1747 | Ga0501074_0181257 | |||
| 1748 | Ga0501074_0223815 | |||
| 1749 | Ga0501075_0006386 | |||
| 1750 | Ga0501075_0013924 | |||
| 1751 | Ga0501075_0054348 | |||
| 1752 | Ga0501075_0056646 | |||
| 1753 | Ga0501075_0149283 | |||
| 1754 | Ga0501075_0162250 | |||
| 1755 | Ga0501075_0673838 | |||
| 1756 | Ga0501076_0003251 | |||
| 1757 | Ga0501076_0060531 | |||
| 1758 | Ga0501076_0082734 | |||
| 1759 | Ga0501076_0082975 | |||
| 1760 | Ga0501076_0112821 | |||
| 1761 | Ga0501077_0005795 | |||
| 1762 | Ga0501077_0013276 | |||
| 1763 | Ga0501077_0060625 | |||
| 1764 | Ga0501077_0155334 | |||
| 1765 | Ga0501077_0563854 | |||
| 1766 | Ga0501079_0014641 | |||
| 1767 | Ga0501079_0021169 | |||
| 1768 | Ga0501079_0021307 | |||
| 1769 | Ga0501079_0025061 | |||
| 1770 | Ga0501079_0030717 | |||
| 1771 | Ga0501079_0088131 | |||
| 1772 | Ga0501079_0107964 | |||
| 1773 | Ga0501079_0174715 | |||
| 1774 | Ga0501079_0360170 | |||
| 1775 | Ga0501079_0544851 | |||
| 1776 | Ga0501079_0559162 | |||
| 1777 | Ga0501080_0002996 | |||
| 1778 | Ga0501080_0005470 | |||
| 1779 | Ga0501080_0008372 | |||
| 1780 | Ga0501080_0052373 | |||
| 1781 | Ga0501080_0127790 | |||
| 1782 | Ga0501080_0179086 | |||
| 1783 | Ga0501080_0226625 | |||
| 1784 | Ga0501080_0490856 | |||
| 1785 | Ga0501080_0690509 | |||
| 1786 | Ga0501081_0011882 | |||
| 1787 | Ga0501081_0054457 | |||
| 1788 | Ga0501081_0058456 | |||
| 1789 | Ga0501081_0148121 | |||
| 1790 | Ga0501081_0447317 | |||
| 1791 | Ga0501083_0001554 | |||
| 1792 | Ga0501083_0046361 | |||
| 1793 | Ga0501083_0099877 | |||
| 1794 | Ga0501035_0006199 | |||
| 1795 | Ga0501035_0225158 | |||
| 1796 | Ga0501035_0665373 | |||
| 1797 | Ga0501044_0136092 | |||
| 1798 | Ga0501045_0011268 | |||
| 1799 | Ga0501045_0019236 | |||
| 1800 | Ga0501045_0039351 | |||
| 1801 | Ga0501045_0334110 | |||
| 1802 | nmdc:mga05p37_20006_c1 | |||
| 1803 | nmdc:mga05p37_312219_c1 | |||
| 1804 | nmdc:mga05p37_6234_c1 | |||
| 1805 | nmdc:mga05p37_854906_c1 | |||
| 1806 | nmdc:mga05p37_885_c1 | |||
| 1807 | nmdc:mga09592_4849_c1 | |||
| 1808 | nmdc:mga09592_60620_c1 | |||
| 1809 | nmdc:mga0qj67_24145_c1 | |||
| 1810 | nmdc:mga06r32_36445_c1 | |||
| 1811 | nmdc:mga08y16_1003_c1 | |||
| 1812 | nmdc:mga08y16_125008_c1 | |||
| 1813 | nmdc:mga08y16_12611_c1 | |||
| 1814 | nmdc:mga08y16_1683885_c1 | |||
| 1815 | nmdc:mga08y16_404540_c1 | |||
| 1816 | nmdc:mga0n895_239708_c1 | |||
| 1817 | nmdc:mga0rr50_303143_c1 | |||
| 1818 | nmdc:mga08x19_258229_c1 | |||
| 1819 | nmdc:mga0a205_351684_c1 | |||
| 1820 | nmdc:mga0a205_50961_c1 | |||
| 1821 | Ga0495601_0157056 | |||
| 1822 | Ga0495601_0503004 | |||
| 1823 | Ga0495612_0028068 | |||
| 1824 | Ga0495612_0158128 | |||
| 1825 | Ga0500635_0182221 | |||
| 1826 | Ga0495655_0030257 | |||
| 1827 | Ga0495655_0206950 | |||
| 1828 | Ga0495595_0020664 | |||
| 1829 | Ga0495595_0259361 | |||
| 1830 | Ga0501084_0008834 | |||
| 1831 | Ga0501084_0016468 | |||
| 1832 | Ga0501084_0019805 | |||
| 1833 | Ga0501084_0022799 | |||
| 1834 | Ga0501084_0033799 | |||
| 1835 | Ga0501084_0078132 | |||
| 1836 | Ga0501084_0136167 | |||
| 1837 | Ga0501084_0166827 | |||
| 1838 | Ga0501084_0504265 | |||
| 1839 | Ga0501084_0831999 | |||
| 1840 | Ga0501082_0003852 | |||
| 1841 | Ga0501082_0083099 | |||
| 1842 | Ga0501082_0129470 | |||
| 1843 | Ga0501082_0172225 | |||
| 1844 | Ga0501082_0255308 | |||
| 1845 | Ga0501082_0384777 | |||
| 1846 | Ga0501082_0709374 | |||
| 1847 | Ga0501082_0709466 | |||
| 1848 | Ga0501082_1064728 | |||
| 1849 | Ga0466962_0002194 | |||
| 1850 | Ga0466962_0006777 | |||
| 1851 | Ga0466962_0082915 | |||
| 1852 | Ga0530510_0004085 | |||
| 1853 | Ga0530510_0071572 | |||
| 1854 | Ga0530510_0156885 | |||
| 1855 | Ga0530510_0162706 | |||
| 1856 | Ga0530510_0319809 | |||
| 1857 | Ga0530510_0403617 | |||
| 1858 | Ga0530510_0595747 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.905 | 1 | 168 |
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.8388 | 1 | 168 |
| 6h53-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form | 0.6587 | 2 | 168 |
| 6h5a-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate | 0.6466 | 2 | 170 |
| 6h59-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) with cdp-dag bound | 0.6382 | 2 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O01916_50_234_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8848 | 1 | 162 | 1.20.120.1760 |
| af_Q2FZ11_2_191_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8659 | 2 | 175 | 1.20.120.1760 |
| af_Q8MZC4_124_317_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8639 | 1 | 168 | 1.20.120.1760 |
| af_O13899_376_527_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8594 | 2 | 116 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8506 | 3 | 172 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0PWP5-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9611 | 1 | 179 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A7W0PWP5-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.956 | 1 | 179 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A496U8S2-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9383 | 1 | 175 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A5D8QAE3-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (Phosphatidylglycerophosphate synthase) | 0.9339 | 1 | 172 |
GO:0005886
GO:0006655 GO:0008444 |
| AF-A0A538IB72-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9333 | 2 | 179 |
GO:0005886
GO:0008444 GO:0046474 |