F485967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 928 | 394 | 919 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300003214|JGI25165J46597_1000003|JGI25165J46597_1000003682 |
| Length | 115 |
| Sequence | LAYRFATWGAAAGAQGVQQMRVSETIRQKLTASFAPLALDVVDESHRHAGHAGATRTDGSRGETHFHVRIVSAAFDGIARVERQRRVYAALADELSGPVHALSLKALSPSEAAKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 2 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 3 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 4 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 5 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 6 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 7 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 8 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 131 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 212 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 233 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 260 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 263 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 266 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 267 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 274 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 275 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 276 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 277 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 280 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 281 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 340 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 341 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 342 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 343 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 382 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 384 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 386 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 387 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 390 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 391 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.71 |
| Metatranscriptomes | 0.32 |
| Isolates | 0.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.65 |
| Nodule | 0 |
| Rhizoplane | 3.56 |
| Rhizosphere | 85.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 2 | rootH2_10198168 | 3300003320 | Bacteria | 2148 |
| 3 | JGI25404J52841_10096897 | 3300003659 | Bacteria | 618 |
| 4 | Ga0055526_1000032 | 3300003771 | Bacteria | 143118 |
| 5 | Ga0055526_1062541 | 3300003771 | Bacteria | 787 |
| 6 | Ga0055537_1000283 | 3300003773 | Bacteria | 36181 |
| 7 | Ga0055524_1000054 | 3300003775 | Bacteria | 143118 |
| 8 | Ga0055524_1023261 | 3300003775 | Bacteria | 1999 |
| 9 | Ga0055524_1023324 | 3300003775 | Bacteria | 1996 |
| 10 | Ga0055536_1000659 | 3300003781 | Bacteria | 23340 |
| 11 | Ga0055536_1020862 | 3300003781 | Bacteria | 2008 |
| 12 | Ga0055536_1023547 | 3300003781 | Bacteria | 1807 |
| 13 | Ga0055534_1000041 | 3300003784 | Bacteria | 101875 |
| 14 | Ga0055534_1026779 | 3300003784 | Bacteria | 914 |
| 15 | Ga0055534_1063836 | 3300003784 | Bacteria | 510 |
| 16 | Ga0055528_1000021 | 3300003790 | Bacteria | 143118 |
| 17 | Ga0055528_1051367 | 3300003790 | Bacteria | 831 |
| 18 | Ga0055530_10013099 | 3300003791 | Bacteria | 2849 |
| 19 | Ga0055531_10032577 | 3300003794 | Bacteria | 1699 |
| 20 | Ga0055531_10034386 | 3300003794 | Bacteria | 1609 |
| 21 | Ga0055531_10036459 | 3300003794 | Bacteria | 1516 |
| 22 | Ga0055531_10088827 | 3300003794 | Bacteria | 661 |
| 23 | Ga0055531_10115363 | 3300003794 | Bacteria | 531 |
| 24 | Ga0065715_10707627 | 3300005293 | Unclassified | 650 |
| 25 | Ga0070658_11066672 | 3300005327 | Bacteria | 703 |
| 26 | Ga0070676_10181383 | 3300005328 | Bacteria | 1369 |
| 27 | Ga0070676_10195936 | 3300005328 | Bacteria | 1322 |
| 28 | Ga0070676_10339093 | 3300005328 | Bacteria | 1030 |
| 29 | Ga0070683_100924143 | 3300005329 | Bacteria | 837 |
| 30 | Ga0070690_101035798 | 3300005330 | Bacteria | 648 |
| 31 | Ga0070690_101487530 | 3300005330 | Bacteria | 547 |
| 32 | Ga0070670_100015548 | 3300005331 | Bacteria | 6535 |
| 33 | Ga0070670_100070578 | 3300005331 | Bacteria | 2999 |
| 34 | Ga0070670_100207331 | 3300005331 | Bacteria | 1704 |
| 35 | Ga0070670_100666078 | 3300005331 | Unclassified | 934 |
| 36 | Ga0068869_100392280 | 3300005334 | Bacteria | 1140 |
| 37 | Ga0068869_101780048 | 3300005334 | Bacteria | 551 |
| 38 | Ga0070666_10000757 | 3300005335 | Bacteria | 19578 |
| 39 | Ga0070666_10009705 | 3300005335 | Bacteria | 6013 |
| 40 | Ga0070666_10131108 | 3300005335 | Bacteria | 1742 |
| 41 | Ga0070666_10352011 | 3300005335 | Bacteria | 1054 |
| 42 | Ga0070680_100092051 | 3300005336 | Bacteria | 2510 |
| 43 | Ga0070680_100137081 | 3300005336 | Bacteria | 2050 |
| 44 | Ga0070682_100362873 | 3300005337 | Bacteria | 1084 |
| 45 | Ga0070682_100502539 | 3300005337 | Bacteria | 940 |
| 46 | Ga0068868_100027994 | 3300005338 | Bacteria | 4303 |
| 47 | Ga0068868_100056640 | 3300005338 | Bacteria | 3096 |
| 48 | Ga0068868_101608795 | 3300005338 | Bacteria | 610 |
| 49 | Ga0070691_10250800 | 3300005341 | Bacteria | 949 |
| 50 | Ga0070661_100019364 | 3300005344 | Bacteria | 4851 |
| 51 | Ga0070661_100118687 | 3300005344 | Bacteria | 1979 |
| 52 | Ga0070661_100237090 | 3300005344 | Bacteria | 1403 |
| 53 | Ga0070661_100967333 | 3300005344 | Bacteria | 705 |
| 54 | Ga0070661_101200093 | 3300005344 | Bacteria | 634 |
| 55 | Ga0070661_101298746 | 3300005344 | Bacteria | 610 |
| 56 | Ga0070668_100008453 | 3300005347 | Bacteria | 7643 |
| 57 | Ga0070668_100047303 | 3300005347 | Bacteria | 3307 |
| 58 | Ga0070669_101434804 | 3300005353 | Bacteria | 599 |
| 59 | Ga0070669_101847872 | 3300005353 | Unclassified | 527 |
| 60 | Ga0070675_101792683 | 3300005354 | Unclassified | 566 |
| 61 | Ga0070675_102183818 | 3300005354 | Bacteria | 510 |
| 62 | Ga0070671_100085319 | 3300005355 | Bacteria | 2641 |
| 63 | Ga0070671_100179990 | 3300005355 | Bacteria | 1789 |
| 64 | Ga0070671_100351457 | 3300005355 | Unclassified | 1258 |
| 65 | Ga0070671_101076074 | 3300005355 | Bacteria | 706 |
| 66 | Ga0070671_101325191 | 3300005355 | Bacteria | 635 |
| 67 | Ga0070673_100078330 | 3300005364 | Bacteria | 2674 |
| 68 | Ga0070673_100271217 | 3300005364 | Bacteria | 1485 |
| 69 | Ga0070673_101326571 | 3300005364 | Bacteria | 676 |
| 70 | Ga0070673_102099389 | 3300005364 | Bacteria | 537 |
| 71 | Ga0070673_102405880 | 3300005364 | Bacteria | 501 |
| 72 | Ga0070659_100178076 | 3300005366 | Bacteria | 1744 |
| 73 | Ga0070659_100598975 | 3300005366 | Bacteria | 947 |
| 74 | Ga0070659_101198431 | 3300005366 | Bacteria | 671 |
| 75 | Ga0070667_100000173 | 3300005367 | Bacteria | 79829 |
| 76 | Ga0070667_100017183 | 3300005367 | Bacteria | 5992 |
| 77 | Ga0070667_100025113 | 3300005367 | Bacteria | 4953 |
| 78 | Ga0070667_100048047 | 3300005367 | Bacteria | 3591 |
| 79 | Ga0070667_100052306 | 3300005367 | Bacteria | 3446 |
| 80 | Ga0070667_100055945 | 3300005367 | Bacteria | 3332 |
| 81 | Ga0070667_100102632 | 3300005367 | Bacteria | 2471 |
| 82 | Ga0070667_100132984 | 3300005367 | Bacteria | 2173 |
| 83 | Ga0070667_100267424 | 3300005367 | Bacteria | 1532 |
| 84 | Ga0070667_100300972 | 3300005367 | Bacteria | 1444 |
| 85 | Ga0070667_100612645 | 3300005367 | Bacteria | 1004 |
| 86 | Ga0070709_11012137 | 3300005434 | Bacteria | 661 |
| 87 | Ga0070714_101505081 | 3300005435 | Unclassified | 657 |
| 88 | Ga0070714_101876988 | 3300005435 | Bacteria | 585 |
| 89 | Ga0070713_100875892 | 3300005436 | Bacteria | 863 |
| 90 | Ga0070710_10736483 | 3300005437 | Unclassified | 699 |
| 91 | Ga0070710_10960217 | 3300005437 | Bacteria | 620 |
| 92 | Ga0070711_100160109 | 3300005439 | Bacteria | 1706 |
| 93 | Ga0070711_100973472 | 3300005439 | Bacteria | 727 |
| 94 | Ga0070711_101106171 | 3300005439 | Bacteria | 683 |
| 95 | Ga0070711_101294710 | 3300005439 | Bacteria | 632 |
| 96 | Ga0070705_100141600 | 3300005440 | Bacteria | 1583 |
| 97 | Ga0070700_100572725 | 3300005441 | Bacteria | 880 |
| 98 | Ga0070694_100263966 | 3300005444 | Bacteria | 1307 |
| 99 | Ga0070694_100271668 | 3300005444 | Unclassified | 1289 |
| 100 | Ga0070694_100385506 | 3300005444 | Unclassified | 1094 |
| 101 | Ga0070708_100488261 | 3300005445 | Unclassified | 1162 |
| 102 | Ga0070663_100000433 | 3300005455 | Bacteria | 22073 |
| 103 | Ga0070663_100014214 | 3300005455 | Bacteria | 5104 |
| 104 | Ga0070663_100016057 | 3300005455 | Bacteria | 4850 |
| 105 | Ga0070663_100129903 | 3300005455 | Bacteria | 1912 |
| 106 | Ga0070663_100140351 | 3300005455 | Unclassified | 1844 |
| 107 | Ga0070663_100611226 | 3300005455 | Bacteria | 918 |
| 108 | Ga0070662_100052807 | 3300005457 | Bacteria | 2940 |
| 109 | Ga0070662_100497703 | 3300005457 | Bacteria | 1016 |
| 110 | Ga0070681_10004353 | 3300005458 | Bacteria | 13464 |
| 111 | Ga0070681_10028265 | 3300005458 | Bacteria | 5637 |
| 112 | Ga0070681_10488653 | 3300005458 | Unclassified | 1144 |
| 113 | Ga0070681_10657500 | 3300005458 | Bacteria | 963 |
| 114 | Ga0070681_10786673 | 3300005458 | Bacteria | 868 |
| 115 | Ga0070681_10845666 | 3300005458 | Bacteria | 833 |
| 116 | Ga0068867_100044082 | 3300005459 | Bacteria | 3267 |
| 117 | Ga0068867_100086928 | 3300005459 | Bacteria | 2366 |
| 118 | Ga0070685_10625954 | 3300005466 | Bacteria | 777 |
| 119 | Ga0070706_100058201 | 3300005467 | Bacteria | 3567 |
| 120 | Ga0070706_100104346 | 3300005467 | Bacteria | 2636 |
| 121 | Ga0070706_100286691 | 3300005467 | Bacteria | 1537 |
| 122 | Ga0070706_101886643 | 3300005467 | Bacteria | 542 |
| 123 | Ga0070707_100318648 | 3300005468 | Unclassified | 1511 |
| 124 | Ga0070707_101917292 | 3300005468 | Bacteria | 560 |
| 125 | Ga0070707_102007567 | 3300005468 | Unclassified | 546 |
| 126 | Ga0070698_100025034 | 3300005471 | Bacteria | 6220 |
| 127 | Ga0070698_100045045 | 3300005471 | Bacteria | 4515 |
| 128 | Ga0070698_101000647 | 3300005471 | Unclassified | 783 |
| 129 | Ga0070699_100306357 | 3300005518 | Bacteria | 1425 |
| 130 | Ga0070699_100367954 | 3300005518 | Unclassified | 1296 |
| 131 | Ga0070699_100427559 | 3300005518 | Bacteria | 1199 |
| 132 | Ga0070679_100019586 | 3300005530 | Bacteria | 6584 |
| 133 | Ga0070679_100050521 | 3300005530 | Bacteria | 4142 |
| 134 | Ga0070679_100354039 | 3300005530 | Bacteria | 1416 |
| 135 | Ga0070679_100695711 | 3300005530 | Bacteria | 959 |
| 136 | Ga0070679_101635488 | 3300005530 | Unclassified | 592 |
| 137 | Ga0070679_101645651 | 3300005530 | Unclassified | 590 |
| 138 | Ga0070679_101649452 | 3300005530 | Unclassified | 589 |
| 139 | Ga0070684_102134593 | 3300005535 | Bacteria | 529 |
| 140 | Ga0070697_100012925 | 3300005536 | Bacteria | 6541 |
| 141 | Ga0070697_100191265 | 3300005536 | Bacteria | 1737 |
| 142 | Ga0070697_101285078 | 3300005536 | Bacteria | 653 |
| 143 | Ga0068853_100000439 | 3300005539 | Bacteria | 28384 |
| 144 | Ga0068853_100005942 | 3300005539 | Bacteria | 9640 |
| 145 | Ga0068853_100010569 | 3300005539 | Bacteria | 7463 |
| 146 | Ga0068853_100038085 | 3300005539 | Bacteria | 4094 |
| 147 | Ga0068853_100079524 | 3300005539 | Bacteria | 2867 |
| 148 | Ga0068853_100083127 | 3300005539 | Bacteria | 2805 |
| 149 | Ga0068853_100135486 | 3300005539 | Bacteria | 2207 |
| 150 | Ga0068853_100153411 | 3300005539 | Bacteria | 2074 |
| 151 | Ga0068853_100400748 | 3300005539 | Bacteria | 1284 |
| 152 | Ga0068853_100609914 | 3300005539 | Bacteria | 1037 |
| 153 | Ga0068853_101622285 | 3300005539 | Unclassified | 627 |
| 154 | Ga0070672_100962956 | 3300005543 | Unclassified | 755 |
| 155 | Ga0070672_100983362 | 3300005543 | Bacteria | 747 |
| 156 | Ga0070686_100777648 | 3300005544 | Bacteria | 770 |
| 157 | Ga0070695_100647603 | 3300005545 | Unclassified | 834 |
| 158 | Ga0070695_100998360 | 3300005545 | Unclassified | 681 |
| 159 | Ga0070695_101270067 | 3300005545 | Bacteria | 607 |
| 160 | Ga0070696_100202062 | 3300005546 | Bacteria | 1484 |
| 161 | Ga0070696_100302025 | 3300005546 | Unclassified | 1226 |
| 162 | Ga0070693_100017460 | 3300005547 | Bacteria | 3731 |
| 163 | Ga0070693_100210358 | 3300005547 | Bacteria | 1269 |
| 164 | Ga0070665_100000095 | 3300005548 | Bacteria | 170459 |
| 165 | Ga0070665_100000668 | 3300005548 | Bacteria | 46152 |
| 166 | Ga0070665_100000887 | 3300005548 | Bacteria | 38376 |
| 167 | Ga0070665_100054241 | 3300005548 | Bacteria | 4021 |
| 168 | Ga0070665_100128608 | 3300005548 | Bacteria | 2535 |
| 169 | Ga0070665_100156522 | 3300005548 | Bacteria | 2280 |
| 170 | Ga0070665_100297443 | 3300005548 | Bacteria | 1616 |
| 171 | Ga0070665_100464002 | 3300005548 | Bacteria | 1277 |
| 172 | Ga0070665_100525843 | 3300005548 | Bacteria | 1195 |
| 173 | Ga0070665_100957931 | 3300005548 | Bacteria | 868 |
| 174 | Ga0070665_101076593 | 3300005548 | Bacteria | 815 |
| 175 | Ga0070704_100019076 | 3300005549 | Bacteria | 4400 |
| 176 | Ga0070704_100319082 | 3300005549 | Bacteria | 1301 |
| 177 | Ga0068855_100036896 | 3300005563 | Bacteria | 5815 |
| 178 | Ga0068855_100040241 | 3300005563 | Bacteria | 5548 |
| 179 | Ga0068855_100085911 | 3300005563 | Bacteria | 3639 |
| 180 | Ga0068855_100133530 | 3300005563 | Bacteria | 2833 |
| 181 | Ga0068855_100180405 | 3300005563 | Bacteria | 2387 |
| 182 | Ga0068855_100194707 | 3300005563 | Bacteria | 2284 |
| 183 | Ga0068855_101279681 | 3300005563 | Unclassified | 760 |
| 184 | Ga0068855_101288155 | 3300005563 | Unclassified | 757 |
| 185 | Ga0068855_102319541 | 3300005563 | Bacteria | 537 |
| 186 | Ga0070664_100142038 | 3300005564 | Bacteria | 2114 |
| 187 | Ga0070664_101318064 | 3300005564 | Unclassified | 682 |
| 188 | Ga0070664_101480146 | 3300005564 | Unclassified | 642 |
| 189 | Ga0070664_102128351 | 3300005564 | Bacteria | 532 |
| 190 | Ga0068857_100034950 | 3300005577 | Bacteria | 4448 |
| 191 | Ga0068857_100064811 | 3300005577 | Bacteria | 3249 |
| 192 | Ga0068857_100113654 | 3300005577 | Bacteria | 2434 |
| 193 | Ga0068857_100307780 | 3300005577 | Bacteria | 1461 |
| 194 | Ga0068857_100961573 | 3300005577 | Bacteria | 821 |
| 195 | Ga0068854_100005787 | 3300005578 | Bacteria | 7825 |
| 196 | Ga0068854_100075717 | 3300005578 | Bacteria | 2472 |
| 197 | Ga0068854_100144807 | 3300005578 | Bacteria | 1827 |
| 198 | Ga0068854_100183054 | 3300005578 | Bacteria | 1638 |
| 199 | Ga0068854_100272645 | 3300005578 | Bacteria | 1359 |
| 200 | Ga0068854_100588819 | 3300005578 | Bacteria | 948 |
| 201 | Ga0068856_100005667 | 3300005614 | Bacteria | 12295 |
| 202 | Ga0068856_100127697 | 3300005614 | Bacteria | 2546 |
| 203 | Ga0068856_100661213 | 3300005614 | Bacteria | 1065 |
| 204 | Ga0068856_101499583 | 3300005614 | Bacteria | 688 |
| 205 | Ga0070702_100096341 | 3300005615 | Unclassified | 1806 |
| 206 | Ga0070702_101490716 | 3300005615 | Bacteria | 556 |
| 207 | Ga0068852_100013925 | 3300005616 | Bacteria | 6168 |
| 208 | Ga0068852_100014213 | 3300005616 | Bacteria | 6116 |
| 209 | Ga0068852_100030374 | 3300005616 | Bacteria | 4447 |
| 210 | Ga0068852_100139011 | 3300005616 | Bacteria | 2246 |
| 211 | Ga0068852_100242176 | 3300005616 | Bacteria | 1724 |
| 212 | Ga0068852_100526428 | 3300005616 | Bacteria | 1180 |
| 213 | Ga0068859_100000208 | 3300005617 | Bacteria | 58155 |
| 214 | Ga0068859_100904804 | 3300005617 | Bacteria | 967 |
| 215 | Ga0068859_101527167 | 3300005617 | Bacteria | 737 |
| 216 | Ga0068859_103003115 | 3300005617 | Bacteria | 515 |
| 217 | Ga0068864_100051778 | 3300005618 | Bacteria | 3538 |
| 218 | Ga0068864_100140661 | 3300005618 | Bacteria | 2177 |
| 219 | Ga0068864_100346407 | 3300005618 | Bacteria | 1401 |
| 220 | Ga0068864_100732979 | 3300005618 | Bacteria | 968 |
| 221 | Ga0068861_100172255 | 3300005719 | Bacteria | 1795 |
| 222 | Ga0068851_10000537 | 3300005834 | Bacteria | 16566 |
| 223 | Ga0068851_10033622 | 3300005834 | Bacteria | 2556 |
| 224 | Ga0068851_10489660 | 3300005834 | Bacteria | 736 |
| 225 | Ga0068851_10660391 | 3300005834 | Bacteria | 641 |
| 226 | Ga0068863_100012962 | 3300005841 | Bacteria | 8037 |
| 227 | Ga0068863_100041995 | 3300005841 | Bacteria | 4346 |
| 228 | Ga0068863_100045063 | 3300005841 | Bacteria | 4186 |
| 229 | Ga0068863_100077046 | 3300005841 | Bacteria | 3155 |
| 230 | Ga0068863_100174482 | 3300005841 | Bacteria | 2063 |
| 231 | Ga0068863_100229478 | 3300005841 | Bacteria | 1790 |
| 232 | Ga0068863_100232198 | 3300005841 | Bacteria | 1780 |
| 233 | Ga0068863_101415784 | 3300005841 | Unclassified | 703 |
| 234 | Ga0068858_100017961 | 3300005842 | Bacteria | 6624 |
| 235 | Ga0068858_100061350 | 3300005842 | Bacteria | 3476 |
| 236 | Ga0068858_100272811 | 3300005842 | Bacteria | 1610 |
| 237 | Ga0068858_100506949 | 3300005842 | Bacteria | 1166 |
| 238 | Ga0068858_100567778 | 3300005842 | Bacteria | 1099 |
| 239 | Ga0068858_101106588 | 3300005842 | Bacteria | 778 |
| 240 | Ga0068860_100075425 | 3300005843 | Bacteria | 3208 |
| 241 | Ga0068860_100098728 | 3300005843 | Bacteria | 2784 |
| 242 | Ga0068860_100099406 | 3300005843 | Bacteria | 2775 |
| 243 | Ga0068860_100296464 | 3300005843 | Bacteria | 1583 |
| 244 | Ga0068860_100333468 | 3300005843 | Bacteria | 1490 |
| 245 | Ga0068860_100677609 | 3300005843 | Bacteria | 1040 |
| 246 | Ga0068860_102474719 | 3300005843 | Bacteria | 539 |
| 247 | Ga0068862_100000404 | 3300005844 | Bacteria | 46607 |
| 248 | Ga0068862_100077359 | 3300005844 | Bacteria | 2881 |
| 249 | Ga0068862_100825142 | 3300005844 | Bacteria | 907 |
| 250 | Ga0081455_10071898 | 3300005937 | Bacteria | 2866 |
| 251 | Ga0081455_10162222 | 3300005937 | Bacteria | 1712 |
| 252 | Ga0081538_10110331 | 3300005981 | Bacteria | 1352 |
| 253 | Ga0081540_1003155 | 3300005983 | Bacteria | 13175 |
| 254 | Ga0070717_10037516 | 3300006028 | Bacteria | 3935 |
| 255 | Ga0070715_10089056 | 3300006163 | Bacteria | 1416 |
| 256 | Ga0070715_10174299 | 3300006163 | Bacteria | 1074 |
| 257 | Ga0070716_100302751 | 3300006173 | Bacteria | 1113 |
| 258 | Ga0070716_100559142 | 3300006173 | Bacteria | 854 |
| 259 | Ga0070712_100299588 | 3300006175 | Bacteria | 1301 |
| 260 | Ga0097621_100018815 | 3300006237 | Bacteria | 5287 |
| 261 | Ga0097621_100397113 | 3300006237 | Bacteria | 1234 |
| 262 | Ga0097621_100418811 | 3300006237 | Bacteria | 1202 |
| 263 | Ga0097621_100518809 | 3300006237 | Bacteria | 1081 |
| 264 | Ga0097621_101332575 | 3300006237 | Bacteria | 678 |
| 265 | Ga0068871_100070200 | 3300006358 | Bacteria | 2879 |
| 266 | Ga0068871_100123937 | 3300006358 | Bacteria | 2185 |
| 267 | Ga0068871_100225067 | 3300006358 | Bacteria | 1626 |
| 268 | Ga0068871_100310122 | 3300006358 | Bacteria | 1387 |
| 269 | Ga0068871_100396982 | 3300006358 | Unclassified | 1228 |
| 270 | Ga0068871_100610694 | 3300006358 | Bacteria | 992 |
| 271 | Ga0068871_101011180 | 3300006358 | Bacteria | 774 |
| 272 | Ga0068871_101322480 | 3300006358 | Unclassified | 678 |
| 273 | Ga0075431_101291443 | 3300006847 | Bacteria | 691 |
| 274 | Ga0075433_10330175 | 3300006852 | Bacteria | 1349 |
| 275 | Ga0075434_100094618 | 3300006871 | Bacteria | 2993 |
| 276 | Ga0075434_100457054 | 3300006871 | Bacteria | 1298 |
| 277 | Ga0068865_100041404 | 3300006881 | Bacteria | 3134 |
| 278 | Ga0068865_100397149 | 3300006881 | Bacteria | 1128 |
| 279 | Ga0068865_101082937 | 3300006881 | Bacteria | 705 |
| 280 | Ga0075436_100368625 | 3300006914 | Bacteria | 1037 |
| 281 | Ga0075436_100850883 | 3300006914 | Unclassified | 681 |
| 282 | Ga0097620_100000208 | 3300006931 | Bacteria | 58155 |
| 283 | Ga0097620_100904842 | 3300006931 | Bacteria | 967 |
| 284 | Ga0097620_101527819 | 3300006931 | Bacteria | 737 |
| 285 | Ga0097620_103005727 | 3300006931 | Bacteria | 515 |
| 286 | Ga0075435_100105373 | 3300007076 | Bacteria | 2340 |
| 287 | Ga0075435_100909737 | 3300007076 | Bacteria | 767 |
| 288 | Ga0099795_10092628 | 3300007788 | Bacteria | 1173 |
| 289 | Ga0105240_10018288 | 3300009093 | Bacteria | 9419 |
| 290 | Ga0105240_10040738 | 3300009093 | Bacteria | 5937 |
| 291 | Ga0105240_10310080 | 3300009093 | Bacteria | 1802 |
| 292 | Ga0105240_10389613 | 3300009093 | Bacteria | 1572 |
| 293 | Ga0105240_10398442 | 3300009093 | Bacteria | 1551 |
| 294 | Ga0105240_10442675 | 3300009093 | Bacteria | 1456 |
| 295 | Ga0105240_10489203 | 3300009093 | Bacteria | 1370 |
| 296 | Ga0105240_10678366 | 3300009093 | Bacteria | 1127 |
| 297 | Ga0105240_11477216 | 3300009093 | Unclassified | 713 |
| 298 | Ga0105240_11559296 | 3300009093 | Bacteria | 692 |
| 299 | Ga0105240_11605755 | 3300009093 | Bacteria | 680 |
| 300 | Ga0105240_11614880 | 3300009093 | Bacteria | 678 |
| 301 | Ga0105240_11646486 | 3300009093 | Bacteria | 671 |
| 302 | Ga0111539_11216866 | 3300009094 | Unclassified | 875 |
| 303 | Ga0105245_10103549 | 3300009098 | Bacteria | 2637 |
| 304 | Ga0105245_11906152 | 3300009098 | Unclassified | 647 |
| 305 | Ga0105247_10098662 | 3300009101 | Bacteria | 1865 |
| 306 | Ga0105247_10163352 | 3300009101 | Bacteria | 1476 |
| 307 | Ga0105247_10197065 | 3300009101 | Bacteria | 1351 |
| 308 | Ga0105247_10966186 | 3300009101 | Bacteria | 663 |
| 309 | Ga0114129_10137959 | 3300009147 | Bacteria | 3345 |
| 310 | Ga0105243_10135996 | 3300009148 | Bacteria | 2091 |
| 311 | Ga0105243_11702691 | 3300009148 | Unclassified | 659 |
| 312 | Ga0105241_10081236 | 3300009174 | Bacteria | 2538 |
| 313 | Ga0105241_10171748 | 3300009174 | Bacteria | 1791 |
| 314 | Ga0105241_10223027 | 3300009174 | Bacteria | 1585 |
| 315 | Ga0105241_12227509 | 3300009174 | Bacteria | 544 |
| 316 | Ga0105242_10485840 | 3300009176 | Bacteria | 1171 |
| 317 | Ga0105248_10014943 | 3300009177 | Bacteria | 8548 |
| 318 | Ga0105248_10769117 | 3300009177 | Bacteria | 1087 |
| 319 | Ga0105248_11341816 | 3300009177 | Bacteria | 809 |
| 320 | Ga0105248_12195223 | 3300009177 | Bacteria | 628 |
| 321 | Ga0105248_13386771 | 3300009177 | Bacteria | 506 |
| 322 | Ga0105237_10000345 | 3300009545 | Bacteria | 65477 |
| 323 | Ga0105237_10084295 | 3300009545 | Bacteria | 3169 |
| 324 | Ga0105237_10130044 | 3300009545 | Bacteria | 2512 |
| 325 | Ga0105237_10238678 | 3300009545 | Bacteria | 1819 |
| 326 | Ga0105237_10299471 | 3300009545 | Bacteria | 1611 |
| 327 | Ga0105237_10899297 | 3300009545 | Bacteria | 892 |
| 328 | Ga0105238_10018425 | 3300009551 | Bacteria | 7107 |
| 329 | Ga0105238_10069275 | 3300009551 | Bacteria | 3528 |
| 330 | Ga0105238_10168057 | 3300009551 | Bacteria | 2169 |
| 331 | Ga0105238_10237520 | 3300009551 | Bacteria | 1800 |
| 332 | Ga0105238_10306350 | 3300009551 | Bacteria | 1573 |
| 333 | Ga0105238_10431396 | 3300009551 | Bacteria | 1314 |
| 334 | Ga0105238_10636547 | 3300009551 | Bacteria | 1076 |
| 335 | Ga0105238_11078873 | 3300009551 | Bacteria | 825 |
| 336 | Ga0105249_10000175 | 3300009553 | Bacteria | 74934 |
| 337 | Ga0105249_10000936 | 3300009553 | Bacteria | 25817 |
| 338 | Ga0105249_10081967 | 3300009553 | Bacteria | 3000 |
| 339 | Ga0105249_10289196 | 3300009553 | Bacteria | 1640 |
| 340 | Ga0105249_10356280 | 3300009553 | Bacteria | 1483 |
| 341 | Ga0105249_12181879 | 3300009553 | Bacteria | 627 |
| 342 | Ga0099796_10009045 | 3300010159 | Bacteria | 2680 |
| 343 | Ga0105239_10039913 | 3300010375 | Bacteria | 5142 |
| 344 | Ga0105239_10149926 | 3300010375 | Bacteria | 2602 |
| 345 | Ga0105239_10187090 | 3300010375 | Bacteria | 2318 |
| 346 | Ga0105239_10297387 | 3300010375 | Bacteria | 1818 |
| 347 | Ga0105239_10352587 | 3300010375 | Bacteria | 1661 |
| 348 | Ga0105239_10565254 | 3300010375 | Unclassified | 1296 |
| 349 | Ga0105239_10596883 | 3300010375 | Bacteria | 1259 |
| 350 | Ga0105239_11216802 | 3300010375 | Bacteria | 868 |
| 351 | Ga0105239_11764085 | 3300010375 | Bacteria | 717 |
| 352 | Ga0105246_10045743 | 3300011119 | Bacteria | 2982 |
| 353 | Ga0105246_10095948 | 3300011119 | Bacteria | 2148 |
| 354 | Ga0105246_10716904 | 3300011119 | Bacteria | 878 |
| 355 | Ga0157323_1001558 | 3300012495 | Bacteria | 1166 |
| 356 | Ga0157327_1000791 | 3300012512 | Bacteria | 1809 |
| 357 | Ga0157327_1036838 | 3300012512 | Bacteria | 639 |
| 358 | Ga0157373_10181012 | 3300013100 | Bacteria | 1484 |
| 359 | Ga0157373_11006987 | 3300013100 | Bacteria | 622 |
| 360 | Ga0157370_10013990 | 3300013104 | Bacteria | 8240 |
| 361 | Ga0157370_10056772 | 3300013104 | Bacteria | 3725 |
| 362 | Ga0157370_10188888 | 3300013104 | Bacteria | 1912 |
| 363 | Ga0157370_10350100 | 3300013104 | Bacteria | 1361 |
| 364 | Ga0157370_10389563 | 3300013104 | Bacteria | 1283 |
| 365 | Ga0157370_10561185 | 3300013104 | Bacteria | 1046 |
| 366 | Ga0157370_10894639 | 3300013104 | Bacteria | 806 |
| 367 | Ga0157370_11918075 | 3300013104 | Bacteria | 531 |
| 368 | Ga0157369_10008071 | 3300013105 | Bacteria | 12072 |
| 369 | Ga0157369_10057002 | 3300013105 | Bacteria | 4216 |
| 370 | Ga0157369_10446650 | 3300013105 | Bacteria | 1339 |
| 371 | Ga0157369_10949451 | 3300013105 | Bacteria | 881 |
| 372 | Ga0157369_11412056 | 3300013105 | Bacteria | 709 |
| 373 | Ga0157374_10273908 | 3300013296 | Bacteria | 1665 |
| 374 | Ga0157374_10849946 | 3300013296 | Bacteria | 929 |
| 375 | Ga0157374_12218719 | 3300013296 | Bacteria | 576 |
| 376 | Ga0157378_10026393 | 3300013297 | Bacteria | 5120 |
| 377 | Ga0157378_10235048 | 3300013297 | Bacteria | 1748 |
| 378 | Ga0157378_11031661 | 3300013297 | Bacteria | 858 |
| 379 | Ga0157378_11208406 | 3300013297 | Bacteria | 795 |
| 380 | Ga0163162_10722162 | 3300013306 | Bacteria | 1117 |
| 381 | Ga0163162_11351097 | 3300013306 | Bacteria | 810 |
| 382 | Ga0157372_10002630 | 3300013307 | Bacteria | 19452 |
| 383 | Ga0157372_10369451 | 3300013307 | Bacteria | 1671 |
| 384 | Ga0157372_11311132 | 3300013307 | Bacteria | 835 |
| 385 | Ga0157375_10477090 | 3300013308 | Bacteria | 1412 |
| 386 | Ga0157375_13658044 | 3300013308 | Unclassified | 511 |
| 387 | Ga0163163_10023588 | 3300014325 | Bacteria | 5840 |
| 388 | Ga0163163_10101601 | 3300014325 | Bacteria | 2898 |
| 389 | Ga0163163_10473105 | 3300014325 | Bacteria | 1314 |
| 390 | Ga0163163_11100885 | 3300014325 | Bacteria | 857 |
| 391 | Ga0182008_10028734 | 3300014497 | Bacteria | 2812 |
| 392 | Ga0157379_10000992 | 3300014968 | Bacteria | 23037 |
| 393 | Ga0157379_10170217 | 3300014968 | Bacteria | 1966 |
| 394 | Ga0157379_10524912 | 3300014968 | Bacteria | 1099 |
| 395 | Ga0157379_11969967 | 3300014968 | Unclassified | 577 |
| 396 | Ga0157376_10084090 | 3300014969 | Bacteria | 2739 |
| 397 | Ga0157376_10123760 | 3300014969 | Unclassified | 2296 |
| 398 | Ga0157376_10177852 | 3300014969 | Bacteria | 1942 |
| 399 | Ga0157376_10337905 | 3300014969 | Bacteria | 1437 |
| 400 | Ga0157376_10414173 | 3300014969 | Bacteria | 1306 |
| 401 | Ga0157376_11094635 | 3300014969 | Bacteria | 822 |
| 402 | Ga0157376_11182073 | 3300014969 | Bacteria | 793 |
| 403 | Ga0157376_11774472 | 3300014969 | Bacteria | 653 |
| 404 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 405 | Ga0206356_10665401 | 3300020070 | Bacteria | 822 |
| 406 | Ga0206353_10282457 | 3300020082 | Bacteria | 1695 |
| 407 | Ga0206353_11851096 | 3300020082 | Bacteria | 639 |
| 408 | Ga0213873_10031477 | 3300021358 | Bacteria | 1320 |
| 409 | Ga0213876_10599148 | 3300021384 | Unclassified | 586 |
| 410 | Ga0213875_10010320 | 3300021388 | Bacteria | 4678 |
| 411 | Ga0228598_1089098 | 3300024227 | Unclassified | 620 |
| 412 | Ga0207425_1002170 | 3300025245 | Bacteria | 7164 |
| 413 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 414 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 415 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 416 | Ga0209673_1003489 | 3300025273 | Bacteria | 9229 |
| 417 | Ga0209673_1052811 | 3300025273 | Bacteria | 1064 |
| 418 | Ga0209130_1004560 | 3300025284 | Bacteria | 5205 |
| 419 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 420 | Ga0209675_1008125 | 3300025291 | Bacteria | 3910 |
| 421 | Ga0209675_1027378 | 3300025291 | Bacteria | 1403 |
| 422 | Ga0209676_1007374 | 3300025292 | Bacteria | 5176 |
| 423 | Ga0209676_1022610 | 3300025292 | Bacteria | 2078 |
| 424 | Ga0209676_1027136 | 3300025292 | Bacteria | 1806 |
| 425 | Ga0209676_1036651 | 3300025292 | Bacteria | 1424 |
| 426 | Ga0209676_1067479 | 3300025292 | Bacteria | 863 |
| 427 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 428 | Ga0209025_1018697 | 3300025294 | Bacteria | 3905 |
| 429 | Ga0209025_1054771 | 3300025294 | Bacteria | 1549 |
| 430 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 431 | Ga0209564_1011660 | 3300025295 | Bacteria | 3913 |
| 432 | Ga0209564_1030519 | 3300025295 | Bacteria | 1668 |
| 433 | Ga0209758_1013026 | 3300025297 | Bacteria | 4582 |
| 434 | Ga0209758_1055202 | 3300025297 | Bacteria | 1351 |
| 435 | Ga0209758_1071927 | 3300025297 | Bacteria | 1085 |
| 436 | Ga0209050_1033547 | 3300025298 | Bacteria | 1554 |
| 437 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 438 | Ga0209256_1002071 | 3300025299 | Bacteria | 17657 |
| 439 | Ga0209256_1002825 | 3300025299 | Bacteria | 13266 |
| 440 | Ga0209256_1006641 | 3300025299 | Bacteria | 6032 |
| 441 | Ga0207426_1118271 | 3300025302 | Bacteria | 658 |
| 442 | Ga0209051_1012544 | 3300025303 | Bacteria | 4094 |
| 443 | Ga0209051_1020949 | 3300025303 | Bacteria | 2799 |
| 444 | Ga0209257_1001477 | 3300025304 | Bacteria | 27623 |
| 445 | Ga0209257_1003054 | 3300025304 | Bacteria | 15085 |
| 446 | Ga0209257_1027132 | 3300025304 | Bacteria | 1912 |
| 447 | Ga0209257_1030258 | 3300025304 | Bacteria | 1750 |
| 448 | Ga0207697_10139986 | 3300025315 | Bacteria | 1049 |
| 449 | Ga0207656_10000504 | 3300025321 | Bacteria | 12881 |
| 450 | Ga0207656_10009164 | 3300025321 | Bacteria | 3670 |
| 451 | Ga0207656_10228075 | 3300025321 | Bacteria | 907 |
| 452 | Ga0207692_10401347 | 3300025898 | Unclassified | 855 |
| 453 | Ga0207710_10084666 | 3300025900 | Bacteria | 1476 |
| 454 | Ga0207688_10309678 | 3300025901 | Bacteria | 967 |
| 455 | Ga0207680_10016098 | 3300025903 | Bacteria | 3918 |
| 456 | Ga0207680_10086202 | 3300025903 | Bacteria | 1985 |
| 457 | Ga0207680_10153677 | 3300025903 | Bacteria | 1536 |
| 458 | Ga0207647_10000123 | 3300025904 | Bacteria | 60090 |
| 459 | Ga0207685_10244931 | 3300025905 | Bacteria | 864 |
| 460 | Ga0207699_10618038 | 3300025906 | Bacteria | 790 |
| 461 | Ga0207699_10810142 | 3300025906 | Bacteria | 689 |
| 462 | Ga0207645_10012768 | 3300025907 | Bacteria | 5693 |
| 463 | Ga0207705_10012977 | 3300025909 | Bacteria | 6014 |
| 464 | Ga0207684_10196400 | 3300025910 | Bacteria | 1740 |
| 465 | Ga0207654_10015624 | 3300025911 | Bacteria | 3944 |
| 466 | Ga0207707_10009949 | 3300025912 | Bacteria | 8246 |
| 467 | Ga0207707_10084929 | 3300025912 | Bacteria | 2765 |
| 468 | Ga0207707_10712947 | 3300025912 | Bacteria | 841 |
| 469 | Ga0207707_10815652 | 3300025912 | Bacteria | 776 |
| 470 | Ga0207707_11142378 | 3300025912 | Bacteria | 633 |
| 471 | Ga0207695_10000536 | 3300025913 | Bacteria | 79171 |
| 472 | Ga0207695_10012571 | 3300025913 | Bacteria | 10145 |
| 473 | Ga0207695_10043884 | 3300025913 | Bacteria | 4759 |
| 474 | Ga0207695_10549144 | 3300025913 | Bacteria | 1037 |
| 475 | Ga0207695_10678878 | 3300025913 | Bacteria | 911 |
| 476 | Ga0207671_10004444 | 3300025914 | Bacteria | 13400 |
| 477 | Ga0207671_10010174 | 3300025914 | Bacteria | 7789 |
| 478 | Ga0207671_10027507 | 3300025914 | Bacteria | 4252 |
| 479 | Ga0207671_10099792 | 3300025914 | Bacteria | 2197 |
| 480 | Ga0207671_10645067 | 3300025914 | Bacteria | 843 |
| 481 | Ga0207671_10687372 | 3300025914 | Unclassified | 814 |
| 482 | Ga0207671_11574412 | 3300025914 | Bacteria | 506 |
| 483 | Ga0207693_10215801 | 3300025915 | Bacteria | 1507 |
| 484 | Ga0207663_10085751 | 3300025916 | Bacteria | 2074 |
| 485 | Ga0207663_10903699 | 3300025916 | Unclassified | 706 |
| 486 | Ga0207660_10258251 | 3300025917 | Bacteria | 1377 |
| 487 | Ga0207662_10441258 | 3300025918 | Bacteria | 889 |
| 488 | Ga0207657_10101658 | 3300025919 | Bacteria | 2385 |
| 489 | Ga0207649_10018768 | 3300025920 | Bacteria | 3941 |
| 490 | Ga0207649_10102980 | 3300025920 | Bacteria | 1893 |
| 491 | Ga0207649_10340112 | 3300025920 | Bacteria | 1108 |
| 492 | Ga0207649_10638042 | 3300025920 | Bacteria | 822 |
| 493 | Ga0207649_11182276 | 3300025920 | Bacteria | 604 |
| 494 | Ga0207652_10025366 | 3300025921 | Bacteria | 4927 |
| 495 | Ga0207652_10372831 | 3300025921 | Bacteria | 1288 |
| 496 | Ga0207652_10875863 | 3300025921 | Bacteria | 794 |
| 497 | Ga0207652_11120260 | 3300025921 | Bacteria | 688 |
| 498 | Ga0207646_10181939 | 3300025922 | Bacteria | 1898 |
| 499 | Ga0207694_10020919 | 3300025924 | Bacteria | 4954 |
| 500 | Ga0207694_10136899 | 3300025924 | Bacteria | 1968 |
| 501 | Ga0207694_10175321 | 3300025924 | Bacteria | 1737 |
| 502 | Ga0207694_10543636 | 3300025924 | Bacteria | 974 |
| 503 | Ga0207650_10033885 | 3300025925 | Bacteria | 3702 |
| 504 | Ga0207650_10285722 | 3300025925 | Bacteria | 1344 |
| 505 | Ga0207650_10735489 | 3300025925 | Unclassified | 834 |
| 506 | Ga0207659_10294861 | 3300025926 | Bacteria | 1330 |
| 507 | Ga0207659_10596439 | 3300025926 | Bacteria | 941 |
| 508 | Ga0207687_10484255 | 3300025927 | Bacteria | 1030 |
| 509 | Ga0207700_10853840 | 3300025928 | Unclassified | 815 |
| 510 | Ga0207664_11498712 | 3300025929 | Unclassified | 596 |
| 511 | Ga0207644_10048611 | 3300025931 | Bacteria | 3034 |
| 512 | Ga0207644_10206270 | 3300025931 | Bacteria | 1552 |
| 513 | Ga0207644_10263850 | 3300025931 | Bacteria | 1378 |
| 514 | Ga0207706_10004683 | 3300025933 | Bacteria | 12824 |
| 515 | Ga0207706_10938473 | 3300025933 | Bacteria | 729 |
| 516 | Ga0207706_11186360 | 3300025933 | Bacteria | 635 |
| 517 | Ga0207669_10859723 | 3300025937 | Bacteria | 755 |
| 518 | Ga0207669_11328402 | 3300025937 | Bacteria | 611 |
| 519 | Ga0207704_10157541 | 3300025938 | Bacteria | 1611 |
| 520 | Ga0207704_10269067 | 3300025938 | Bacteria | 1289 |
| 521 | Ga0207704_10431662 | 3300025938 | Bacteria | 1047 |
| 522 | Ga0207704_10813533 | 3300025938 | Bacteria | 781 |
| 523 | Ga0207704_11881460 | 3300025938 | Bacteria | 515 |
| 524 | Ga0207711_10009640 | 3300025941 | Bacteria | 8046 |
| 525 | Ga0207711_10565622 | 3300025941 | Bacteria | 1060 |
| 526 | Ga0207711_12012592 | 3300025941 | Bacteria | 520 |
| 527 | Ga0207689_10299558 | 3300025942 | Bacteria | 1333 |
| 528 | Ga0207661_10431050 | 3300025944 | Bacteria | 1199 |
| 529 | Ga0207679_10039975 | 3300025945 | Bacteria | 3354 |
| 530 | Ga0207679_11569738 | 3300025945 | Bacteria | 603 |
| 531 | Ga0207667_10006332 | 3300025949 | Bacteria | 14347 |
| 532 | Ga0207667_10051861 | 3300025949 | Bacteria | 4323 |
| 533 | Ga0207667_10071805 | 3300025949 | Bacteria | 3598 |
| 534 | Ga0207667_10128111 | 3300025949 | Bacteria | 2614 |
| 535 | Ga0207667_10131666 | 3300025949 | Bacteria | 2576 |
| 536 | Ga0207667_10266294 | 3300025949 | Bacteria | 1752 |
| 537 | Ga0207667_11147692 | 3300025949 | Unclassified | 758 |
| 538 | Ga0207651_10313055 | 3300025960 | Bacteria | 1310 |
| 539 | Ga0207651_11909540 | 3300025960 | Unclassified | 534 |
| 540 | Ga0207712_10000600 | 3300025961 | Bacteria | 28673 |
| 541 | Ga0207712_10001206 | 3300025961 | Bacteria | 17862 |
| 542 | Ga0207712_10052758 | 3300025961 | Bacteria | 2849 |
| 543 | Ga0207668_10229935 | 3300025972 | Bacteria | 1494 |
| 544 | Ga0207668_11262375 | 3300025972 | Bacteria | 665 |
| 545 | Ga0207668_11369459 | 3300025972 | Bacteria | 637 |
| 546 | Ga0207668_11688900 | 3300025972 | Bacteria | 572 |
| 547 | Ga0207640_10067489 | 3300025981 | Bacteria | 2394 |
| 548 | Ga0207640_10172843 | 3300025981 | Bacteria | 1612 |
| 549 | Ga0207640_10192447 | 3300025981 | Bacteria | 1538 |
| 550 | Ga0207640_10460561 | 3300025981 | Bacteria | 1050 |
| 551 | Ga0207640_10550598 | 3300025981 | Bacteria | 969 |
| 552 | Ga0207658_10000111 | 3300025986 | Bacteria | 89180 |
| 553 | Ga0207658_10020316 | 3300025986 | Bacteria | 4598 |
| 554 | Ga0207658_10062060 | 3300025986 | Bacteria | 2795 |
| 555 | Ga0207658_10089670 | 3300025986 | Bacteria | 2381 |
| 556 | Ga0207658_10320566 | 3300025986 | Bacteria | 1341 |
| 557 | Ga0207658_11496056 | 3300025986 | Bacteria | 617 |
| 558 | Ga0207658_11973337 | 3300025986 | Bacteria | 531 |
| 559 | Ga0207677_10340151 | 3300026023 | Bacteria | 1253 |
| 560 | Ga0207677_11066871 | 3300026023 | Bacteria | 735 |
| 561 | Ga0207703_10000950 | 3300026035 | Bacteria | 28053 |
| 562 | Ga0207703_10208235 | 3300026035 | Bacteria | 1742 |
| 563 | Ga0207703_10230212 | 3300026035 | Bacteria | 1661 |
| 564 | Ga0207703_10450206 | 3300026035 | Bacteria | 1202 |
| 565 | Ga0207703_11276398 | 3300026035 | Bacteria | 706 |
| 566 | Ga0207639_10000299 | 3300026041 | Bacteria | 35014 |
| 567 | Ga0207639_10000658 | 3300026041 | Bacteria | 23775 |
| 568 | Ga0207639_10001041 | 3300026041 | Bacteria | 18842 |
| 569 | Ga0207639_10001611 | 3300026041 | Bacteria | 15191 |
| 570 | Ga0207639_10010017 | 3300026041 | Bacteria | 6552 |
| 571 | Ga0207639_10168920 | 3300026041 | Bacteria | 1850 |
| 572 | Ga0207639_10185697 | 3300026041 | Bacteria | 1772 |
| 573 | Ga0207639_10253468 | 3300026041 | Bacteria | 1536 |
| 574 | Ga0207639_10591382 | 3300026041 | Unclassified | 1022 |
| 575 | Ga0207639_11940880 | 3300026041 | Unclassified | 550 |
| 576 | Ga0207678_10007436 | 3300026067 | Bacteria | 9698 |
| 577 | Ga0207678_10011856 | 3300026067 | Bacteria | 7654 |
| 578 | Ga0207678_10023314 | 3300026067 | Bacteria | 5413 |
| 579 | Ga0207678_10269755 | 3300026067 | Bacteria | 1459 |
| 580 | Ga0207678_10889966 | 3300026067 | Bacteria | 787 |
| 581 | Ga0207702_10077091 | 3300026078 | Bacteria | 2882 |
| 582 | Ga0207702_10161518 | 3300026078 | Bacteria | 2046 |
| 583 | Ga0207702_10277445 | 3300026078 | Bacteria | 1583 |
| 584 | Ga0207702_10509864 | 3300026078 | Bacteria | 1173 |
| 585 | Ga0207702_10583121 | 3300026078 | Bacteria | 1096 |
| 586 | Ga0207641_10020120 | 3300026088 | Bacteria | 5479 |
| 587 | Ga0207641_10078111 | 3300026088 | Bacteria | 2866 |
| 588 | Ga0207641_10140048 | 3300026088 | Bacteria | 2182 |
| 589 | Ga0207641_10236092 | 3300026088 | Bacteria | 1701 |
| 590 | Ga0207641_11684894 | 3300026088 | Bacteria | 636 |
| 591 | Ga0207648_10029496 | 3300026089 | Bacteria | 4864 |
| 592 | Ga0207648_10115420 | 3300026089 | Bacteria | 2359 |
| 593 | Ga0207648_10487252 | 3300026089 | Bacteria | 1127 |
| 594 | Ga0207676_10004118 | 3300026095 | Bacteria | 10264 |
| 595 | Ga0207676_10026736 | 3300026095 | Bacteria | 4292 |
| 596 | Ga0207676_10340404 | 3300026095 | Bacteria | 1384 |
| 597 | Ga0207676_10580288 | 3300026095 | Bacteria | 1075 |
| 598 | Ga0207674_10072634 | 3300026116 | Bacteria | 3456 |
| 599 | Ga0207674_10132242 | 3300026116 | Bacteria | 2458 |
| 600 | Ga0207674_10169796 | 3300026116 | Bacteria | 2135 |
| 601 | Ga0207674_10320080 | 3300026116 | Bacteria | 1500 |
| 602 | Ga0207674_10813223 | 3300026116 | Bacteria | 902 |
| 603 | Ga0207675_100283057 | 3300026118 | Bacteria | 1611 |
| 604 | Ga0207675_100333706 | 3300026118 | Bacteria | 1483 |
| 605 | Ga0207675_102126718 | 3300026118 | Bacteria | 577 |
| 606 | Ga0207683_10348892 | 3300026121 | Bacteria | 1358 |
| 607 | Ga0207698_10030238 | 3300026142 | Bacteria | 3891 |
| 608 | Ga0207698_10113933 | 3300026142 | Bacteria | 2273 |
| 609 | Ga0207698_10254372 | 3300026142 | Bacteria | 1610 |
| 610 | Ga0207698_10270916 | 3300026142 | Bacteria | 1565 |
| 611 | Ga0207698_10297455 | 3300026142 | Bacteria | 1501 |
| 612 | Ga0207698_10465878 | 3300026142 | Bacteria | 1223 |
| 613 | Ga0207698_10807813 | 3300026142 | Bacteria | 940 |
| 614 | Ga0207698_11465092 | 3300026142 | Unclassified | 698 |
| 615 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 616 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 617 | Ga0268266_10000497 | 3300028379 | Bacteria | 56202 |
| 618 | Ga0268266_10051541 | 3300028379 | Bacteria | 3533 |
| 619 | Ga0268266_10096944 | 3300028379 | Bacteria | 2593 |
| 620 | Ga0268266_10202320 | 3300028379 | Bacteria | 1818 |
| 621 | Ga0268266_10311356 | 3300028379 | Bacteria | 1471 |
| 622 | Ga0268266_10380540 | 3300028379 | Bacteria | 1331 |
| 623 | Ga0268266_10730856 | 3300028379 | Bacteria | 955 |
| 624 | Ga0268266_11142432 | 3300028379 | Bacteria | 753 |
| 625 | Ga0268265_10000297 | 3300028380 | Bacteria | 55640 |
| 626 | Ga0268265_10058734 | 3300028380 | Bacteria | 2939 |
| 627 | Ga0268265_10223968 | 3300028380 | Bacteria | 1648 |
| 628 | Ga0268264_10037860 | 3300028381 | Bacteria | 3978 |
| 629 | Ga0268264_10138355 | 3300028381 | Bacteria | 2168 |
| 630 | Ga0268264_10154233 | 3300028381 | Bacteria | 2062 |
| 631 | Ga0268264_10803127 | 3300028381 | Unclassified | 940 |
| 632 | Ga0268264_11201236 | 3300028381 | Bacteria | 768 |
| 633 | Ga0268264_12131582 | 3300028381 | Bacteria | 569 |
| 634 | Ga0268264_12347717 | 3300028381 | Bacteria | 540 |
| 635 | Ga0307517_10190704 | 3300028786 | Bacteria | 1302 |
| 636 | Ga0265324_10001478 | 3300029957 | Bacteria | 13364 |
| 637 | Ga0265330_10429120 | 3300031235 | Bacteria | 560 |
| 638 | Ga0265328_10003709 | 3300031239 | Bacteria | 6732 |
| 639 | Ga0265339_10029810 | 3300031249 | Bacteria | 3093 |
| 640 | Ga0265331_10002012 | 3300031250 | Bacteria | 14146 |
| 641 | Ga0265331_10025641 | 3300031250 | Bacteria | 2973 |
| 642 | Ga0265327_10018518 | 3300031251 | Bacteria | 4313 |
| 643 | Ga0265316_10164838 | 3300031344 | Bacteria | 1656 |
| 644 | Ga0265316_10174473 | 3300031344 | Bacteria | 1603 |
| 645 | Ga0265316_10612416 | 3300031344 | Bacteria | 772 |
| 646 | Ga0265313_10009191 | 3300031595 | Bacteria | 6445 |
| 647 | Ga0307508_10138832 | 3300031616 | Bacteria | 2034 |
| 648 | Ga0265314_10055573 | 3300031711 | Bacteria | 2731 |
| 649 | Ga0265342_10081356 | 3300031712 | Bacteria | 1870 |
| 650 | Ga0265342_10292180 | 3300031712 | Bacteria | 860 |
| 651 | Ga0265342_10487564 | 3300031712 | Bacteria | 630 |
| 652 | Ga0316578_10321009 | 3300031728 | Unclassified | 924 |
| 653 | Ga0307405_11697489 | 3300031731 | Bacteria | 559 |
| 654 | Ga0307413_10604691 | 3300031824 | Bacteria | 898 |
| 655 | Ga0307406_10867629 | 3300031901 | Bacteria | 766 |
| 656 | Ga0307412_10096326 | 3300031911 | Bacteria | 2082 |
| 657 | Ga0307412_10564949 | 3300031911 | Bacteria | 958 |
| 658 | Ga0307412_10979821 | 3300031911 | Bacteria | 746 |
| 659 | Ga0307416_101044535 | 3300032002 | Bacteria | 921 |
| 660 | Ga0307416_101475860 | 3300032002 | Bacteria | 786 |
| 661 | Ga0307414_10168238 | 3300032004 | Bacteria | 1749 |
| 662 | Ga0307411_11389492 | 3300032005 | Bacteria | 642 |
| 663 | Ga0316583_10254599 | 3300032133 | Unclassified | 608 |
| 664 | Ga0316585_10128453 | 3300032137 | Unclassified | 835 |
| 665 | Ga0307507_10024813 | 3300033179 | Bacteria | 6521 |
| 666 | Ga0373959_0035781 | 3300034820 | Bacteria | 1022 |
| 667 | Ga0373926_0017416 | 3300035083 | Bacteria | 2466 |
| 668 | Ga0373944_0422610 | 3300035089 | Bacteria | 516 |
| 669 | Ga0373951_0056119 | 3300035091 | Bacteria | 978 |
| 670 | Ga0373936_0038424 | 3300035113 | Bacteria | 1913 |
| 671 | Ga0373945_0006101 | 3300035116 | Bacteria | 3877 |
| 672 | Ga0373956_0057703 | 3300035119 | Bacteria | 1755 |
| 673 | Ga0373957_0072147 | 3300035120 | Bacteria | 1352 |
| 674 | Ga0373943_0001524 | 3300035170 | Bacteria | 10486 |
| 675 | Ga0373943_0431914 | 3300035170 | Bacteria | 763 |
| 676 | Ga0373943_0766562 | 3300035170 | Bacteria | 573 |
| 677 | Ga0373946_0160214 | 3300035171 | Bacteria | 1056 |
| 678 | Ga0373946_0621658 | 3300035171 | Bacteria | 561 |
| 679 | Ga0373955_0190561 | 3300035172 | Bacteria | 1219 |
| 680 | Ga0373961_0449804 | 3300035241 | Bacteria | 502 |
| 681 | Ga0316574_0122530 | 3300035398 | Unclassified | 1670 |
| 682 | Ga0373931_0262650 | 3300035691 | Bacteria | 1054 |
| 683 | Ga0373931_0338968 | 3300035691 | Unclassified | 938 |
| 684 | Ga0373931_0582533 | 3300035691 | Bacteria | 730 |
| 685 | Ga0373935_0020131 | 3300035692 | Bacteria | 4073 |
| 686 | Ga0373935_0111091 | 3300035692 | Bacteria | 1820 |
| 687 | Ga0373927_0074892 | 3300035695 | Bacteria | 2192 |
| 688 | Ga0373927_0085424 | 3300035695 | Bacteria | 2048 |
| 689 | Ga0373927_0296408 | 3300035695 | Bacteria | 1064 |
| 690 | Ga0373933_0862358 | 3300035724 | Bacteria | 596 |
| 691 | Ga0373933_1002629 | 3300035724 | Bacteria | 550 |
| 692 | Ga0373947_0040054 | 3300035725 | Bacteria | 2790 |
| 693 | Ga0373947_0591857 | 3300035725 | Bacteria | 756 |
| 694 | Ga0373937_0014255 | 3300036401 | Bacteria | 7016 |
| 695 | Ga0373937_0209252 | 3300036401 | Bacteria | 1835 |
| 696 | Ga0373937_2044079 | 3300036401 | Unclassified | 519 |
| 697 | Ga0316584_0027103 | 3300036712 | Bacteria | 4215 |
| 698 | Ga0373925_0015487 | 3300037068 | Bacteria | 5513 |
| 699 | Ga0373925_0076726 | 3300037068 | Bacteria | 2535 |
| 700 | Ga0395900_0095984 | 3300037418 | Bacteria | 3046 |
| 701 | Ga0395900_0623457 | 3300037418 | Bacteria | 1017 |
| 702 | Ga0395900_1097608 | 3300037418 | Bacteria | 713 |
| 703 | Ga0395898_0017375 | 3300037466 | Bacteria | 7349 |
| 704 | Ga0436364_0207585 | 3300037853 | Bacteria | 136246 |
| 705 | Ga0436364_1073612 | 3300037853 | Bacteria | 5322 |
| 706 | Ga0436364_1170313 | 3300037853 | Bacteria | 898 |
| 707 | Ga0436364_1284200 | 3300037853 | Bacteria | 100206 |
| 708 | Ga0395901_0697269 | 3300038443 | Bacteria | 1013 |
| 709 | Ga0395901_1648803 | 3300038443 | Bacteria | 594 |
| 710 | Ga0242420_165388 | 3300038996 | Unclassified | 502 |
| 711 | Ga0400483_002478 | 3300039062 | Bacteria | 3352 |
| 712 | Ga0436365_1080253 | 3300039437 | Bacteria | 785 |
| 713 | Ga0436360_0716208 | 3300039438 | Unclassified | 1223 |
| 714 | Ga0436361_0332190 | 3300039447 | Bacteria | 3047 |
| 715 | Ga0436363_0490290 | 3300039450 | Bacteria | 976 |
| 716 | Ga0436362_0050995 | 3300039453 | Bacteria | 1721 |
| 717 | Ga0439447_003335 | 3300041407 | Bacteria | 5712 |
| 718 | Ga0451793_1900517 | 3300041452 | Bacteria | 1381 |
| 719 | Ga0451795_1254461 | 3300041456 | Bacteria | 572 |
| 720 | Ga0451800_1211016 | 3300041459 | Bacteria | 514 |
| 721 | Ga0451802_0495449 | 3300041460 | Bacteria | 2802 |
| 722 | Ga0451804_0303647 | 3300041463 | Bacteria | 6913 |
| 723 | Ga0451804_0322379 | 3300041463 | Bacteria | 566 |
| 724 | Ga0451807_2708043 | 3300041486 | Bacteria | 599 |
| 725 | Ga0451835_0754127 | 3300041492 | Bacteria | 810 |
| 726 | Ga0451839_0883414 | 3300041496 | Bacteria | 1115 |
| 727 | Ga0451845_0363449 | 3300041501 | Bacteria | 556 |
| 728 | Ga0451847_0290674 | 3300041503 | Bacteria | 508 |
| 729 | Ga0451849_1561108 | 3300041505 | Bacteria | 1124 |
| 730 | Ga0451853_1273233 | 3300041512 | Bacteria | 2040 |
| 731 | Ga0439448_0060634 | 3300042005 | Bacteria | 1250 |
| 732 | Ga0439432_100104 | 3300042006 | Bacteria | 867 |
| 733 | Ga0439432_110430 | 3300042006 | Bacteria | 818 |
| 734 | Ga0439432_199771 | 3300042006 | Bacteria | 580 |
| 735 | Ga0439449_0006210 | 3300042007 | Bacteria | 4566 |
| 736 | Ga0439449_0011489 | 3300042007 | Bacteria | 3331 |
| 737 | Ga0439449_0037678 | 3300042007 | Bacteria | 1798 |
| 738 | Ga0439449_0150777 | 3300042007 | Bacteria | 867 |
| 739 | Ga0466963_0761726 | 3300044694 | Bacteria | 683 |
| 740 | Ga0466968_0126737 | 3300044735 | Unclassified | 1159 |
| 741 | Ga0466957_1048467 | 3300044842 | Bacteria | 587 |
| 742 | Ga0466958_0651554 | 3300045836 | Bacteria | 686 |
| 743 | Ga0466967_0442523 | 3300045976 | Bacteria | 1269 |
| 744 | Ga0466967_0623732 | 3300045976 | Bacteria | 1065 |
| 745 | Ga0466967_0793137 | 3300045976 | Unclassified | 940 |
| 746 | Ga0466967_1259892 | 3300045976 | Bacteria | 737 |
| 747 | Ga0495592_0114029 | 3300046454 | Bacteria | 1909 |
| 748 | Ga0495629_0020302 | 3300046459 | Bacteria | 4744 |
| 749 | Ga0495638_0057269 | 3300046460 | Bacteria | 2418 |
| 750 | Ga0495651_0799375 | 3300046462 | Bacteria | 582 |
| 751 | Ga0495580_0009377 | 3300046472 | Bacteria | 7700 |
| 752 | Ga0495580_0116620 | 3300046472 | Bacteria | 1855 |
| 753 | Ga0495580_0753063 | 3300046472 | Unclassified | 634 |
| 754 | Ga0495639_0048674 | 3300046475 | Bacteria | 1923 |
| 755 | Ga0495639_0396544 | 3300046475 | Bacteria | 697 |
| 756 | Ga0495607_0012605 | 3300046501 | Bacteria | 5571 |
| 757 | Ga0495606_0007530 | 3300046507 | Bacteria | 9713 |
| 758 | Ga0495610_0171972 | 3300046512 | Bacteria | 908 |
| 759 | Ga0495618_0164351 | 3300046514 | Bacteria | 1414 |
| 760 | Ga0495630_0273280 | 3300046517 | Bacteria | 1291 |
| 761 | Ga0495631_0435736 | 3300046518 | Bacteria | 558 |
| 762 | Ga0495663_0044157 | 3300046525 | Bacteria | 1363 |
| 763 | Ga0495663_0087063 | 3300046525 | Bacteria | 1013 |
| 764 | Ga0495666_0430690 | 3300046526 | Bacteria | 592 |
| 765 | Ga0495640_0311693 | 3300046533 | Bacteria | 976 |
| 766 | Ga0495587_0435094 | 3300046536 | Bacteria | 727 |
| 767 | Ga0495621_0108453 | 3300046539 | Bacteria | 1063 |
| 768 | Ga0495622_0018296 | 3300046557 | Bacteria | 3264 |
| 769 | Ga0495667_0009254 | 3300046559 | Bacteria | 6681 |
| 770 | Ga0495656_0002013 | 3300046615 | Bacteria | 6690 |
| 771 | Ga0495656_0038020 | 3300046615 | Bacteria | 1991 |
| 772 | Ga0495656_0109955 | 3300046615 | Bacteria | 1287 |
| 773 | Ga0495656_0137566 | 3300046615 | Bacteria | 1168 |
| 774 | Ga0495668_0005354 | 3300046616 | Bacteria | 8751 |
| 775 | Ga0495634_0744259 | 3300046642 | Bacteria | 561 |
| 776 | Ga0495635_0035060 | 3300046663 | Bacteria | 3479 |
| 777 | Ga0495635_0381174 | 3300046663 | Bacteria | 938 |
| 778 | Ga0495659_0062592 | 3300046664 | Bacteria | 1377 |
| 779 | Ga0495657_0266218 | 3300046675 | Bacteria | 1029 |
| 780 | Ga0495599_0110216 | 3300046678 | Bacteria | 1715 |
| 781 | Ga0495658_0001477 | 3300046683 | Bacteria | 12363 |
| 782 | Ga0495613_0083411 | 3300046689 | Bacteria | 2321 |
| 783 | Ga0495670_0530266 | 3300046691 | Bacteria | 640 |
| 784 | Ga0495649_0031421 | 3300046694 | Bacteria | 2928 |
| 785 | Ga0495600_0097240 | 3300046809 | Bacteria | 1919 |
| 786 | Ga0495600_0685630 | 3300046809 | Bacteria | 617 |
| 787 | Ga0495581_0253571 | 3300047315 | Bacteria | 1029 |
| 788 | Ga0495636_0008266 | 3300047318 | Bacteria | 4108 |
| 789 | Ga0495636_0077756 | 3300047318 | Bacteria | 1424 |
| 790 | Ga0495636_0110047 | 3300047318 | Bacteria | 1211 |
| 791 | Ga0495636_0145110 | 3300047318 | Bacteria | 1062 |
| 792 | Ga0495680_0093050 | 3300047322 | Bacteria | 2257 |
| 793 | Ga0495681_0066444 | 3300047470 | Bacteria | 1646 |
| 794 | Ga0495684_0159148 | 3300047471 | Bacteria | 1685 |
| 795 | Ga0495602_1109086 | 3300048088 | Bacteria | 518 |
| 796 | Ga0495614_0304316 | 3300048089 | Bacteria | 737 |
| 797 | Ga0496100_0263986 | 3300048903 | Bacteria | 1278 |
| 798 | Ga0496100_0404789 | 3300048903 | Bacteria | 1040 |
| 799 | Ga0496102_0171258 | 3300048905 | Bacteria | 2044 |
| 800 | Ga0496103_0137448 | 3300048906 | Bacteria | 1562 |
| 801 | Ga0496104_1128974 | 3300048907 | Unclassified | 687 |
| 802 | Ga0496106_0333427 | 3300048909 | Bacteria | 1218 |
| 803 | Ga0496106_1119555 | 3300048909 | Unclassified | 616 |
| 804 | Ga0496107_0032894 | 3300048910 | Bacteria | 3708 |
| 805 | Ga0496107_0273503 | 3300048910 | Unclassified | 1257 |
| 806 | Ga0496109_0334956 | 3300048912 | Unclassified | 1429 |
| 807 | Ga0496109_0611110 | 3300048912 | Bacteria | 1026 |
| 808 | Ga0496109_1162484 | 3300048912 | Bacteria | 708 |
| 809 | Ga0496110_0465079 | 3300048913 | Bacteria | 1152 |
| 810 | Ga0496111_0377429 | 3300048914 | Bacteria | 1048 |
| 811 | Ga0496112_0168815 | 3300048915 | Bacteria | 2154 |
| 812 | Ga0496112_1470595 | 3300048915 | Unclassified | 595 |
| 813 | Ga0496113_0131177 | 3300048916 | Bacteria | 1967 |
| 814 | Ga0496113_0242883 | 3300048916 | Unclassified | 1437 |
| 815 | Ga0496113_0347270 | 3300048916 | Bacteria | 1190 |
| 816 | Ga0496113_0440012 | 3300048916 | Bacteria | 1047 |
| 817 | Ga0496114_0150285 | 3300048917 | Bacteria | 2020 |
| 818 | Ga0496114_0236613 | 3300048917 | Bacteria | 1605 |
| 819 | Ga0496114_0450965 | 3300048917 | Bacteria | 1139 |
| 820 | Ga0496114_1339007 | 3300048917 | Unclassified | 603 |
| 821 | Ga0496115_0067756 | 3300048918 | Bacteria | 2888 |
| 822 | Ga0496115_0138692 | 3300048918 | Bacteria | 2006 |
| 823 | Ga0496118_0091958 | 3300048921 | Bacteria | 2084 |
| 824 | Ga0496119_0510875 | 3300048922 | Bacteria | 558 |
| 825 | Ga0496121_0001610 | 3300048924 | Bacteria | 37474 |
| 826 | Ga0496121_0796780 | 3300048924 | Bacteria | 556 |
| 827 | Ga0496122_0000129 | 3300048925 | Bacteria | 173688 |
| 828 | Ga0496123_0000113 | 3300048926 | Bacteria | 163689 |
| 829 | Ga0496124_0000087 | 3300048927 | Bacteria | 200697 |
| 830 | Ga0496126_0278388 | 3300048929 | Bacteria | 1386 |
| 831 | Ga0501031_0036335 | 3300049568 | Bacteria | 3213 |
| 832 | Ga0501031_0732684 | 3300049568 | Unclassified | 634 |
| 833 | Ga0501032_0000744 | 3300049569 | Bacteria | 26473 |
| 834 | Ga0501032_0293790 | 3300049569 | Bacteria | 1051 |
| 835 | Ga0501033_0010512 | 3300049570 | Bacteria | 7098 |
| 836 | Ga0501033_0041688 | 3300049570 | Bacteria | 3424 |
| 837 | Ga0501033_0663747 | 3300049570 | Unclassified | 712 |
| 838 | Ga0501034_0000996 | 3300049571 | Bacteria | 40586 |
| 839 | Ga0501034_0818257 | 3300049571 | Unclassified | 823 |
| 840 | Ga0501034_0825957 | 3300049571 | Bacteria | 818 |
| 841 | Ga0501036_0211884 | 3300049572 | Bacteria | 1628 |
| 842 | Ga0501036_0417122 | 3300049572 | Unclassified | 1119 |
| 843 | Ga0501037_0000566 | 3300049573 | Bacteria | 29217 |
| 844 | Ga0501037_0128569 | 3300049573 | Bacteria | 1817 |
| 845 | Ga0501037_0446922 | 3300049573 | Bacteria | 882 |
| 846 | Ga0501037_0913836 | 3300049573 | Bacteria | 575 |
| 847 | Ga0501038_0005436 | 3300049574 | Bacteria | 11835 |
| 848 | Ga0501038_0239412 | 3300049574 | Unclassified | 1441 |
| 849 | Ga0501039_0012430 | 3300049575 | Bacteria | 6501 |
| 850 | Ga0501041_0249794 | 3300049577 | Bacteria | 1115 |
| 851 | Ga0501042_0054064 | 3300049578 | Bacteria | 2864 |
| 852 | Ga0501042_0799553 | 3300049578 | Bacteria | 686 |
| 853 | Ga0501043_0005586 | 3300049579 | Bacteria | 10129 |
| 854 | Ga0501043_0036419 | 3300049579 | Bacteria | 3870 |
| 855 | Ga0501046_0000760 | 3300049580 | Bacteria | 31143 |
| 856 | Ga0501046_0637142 | 3300049580 | Unclassified | 754 |
| 857 | Ga0501047_0006314 | 3300049581 | Bacteria | 11147 |
| 858 | Ga0501047_0011719 | 3300049581 | Bacteria | 8290 |
| 859 | Ga0501067_0021904 | 3300049583 | Bacteria | 3536 |
| 860 | Ga0501067_0048538 | 3300049583 | Bacteria | 2354 |
| 861 | Ga0501067_0172222 | 3300049583 | Bacteria | 1206 |
| 862 | Ga0501067_0475872 | 3300049583 | Bacteria | 698 |
| 863 | Ga0501069_0233625 | 3300049585 | Bacteria | 1071 |
| 864 | Ga0501070_0049943 | 3300049586 | Bacteria | 3473 |
| 865 | Ga0501070_0099087 | 3300049586 | Bacteria | 2411 |
| 866 | Ga0501070_0317597 | 3300049586 | Bacteria | 1267 |
| 867 | Ga0501072_0917133 | 3300049588 | Unclassified | 684 |
| 868 | Ga0501073_0001389 | 3300049589 | Bacteria | 17851 |
| 869 | Ga0501073_0056916 | 3300049589 | Bacteria | 2734 |
| 870 | Ga0501073_0159142 | 3300049589 | Bacteria | 1565 |
| 871 | Ga0501074_0401451 | 3300049590 | Bacteria | 972 |
| 872 | Ga0501074_0625761 | 3300049590 | Bacteria | 761 |
| 873 | Ga0501075_0370738 | 3300049591 | Bacteria | 1091 |
| 874 | Ga0501080_0025335 | 3300049742 | Bacteria | 5503 |
| 875 | Ga0501080_0057125 | 3300049742 | Bacteria | 3634 |
| 876 | Ga0501080_0613035 | 3300049742 | Unclassified | 965 |
| 877 | Ga0501080_1019054 | 3300049742 | Unclassified | 717 |
| 878 | Ga0501080_1488475 | 3300049742 | Bacteria | 576 |
| 879 | Ga0501081_0522065 | 3300049743 | Bacteria | 886 |
| 880 | Ga0501083_0031915 | 3300049744 | Bacteria | 3613 |
| 881 | Ga0501083_0043356 | 3300049744 | Bacteria | 3048 |
| 882 | Ga0501035_0003276 | 3300049822 | Bacteria | 15521 |
| 883 | Ga0501035_0098367 | 3300049822 | Bacteria | 2569 |
| 884 | Ga0501035_0430651 | 3300049822 | Bacteria | 1094 |
| 885 | Ga0501035_0439014 | 3300049822 | Unclassified | 1081 |
| 886 | Ga0501044_0002882 | 3300049823 | Bacteria | 19574 |
| 887 | Ga0501044_0078688 | 3300049823 | Bacteria | 3341 |
| 888 | Ga0501044_0114381 | 3300049823 | Bacteria | 2704 |
| 889 | Ga0501044_1343055 | 3300049823 | Bacteria | 581 |
| 890 | Ga0501045_1373544 | 3300049824 | Bacteria | 513 |
| 891 | nmdc:mga05p37_1711270_c1 | 3300050507 | Unclassified | 612 |
| 892 | nmdc:mga05p37_1812620_c1 | 3300050507 | Unclassified | 588 |
| 893 | nmdc:mga06r32_680441_c1 | 3300050510 | Bacteria | 995 |
| 894 | nmdc:mga08y16_1796630_c1 | 3300050511 | Unclassified | 566 |
| 895 | nmdc:mga0n895_448882_c1 | 3300050512 | Bacteria | 1302 |
| 896 | nmdc:mga0n895_45227_c1 | 3300050512 | Bacteria | 4295 |
| 897 | nmdc:mga0n895_585594_c1 | 3300050512 | Bacteria | 1119 |
| 898 | nmdc:mga08x19_346191_c1 | 3300050514 | Bacteria | 1037 |
| 899 | nmdc:mga0a205_461333_c1 | 3300050515 | Unclassified | 1130 |
| 900 | Ga0500610_0000046 | 3300053079 | Bacteria | 40326 |
| 901 | Ga0495595_0003973 | 3300053084 | Bacteria | 5911 |
| 902 | Ga0495619_0018647 | 3300053085 | Bacteria | 4403 |
| 903 | Ga0495619_0697976 | 3300053085 | Bacteria | 690 |
| 904 | Ga0500643_003031 | 3300053087 | Bacteria | 8293 |
| 905 | Ga0500651_0009526 | 3300053093 | Bacteria | 5779 |
| 906 | Ga0500651_0041050 | 3300053093 | Bacteria | 2916 |
| 907 | Ga0500566_0529443 | 3300053094 | Bacteria | 503 |
| 908 | Ga0500650_0124619 | 3300053098 | Bacteria | 1200 |
| 909 | Ga0500597_000072 | 3300053120 | Bacteria | 20645 |
| 910 | Ga0500628_065716 | 3300053129 | Bacteria | 897 |
| 911 | Ga0500642_0000303 | 3300053130 | Bacteria | 17604 |
| 912 | Ga0500559_0316360 | 3300053136 | Bacteria | 732 |
| 913 | Ga0500568_0002451 | 3300053139 | Bacteria | 10904 |
| 914 | Ga0500588_0214602 | 3300053146 | Bacteria | 716 |
| 915 | Ga0500620_116810 | 3300053155 | Bacteria | 935 |
| 916 | Ga0500587_038486 | 3300053739 | Bacteria | 678 |
| 917 | Ga0501084_1856192 | 3300054114 | Bacteria | 503 |
| 918 | Ga0501082_0062155 | 3300060353 | Bacteria | 3214 |
| 919 | Ga0501082_0105172 | 3300060353 | Bacteria | 2442 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003794 | Ga0055531_10115363 | Ga0055531_101153632 | 81 |
| 2 | 3300039450 | Ga0436363_0490290 | Ga0436363_0490290_536_796 | 85 |
| 3 | 3300014969 | Ga0157376_11774472 | Ga0157376_117744722 | 86 |
| 4 | 3300046517 | Ga0495630_0273280 | Ga0495630_0273280_579_839 | 86 |
| 5 | 3300046557 | Ga0495622_0018296 | Ga0495622_0018296_1637_1897 | 86 |
| 6 | 3300049568 | Ga0501031_0732684 | Ga0501031_0732684_35_298 | 86 |
| 7 | 3300049570 | Ga0501033_0663747 | Ga0501033_0663747_412_675 | 86 |
| 8 | 3300049571 | Ga0501034_0818257 | Ga0501034_0818257_61_324 | 86 |
| 9 | 3300049574 | Ga0501038_0239412 | Ga0501038_0239412_656_919 | 86 |
| 10 | 3300049586 | Ga0501070_0099087 | Ga0501070_0099087_33_296 | 86 |
| 11 | 3300049742 | Ga0501080_0613035 | Ga0501080_0613035_123_386 | 86 |
| 12 | 3300049822 | Ga0501035_0430651 | Ga0501035_0430651_624_887 | 86 |
| 13 | 3300049823 | Ga0501044_0114381 | Ga0501044_0114381_786_1049 | 86 |
| 14 | 3300053139 | Ga0500568_0002451 | Ga0500568_0002451_6564_6824 | 86 |
| 15 | 3300005367 | Ga0070667_100052306 | Ga0070667_1000523062 | 87 |
| 16 | 3300005548 | Ga0070665_100128608 | Ga0070665_1001286083 | 87 |
| 17 | 3300005841 | Ga0068863_100174482 | Ga0068863_1001744823 | 87 |
| 18 | 3300006237 | Ga0097621_100518809 | Ga0097621_1005188093 | 87 |
| 19 | 3300006358 | Ga0068871_100225067 | Ga0068871_1002250672 | 87 |
| 20 | 3300013307 | Ga0157372_11311132 | Ga0157372_113111321 | 87 |
| 21 | 3300025986 | Ga0207658_10320566 | Ga0207658_103205662 | 87 |
| 22 | 3300028379 | Ga0268266_10311356 | Ga0268266_103113562 | 87 |
| 23 | 3300053129 | Ga0500628_065716 | Ga0500628_065716_614_877 | 87 |
| 24 | 3300005328 | Ga0070676_10181383 | Ga0070676_101813832 | 88 |
| 25 | 3300005334 | Ga0068869_101780048 | Ga0068869_1017800482 | 88 |
| 26 | 3300005337 | Ga0070682_100502539 | Ga0070682_1005025393 | 88 |
| 27 | 3300005344 | Ga0070661_101200093 | Ga0070661_1012000932 | 88 |
| 28 | 3300005366 | Ga0070659_100598975 | Ga0070659_1005989752 | 88 |
| 29 | 3300005367 | Ga0070667_100132984 | Ga0070667_1001329843 | 88 |
| 30 | 3300005440 | Ga0070705_100141600 | Ga0070705_1001416002 | 88 |
| 31 | 3300005444 | Ga0070694_100263966 | Ga0070694_1002639662 | 88 |
| 32 | 3300005539 | Ga0068853_100005942 | Ga0068853_1000059424 | 88 |
| 33 | 3300005539 | Ga0068853_100153411 | Ga0068853_1001534113 | 88 |
| 34 | 3300005548 | Ga0070665_100464002 | Ga0070665_1004640022 | 88 |
| 35 | 3300005549 | Ga0070704_100319082 | Ga0070704_1003190822 | 88 |
| 36 | 3300005563 | Ga0068855_100085911 | Ga0068855_1000859113 | 88 |
| 37 | 3300005577 | Ga0068857_100034950 | Ga0068857_1000349502 | 88 |
| 38 | 3300005834 | Ga0068851_10660391 | Ga0068851_106603912 | 88 |
| 39 | 3300006237 | Ga0097621_101332575 | Ga0097621_1013325752 | 88 |
| 40 | 3300010375 | Ga0105239_11764085 | Ga0105239_117640852 | 88 |
| 41 | 3300013104 | Ga0157370_11918075 | Ga0157370_119180752 | 88 |
| 42 | 3300014969 | Ga0157376_11182073 | Ga0157376_111820732 | 88 |
| 43 | 3300025303 | Ga0209051_1020949 | Ga0209051_10209492 | 88 |
| 44 | 3300025914 | Ga0207671_10645067 | Ga0207671_106450672 | 88 |
| 45 | 3300025920 | Ga0207649_11182276 | Ga0207649_111822761 | 88 |
| 46 | 3300025933 | Ga0207706_10938473 | Ga0207706_109384732 | 88 |
| 47 | 3300025949 | Ga0207667_10266294 | Ga0207667_102662942 | 88 |
| 48 | 3300025986 | Ga0207658_11496056 | Ga0207658_114960562 | 88 |
| 49 | 3300026041 | Ga0207639_10001611 | Ga0207639_1000161111 | 88 |
| 50 | 3300026041 | Ga0207639_10185697 | Ga0207639_101856973 | 88 |
| 51 | 3300026116 | Ga0207674_10132242 | Ga0207674_101322422 | 88 |
| 52 | 3300026121 | Ga0207683_10348892 | Ga0207683_103488922 | 88 |
| 53 | 3300028379 | Ga0268266_11142432 | Ga0268266_111424323 | 88 |
| 54 | 3300037418 | Ga0395900_1097608 | Ga0395900_1097608_185_487 | 88 |
| 55 | 3300041512 | Ga0451853_1273233 | Ga0451853_1273233_305_571 | 88 |
| 56 | 3300046501 | Ga0495607_0012605 | Ga0495607_0012605_2995_3267 | 88 |
| 57 | 3300046507 | Ga0495606_0007530 | Ga0495606_0007530_3619_3891 | 88 |
| 58 | 3300046512 | Ga0495610_0171972 | Ga0495610_0171972_523_795 | 88 |
| 59 | 3300046518 | Ga0495631_0435736 | Ga0495631_0435736_36_308 | 88 |
| 60 | 3300047470 | Ga0495681_0066444 | Ga0495681_0066444_607_879 | 88 |
| 61 | 3300048927 | Ga0496124_0000087 | Ga0496124_0000087_48906_49178 | 88 |
| 62 | 3300049568 | Ga0501031_0036335 | Ga0501031_0036335_843_1112 | 88 |
| 63 | 3300049569 | Ga0501032_0000744 | Ga0501032_0000744_18192_18461 | 88 |
| 64 | 3300049570 | Ga0501033_0010512 | Ga0501033_0010512_4971_5240 | 88 |
| 65 | 3300049571 | Ga0501034_0000996 | Ga0501034_0000996_28634_28903 | 88 |
| 66 | 3300049573 | Ga0501037_0000566 | Ga0501037_0000566_2891_3160 | 88 |
| 67 | 3300049574 | Ga0501038_0005436 | Ga0501038_0005436_6194_6463 | 88 |
| 68 | 3300049575 | Ga0501039_0012430 | Ga0501039_0012430_3792_4061 | 88 |
| 69 | 3300049579 | Ga0501043_0005586 | Ga0501043_0005586_5744_6013 | 88 |
| 70 | 3300049580 | Ga0501046_0000760 | Ga0501046_0000760_17380_17649 | 88 |
| 71 | 3300049581 | Ga0501047_0006314 | Ga0501047_0006314_3641_3910 | 88 |
| 72 | 3300049583 | Ga0501067_0048538 | Ga0501067_0048538_419_688 | 88 |
| 73 | 3300049583 | Ga0501067_0172222 | Ga0501067_0172222_577_879 | 88 |
| 74 | 3300049586 | Ga0501070_0317597 | Ga0501070_0317597_741_1010 | 88 |
| 75 | 3300049589 | Ga0501073_0001389 | Ga0501073_0001389_10474_10743 | 88 |
| 76 | 3300049742 | Ga0501080_0025335 | Ga0501080_0025335_3018_3287 | 88 |
| 77 | 3300049822 | Ga0501035_0003276 | Ga0501035_0003276_3641_3910 | 88 |
| 78 | 3300049823 | Ga0501044_0002882 | Ga0501044_0002882_13927_14196 | 88 |
| 79 | 3300053093 | Ga0500651_0041050 | Ga0500651_0041050_831_1100 | 88 |
| 80 | iso_pu_bacteria | 2842780639 | 2842783777 | 88 |
| 81 | iso_pu_bacteria | 2995948881 | 2995951457 | 88 |
| 82 | 3300003659 | JGI25404J52841_10096897 | JGI25404J52841_100968972 | 89 |
| 83 | 3300005328 | Ga0070676_10339093 | Ga0070676_103390932 | 89 |
| 84 | 3300005331 | Ga0070670_100207331 | Ga0070670_1002073312 | 89 |
| 85 | 3300005337 | Ga0070682_100362873 | Ga0070682_1003628732 | 89 |
| 86 | 3300005338 | Ga0068868_100056640 | Ga0068868_1000566403 | 89 |
| 87 | 3300005344 | Ga0070661_100237090 | Ga0070661_1002370902 | 89 |
| 88 | 3300005347 | Ga0070668_100008453 | Ga0070668_1000084533 | 89 |
| 89 | 3300005355 | Ga0070671_100179990 | Ga0070671_1001799902 | 89 |
| 90 | 3300005355 | Ga0070671_101325191 | Ga0070671_1013251912 | 89 |
| 91 | 3300005364 | Ga0070673_100271217 | Ga0070673_1002712172 | 89 |
| 92 | 3300005366 | Ga0070659_101198431 | Ga0070659_1011984312 | 89 |
| 93 | 3300005367 | Ga0070667_100000173 | Ga0070667_10000017360 | 89 |
| 94 | 3300005367 | Ga0070667_100017183 | Ga0070667_1000171832 | 89 |
| 95 | 3300005367 | Ga0070667_100048047 | Ga0070667_1000480472 | 89 |
| 96 | 3300005367 | Ga0070667_100055945 | Ga0070667_1000559453 | 89 |
| 97 | 3300005367 | Ga0070667_100612645 | Ga0070667_1006126452 | 89 |
| 98 | 3300005439 | Ga0070711_100160109 | Ga0070711_1001601093 | 89 |
| 99 | 3300005455 | Ga0070663_100000433 | Ga0070663_1000004333 | 89 |
| 100 | 3300005455 | Ga0070663_100014214 | Ga0070663_1000142145 | 89 |
| 101 | 3300005455 | Ga0070663_100129903 | Ga0070663_1001299032 | 89 |
| 102 | 3300005457 | Ga0070662_100497703 | Ga0070662_1004977032 | 89 |
| 103 | 3300005466 | Ga0070685_10625954 | Ga0070685_106259542 | 89 |
| 104 | 3300005539 | Ga0068853_100000439 | Ga0068853_10000043921 | 89 |
| 105 | 3300005539 | Ga0068853_100010569 | Ga0068853_1000105694 | 89 |
| 106 | 3300005539 | Ga0068853_100135486 | Ga0068853_1001354864 | 89 |
| 107 | 3300005539 | Ga0068853_101622285 | Ga0068853_1016222852 | 89 |
| 108 | 3300005547 | Ga0070693_100017460 | Ga0070693_1000174603 | 89 |
| 109 | 3300005548 | Ga0070665_100000095 | Ga0070665_100000095121 | 89 |
| 110 | 3300005548 | Ga0070665_100054241 | Ga0070665_1000542412 | 89 |
| 111 | 3300005548 | Ga0070665_100156522 | Ga0070665_1001565222 | 89 |
| 112 | 3300005548 | Ga0070665_100525843 | Ga0070665_1005258432 | 89 |
| 113 | 3300005548 | Ga0070665_100957931 | Ga0070665_1009579312 | 89 |
| 114 | 3300005548 | Ga0070665_101076593 | Ga0070665_1010765932 | 89 |
| 115 | 3300005563 | Ga0068855_100036896 | Ga0068855_1000368964 | 89 |
| 116 | 3300005563 | Ga0068855_100194707 | Ga0068855_1001947073 | 89 |
| 117 | 3300005564 | Ga0070664_100142038 | Ga0070664_1001420382 | 89 |
| 118 | 3300005577 | Ga0068857_100113654 | Ga0068857_1001136543 | 89 |
| 119 | 3300005577 | Ga0068857_100961573 | Ga0068857_1009615732 | 89 |
| 120 | 3300005578 | Ga0068854_100075717 | Ga0068854_1000757173 | 89 |
| 121 | 3300005614 | Ga0068856_100127697 | Ga0068856_1001276974 | 89 |
| 122 | 3300005616 | Ga0068852_100030374 | Ga0068852_1000303742 | 89 |
| 123 | 3300005616 | Ga0068852_100242176 | Ga0068852_1002421762 | 89 |
| 124 | 3300005616 | Ga0068852_100526428 | Ga0068852_1005264281 | 89 |
| 125 | 3300005617 | Ga0068859_100000208 | Ga0068859_10000020821 | 89 |
| 126 | 3300005618 | Ga0068864_100051778 | Ga0068864_1000517783 | 89 |
| 127 | 3300005834 | Ga0068851_10033622 | Ga0068851_100336223 | 89 |
| 128 | 3300005834 | Ga0068851_10489660 | Ga0068851_104896601 | 89 |
| 129 | 3300005841 | Ga0068863_100041995 | Ga0068863_1000419952 | 89 |
| 130 | 3300005841 | Ga0068863_100045063 | Ga0068863_1000450632 | 89 |
| 131 | 3300005841 | Ga0068863_100229478 | Ga0068863_1002294782 | 89 |
| 132 | 3300005842 | Ga0068858_100061350 | Ga0068858_1000613503 | 89 |
| 133 | 3300005842 | Ga0068858_100272811 | Ga0068858_1002728113 | 89 |
| 134 | 3300005842 | Ga0068858_100506949 | Ga0068858_1005069492 | 89 |
| 135 | 3300005843 | Ga0068860_100098728 | Ga0068860_1000987282 | 89 |
| 136 | 3300005843 | Ga0068860_100333468 | Ga0068860_1003334682 | 89 |
| 137 | 3300005843 | Ga0068860_102474719 | Ga0068860_1024747192 | 89 |
| 138 | 3300005844 | Ga0068862_100000404 | Ga0068862_10000040434 | 89 |
| 139 | 3300005983 | Ga0081540_1003155 | Ga0081540_10031555 | 89 |
| 140 | 3300006163 | Ga0070715_10089056 | Ga0070715_100890562 | 89 |
| 141 | 3300006173 | Ga0070716_100559142 | Ga0070716_1005591422 | 89 |
| 142 | 3300006175 | Ga0070712_100299588 | Ga0070712_1002995883 | 89 |
| 143 | 3300006237 | Ga0097621_100018815 | Ga0097621_1000188152 | 89 |
| 144 | 3300006237 | Ga0097621_100418811 | Ga0097621_1004188112 | 89 |
| 145 | 3300006358 | Ga0068871_100070200 | Ga0068871_1000702002 | 89 |
| 146 | 3300006358 | Ga0068871_100123937 | Ga0068871_1001239373 | 89 |
| 147 | 3300006358 | Ga0068871_100396982 | Ga0068871_1003969822 | 89 |
| 148 | 3300006358 | Ga0068871_100610694 | Ga0068871_1006106942 | 89 |
| 149 | 3300006358 | Ga0068871_101011180 | Ga0068871_1010111802 | 89 |
| 150 | 3300006881 | Ga0068865_100041404 | Ga0068865_1000414043 | 89 |
| 151 | 3300006881 | Ga0068865_101082937 | Ga0068865_1010829372 | 89 |
| 152 | 3300006931 | Ga0097620_100000208 | Ga0097620_10000020821 | 89 |
| 153 | 3300009093 | Ga0105240_10678366 | Ga0105240_106783662 | 89 |
| 154 | 3300009093 | Ga0105240_11605755 | Ga0105240_116057552 | 89 |
| 155 | 3300009093 | Ga0105240_11614880 | Ga0105240_116148802 | 89 |
| 156 | 3300009093 | Ga0105240_11646486 | Ga0105240_116464861 | 89 |
| 157 | 3300009101 | Ga0105247_10098662 | Ga0105247_100986622 | 89 |
| 158 | 3300009101 | Ga0105247_10163352 | Ga0105247_101633522 | 89 |
| 159 | 3300009101 | Ga0105247_10197065 | Ga0105247_101970652 | 89 |
| 160 | 3300009174 | Ga0105241_10081236 | Ga0105241_100812363 | 89 |
| 161 | 3300009174 | Ga0105241_12227509 | Ga0105241_122275092 | 89 |
| 162 | 3300009177 | Ga0105248_10014943 | Ga0105248_100149434 | 89 |
| 163 | 3300009177 | Ga0105248_10769117 | Ga0105248_107691172 | 89 |
| 164 | 3300009545 | Ga0105237_10000345 | Ga0105237_1000034552 | 89 |
| 165 | 3300009545 | Ga0105237_10130044 | Ga0105237_101300442 | 89 |
| 166 | 3300009545 | Ga0105237_10238678 | Ga0105237_102386782 | 89 |
| 167 | 3300009545 | Ga0105237_10899297 | Ga0105237_108992972 | 89 |
| 168 | 3300009551 | Ga0105238_10168057 | Ga0105238_101680573 | 89 |
| 169 | 3300009551 | Ga0105238_10636547 | Ga0105238_106365472 | 89 |
| 170 | 3300009553 | Ga0105249_10000175 | Ga0105249_1000017559 | 89 |
| 171 | 3300009553 | Ga0105249_10081967 | Ga0105249_100819674 | 89 |
| 172 | 3300010375 | Ga0105239_10039913 | Ga0105239_100399136 | 89 |
| 173 | 3300010375 | Ga0105239_10149926 | Ga0105239_101499263 | 89 |
| 174 | 3300010375 | Ga0105239_10297387 | Ga0105239_102973872 | 89 |
| 175 | 3300010375 | Ga0105239_10596883 | Ga0105239_105968832 | 89 |
| 176 | 3300013104 | Ga0157370_10188888 | Ga0157370_101888883 | 89 |
| 177 | 3300013296 | Ga0157374_10273908 | Ga0157374_102739082 | 89 |
| 178 | 3300014325 | Ga0163163_10101601 | Ga0163163_101016013 | 89 |
| 179 | 3300014968 | Ga0157379_10170217 | Ga0157379_101702172 | 89 |
| 180 | 3300014969 | Ga0157376_10084090 | Ga0157376_100840902 | 89 |
| 181 | 3300014969 | Ga0157376_10414173 | Ga0157376_104141733 | 89 |
| 182 | 3300014969 | Ga0157376_11094635 | Ga0157376_110946352 | 89 |
| 183 | 3300025321 | Ga0207656_10009164 | Ga0207656_100091643 | 89 |
| 184 | 3300025321 | Ga0207656_10228075 | Ga0207656_102280752 | 89 |
| 185 | 3300025900 | Ga0207710_10084666 | Ga0207710_100846662 | 89 |
| 186 | 3300025906 | Ga0207699_10810142 | Ga0207699_108101422 | 89 |
| 187 | 3300025913 | Ga0207695_10549144 | Ga0207695_105491442 | 89 |
| 188 | 3300025914 | Ga0207671_10004444 | Ga0207671_100044443 | 89 |
| 189 | 3300025914 | Ga0207671_10099792 | Ga0207671_100997922 | 89 |
| 190 | 3300025914 | Ga0207671_10687372 | Ga0207671_106873722 | 89 |
| 191 | 3300025914 | Ga0207671_11574412 | Ga0207671_115744122 | 89 |
| 192 | 3300025915 | Ga0207693_10215801 | Ga0207693_102158012 | 89 |
| 193 | 3300025916 | Ga0207663_10085751 | Ga0207663_100857513 | 89 |
| 194 | 3300025920 | Ga0207649_10102980 | Ga0207649_101029802 | 89 |
| 195 | 3300025925 | Ga0207650_10285722 | Ga0207650_102857223 | 89 |
| 196 | 3300025931 | Ga0207644_10048611 | Ga0207644_100486113 | 89 |
| 197 | 3300025933 | Ga0207706_11186360 | Ga0207706_111863602 | 89 |
| 198 | 3300025937 | Ga0207669_10859723 | Ga0207669_108597232 | 89 |
| 199 | 3300025938 | Ga0207704_10157541 | Ga0207704_101575412 | 89 |
| 200 | 3300025938 | Ga0207704_10813533 | Ga0207704_108135332 | 89 |
| 201 | 3300025938 | Ga0207704_11881460 | Ga0207704_118814602 | 89 |
| 202 | 3300025941 | Ga0207711_10009640 | Ga0207711_100096405 | 89 |
| 203 | 3300025941 | Ga0207711_10565622 | Ga0207711_105656222 | 89 |
| 204 | 3300025945 | Ga0207679_10039975 | Ga0207679_100399752 | 89 |
| 205 | 3300025949 | Ga0207667_10006332 | Ga0207667_100063322 | 89 |
| 206 | 3300025949 | Ga0207667_10131666 | Ga0207667_101316662 | 89 |
| 207 | 3300025960 | Ga0207651_10313055 | Ga0207651_103130552 | 89 |
| 208 | 3300025961 | Ga0207712_10000600 | Ga0207712_1000060021 | 89 |
| 209 | 3300025961 | Ga0207712_10052758 | Ga0207712_100527582 | 89 |
| 210 | 3300025972 | Ga0207668_10229935 | Ga0207668_102299352 | 89 |
| 211 | 3300025972 | Ga0207668_11369459 | Ga0207668_113694592 | 89 |
| 212 | 3300025981 | Ga0207640_10460561 | Ga0207640_104605612 | 89 |
| 213 | 3300025986 | Ga0207658_10000111 | Ga0207658_1000011178 | 89 |
| 214 | 3300025986 | Ga0207658_10062060 | Ga0207658_100620602 | 89 |
| 215 | 3300025986 | Ga0207658_10089670 | Ga0207658_100896703 | 89 |
| 216 | 3300026023 | Ga0207677_10340151 | Ga0207677_103401513 | 89 |
| 217 | 3300026035 | Ga0207703_10208235 | Ga0207703_102082352 | 89 |
| 218 | 3300026035 | Ga0207703_10230212 | Ga0207703_102302122 | 89 |
| 219 | 3300026035 | Ga0207703_10450206 | Ga0207703_104502062 | 89 |
| 220 | 3300026041 | Ga0207639_10000299 | Ga0207639_100002996 | 89 |
| 221 | 3300026041 | Ga0207639_10010017 | Ga0207639_100100173 | 89 |
| 222 | 3300026041 | Ga0207639_10168920 | Ga0207639_101689203 | 89 |
| 223 | 3300026041 | Ga0207639_11940880 | Ga0207639_119408801 | 89 |
| 224 | 3300026067 | Ga0207678_10007436 | Ga0207678_100074369 | 89 |
| 225 | 3300026067 | Ga0207678_10023314 | Ga0207678_100233145 | 89 |
| 226 | 3300026067 | Ga0207678_10269755 | Ga0207678_102697552 | 89 |
| 227 | 3300026067 | Ga0207678_10889966 | Ga0207678_108899662 | 89 |
| 228 | 3300026078 | Ga0207702_10077091 | Ga0207702_100770913 | 89 |
| 229 | 3300026088 | Ga0207641_10020120 | Ga0207641_100201201 | 89 |
| 230 | 3300026088 | Ga0207641_10236092 | Ga0207641_102360922 | 89 |
| 231 | 3300026116 | Ga0207674_10169796 | Ga0207674_101697963 | 89 |
| 232 | 3300026116 | Ga0207674_10813223 | Ga0207674_108132232 | 89 |
| 233 | 3300026142 | Ga0207698_10254372 | Ga0207698_102543722 | 89 |
| 234 | 3300026142 | Ga0207698_10270916 | Ga0207698_102709162 | 89 |
| 235 | 3300026142 | Ga0207698_10465878 | Ga0207698_104658781 | 89 |
| 236 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012241 | 89 |
| 237 | 3300028379 | Ga0268266_10051541 | Ga0268266_100515415 | 89 |
| 238 | 3300028379 | Ga0268266_10096944 | Ga0268266_100969443 | 89 |
| 239 | 3300028379 | Ga0268266_10380540 | Ga0268266_103805402 | 89 |
| 240 | 3300028379 | Ga0268266_10730856 | Ga0268266_107308562 | 89 |
| 241 | 3300028380 | Ga0268265_10000297 | Ga0268265_1000029710 | 89 |
| 242 | 3300028381 | Ga0268264_10138355 | Ga0268264_101383552 | 89 |
| 243 | 3300028381 | Ga0268264_12131582 | Ga0268264_121315822 | 89 |
| 244 | 3300028381 | Ga0268264_12347717 | Ga0268264_123477172 | 89 |
| 245 | 3300028786 | Ga0307517_10190704 | Ga0307517_101907043 | 89 |
| 246 | 3300031728 | Ga0316578_10321009 | Ga0316578_103210091 | 89 |
| 247 | 3300032137 | Ga0316585_10128453 | Ga0316585_101284531 | 89 |
| 248 | 3300034820 | Ga0373959_0035781 | Ga0373959_0035781_533_805 | 89 |
| 249 | 3300035398 | Ga0316574_0122530 | Ga0316574_0122530_445_723 | 89 |
| 250 | 3300036712 | Ga0316584_0027103 | Ga0316584_0027103_1419_1697 | 89 |
| 251 | 3300041452 | Ga0451793_1900517 | Ga0451793_1900517_984_1256 | 89 |
| 252 | 3300041460 | Ga0451802_0495449 | Ga0451802_0495449_1971_2243 | 89 |
| 253 | 3300041463 | Ga0451804_0303647 | Ga0451804_0303647_5968_6240 | 89 |
| 254 | 3300041486 | Ga0451807_2708043 | Ga0451807_2708043_126_398 | 89 |
| 255 | 3300041492 | Ga0451835_0754127 | Ga0451835_0754127_30_302 | 89 |
| 256 | 3300041496 | Ga0451839_0883414 | Ga0451839_0883414_504_776 | 89 |
| 257 | 3300041501 | Ga0451845_0363449 | Ga0451845_0363449_129_401 | 89 |
| 258 | 3300041503 | Ga0451847_0290674 | Ga0451847_0290674_58_330 | 89 |
| 259 | 3300041505 | Ga0451849_1561108 | Ga0451849_1561108_690_962 | 89 |
| 260 | 3300046694 | Ga0495649_0031421 | Ga0495649_0031421_2218_2490 | 89 |
| 261 | 3300048917 | Ga0496114_0150285 | Ga0496114_0150285_288_560 | 89 |
| 262 | 3300048917 | Ga0496114_0450965 | Ga0496114_0450965_845_1117 | 89 |
| 263 | 3300048918 | Ga0496115_0067756 | Ga0496115_0067756_547_819 | 89 |
| 264 | 3300048918 | Ga0496115_0138692 | Ga0496115_0138692_656_928 | 89 |
| 265 | 3300048921 | Ga0496118_0091958 | Ga0496118_0091958_245_517 | 89 |
| 266 | 3300048922 | Ga0496119_0510875 | Ga0496119_0510875_230_502 | 89 |
| 267 | 3300048924 | Ga0496121_0796780 | Ga0496121_0796780_218_490 | 89 |
| 268 | 3300048925 | Ga0496122_0000129 | Ga0496122_0000129_89492_89764 | 89 |
| 269 | 3300048926 | Ga0496123_0000113 | Ga0496123_0000113_114364_114636 | 89 |
| 270 | 3300048929 | Ga0496126_0278388 | Ga0496126_0278388_906_1178 | 89 |
| 271 | 3300053087 | Ga0500643_003031 | Ga0500643_003031_2071_2343 | 89 |
| 272 | 3300053093 | Ga0500651_0009526 | Ga0500651_0009526_3786_4058 | 89 |
| 273 | 3300053120 | Ga0500597_000072 | Ga0500597_000072_4270_4542 | 89 |
| 274 | 3300053136 | Ga0500559_0316360 | Ga0500559_0316360_49_321 | 89 |
| 275 | 3300053155 | Ga0500620_116810 | Ga0500620_116810_178_450 | 89 |
| 276 | 3300005328 | Ga0070676_10195936 | Ga0070676_101959363 | 90 |
| 277 | 3300005331 | Ga0070670_100070578 | Ga0070670_1000705782 | 90 |
| 278 | 3300005334 | Ga0068869_100392280 | Ga0068869_1003922802 | 90 |
| 279 | 3300005335 | Ga0070666_10131108 | Ga0070666_101311082 | 90 |
| 280 | 3300005338 | Ga0068868_101608795 | Ga0068868_1016087952 | 90 |
| 281 | 3300005347 | Ga0070668_100047303 | Ga0070668_1000473032 | 90 |
| 282 | 3300005353 | Ga0070669_101434804 | Ga0070669_1014348042 | 90 |
| 283 | 3300005354 | Ga0070675_102183818 | Ga0070675_1021838182 | 90 |
| 284 | 3300005355 | Ga0070671_100085319 | Ga0070671_1000853193 | 90 |
| 285 | 3300005364 | Ga0070673_100078330 | Ga0070673_1000783303 | 90 |
| 286 | 3300005364 | Ga0070673_101326571 | Ga0070673_1013265712 | 90 |
| 287 | 3300005367 | Ga0070667_100102632 | Ga0070667_1001026322 | 90 |
| 288 | 3300005367 | Ga0070667_100300972 | Ga0070667_1003009723 | 90 |
| 289 | 3300005455 | Ga0070663_100611226 | Ga0070663_1006112262 | 90 |
| 290 | 3300005459 | Ga0068867_100044082 | Ga0068867_1000440823 | 90 |
| 291 | 3300005539 | Ga0068853_100609914 | Ga0068853_1006099142 | 90 |
| 292 | 3300005548 | Ga0070665_100297443 | Ga0070665_1002974433 | 90 |
| 293 | 3300005563 | Ga0068855_102319541 | Ga0068855_1023195412 | 90 |
| 294 | 3300005578 | Ga0068854_100144807 | Ga0068854_1001448073 | 90 |
| 295 | 3300005615 | Ga0070702_101490716 | Ga0070702_1014907162 | 90 |
| 296 | 3300005617 | Ga0068859_101527167 | Ga0068859_1015271672 | 90 |
| 297 | 3300005618 | Ga0068864_100140661 | Ga0068864_1001406612 | 90 |
| 298 | 3300005618 | Ga0068864_100346407 | Ga0068864_1003464072 | 90 |
| 299 | 3300005618 | Ga0068864_100732979 | Ga0068864_1007329792 | 90 |
| 300 | 3300005841 | Ga0068863_100012962 | Ga0068863_1000129627 | 90 |
| 301 | 3300005841 | Ga0068863_100232198 | Ga0068863_1002321982 | 90 |
| 302 | 3300005843 | Ga0068860_100075425 | Ga0068860_1000754253 | 90 |
| 303 | 3300005843 | Ga0068860_100099406 | Ga0068860_1000994062 | 90 |
| 304 | 3300005843 | Ga0068860_100296464 | Ga0068860_1002964642 | 90 |
| 305 | 3300005844 | Ga0068862_100077359 | Ga0068862_1000773595 | 90 |
| 306 | 3300005844 | Ga0068862_100825142 | Ga0068862_1008251422 | 90 |
| 307 | 3300005937 | Ga0081455_10071898 | Ga0081455_100718985 | 90 |
| 308 | 3300006358 | Ga0068871_101322480 | Ga0068871_1013224802 | 90 |
| 309 | 3300006931 | Ga0097620_101527819 | Ga0097620_1015278192 | 90 |
| 310 | 3300009101 | Ga0105247_10966186 | Ga0105247_109661863 | 90 |
| 311 | 3300009177 | Ga0105248_11341816 | Ga0105248_113418162 | 90 |
| 312 | 3300009553 | Ga0105249_10289196 | Ga0105249_102891962 | 90 |
| 313 | 3300009553 | Ga0105249_10356280 | Ga0105249_103562803 | 90 |
| 314 | 3300011119 | Ga0105246_10095948 | Ga0105246_100959483 | 90 |
| 315 | 3300011119 | Ga0105246_10716904 | Ga0105246_107169042 | 90 |
| 316 | 3300012495 | Ga0157323_1001558 | Ga0157323_10015582 | 90 |
| 317 | 3300012512 | Ga0157327_1036838 | Ga0157327_10368381 | 90 |
| 318 | 3300013306 | Ga0163162_10722162 | Ga0163162_107221623 | 90 |
| 319 | 3300013306 | Ga0163162_11351097 | Ga0163162_113510972 | 90 |
| 320 | 3300013308 | Ga0157375_10477090 | Ga0157375_104770903 | 90 |
| 321 | 3300014325 | Ga0163163_10023588 | Ga0163163_100235888 | 90 |
| 322 | 3300014968 | Ga0157379_10000992 | Ga0157379_100009927 | 90 |
| 323 | 3300014969 | Ga0157376_10177852 | Ga0157376_101778522 | 90 |
| 324 | 3300025315 | Ga0207697_10139986 | Ga0207697_101399862 | 90 |
| 325 | 3300025907 | Ga0207645_10012768 | Ga0207645_100127683 | 90 |
| 326 | 3300025918 | Ga0207662_10441258 | Ga0207662_104412582 | 90 |
| 327 | 3300025931 | Ga0207644_10263850 | Ga0207644_102638502 | 90 |
| 328 | 3300025938 | Ga0207704_10431662 | Ga0207704_104316622 | 90 |
| 329 | 3300025941 | Ga0207711_12012592 | Ga0207711_120125922 | 90 |
| 330 | 3300025942 | Ga0207689_10299558 | Ga0207689_102995582 | 90 |
| 331 | 3300025972 | Ga0207668_11262375 | Ga0207668_112623752 | 90 |
| 332 | 3300025986 | Ga0207658_11973337 | Ga0207658_119733371 | 90 |
| 333 | 3300026023 | Ga0207677_11066871 | Ga0207677_110668712 | 90 |
| 334 | 3300026088 | Ga0207641_10078111 | Ga0207641_100781114 | 90 |
| 335 | 3300026088 | Ga0207641_10140048 | Ga0207641_101400484 | 90 |
| 336 | 3300026088 | Ga0207641_11684894 | Ga0207641_116848942 | 90 |
| 337 | 3300026089 | Ga0207648_10029496 | Ga0207648_100294964 | 90 |
| 338 | 3300026095 | Ga0207676_10004118 | Ga0207676_100041189 | 90 |
| 339 | 3300026095 | Ga0207676_10026736 | Ga0207676_100267362 | 90 |
| 340 | 3300026095 | Ga0207676_10340404 | Ga0207676_103404042 | 90 |
| 341 | 3300026118 | Ga0207675_100283057 | Ga0207675_1002830572 | 90 |
| 342 | 3300028379 | Ga0268266_10202320 | Ga0268266_102023202 | 90 |
| 343 | 3300028380 | Ga0268265_10058734 | Ga0268265_100587345 | 90 |
| 344 | 3300028380 | Ga0268265_10223968 | Ga0268265_102239683 | 90 |
| 345 | 3300028381 | Ga0268264_10037860 | Ga0268264_100378603 | 90 |
| 346 | 3300028381 | Ga0268264_10154233 | Ga0268264_101542333 | 90 |
| 347 | 3300028381 | Ga0268264_11201236 | Ga0268264_112012362 | 90 |
| 348 | 3300029957 | Ga0265324_10001478 | Ga0265324_100014785 | 90 |
| 349 | 3300031235 | Ga0265330_10429120 | Ga0265330_104291201 | 90 |
| 350 | 3300031239 | Ga0265328_10003709 | Ga0265328_100037095 | 90 |
| 351 | 3300031250 | Ga0265331_10002012 | Ga0265331_100020122 | 90 |
| 352 | 3300031344 | Ga0265316_10164838 | Ga0265316_101648382 | 90 |
| 353 | 3300031712 | Ga0265342_10487564 | Ga0265342_104875641 | 90 |
| 354 | 3300031901 | Ga0307406_10867629 | Ga0307406_108676292 | 90 |
| 355 | 3300032005 | Ga0307411_11389492 | Ga0307411_113894922 | 90 |
| 356 | 3300035083 | Ga0373926_0017416 | Ga0373926_0017416_1484_1771 | 90 |
| 357 | 3300035089 | Ga0373944_0422610 | Ga0373944_0422610_52_339 | 90 |
| 358 | 3300035113 | Ga0373936_0038424 | Ga0373936_0038424_582_869 | 90 |
| 359 | 3300035116 | Ga0373945_0006101 | Ga0373945_0006101_228_515 | 90 |
| 360 | 3300035170 | Ga0373943_0001524 | Ga0373943_0001524_4757_5044 | 90 |
| 361 | 3300035171 | Ga0373946_0160214 | Ga0373946_0160214_410_697 | 90 |
| 362 | 3300035692 | Ga0373935_0020131 | Ga0373935_0020131_598_885 | 90 |
| 363 | 3300035695 | Ga0373927_0296408 | Ga0373927_0296408_223_510 | 90 |
| 364 | 3300035725 | Ga0373947_0040054 | Ga0373947_0040054_545_832 | 90 |
| 365 | 3300035725 | Ga0373947_0591857 | Ga0373947_0591857_442_714 | 90 |
| 366 | 3300037068 | Ga0373925_0015487 | Ga0373925_0015487_3968_4255 | 90 |
| 367 | 3300037068 | Ga0373925_0076726 | Ga0373925_0076726_1944_2216 | 90 |
| 368 | 3300041407 | Ga0439447_003335 | Ga0439447_003335_880_1161 | 90 |
| 369 | 3300041456 | Ga0451795_1254461 | Ga0451795_1254461_51_326 | 90 |
| 370 | 3300041459 | Ga0451800_1211016 | Ga0451800_1211016_184_459 | 90 |
| 371 | 3300041463 | Ga0451804_0322379 | Ga0451804_0322379_159_434 | 90 |
| 372 | 3300046472 | Ga0495580_0116620 | Ga0495580_0116620_351_638 | 90 |
| 373 | 3300046525 | Ga0495663_0044157 | Ga0495663_0044157_553_834 | 90 |
| 374 | 3300046615 | Ga0495656_0109955 | Ga0495656_0109955_143_418 | 90 |
| 375 | 3300046616 | Ga0495668_0005354 | Ga0495668_0005354_5077_5358 | 90 |
| 376 | 3300047318 | Ga0495636_0145110 | Ga0495636_0145110_766_1041 | 90 |
| 377 | 3300048903 | Ga0496100_0263986 | Ga0496100_0263986_927_1202 | 90 |
| 378 | 3300048905 | Ga0496102_0171258 | Ga0496102_0171258_1181_1456 | 90 |
| 379 | 3300048909 | Ga0496106_0333427 | Ga0496106_0333427_169_444 | 90 |
| 380 | 3300048910 | Ga0496107_0032894 | Ga0496107_0032894_3221_3496 | 90 |
| 381 | 3300048912 | Ga0496109_0611110 | Ga0496109_0611110_280_555 | 90 |
| 382 | 3300048912 | Ga0496109_1162484 | Ga0496109_1162484_43_318 | 90 |
| 383 | 3300048913 | Ga0496110_0465079 | Ga0496110_0465079_136_411 | 90 |
| 384 | 3300048914 | Ga0496111_0377429 | Ga0496111_0377429_213_488 | 90 |
| 385 | 3300048915 | Ga0496112_0168815 | Ga0496112_0168815_961_1236 | 90 |
| 386 | 3300048916 | Ga0496113_0347270 | Ga0496113_0347270_38_313 | 90 |
| 387 | 3300048917 | Ga0496114_0236613 | Ga0496114_0236613_1114_1389 | 90 |
| 388 | iso_pu_bacteria | 2643221695 | 2644529481 | 90 |
| 389 | iso_pu_bacteria | 2883354860 | 2883359130 | 90 |
| 390 | 3300003771 | Ga0055526_1062541 | Ga0055526_10625412 | 91 |
| 391 | 3300003775 | Ga0055524_1023261 | Ga0055524_10232612 | 91 |
| 392 | 3300003775 | Ga0055524_1023324 | Ga0055524_10233242 | 91 |
| 393 | 3300003781 | Ga0055536_1000659 | Ga0055536_10006592 | 91 |
| 394 | 3300003781 | Ga0055536_1020862 | Ga0055536_10208622 | 91 |
| 395 | 3300003781 | Ga0055536_1023547 | Ga0055536_10235473 | 91 |
| 396 | 3300003784 | Ga0055534_1026779 | Ga0055534_10267792 | 91 |
| 397 | 3300003784 | Ga0055534_1063836 | Ga0055534_10638361 | 91 |
| 398 | 3300003790 | Ga0055528_1051367 | Ga0055528_10513672 | 91 |
| 399 | 3300003791 | Ga0055530_10013099 | Ga0055530_100130995 | 91 |
| 400 | 3300003794 | Ga0055531_10032577 | Ga0055531_100325772 | 91 |
| 401 | 3300003794 | Ga0055531_10034386 | Ga0055531_100343862 | 91 |
| 402 | 3300003794 | Ga0055531_10088827 | Ga0055531_100888272 | 91 |
| 403 | 3300005331 | Ga0070670_100666078 | Ga0070670_1006660781 | 91 |
| 404 | 3300005335 | Ga0070666_10000757 | Ga0070666_100007573 | 91 |
| 405 | 3300005336 | Ga0070680_100092051 | Ga0070680_1000920512 | 91 |
| 406 | 3300005344 | Ga0070661_100118687 | Ga0070661_1001186872 | 91 |
| 407 | 3300005344 | Ga0070661_101298746 | Ga0070661_1012987461 | 91 |
| 408 | 3300005353 | Ga0070669_101847872 | Ga0070669_1018478721 | 91 |
| 409 | 3300005355 | Ga0070671_100351457 | Ga0070671_1003514572 | 91 |
| 410 | 3300005367 | Ga0070667_100267424 | Ga0070667_1002674242 | 91 |
| 411 | 3300005434 | Ga0070709_11012137 | Ga0070709_110121372 | 91 |
| 412 | 3300005437 | Ga0070710_10736483 | Ga0070710_107364832 | 91 |
| 413 | 3300005437 | Ga0070710_10960217 | Ga0070710_109602172 | 91 |
| 414 | 3300005439 | Ga0070711_100973472 | Ga0070711_1009734722 | 91 |
| 415 | 3300005444 | Ga0070694_100385506 | Ga0070694_1003855062 | 91 |
| 416 | 3300005445 | Ga0070708_100488261 | Ga0070708_1004882612 | 91 |
| 417 | 3300005455 | Ga0070663_100140351 | Ga0070663_1001403512 | 91 |
| 418 | 3300005458 | Ga0070681_10004353 | Ga0070681_100043538 | 91 |
| 419 | 3300005458 | Ga0070681_10488653 | Ga0070681_104886532 | 91 |
| 420 | 3300005467 | Ga0070706_100104346 | Ga0070706_1001043462 | 91 |
| 421 | 3300005468 | Ga0070707_101917292 | Ga0070707_1019172922 | 91 |
| 422 | 3300005468 | Ga0070707_102007567 | Ga0070707_1020075672 | 91 |
| 423 | 3300005471 | Ga0070698_100045045 | Ga0070698_1000450452 | 91 |
| 424 | 3300005471 | Ga0070698_101000647 | Ga0070698_1010006471 | 91 |
| 425 | 3300005518 | Ga0070699_100306357 | Ga0070699_1003063573 | 91 |
| 426 | 3300005518 | Ga0070699_100367954 | Ga0070699_1003679542 | 91 |
| 427 | 3300005530 | Ga0070679_100019586 | Ga0070679_1000195863 | 91 |
| 428 | 3300005536 | Ga0070697_100012925 | Ga0070697_1000129253 | 91 |
| 429 | 3300005536 | Ga0070697_100191265 | Ga0070697_1001912652 | 91 |
| 430 | 3300005539 | Ga0068853_100079524 | Ga0068853_1000795243 | 91 |
| 431 | 3300005545 | Ga0070695_100647603 | Ga0070695_1006476031 | 91 |
| 432 | 3300005545 | Ga0070695_101270067 | Ga0070695_1012700671 | 91 |
| 433 | 3300005549 | Ga0070704_100019076 | Ga0070704_1000190767 | 91 |
| 434 | 3300005563 | Ga0068855_100040241 | Ga0068855_1000402412 | 91 |
| 435 | 3300005578 | Ga0068854_100272645 | Ga0068854_1002726452 | 91 |
| 436 | 3300005578 | Ga0068854_100588819 | Ga0068854_1005888192 | 91 |
| 437 | 3300005614 | Ga0068856_100005667 | Ga0068856_1000056679 | 91 |
| 438 | 3300005615 | Ga0070702_100096341 | Ga0070702_1000963413 | 91 |
| 439 | 3300005616 | Ga0068852_100013925 | Ga0068852_1000139259 | 91 |
| 440 | 3300005841 | Ga0068863_101415784 | Ga0068863_1014157842 | 91 |
| 441 | 3300005937 | Ga0081455_10162222 | Ga0081455_101622221 | 91 |
| 442 | 3300006173 | Ga0070716_100302751 | Ga0070716_1003027512 | 91 |
| 443 | 3300006237 | Ga0097621_100397113 | Ga0097621_1003971133 | 91 |
| 444 | 3300006358 | Ga0068871_100310122 | Ga0068871_1003101223 | 91 |
| 445 | 3300006852 | Ga0075433_10330175 | Ga0075433_103301753 | 91 |
| 446 | 3300006871 | Ga0075434_100094618 | Ga0075434_1000946183 | 91 |
| 447 | 3300006914 | Ga0075436_100368625 | Ga0075436_1003686251 | 91 |
| 448 | 3300007076 | Ga0075435_100105373 | Ga0075435_1001053733 | 91 |
| 449 | 3300007788 | Ga0099795_10092628 | Ga0099795_100926282 | 91 |
| 450 | 3300009093 | Ga0105240_10018288 | Ga0105240_100182889 | 91 |
| 451 | 3300009093 | Ga0105240_10310080 | Ga0105240_103100803 | 91 |
| 452 | 3300009098 | Ga0105245_10103549 | Ga0105245_101035492 | 91 |
| 453 | 3300009098 | Ga0105245_11906152 | Ga0105245_119061521 | 91 |
| 454 | 3300009147 | Ga0114129_10137959 | Ga0114129_101379591 | 91 |
| 455 | 3300009148 | Ga0105243_10135996 | Ga0105243_101359964 | 91 |
| 456 | 3300009174 | Ga0105241_10223027 | Ga0105241_102230272 | 91 |
| 457 | 3300009176 | Ga0105242_10485840 | Ga0105242_104858402 | 91 |
| 458 | 3300009177 | Ga0105248_13386771 | Ga0105248_133867711 | 91 |
| 459 | 3300009545 | Ga0105237_10084295 | Ga0105237_100842954 | 91 |
| 460 | 3300009551 | Ga0105238_10018425 | Ga0105238_100184254 | 91 |
| 461 | 3300010159 | Ga0099796_10009045 | Ga0099796_100090453 | 91 |
| 462 | 3300010375 | Ga0105239_10187090 | Ga0105239_101870902 | 91 |
| 463 | 3300010375 | Ga0105239_10352587 | Ga0105239_103525872 | 91 |
| 464 | 3300010375 | Ga0105239_10565254 | Ga0105239_105652542 | 91 |
| 465 | 3300012512 | Ga0157327_1000791 | Ga0157327_10007913 | 91 |
| 466 | 3300013100 | Ga0157373_10181012 | Ga0157373_101810122 | 91 |
| 467 | 3300013104 | Ga0157370_10013990 | Ga0157370_100139903 | 91 |
| 468 | 3300013104 | Ga0157370_10894639 | Ga0157370_108946392 | 91 |
| 469 | 3300013105 | Ga0157369_10008071 | Ga0157369_100080719 | 91 |
| 470 | 3300013105 | Ga0157369_11412056 | Ga0157369_114120561 | 91 |
| 471 | 3300013297 | Ga0157378_10026393 | Ga0157378_100263938 | 91 |
| 472 | 3300013297 | Ga0157378_11031661 | Ga0157378_110316611 | 91 |
| 473 | 3300013307 | Ga0157372_10002630 | Ga0157372_100026309 | 91 |
| 474 | 3300013308 | Ga0157375_13658044 | Ga0157375_136580441 | 91 |
| 475 | 3300014968 | Ga0157379_10524912 | Ga0157379_105249122 | 91 |
| 476 | 3300014969 | Ga0157376_10123760 | Ga0157376_101237602 | 91 |
| 477 | 3300020070 | Ga0206356_10665401 | Ga0206356_106654012 | 91 |
| 478 | 3300020082 | Ga0206353_11851096 | Ga0206353_118510962 | 91 |
| 479 | 3300025273 | Ga0209673_1003489 | Ga0209673_10034894 | 91 |
| 480 | 3300025273 | Ga0209673_1052811 | Ga0209673_10528112 | 91 |
| 481 | 3300025284 | Ga0209130_1004560 | Ga0209130_10045604 | 91 |
| 482 | 3300025291 | Ga0209675_1008125 | Ga0209675_10081253 | 91 |
| 483 | 3300025291 | Ga0209675_1027378 | Ga0209675_10273781 | 91 |
| 484 | 3300025292 | Ga0209676_1007374 | Ga0209676_10073743 | 91 |
| 485 | 3300025292 | Ga0209676_1022610 | Ga0209676_10226103 | 91 |
| 486 | 3300025292 | Ga0209676_1027136 | Ga0209676_10271362 | 91 |
| 487 | 3300025292 | Ga0209676_1036651 | Ga0209676_10366511 | 91 |
| 488 | 3300025292 | Ga0209676_1067479 | Ga0209676_10674793 | 91 |
| 489 | 3300025294 | Ga0209025_1018697 | Ga0209025_10186973 | 91 |
| 490 | 3300025294 | Ga0209025_1054771 | Ga0209025_10547712 | 91 |
| 491 | 3300025295 | Ga0209564_1011660 | Ga0209564_10116602 | 91 |
| 492 | 3300025295 | Ga0209564_1030519 | Ga0209564_10305192 | 91 |
| 493 | 3300025297 | Ga0209758_1055202 | Ga0209758_10552021 | 91 |
| 494 | 3300025297 | Ga0209758_1071927 | Ga0209758_10719272 | 91 |
| 495 | 3300025298 | Ga0209050_1033547 | Ga0209050_10335473 | 91 |
| 496 | 3300025299 | Ga0209256_1002071 | Ga0209256_100207111 | 91 |
| 497 | 3300025299 | Ga0209256_1006641 | Ga0209256_10066413 | 91 |
| 498 | 3300025302 | Ga0207426_1118271 | Ga0207426_11182711 | 91 |
| 499 | 3300025303 | Ga0209051_1012544 | Ga0209051_10125441 | 91 |
| 500 | 3300025304 | Ga0209257_1001477 | Ga0209257_100147714 | 91 |
| 501 | 3300025304 | Ga0209257_1027132 | Ga0209257_10271322 | 91 |
| 502 | 3300025304 | Ga0209257_1030258 | Ga0209257_10302582 | 91 |
| 503 | 3300025898 | Ga0207692_10401347 | Ga0207692_104013471 | 91 |
| 504 | 3300025903 | Ga0207680_10153677 | Ga0207680_101536772 | 91 |
| 505 | 3300025906 | Ga0207699_10618038 | Ga0207699_106180382 | 91 |
| 506 | 3300025911 | Ga0207654_10015624 | Ga0207654_100156243 | 91 |
| 507 | 3300025912 | Ga0207707_10009949 | Ga0207707_100099496 | 91 |
| 508 | 3300025913 | Ga0207695_10000536 | Ga0207695_1000053641 | 91 |
| 509 | 3300025914 | Ga0207671_10010174 | Ga0207671_1001017410 | 91 |
| 510 | 3300025916 | Ga0207663_10903699 | Ga0207663_109036992 | 91 |
| 511 | 3300025917 | Ga0207660_10258251 | Ga0207660_102582513 | 91 |
| 512 | 3300025920 | Ga0207649_10018768 | Ga0207649_100187686 | 91 |
| 513 | 3300025920 | Ga0207649_10638042 | Ga0207649_106380422 | 91 |
| 514 | 3300025921 | Ga0207652_10025366 | Ga0207652_100253665 | 91 |
| 515 | 3300025924 | Ga0207694_10175321 | Ga0207694_101753213 | 91 |
| 516 | 3300025925 | Ga0207650_10735489 | Ga0207650_107354892 | 91 |
| 517 | 3300025927 | Ga0207687_10484255 | Ga0207687_104842552 | 91 |
| 518 | 3300025949 | Ga0207667_10051861 | Ga0207667_100518617 | 91 |
| 519 | 3300025981 | Ga0207640_10192447 | Ga0207640_101924472 | 91 |
| 520 | 3300025981 | Ga0207640_10550598 | Ga0207640_105505982 | 91 |
| 521 | 3300026041 | Ga0207639_10001041 | Ga0207639_1000104110 | 91 |
| 522 | 3300026078 | Ga0207702_10277445 | Ga0207702_102774452 | 91 |
| 523 | 3300026142 | Ga0207698_10113933 | Ga0207698_101139332 | 91 |
| 524 | 3300026142 | Ga0207698_10807813 | Ga0207698_108078132 | 91 |
| 525 | 3300035119 | Ga0373956_0057703 | Ga0373956_0057703_592_867 | 91 |
| 526 | 3300035120 | Ga0373957_0072147 | Ga0373957_0072147_442_717 | 91 |
| 527 | 3300035172 | Ga0373955_0190561 | Ga0373955_0190561_57_332 | 91 |
| 528 | 3300035691 | Ga0373931_0262650 | Ga0373931_0262650_43_318 | 91 |
| 529 | 3300035691 | Ga0373931_0338968 | Ga0373931_0338968_570_854 | 91 |
| 530 | 3300035695 | Ga0373927_0074892 | Ga0373927_0074892_1025_1303 | 91 |
| 531 | 3300035695 | Ga0373927_0085424 | Ga0373927_0085424_26_301 | 91 |
| 532 | 3300035724 | Ga0373933_1002629 | Ga0373933_1002629_183_458 | 91 |
| 533 | 3300036401 | Ga0373937_0014255 | Ga0373937_0014255_218_493 | 91 |
| 534 | 3300036401 | Ga0373937_2044079 | Ga0373937_2044079_180_461 | 91 |
| 535 | 3300038996 | Ga0242420_165388 | Ga0242420_165388_175_459 | 91 |
| 536 | 3300039438 | Ga0436360_0716208 | Ga0436360_0716208_265_552 | 91 |
| 537 | 3300039447 | Ga0436361_0332190 | Ga0436361_0332190_1510_1788 | 91 |
| 538 | 3300039453 | Ga0436362_0050995 | Ga0436362_0050995_1391_1678 | 91 |
| 539 | 3300042007 | Ga0439449_0150777 | Ga0439449_0150777_449_733 | 91 |
| 540 | 3300046454 | Ga0495592_0114029 | Ga0495592_0114029_36_311 | 91 |
| 541 | 3300046462 | Ga0495651_0799375 | Ga0495651_0799375_289_564 | 91 |
| 542 | 3300046472 | Ga0495580_0753063 | Ga0495580_0753063_132_410 | 91 |
| 543 | 3300046475 | Ga0495639_0048674 | Ga0495639_0048674_444_719 | 91 |
| 544 | 3300046514 | Ga0495618_0164351 | Ga0495618_0164351_196_471 | 91 |
| 545 | 3300046526 | Ga0495666_0430690 | Ga0495666_0430690_61_336 | 91 |
| 546 | 3300046536 | Ga0495587_0435094 | Ga0495587_0435094_419_694 | 91 |
| 547 | 3300046559 | Ga0495667_0009254 | Ga0495667_0009254_5590_5865 | 91 |
| 548 | 3300046642 | Ga0495634_0744259 | Ga0495634_0744259_218_493 | 91 |
| 549 | 3300046663 | Ga0495635_0035060 | Ga0495635_0035060_1994_2269 | 91 |
| 550 | 3300046675 | Ga0495657_0266218 | Ga0495657_0266218_227_502 | 91 |
| 551 | 3300046678 | Ga0495599_0110216 | Ga0495599_0110216_1234_1509 | 91 |
| 552 | 3300046809 | Ga0495600_0097240 | Ga0495600_0097240_1573_1848 | 91 |
| 553 | 3300047322 | Ga0495680_0093050 | Ga0495680_0093050_1479_1754 | 91 |
| 554 | 3300048903 | Ga0496100_0404789 | Ga0496100_0404789_729_1013 | 91 |
| 555 | 3300048906 | Ga0496103_0137448 | Ga0496103_0137448_918_1202 | 91 |
| 556 | 3300048909 | Ga0496106_1119555 | Ga0496106_1119555_195_479 | 91 |
| 557 | 3300048910 | Ga0496107_0273503 | Ga0496107_0273503_414_698 | 91 |
| 558 | 3300048912 | Ga0496109_0334956 | Ga0496109_0334956_670_954 | 91 |
| 559 | 3300048916 | Ga0496113_0242883 | Ga0496113_0242883_133_417 | 91 |
| 560 | 3300048916 | Ga0496113_0440012 | Ga0496113_0440012_90_374 | 91 |
| 561 | 3300049573 | Ga0501037_0446922 | Ga0501037_0446922_338_622 | 91 |
| 562 | 3300049579 | Ga0501043_0036419 | Ga0501043_0036419_3575_3859 | 91 |
| 563 | 3300049742 | Ga0501080_1488475 | Ga0501080_1488475_125_409 | 91 |
| 564 | 3300049823 | Ga0501044_1343055 | Ga0501044_1343055_51_335 | 91 |
| 565 | 3300050507 | nmdc:mga05p37_1812620_c1 | nmdc:mga05p37_1812620_c1_197_481 | 91 |
| 566 | 3300050512 | nmdc:mga0n895_45227_c1 | nmdc:mga0n895_45227_c1_343_627 | 91 |
| 567 | 3300050512 | nmdc:mga0n895_585594_c1 | nmdc:mga0n895_585594_c1_547_822 | 91 |
| 568 | 3300050514 | nmdc:mga08x19_346191_c1 | nmdc:mga08x19_346191_c1_37_312 | 91 |
| 569 | 3300050515 | nmdc:mga0a205_461333_c1 | nmdc:mga0a205_461333_c1_248_532 | 91 |
| 570 | 3300053079 | Ga0500610_0000046 | Ga0500610_0000046_15221_15499 | 91 |
| 571 | 3300053084 | Ga0495595_0003973 | Ga0495595_0003973_598_873 | 91 |
| 572 | 3300053085 | Ga0495619_0018647 | Ga0495619_0018647_3616_3891 | 91 |
| 573 | 3300053098 | Ga0500650_0124619 | Ga0500650_0124619_147_425 | 91 |
| 574 | 3300053130 | Ga0500642_0000303 | Ga0500642_0000303_943_1230 | 91 |
| 575 | 3300053146 | Ga0500588_0214602 | Ga0500588_0214602_34_312 | 91 |
| 576 | iso_pu_bacteria | 2643221593 | 2643976570 | 91 |
| 577 | iso_pu_bacteria | 2941489479 | 2941490586 | 91 |
| 578 | iso_pu_bacteria | 8003014200 | 8003014481 | 91 |
| 579 | 3300003771 | Ga0055526_1000032 | Ga0055526_1000032105 | 92 |
| 580 | 3300003773 | Ga0055537_1000283 | Ga0055537_100028311 | 92 |
| 581 | 3300003775 | Ga0055524_1000054 | Ga0055524_1000054105 | 92 |
| 582 | 3300003784 | Ga0055534_1000041 | Ga0055534_100004111 | 92 |
| 583 | 3300003790 | Ga0055528_1000021 | Ga0055528_100002111 | 92 |
| 584 | 3300005293 | Ga0065715_10707627 | Ga0065715_107076271 | 92 |
| 585 | 3300005329 | Ga0070683_100924143 | Ga0070683_1009241432 | 92 |
| 586 | 3300005330 | Ga0070690_101035798 | Ga0070690_1010357981 | 92 |
| 587 | 3300005330 | Ga0070690_101487530 | Ga0070690_1014875302 | 92 |
| 588 | 3300005331 | Ga0070670_100015548 | Ga0070670_1000155482 | 92 |
| 589 | 3300005335 | Ga0070666_10009705 | Ga0070666_100097054 | 92 |
| 590 | 3300005335 | Ga0070666_10352011 | Ga0070666_103520112 | 92 |
| 591 | 3300005338 | Ga0068868_100027994 | Ga0068868_1000279944 | 92 |
| 592 | 3300005344 | Ga0070661_100019364 | Ga0070661_1000193644 | 92 |
| 593 | 3300005354 | Ga0070675_101792683 | Ga0070675_1017926832 | 92 |
| 594 | 3300005355 | Ga0070671_101076074 | Ga0070671_1010760741 | 92 |
| 595 | 3300005364 | Ga0070673_102099389 | Ga0070673_1020993891 | 92 |
| 596 | 3300005364 | Ga0070673_102405880 | Ga0070673_1024058801 | 92 |
| 597 | 3300005367 | Ga0070667_100025113 | Ga0070667_1000251134 | 92 |
| 598 | 3300005435 | Ga0070714_101505081 | Ga0070714_1015050812 | 92 |
| 599 | 3300005435 | Ga0070714_101876988 | Ga0070714_1018769882 | 92 |
| 600 | 3300005436 | Ga0070713_100875892 | Ga0070713_1008758922 | 92 |
| 601 | 3300005439 | Ga0070711_101106171 | Ga0070711_1011061712 | 92 |
| 602 | 3300005439 | Ga0070711_101294710 | Ga0070711_1012947101 | 92 |
| 603 | 3300005441 | Ga0070700_100572725 | Ga0070700_1005727252 | 92 |
| 604 | 3300005455 | Ga0070663_100016057 | Ga0070663_1000160574 | 92 |
| 605 | 3300005457 | Ga0070662_100052807 | Ga0070662_1000528074 | 92 |
| 606 | 3300005458 | Ga0070681_10657500 | Ga0070681_106575002 | 92 |
| 607 | 3300005458 | Ga0070681_10845666 | Ga0070681_108456662 | 92 |
| 608 | 3300005459 | Ga0068867_100086928 | Ga0068867_1000869282 | 92 |
| 609 | 3300005467 | Ga0070706_100058201 | Ga0070706_1000582011 | 92 |
| 610 | 3300005467 | Ga0070706_100286691 | Ga0070706_1002866912 | 92 |
| 611 | 3300005467 | Ga0070706_101886643 | Ga0070706_1018866431 | 92 |
| 612 | 3300005468 | Ga0070707_100318648 | Ga0070707_1003186483 | 92 |
| 613 | 3300005471 | Ga0070698_100025034 | Ga0070698_1000250347 | 92 |
| 614 | 3300005518 | Ga0070699_100427559 | Ga0070699_1004275592 | 92 |
| 615 | 3300005530 | Ga0070679_100695711 | Ga0070679_1006957112 | 92 |
| 616 | 3300005530 | Ga0070679_101635488 | Ga0070679_1016354881 | 92 |
| 617 | 3300005530 | Ga0070679_101649452 | Ga0070679_1016494521 | 92 |
| 618 | 3300005535 | Ga0070684_102134593 | Ga0070684_1021345931 | 92 |
| 619 | 3300005536 | Ga0070697_101285078 | Ga0070697_1012850781 | 92 |
| 620 | 3300005539 | Ga0068853_100038085 | Ga0068853_1000380853 | 92 |
| 621 | 3300005539 | Ga0068853_100083127 | Ga0068853_1000831272 | 92 |
| 622 | 3300005543 | Ga0070672_100983362 | Ga0070672_1009833622 | 92 |
| 623 | 3300005544 | Ga0070686_100777648 | Ga0070686_1007776482 | 92 |
| 624 | 3300005545 | Ga0070695_100998360 | Ga0070695_1009983601 | 92 |
| 625 | 3300005548 | Ga0070665_100000887 | Ga0070665_10000088730 | 92 |
| 626 | 3300005563 | Ga0068855_101279681 | Ga0068855_1012796812 | 92 |
| 627 | 3300005563 | Ga0068855_101288155 | Ga0068855_1012881552 | 92 |
| 628 | 3300005564 | Ga0070664_101318064 | Ga0070664_1013180642 | 92 |
| 629 | 3300005564 | Ga0070664_102128351 | Ga0070664_1021283511 | 92 |
| 630 | 3300005577 | Ga0068857_100064811 | Ga0068857_1000648112 | 92 |
| 631 | 3300005578 | Ga0068854_100005787 | Ga0068854_1000057874 | 92 |
| 632 | 3300005614 | Ga0068856_101499583 | Ga0068856_1014995832 | 92 |
| 633 | 3300005616 | Ga0068852_100014213 | Ga0068852_1000142134 | 92 |
| 634 | 3300005617 | Ga0068859_100904804 | Ga0068859_1009048041 | 92 |
| 635 | 3300005617 | Ga0068859_103003115 | Ga0068859_1030031152 | 92 |
| 636 | 3300005834 | Ga0068851_10000537 | Ga0068851_100005374 | 92 |
| 637 | 3300005841 | Ga0068863_100077046 | Ga0068863_1000770461 | 92 |
| 638 | 3300005842 | Ga0068858_100017961 | Ga0068858_1000179614 | 92 |
| 639 | 3300005842 | Ga0068858_100567778 | Ga0068858_1005677783 | 92 |
| 640 | 3300005842 | Ga0068858_101106588 | Ga0068858_1011065881 | 92 |
| 641 | 3300005843 | Ga0068860_100677609 | Ga0068860_1006776092 | 92 |
| 642 | 3300005981 | Ga0081538_10110331 | Ga0081538_101103312 | 92 |
| 643 | 3300006028 | Ga0070717_10037516 | Ga0070717_100375165 | 92 |
| 644 | 3300006163 | Ga0070715_10174299 | Ga0070715_101742991 | 92 |
| 645 | 3300006871 | Ga0075434_100457054 | Ga0075434_1004570542 | 92 |
| 646 | 3300006881 | Ga0068865_100397149 | Ga0068865_1003971492 | 92 |
| 647 | 3300006914 | Ga0075436_100850883 | Ga0075436_1008508831 | 92 |
| 648 | 3300006931 | Ga0097620_100904842 | Ga0097620_1009048423 | 92 |
| 649 | 3300006931 | Ga0097620_103005727 | Ga0097620_1030057271 | 92 |
| 650 | 3300007076 | Ga0075435_100909737 | Ga0075435_1009097371 | 92 |
| 651 | 3300009093 | Ga0105240_10442675 | Ga0105240_104426752 | 92 |
| 652 | 3300009093 | Ga0105240_10489203 | Ga0105240_104892032 | 92 |
| 653 | 3300009093 | Ga0105240_11477216 | Ga0105240_114772162 | 92 |
| 654 | 3300009094 | Ga0111539_11216866 | Ga0111539_112168661 | 92 |
| 655 | 3300009148 | Ga0105243_11702691 | Ga0105243_117026911 | 92 |
| 656 | 3300009174 | Ga0105241_10171748 | Ga0105241_101717483 | 92 |
| 657 | 3300009177 | Ga0105248_12195223 | Ga0105248_121952231 | 92 |
| 658 | 3300009545 | Ga0105237_10299471 | Ga0105237_102994713 | 92 |
| 659 | 3300009551 | Ga0105238_10069275 | Ga0105238_100692754 | 92 |
| 660 | 3300009551 | Ga0105238_10237520 | Ga0105238_102375202 | 92 |
| 661 | 3300009553 | Ga0105249_10000936 | Ga0105249_1000093623 | 92 |
| 662 | 3300009553 | Ga0105249_12181879 | Ga0105249_121818792 | 92 |
| 663 | 3300010375 | Ga0105239_11216802 | Ga0105239_112168021 | 92 |
| 664 | 3300011119 | Ga0105246_10045743 | Ga0105246_100457432 | 92 |
| 665 | 3300013104 | Ga0157370_10350100 | Ga0157370_103501003 | 92 |
| 666 | 3300013105 | Ga0157369_10446650 | Ga0157369_104466502 | 92 |
| 667 | 3300013296 | Ga0157374_10849946 | Ga0157374_108499461 | 92 |
| 668 | 3300013297 | Ga0157378_11208406 | Ga0157378_112084062 | 92 |
| 669 | 3300014325 | Ga0163163_10473105 | Ga0163163_104731052 | 92 |
| 670 | 3300014325 | Ga0163163_11100885 | Ga0163163_111008852 | 92 |
| 671 | 3300014968 | Ga0157379_11969967 | Ga0157379_119699672 | 92 |
| 672 | 3300014969 | Ga0157376_10337905 | Ga0157376_103379052 | 92 |
| 673 | 3300015689 | Ga0183360_10001 | Ga0183360_100011751 | 92 |
| 674 | 3300020082 | Ga0206353_10282457 | Ga0206353_102824575 | 92 |
| 675 | 3300021384 | Ga0213876_10599148 | Ga0213876_105991482 | 92 |
| 676 | 3300021388 | Ga0213875_10010320 | Ga0213875_100103206 | 92 |
| 677 | 3300024227 | Ga0228598_1089098 | Ga0228598_10890982 | 92 |
| 678 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000012065 | 92 |
| 679 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012065 | 92 |
| 680 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001468 | 92 |
| 681 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001630 | 92 |
| 682 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002923 | 92 |
| 683 | 3300025321 | Ga0207656_10000504 | Ga0207656_100005048 | 92 |
| 684 | 3300025901 | Ga0207688_10309678 | Ga0207688_103096782 | 92 |
| 685 | 3300025903 | Ga0207680_10016098 | Ga0207680_100160984 | 92 |
| 686 | 3300025903 | Ga0207680_10086202 | Ga0207680_100862023 | 92 |
| 687 | 3300025904 | Ga0207647_10000123 | Ga0207647_1000012311 | 92 |
| 688 | 3300025905 | Ga0207685_10244931 | Ga0207685_102449312 | 92 |
| 689 | 3300025910 | Ga0207684_10196400 | Ga0207684_101964002 | 92 |
| 690 | 3300025912 | Ga0207707_10815652 | Ga0207707_108156522 | 92 |
| 691 | 3300025912 | Ga0207707_11142378 | Ga0207707_111423782 | 92 |
| 692 | 3300025913 | Ga0207695_10012571 | Ga0207695_1001257110 | 92 |
| 693 | 3300025914 | Ga0207671_10027507 | Ga0207671_100275074 | 92 |
| 694 | 3300025921 | Ga0207652_11120260 | Ga0207652_111202602 | 92 |
| 695 | 3300025922 | Ga0207646_10181939 | Ga0207646_101819393 | 92 |
| 696 | 3300025924 | Ga0207694_10020919 | Ga0207694_100209194 | 92 |
| 697 | 3300025925 | Ga0207650_10033885 | Ga0207650_100338853 | 92 |
| 698 | 3300025926 | Ga0207659_10294861 | Ga0207659_102948613 | 92 |
| 699 | 3300025926 | Ga0207659_10596439 | Ga0207659_105964392 | 92 |
| 700 | 3300025928 | Ga0207700_10853840 | Ga0207700_108538402 | 92 |
| 701 | 3300025931 | Ga0207644_10206270 | Ga0207644_102062702 | 92 |
| 702 | 3300025933 | Ga0207706_10004683 | Ga0207706_1000468313 | 92 |
| 703 | 3300025938 | Ga0207704_10269067 | Ga0207704_102690672 | 92 |
| 704 | 3300025944 | Ga0207661_10431050 | Ga0207661_104310502 | 92 |
| 705 | 3300025949 | Ga0207667_11147692 | Ga0207667_111476922 | 92 |
| 706 | 3300025961 | Ga0207712_10001206 | Ga0207712_100012066 | 92 |
| 707 | 3300025972 | Ga0207668_11688900 | Ga0207668_116889002 | 92 |
| 708 | 3300025981 | Ga0207640_10067489 | Ga0207640_100674894 | 92 |
| 709 | 3300025986 | Ga0207658_10020316 | Ga0207658_100203164 | 92 |
| 710 | 3300026035 | Ga0207703_10000950 | Ga0207703_1000095026 | 92 |
| 711 | 3300026035 | Ga0207703_11276398 | Ga0207703_112763982 | 92 |
| 712 | 3300026041 | Ga0207639_10000658 | Ga0207639_1000065813 | 92 |
| 713 | 3300026041 | Ga0207639_10591382 | Ga0207639_105913822 | 92 |
| 714 | 3300026067 | Ga0207678_10011856 | Ga0207678_100118567 | 92 |
| 715 | 3300026078 | Ga0207702_10161518 | Ga0207702_101615182 | 92 |
| 716 | 3300026078 | Ga0207702_10583121 | Ga0207702_105831212 | 92 |
| 717 | 3300026089 | Ga0207648_10115420 | Ga0207648_101154203 | 92 |
| 718 | 3300026095 | Ga0207676_10580288 | Ga0207676_105802881 | 92 |
| 719 | 3300026116 | Ga0207674_10072634 | Ga0207674_100726344 | 92 |
| 720 | 3300026118 | Ga0207675_100333706 | Ga0207675_1003337062 | 92 |
| 721 | 3300026142 | Ga0207698_10030238 | Ga0207698_100302385 | 92 |
| 722 | 3300026142 | Ga0207698_11465092 | Ga0207698_114650922 | 92 |
| 723 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006460 | 92 |
| 724 | 3300028381 | Ga0268264_10803127 | Ga0268264_108031272 | 92 |
| 725 | 3300031249 | Ga0265339_10029810 | Ga0265339_100298102 | 92 |
| 726 | 3300031250 | Ga0265331_10025641 | Ga0265331_100256414 | 92 |
| 727 | 3300031251 | Ga0265327_10018518 | Ga0265327_100185186 | 92 |
| 728 | 3300031344 | Ga0265316_10174473 | Ga0265316_101744733 | 92 |
| 729 | 3300031344 | Ga0265316_10612416 | Ga0265316_106124161 | 92 |
| 730 | 3300031595 | Ga0265313_10009191 | Ga0265313_100091915 | 92 |
| 731 | 3300031711 | Ga0265314_10055573 | Ga0265314_100555733 | 92 |
| 732 | 3300031712 | Ga0265342_10081356 | Ga0265342_100813562 | 92 |
| 733 | 3300031712 | Ga0265342_10292180 | Ga0265342_102921801 | 92 |
| 734 | 3300032002 | Ga0307416_101475860 | Ga0307416_1014758601 | 92 |
| 735 | 3300032133 | Ga0316583_10254599 | Ga0316583_102545992 | 92 |
| 736 | 3300035091 | Ga0373951_0056119 | Ga0373951_0056119_35_322 | 92 |
| 737 | 3300035170 | Ga0373943_0431914 | Ga0373943_0431914_258_539 | 92 |
| 738 | 3300035170 | Ga0373943_0766562 | Ga0373943_0766562_261_539 | 92 |
| 739 | 3300035171 | Ga0373946_0621658 | Ga0373946_0621658_159_446 | 92 |
| 740 | 3300035241 | Ga0373961_0449804 | Ga0373961_0449804_161_463 | 92 |
| 741 | 3300035691 | Ga0373931_0582533 | Ga0373931_0582533_26_316 | 92 |
| 742 | 3300035692 | Ga0373935_0111091 | Ga0373935_0111091_843_1124 | 92 |
| 743 | 3300035724 | Ga0373933_0862358 | Ga0373933_0862358_300_578 | 92 |
| 744 | 3300036401 | Ga0373937_0209252 | Ga0373937_0209252_831_1130 | 92 |
| 745 | 3300037418 | Ga0395900_0623457 | Ga0395900_0623457_385_672 | 92 |
| 746 | 3300037853 | Ga0436364_0207585 | Ga0436364_0207585_61627_61914 | 92 |
| 747 | 3300037853 | Ga0436364_1073612 | Ga0436364_1073612_1871_2155 | 92 |
| 748 | 3300037853 | Ga0436364_1170313 | Ga0436364_1170313_532_822 | 92 |
| 749 | 3300037853 | Ga0436364_1284200 | Ga0436364_1284200_96264_96566 | 92 |
| 750 | 3300038443 | Ga0395901_1648803 | Ga0395901_1648803_277_564 | 92 |
| 751 | 3300039062 | Ga0400483_002478 | Ga0400483_002478_1787_2065 | 92 |
| 752 | 3300039437 | Ga0436365_1080253 | Ga0436365_1080253_400_684 | 92 |
| 753 | 3300042007 | Ga0439449_0006210 | Ga0439449_0006210_2250_2543 | 92 |
| 754 | 3300044735 | Ga0466968_0126737 | Ga0466968_0126737_153_431 | 92 |
| 755 | 3300045836 | Ga0466958_0651554 | Ga0466958_0651554_166_447 | 92 |
| 756 | 3300045976 | Ga0466967_0442523 | Ga0466967_0442523_104_385 | 92 |
| 757 | 3300045976 | Ga0466967_0623732 | Ga0466967_0623732_776_1054 | 92 |
| 758 | 3300045976 | Ga0466967_1259892 | Ga0466967_1259892_412_690 | 92 |
| 759 | 3300046459 | Ga0495629_0020302 | Ga0495629_0020302_2613_2891 | 92 |
| 760 | 3300046472 | Ga0495580_0009377 | Ga0495580_0009377_3964_4242 | 92 |
| 761 | 3300046475 | Ga0495639_0396544 | Ga0495639_0396544_157_450 | 92 |
| 762 | 3300046525 | Ga0495663_0087063 | Ga0495663_0087063_446_733 | 92 |
| 763 | 3300046539 | Ga0495621_0108453 | Ga0495621_0108453_626_913 | 92 |
| 764 | 3300046615 | Ga0495656_0038020 | Ga0495656_0038020_53_340 | 92 |
| 765 | 3300046615 | Ga0495656_0137566 | Ga0495656_0137566_482_769 | 92 |
| 766 | 3300046663 | Ga0495635_0381174 | Ga0495635_0381174_316_594 | 92 |
| 767 | 3300046664 | Ga0495659_0062592 | Ga0495659_0062592_365_652 | 92 |
| 768 | 3300046683 | Ga0495658_0001477 | Ga0495658_0001477_4034_4312 | 92 |
| 769 | 3300046689 | Ga0495613_0083411 | Ga0495613_0083411_1539_1817 | 92 |
| 770 | 3300046809 | Ga0495600_0685630 | Ga0495600_0685630_249_527 | 92 |
| 771 | 3300047315 | Ga0495581_0253571 | Ga0495581_0253571_372_650 | 92 |
| 772 | 3300047318 | Ga0495636_0008266 | Ga0495636_0008266_496_783 | 92 |
| 773 | 3300047318 | Ga0495636_0110047 | Ga0495636_0110047_428_715 | 92 |
| 774 | 3300047471 | Ga0495684_0159148 | Ga0495684_0159148_1345_1623 | 92 |
| 775 | 3300048089 | Ga0495614_0304316 | Ga0495614_0304316_404_682 | 92 |
| 776 | 3300048907 | Ga0496104_1128974 | Ga0496104_1128974_127_423 | 92 |
| 777 | 3300048915 | Ga0496112_1470595 | Ga0496112_1470595_167_463 | 92 |
| 778 | 3300048917 | Ga0496114_1339007 | Ga0496114_1339007_155_445 | 92 |
| 779 | 3300049572 | Ga0501036_0211884 | Ga0501036_0211884_288_566 | 92 |
| 780 | 3300049573 | Ga0501037_0913836 | Ga0501037_0913836_226_513 | 92 |
| 781 | 3300049577 | Ga0501041_0249794 | Ga0501041_0249794_403_690 | 92 |
| 782 | 3300049578 | Ga0501042_0054064 | Ga0501042_0054064_2547_2825 | 92 |
| 783 | 3300049583 | Ga0501067_0021904 | Ga0501067_0021904_1104_1388 | 92 |
| 784 | 3300049583 | Ga0501067_0475872 | Ga0501067_0475872_363_650 | 92 |
| 785 | 3300049585 | Ga0501069_0233625 | Ga0501069_0233625_368_652 | 92 |
| 786 | 3300049586 | Ga0501070_0049943 | Ga0501070_0049943_1063_1347 | 92 |
| 787 | 3300049588 | Ga0501072_0917133 | Ga0501072_0917133_337_636 | 92 |
| 788 | 3300049589 | Ga0501073_0159142 | Ga0501073_0159142_248_532 | 92 |
| 789 | 3300049590 | Ga0501074_0401451 | Ga0501074_0401451_225_512 | 92 |
| 790 | 3300049590 | Ga0501074_0625761 | Ga0501074_0625761_62_340 | 92 |
| 791 | 3300049591 | Ga0501075_0370738 | Ga0501075_0370738_148_435 | 92 |
| 792 | 3300049742 | Ga0501080_0057125 | Ga0501080_0057125_1280_1567 | 92 |
| 793 | 3300049742 | Ga0501080_1019054 | Ga0501080_1019054_112_411 | 92 |
| 794 | 3300049743 | Ga0501081_0522065 | Ga0501081_0522065_273_560 | 92 |
| 795 | 3300049744 | Ga0501083_0031915 | Ga0501083_0031915_1646_1930 | 92 |
| 796 | 3300049744 | Ga0501083_0043356 | Ga0501083_0043356_2608_2895 | 92 |
| 797 | 3300049822 | Ga0501035_0098367 | Ga0501035_0098367_242_520 | 92 |
| 798 | 3300049824 | Ga0501045_1373544 | Ga0501045_1373544_29_316 | 92 |
| 799 | 3300050511 | nmdc:mga08y16_1796630_c1 | nmdc:mga08y16_1796630_c1_49_345 | 92 |
| 800 | 3300050512 | nmdc:mga0n895_448882_c1 | nmdc:mga0n895_448882_c1_209_511 | 92 |
| 801 | 3300053085 | Ga0495619_0697976 | Ga0495619_0697976_354_632 | 92 |
| 802 | 3300053094 | Ga0500566_0529443 | Ga0500566_0529443_10_288 | 92 |
| 803 | 3300054114 | Ga0501084_1856192 | Ga0501084_1856192_43_330 | 92 |
| 804 | 3300060353 | Ga0501082_0062155 | Ga0501082_0062155_1183_1470 | 92 |
| 805 | 3300060353 | Ga0501082_0105172 | Ga0501082_0105172_2085_2369 | 92 |
| 806 | 3300003794 | Ga0055531_10036459 | Ga0055531_100364592 | 93 |
| 807 | 3300005327 | Ga0070658_11066672 | Ga0070658_110666722 | 93 |
| 808 | 3300005344 | Ga0070661_100967333 | Ga0070661_1009673332 | 93 |
| 809 | 3300005458 | Ga0070681_10028265 | Ga0070681_100282652 | 93 |
| 810 | 3300005530 | Ga0070679_100050521 | Ga0070679_1000505215 | 93 |
| 811 | 3300005543 | Ga0070672_100962956 | Ga0070672_1009629562 | 93 |
| 812 | 3300005548 | Ga0070665_100000668 | Ga0070665_10000066840 | 93 |
| 813 | 3300005563 | Ga0068855_100180405 | Ga0068855_1001804052 | 93 |
| 814 | 3300005577 | Ga0068857_100307780 | Ga0068857_1003077801 | 93 |
| 815 | 3300005614 | Ga0068856_100661213 | Ga0068856_1006612132 | 93 |
| 816 | 3300006847 | Ga0075431_101291443 | Ga0075431_1012914432 | 93 |
| 817 | 3300009093 | Ga0105240_10040738 | Ga0105240_100407384 | 93 |
| 818 | 3300009093 | Ga0105240_10389613 | Ga0105240_103896132 | 93 |
| 819 | 3300009093 | Ga0105240_10398442 | Ga0105240_103984421 | 93 |
| 820 | 3300009551 | Ga0105238_10306350 | Ga0105238_103063502 | 93 |
| 821 | 3300009551 | Ga0105238_10431396 | Ga0105238_104313963 | 93 |
| 822 | 3300013100 | Ga0157373_11006987 | Ga0157373_110069872 | 93 |
| 823 | 3300013104 | Ga0157370_10056772 | Ga0157370_100567721 | 93 |
| 824 | 3300013104 | Ga0157370_10389563 | Ga0157370_103895632 | 93 |
| 825 | 3300013104 | Ga0157370_10561185 | Ga0157370_105611851 | 93 |
| 826 | 3300013105 | Ga0157369_10057002 | Ga0157369_100570024 | 93 |
| 827 | 3300013296 | Ga0157374_12218719 | Ga0157374_122187192 | 93 |
| 828 | 3300014497 | Ga0182008_10028734 | Ga0182008_100287341 | 93 |
| 829 | 3300025245 | Ga0207425_1002170 | Ga0207425_10021703 | 93 |
| 830 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005504 | 93 |
| 831 | 3300025297 | Ga0209758_1013026 | Ga0209758_10130263 | 93 |
| 832 | 3300025299 | Ga0209256_1002825 | Ga0209256_10028252 | 93 |
| 833 | 3300025304 | Ga0209257_1003054 | Ga0209257_10030548 | 93 |
| 834 | 3300025909 | Ga0207705_10012977 | Ga0207705_100129774 | 93 |
| 835 | 3300025912 | Ga0207707_10084929 | Ga0207707_100849292 | 93 |
| 836 | 3300025913 | Ga0207695_10043884 | Ga0207695_100438844 | 93 |
| 837 | 3300025913 | Ga0207695_10678878 | Ga0207695_106788781 | 93 |
| 838 | 3300025919 | Ga0207657_10101658 | Ga0207657_101016583 | 93 |
| 839 | 3300025920 | Ga0207649_10340112 | Ga0207649_103401121 | 93 |
| 840 | 3300025921 | Ga0207652_10875863 | Ga0207652_108758632 | 93 |
| 841 | 3300025924 | Ga0207694_10543636 | Ga0207694_105436361 | 93 |
| 842 | 3300025949 | Ga0207667_10071805 | Ga0207667_100718053 | 93 |
| 843 | 3300025960 | Ga0207651_11909540 | Ga0207651_119095402 | 93 |
| 844 | 3300026078 | Ga0207702_10509864 | Ga0207702_105098642 | 93 |
| 845 | 3300026116 | Ga0207674_10320080 | Ga0207674_103200801 | 93 |
| 846 | 3300028379 | Ga0268266_10000497 | Ga0268266_1000049737 | 93 |
| 847 | 3300031616 | Ga0307508_10138832 | Ga0307508_101388324 | 93 |
| 848 | 3300031731 | Ga0307405_11697489 | Ga0307405_116974892 | 93 |
| 849 | 3300031824 | Ga0307413_10604691 | Ga0307413_106046912 | 93 |
| 850 | 3300031911 | Ga0307412_10096326 | Ga0307412_100963263 | 93 |
| 851 | 3300031911 | Ga0307412_10564949 | Ga0307412_105649492 | 93 |
| 852 | 3300031911 | Ga0307412_10979821 | Ga0307412_109798212 | 93 |
| 853 | 3300032002 | Ga0307416_101044535 | Ga0307416_1010445352 | 93 |
| 854 | 3300032004 | Ga0307414_10168238 | Ga0307414_101682383 | 93 |
| 855 | 3300033179 | Ga0307507_10024813 | Ga0307507_100248134 | 93 |
| 856 | 3300042005 | Ga0439448_0060634 | Ga0439448_0060634_827_1117 | 93 |
| 857 | 3300042006 | Ga0439432_100104 | Ga0439432_100104_169_462 | 93 |
| 858 | 3300042006 | Ga0439432_110430 | Ga0439432_110430_225_518 | 93 |
| 859 | 3300042007 | Ga0439449_0011489 | Ga0439449_0011489_400_693 | 93 |
| 860 | 3300042007 | Ga0439449_0037678 | Ga0439449_0037678_1057_1350 | 93 |
| 861 | 3300044842 | Ga0466957_1048467 | Ga0466957_1048467_279_560 | 93 |
| 862 | 3300045976 | Ga0466967_0793137 | Ga0466967_0793137_476_757 | 93 |
| 863 | 3300046460 | Ga0495638_0057269 | Ga0495638_0057269_1210_1503 | 93 |
| 864 | 3300046533 | Ga0495640_0311693 | Ga0495640_0311693_264_554 | 93 |
| 865 | 3300048924 | Ga0496121_0001610 | Ga0496121_0001610_5370_5669 | 93 |
| 866 | 3300049580 | Ga0501046_0637142 | Ga0501046_0637142_181_462 | 93 |
| 867 | 3300050510 | nmdc:mga06r32_680441_c1 | nmdc:mga06r32_680441_c1_158_448 | 93 |
| 868 | iso_pu_bacteria | 2883291878 | 2883296435 | 93 |
| 869 | 3300005564 | Ga0070664_101480146 | Ga0070664_1014801462 | 94 |
| 870 | 3300046615 | Ga0495656_0002013 | Ga0495656_0002013_5194_5490 | 94 |
| 871 | 3300046691 | Ga0495670_0530266 | Ga0495670_0530266_192_488 | 94 |
| 872 | 3300047318 | Ga0495636_0077756 | Ga0495636_0077756_86_382 | 94 |
| 873 | 3300049570 | Ga0501033_0041688 | Ga0501033_0041688_1553_1837 | 94 |
| 874 | 3300049571 | Ga0501034_0825957 | Ga0501034_0825957_478_762 | 94 |
| 875 | 3300049572 | Ga0501036_0417122 | Ga0501036_0417122_208_492 | 94 |
| 876 | 3300049573 | Ga0501037_0128569 | Ga0501037_0128569_1155_1439 | 94 |
| 877 | 3300049578 | Ga0501042_0799553 | Ga0501042_0799553_82_366 | 94 |
| 878 | 3300049581 | Ga0501047_0011719 | Ga0501047_0011719_6078_6362 | 94 |
| 879 | 3300049822 | Ga0501035_0439014 | Ga0501035_0439014_624_908 | 94 |
| 880 | 3300049823 | Ga0501044_0078688 | Ga0501044_0078688_1323_1607 | 94 |
| 881 | 3300050507 | nmdc:mga05p37_1711270_c1 | nmdc:mga05p37_1711270_c1_177_470 | 94 |
| 882 | 3300003320 | rootH2_10198168 | rootH2_101981683 | 95 |
| 883 | 3300042006 | Ga0439432_199771 | Ga0439432_199771_220_534 | 95 |
| 884 | iso_pu_bacteria | 2571042365 | 2572255090 | 95 |
| 885 | 3300005336 | Ga0070680_100137081 | Ga0070680_1001370812 | 96 |
| 886 | 3300005341 | Ga0070691_10250800 | Ga0070691_102508002 | 96 |
| 887 | 3300005366 | Ga0070659_100178076 | Ga0070659_1001780762 | 96 |
| 888 | 3300005444 | Ga0070694_100271668 | Ga0070694_1002716683 | 96 |
| 889 | 3300005458 | Ga0070681_10786673 | Ga0070681_107866732 | 96 |
| 890 | 3300005530 | Ga0070679_100354039 | Ga0070679_1003540393 | 96 |
| 891 | 3300005530 | Ga0070679_101645651 | Ga0070679_1016456512 | 96 |
| 892 | 3300005539 | Ga0068853_100400748 | Ga0068853_1004007481 | 96 |
| 893 | 3300005546 | Ga0070696_100202062 | Ga0070696_1002020621 | 96 |
| 894 | 3300005546 | Ga0070696_100302025 | Ga0070696_1003020251 | 96 |
| 895 | 3300005547 | Ga0070693_100210358 | Ga0070693_1002103582 | 96 |
| 896 | 3300005563 | Ga0068855_100133530 | Ga0068855_1001335303 | 96 |
| 897 | 3300005578 | Ga0068854_100183054 | Ga0068854_1001830542 | 96 |
| 898 | 3300005616 | Ga0068852_100139011 | Ga0068852_1001390112 | 96 |
| 899 | 3300005719 | Ga0068861_100172255 | Ga0068861_1001722552 | 96 |
| 900 | 3300009093 | Ga0105240_11559296 | Ga0105240_115592961 | 96 |
| 901 | 3300009551 | Ga0105238_11078873 | Ga0105238_110788732 | 96 |
| 902 | 3300013105 | Ga0157369_10949451 | Ga0157369_109494512 | 96 |
| 903 | 3300013307 | Ga0157372_10369451 | Ga0157372_103694512 | 96 |
| 904 | 3300021358 | Ga0213873_10031477 | Ga0213873_100314771 | 96 |
| 905 | 3300025912 | Ga0207707_10712947 | Ga0207707_107129471 | 96 |
| 906 | 3300025921 | Ga0207652_10372831 | Ga0207652_103728312 | 96 |
| 907 | 3300025924 | Ga0207694_10136899 | Ga0207694_101368992 | 96 |
| 908 | 3300025929 | Ga0207664_11498712 | Ga0207664_114987122 | 96 |
| 909 | 3300025937 | Ga0207669_11328402 | Ga0207669_113284022 | 96 |
| 910 | 3300025945 | Ga0207679_11569738 | Ga0207679_115697382 | 96 |
| 911 | 3300025949 | Ga0207667_10128111 | Ga0207667_101281113 | 96 |
| 912 | 3300025981 | Ga0207640_10172843 | Ga0207640_101728432 | 96 |
| 913 | 3300026041 | Ga0207639_10253468 | Ga0207639_102534682 | 96 |
| 914 | 3300026089 | Ga0207648_10487252 | Ga0207648_104872522 | 96 |
| 915 | 3300026118 | Ga0207675_102126718 | Ga0207675_1021267181 | 96 |
| 916 | 3300026142 | Ga0207698_10297455 | Ga0207698_102974552 | 96 |
| 917 | 3300037418 | Ga0395900_0095984 | Ga0395900_0095984_1894_2187 | 96 |
| 918 | 3300037466 | Ga0395898_0017375 | Ga0395898_0017375_5075_5368 | 96 |
| 919 | 3300038443 | Ga0395901_0697269 | Ga0395901_0697269_264_557 | 96 |
| 920 | 3300048088 | Ga0495602_1109086 | Ga0495602_1109086_34_327 | 96 |
| 921 | 3300049569 | Ga0501032_0293790 | Ga0501032_0293790_122_415 | 96 |
| 922 | 3300049589 | Ga0501073_0056916 | Ga0501073_0056916_1345_1638 | 96 |
| 923 | 3300053739 | Ga0500587_038486 | Ga0500587_038486_357_650 | 96 |
| 924 | 3300048916 | Ga0496113_0131177 | Ga0496113_0131177_1057_1389 | 99 |
| 925 | 3300044694 | Ga0466963_0761726 | Ga0466963_0761726_47_421 | 107 |
| 926 | 3300013297 | Ga0157378_10235048 | Ga0157378_102350481 | 110 |
| 927 | 3300003214 | JGI25165J46597_1000003 | JGI25165J46597_1000003682 | 115 |
| 928 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015102 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pug-assembly2.cif.gz_B | bola1 from arabidopsis thaliana | 0.9413 | 21 | 111 |
| 4pug-assembly1.cif.gz_A | bola1 from arabidopsis thaliana | 0.8976 | 23 | 111 |
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.8966 | 20 | 114 |
| 4pug-assembly2.cif.gz_B | bola1 from arabidopsis thaliana | 0.887 | 21 | 111 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8832 | 23 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4puiA01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9272 | 23 | 111 | 3.30.300.90 |
| af_Q8I3V0_1_83_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.917 | 20 | 114 | 3.10.20.90 |
| af_Q9USK1_28_105_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9156 | 22 | 108 | 3.30.300.90 |
| af_Q69ZI6_1_85_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.907 | 23 | 115 | 3.10.20.90 |
| af_Q682I1_66_160_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9042 | 23 | 111 | 3.30.300.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M7GAI9-F1-model_v4 | Transcriptional regulator, BolA protein family | 0.9614 | 21 | 108 |
GO:0016226
|
| AF-A0A2A4T0I0-F1-model_v4 | BolA family transcriptional regulator | 0.9412 | 23 | 114 |
|
| AF-A0A5E4ZLT4-F1-model_v4 | BolA family protein | 0.9375 | 20 | 111 |
GO:0016226
|
| AF-A0A451DHS3-F1-model_v4 | DNA-binding transcriptional regulator BolA | 0.9358 | 21 | 114 |
GO:0003677
GO:0005829 GO:0006351 |
| AF-A0A2E8TP03-F1-model_v4 | BolA family transcriptional regulator | 0.9351 | 20 | 114 |
GO:0016226
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar