F485928

General Info

Members Datasets Scaffolds Average Seq Length
926 398 926 174

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0247735|Ga0501047_0247735_782_1381
Length 199
Sequence MTKRASPSAKSAKPVSPAWSVPIAVTDVPESGRHVDLVADAAARDAIAKAGGLAGLARLEASFDLTRQGDDGLRATGRVTASVVQTCVVTLEPIESEVDEPIDLIFSADETAASADGGREPQSKPPKAVQALEAEDPPETLHNGMADLGAVATEFLLLGIDPYPRKPGVVFDAPPAGDPSSHPFAALAALKKDGGSKGP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
22 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
23 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
138 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
139 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
140 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
236 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
244 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
249 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
250 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
251 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
252 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
255 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
257 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
259 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
260 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
261 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
262 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
263 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
264 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
265 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
266 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
267 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
270 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
280 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
302 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
310 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
394 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
395 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
396 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
397 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 7.45
Rhizosphere 91.79
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772991 2209111006 Bacteria 11804
2 ARcpr5oldR_c000005 3300000041 Bacteria 43151
3 ARSoilYngRDRAFT_c00062 3300000042 Bacteria 17580
4 ARcpr5yngRDRAFT_c000168 3300000043 Bacteria 10337
5 ARSoilOldRDRAFT_c000012 3300000044 Bacteria 42830
6 ARCol0yngRDRAFT_1001158 3300000652 Bacteria 2230
7 JGI24032J14994_100787 3300001430 Bacteria 1607
8 JGI24752J21851_1009462 3300001976 Bacteria 1272
9 JGI24747J21853_1001463 3300001978 Bacteria 1774
10 JGI24739J22299_10002632 3300001989 Bacteria 6914
11 JGI24737J22298_10004262 3300001990 Bacteria 4995
12 JGI24737J22298_10010328 3300001990 Bacteria 3083
13 JGI24743J22301_10001995 3300001991 Bacteria 2981
14 JGI24743J22301_10065934 3300001991 Bacteria 750
15 JGI24748J21848_1000352 3300002074 Bacteria 5291
16 JGI24738J21930_10000471 3300002075 Bacteria 11404
17 JGI24749J21850_1000776 3300002076 Bacteria 4600
18 JGI24744J21845_10019731 3300002077 Bacteria 1333
19 JGI24035J26624_1000132 3300002126 Bacteria 6606
20 JGI24033J26618_1000622 3300002155 Bacteria 3411
21 JGI24034J26672_10002780 3300002239 Bacteria 2417
22 JGI24742J22300_10000997 3300002244 Bacteria 4353
23 JGI26145J50221_1004394 3300003371 Bacteria 1141
24 Ga0065717_1002352 3300005276 Bacteria 2120
25 Ga0065716_1001728 3300005277 Bacteria 3751
26 Ga0065714_10233309 3300005288 Bacteria 811
27 Ga0065704_10081191 3300005289 Bacteria 3805
28 Ga0065712_10002169 3300005290 Bacteria 5824
29 Ga0065712_10073252 3300005290 Bacteria 4450
30 Ga0065712_10092767 3300005290 Bacteria 2282
31 Ga0065715_10001386 3300005293 Bacteria 6343
32 Ga0065715_10009694 3300005293 Bacteria 4472
33 Ga0065707_10145805 3300005295 Bacteria 1715
34 Ga0070658_10317426 3300005327 Bacteria 1330
35 Ga0070676_10001202 3300005328 Bacteria 12981
36 Ga0070676_10036391 3300005328 Bacteria 2836
37 Ga0070676_10545829 3300005328 Bacteria 829
38 Ga0070676_10566619 3300005328 Bacteria 815
39 Ga0070683_100000121 3300005329 Bacteria 50845
40 Ga0070683_100494255 3300005329 Bacteria 1168
41 Ga0070690_100012170 3300005330 Bacteria 5057
42 Ga0070690_100018802 3300005330 Bacteria 4181
43 Ga0070690_100552976 3300005330 Bacteria 868
44 Ga0070670_100005999 3300005331 Bacteria 10273
45 Ga0070670_100588944 3300005331 Bacteria 994
46 Ga0070670_100770912 3300005331 Unclassified 867
47 Ga0070677_10000055 3300005333 Bacteria 35005
48 Ga0068869_100000507 3300005334 Bacteria 21693
49 Ga0070666_10113417 3300005335 Bacteria 1875
50 Ga0070680_100011815 3300005336 Bacteria 6773
51 Ga0070680_100039387 3300005336 Bacteria 3824
52 Ga0070682_100000697 3300005337 Bacteria 20192
53 Ga0070682_100074907 3300005337 Bacteria 2175
54 Ga0070682_100693463 3300005337 Unclassified 816
55 Ga0068868_100002501 3300005338 Bacteria 12763
56 Ga0068868_100035322 3300005338 Bacteria 3863
57 Ga0070660_100010372 3300005339 Bacteria 6584
58 Ga0070660_100021731 3300005339 Bacteria 4737
59 Ga0070660_100028614 3300005339 Bacteria 4171
60 Ga0070689_100012275 3300005340 Bacteria 6165
61 Ga0070689_100016030 3300005340 Bacteria 5479
62 Ga0070689_100710855 3300005340 Unclassified 878
63 Ga0070691_10000371 3300005341 Bacteria 16253
64 Ga0070691_10049975 3300005341 Bacteria 1994
65 Ga0070691_10124863 3300005341 Bacteria 1299
66 Ga0070687_100002788 3300005343 Bacteria 6647
67 Ga0070687_100198356 3300005343 Bacteria 1214
68 Ga0070687_100236967 3300005343 Bacteria 1126
69 Ga0070661_100000881 3300005344 Bacteria 21577
70 Ga0070661_100063143 3300005344 Bacteria 2720
71 Ga0070661_100134575 3300005344 Bacteria 1859
72 Ga0070692_10000573 3300005345 Bacteria 11543
73 Ga0070692_10114989 3300005345 Bacteria 1493
74 Ga0070668_100004237 3300005347 Bacteria 10641
75 Ga0070668_100717399 3300005347 Unclassified 883
76 Ga0070668_100883041 3300005347 Bacteria 798
77 Ga0070669_100019063 3300005353 Bacteria 4904
78 Ga0070669_100088954 3300005353 Bacteria 2312
79 Ga0070675_100000698 3300005354 Bacteria 23271
80 Ga0070675_100132075 3300005354 Bacteria 2128
81 Ga0070675_100459874 3300005354 Bacteria 1142
82 Ga0070675_100558554 3300005354 Bacteria 1036
83 Ga0070671_100000344 3300005355 Bacteria 31796
84 Ga0070671_100207883 3300005355 Bacteria 1660
85 Ga0070671_101136440 3300005355 Unclassified 686
86 Ga0070674_100000116 3300005356 Bacteria 37121
87 Ga0070674_100027684 3300005356 Bacteria 3716
88 Ga0070673_100000335 3300005364 Bacteria 24640
89 Ga0070688_100000565 3300005365 Bacteria 18794
90 Ga0070688_100034718 3300005365 Bacteria 3057
91 Ga0070688_100076623 3300005365 Bacteria 2152
92 Ga0070688_100205517 3300005365 Bacteria 1380
93 Ga0070659_100011128 3300005366 Bacteria 6647
94 Ga0070659_100018339 3300005366 Bacteria 5282
95 Ga0070659_100079053 3300005366 Bacteria 2625
96 Ga0070659_100664178 3300005366 Bacteria 899
97 Ga0070667_100007699 3300005367 Bacteria 8931
98 Ga0070667_100013516 3300005367 Bacteria 6746
99 Ga0070667_100071592 3300005367 Bacteria 2953
100 Ga0070667_100448698 3300005367 Bacteria 1178
101 Ga0070709_10021059 3300005434 Bacteria 3795
102 Ga0070709_10076401 3300005434 Bacteria 2175
103 Ga0070709_10212169 3300005434 Bacteria 1377
104 Ga0070709_10272693 3300005434 Bacteria 1227
105 Ga0070709_10673828 3300005434 Bacteria 803
106 Ga0070714_100065392 3300005435 Bacteria 3132
107 Ga0070714_100069959 3300005435 Bacteria 3032
108 Ga0070714_101010215 3300005435 Bacteria 809
109 Ga0070713_100002431 3300005436 Bacteria 12142
110 Ga0070713_100203833 3300005436 Bacteria 1787
111 Ga0070713_100416733 3300005436 Bacteria 1257
112 Ga0070710_10009728 3300005437 Bacteria 4709
113 Ga0070701_10002810 3300005438 Bacteria 6773
114 Ga0070701_10054976 3300005438 Bacteria 2077
115 Ga0070711_100054515 3300005439 Bacteria 2759
116 Ga0070711_100376657 3300005439 Bacteria 1146
117 Ga0070711_100410003 3300005439 Bacteria 1102
118 Ga0070711_100974294 3300005439 Unclassified 727
119 Ga0070705_100013561 3300005440 Bacteria 4172
120 Ga0070705_100037987 3300005440 Bacteria 2720
121 Ga0070705_100122110 3300005440 Bacteria 1683
122 Ga0070705_100173743 3300005440 Bacteria 1453
123 Ga0070700_100005744 3300005441 Bacteria 6584
124 Ga0070700_100008316 3300005441 Bacteria 5647
125 Ga0070694_100016106 3300005444 Bacteria 4705
126 Ga0070694_100046557 3300005444 Bacteria 2912
127 Ga0070694_100308992 3300005444 Bacteria 1214
128 Ga0070708_100011088 3300005445 Bacteria 7325
129 Ga0070708_100979878 3300005445 Unclassified 793
130 Ga0070708_101114220 3300005445 Unclassified 739
131 Ga0070663_100001736 3300005455 Bacteria 12106
132 Ga0070678_100000684 3300005456 Bacteria 16710
133 Ga0070678_100029338 3300005456 Bacteria 3765
134 Ga0070678_100059106 3300005456 Bacteria 2816
135 Ga0070678_100172611 3300005456 Bacteria 1762
136 Ga0070662_100009413 3300005457 Bacteria 6385
137 Ga0070662_100018312 3300005457 Bacteria 4736
138 Ga0070681_10006902 3300005458 Bacteria 11053
139 Ga0070681_10017105 3300005458 Bacteria 7248
140 Ga0070681_10035745 3300005458 Bacteria 4990
141 Ga0070681_10048173 3300005458 Bacteria 4259
142 Ga0070681_10321151 3300005458 Bacteria 1458
143 Ga0068867_100004625 3300005459 Bacteria 9680
144 Ga0068867_100075112 3300005459 Bacteria 2535
145 Ga0068867_100112213 3300005459 Bacteria 2096
146 Ga0070685_10002368 3300005466 Bacteria 9702
147 Ga0070685_10016634 3300005466 Bacteria 3922
148 Ga0070685_10458801 3300005466 Unclassified 894
149 Ga0070707_100697664 3300005468 Unclassified 978
150 Ga0070679_100001791 3300005530 Bacteria 19375
151 Ga0070679_100091672 3300005530 Bacteria 3027
152 Ga0070679_100537601 3300005530 Bacteria 1112
153 Ga0070684_100036545 3300005535 Bacteria 4209
154 Ga0070697_100061498 3300005536 Bacteria 3063
155 Ga0068853_100019599 3300005539 Bacteria 5612
156 Ga0068853_100389278 3300005539 Unclassified 1303
157 Ga0068853_100916697 3300005539 Bacteria 842
158 Ga0070672_100000741 3300005543 Bacteria 19384
159 Ga0070672_100111863 3300005543 Bacteria 2227
160 Ga0070672_100526003 3300005543 Unclassified 1025
161 Ga0070686_100009437 3300005544 Bacteria 5486
162 Ga0070686_100018881 3300005544 Bacteria 4055
163 Ga0070686_100034442 3300005544 Bacteria 3121
164 Ga0070686_100123565 3300005544 Bacteria 1780
165 Ga0070686_100829771 3300005544 Bacteria 747
166 Ga0070695_100015651 3300005545 Bacteria 4581
167 Ga0070695_100017329 3300005545 Bacteria 4367
168 Ga0070695_100269106 3300005545 Bacteria 1248
169 Ga0070696_100007917 3300005546 Bacteria 7095
170 Ga0070696_100049562 3300005546 Bacteria 2917
171 Ga0070696_100476917 3300005546 Bacteria 989
172 Ga0070696_100518426 3300005546 Bacteria 951
173 Ga0070693_100001254 3300005547 Bacteria 11478
174 Ga0070693_100047004 3300005547 Bacteria 2454
175 Ga0070693_100244817 3300005547 Bacteria 1186
176 Ga0070704_100016209 3300005549 Bacteria 4705
177 Ga0070704_100445285 3300005549 Bacteria 1114
178 Ga0070704_100561447 3300005549 Unclassified 999
179 Ga0068855_100046827 3300005563 Bacteria 5111
180 Ga0068855_100305269 3300005563 Bacteria 1762
181 Ga0070664_100015589 3300005564 Bacteria 6218
182 Ga0070664_100109821 3300005564 Bacteria 2406
183 Ga0070664_100136293 3300005564 Bacteria 2159
184 Ga0070664_100211431 3300005564 Bacteria 1733
185 Ga0068857_100000680 3300005577 Bacteria 25262
186 Ga0068857_100862312 3300005577 Unclassified 867
187 Ga0068854_100000760 3300005578 Bacteria 19146
188 Ga0068854_100422104 3300005578 Unclassified 1108
189 Ga0068856_100021374 3300005614 Bacteria 6291
190 Ga0068856_100133395 3300005614 Bacteria 2489
191 Ga0068856_100354397 3300005614 Bacteria 1486
192 Ga0068856_100469223 3300005614 Bacteria 1279
193 Ga0070702_100000099 3300005615 Bacteria 25765
194 Ga0070702_100091849 3300005615 Bacteria 1843
195 Ga0068852_100008756 3300005616 Bacteria 7484
196 Ga0068859_100040793 3300005617 Bacteria 4661
197 Ga0068859_100050417 3300005617 Bacteria 4181
198 Ga0068859_100116623 3300005617 Bacteria 2735
199 Ga0068864_100016990 3300005618 Bacteria 6063
200 Ga0068864_100032401 3300005618 Bacteria 4441
201 Ga0068866_10087986 3300005718 Bacteria 1685
202 Ga0068866_10271784 3300005718 Unclassified 1046
203 Ga0068861_100000354 3300005719 Bacteria 26182
204 Ga0068861_100403951 3300005719 Bacteria 1213
205 Ga0068861_100588337 3300005719 Unclassified 1020
206 Ga0068870_10000395 3300005840 Bacteria 16399
207 Ga0068870_10168481 3300005840 Bacteria 1305
208 Ga0068863_100013197 3300005841 Bacteria 7969
209 Ga0068863_100199343 3300005841 Bacteria 1925
210 Ga0068858_100017831 3300005842 Bacteria 6647
211 Ga0068858_100105846 3300005842 Bacteria 2625
212 Ga0068858_100117158 3300005842 Bacteria 2489
213 Ga0068858_100169299 3300005842 Bacteria 2059
214 Ga0068858_101160414 3300005842 Bacteria 759
215 Ga0068860_100007901 3300005843 Bacteria 10619
216 Ga0068860_100116923 3300005843 Bacteria 2551
217 Ga0068862_100013455 3300005844 Bacteria 6773
218 Ga0068862_100043042 3300005844 Bacteria 3849
219 Ga0081455_10001802 3300005937 Bacteria 25849
220 Ga0081538_10072545 3300005981 Bacteria 1886
221 Ga0070717_10003856 3300006028 Bacteria 10784
222 Ga0070717_10459021 3300006028 Bacteria 1149
223 Ga0075432_10002763 3300006058 Bacteria 5880
224 Ga0070715_10001764 3300006163 Bacteria 6436
225 Ga0070715_10053220 3300006163 Bacteria 1749
226 Ga0070716_100028646 3300006173 Bacteria 3002
227 Ga0070712_100108179 3300006175 Bacteria 2070
228 Ga0070712_100874989 3300006175 Bacteria 774
229 Ga0075427_10000518 3300006194 Bacteria 4424
230 Ga0097621_100000430 3300006237 Bacteria 29289
231 Ga0097621_100028001 3300006237 Bacteria 4436
232 Ga0097621_100039378 3300006237 Bacteria 3796
233 Ga0097621_100398693 3300006237 Bacteria 1231
234 Ga0097621_100638827 3300006237 Bacteria 976
235 Ga0068871_100000243 3300006358 Bacteria 37961
236 Ga0068871_100034565 3300006358 Bacteria 4012
237 Ga0068871_100325530 3300006358 Bacteria 1354
238 Ga0068871_101108004 3300006358 Bacteria 740
239 Ga0075428_100028729 3300006844 Bacteria 6153
240 Ga0075430_100000571 3300006846 Bacteria 27962
241 Ga0075431_100000808 3300006847 Bacteria 27366
242 Ga0075433_10000023 3300006852 Bacteria 59195
243 Ga0075433_10027633 3300006852 Bacteria 4814
244 Ga0075433_10664047 3300006852 Bacteria 914
245 Ga0075434_100003484 3300006871 Bacteria 14071
246 Ga0075434_100030033 3300006871 Bacteria 5350
247 Ga0075434_100077844 3300006871 Bacteria 3311
248 Ga0075434_100236708 3300006871 Bacteria 1846
249 Ga0075434_100585618 3300006871 Bacteria 1135
250 Ga0075429_100000227 3300006880 Bacteria 38168
251 Ga0068865_100000675 3300006881 Bacteria 19258
252 Ga0068865_100085676 3300006881 Bacteria 2273
253 Ga0068865_100167775 3300006881 Unclassified 1680
254 Ga0075436_100707989 3300006914 Bacteria 746
255 Ga0097620_100040793 3300006931 Bacteria 4661
256 Ga0097620_100050415 3300006931 Bacteria 4181
257 Ga0097620_100116630 3300006931 Bacteria 2735
258 Ga0075435_100033874 3300007076 Bacteria 4042
259 Ga0075435_100088892 3300007076 Bacteria 2547
260 Ga0099794_10010739 3300007265 Bacteria 3897
261 Ga0099795_10004198 3300007788 Bacteria 3687
262 Ga0105251_10120382 3300009011 Bacteria 1192
263 Ga0105244_10099861 3300009036 Bacteria 1420
264 Ga0105240_10045886 3300009093 Bacteria 5541
265 Ga0111539_10000561 3300009094 Bacteria 47610
266 Ga0111539_10004002 3300009094 Bacteria 19352
267 Ga0111539_10004660 3300009094 Bacteria 17922
268 Ga0105245_10000943 3300009098 Bacteria 26432
269 Ga0105245_10242766 3300009098 Bacteria 1747
270 Ga0105245_10306616 3300009098 Unclassified 1560
271 Ga0105245_10383915 3300009098 Unclassified 1399
272 Ga0105245_11135927 3300009098 Bacteria 828
273 Ga0105247_10014588 3300009101 Bacteria 4713
274 Ga0105247_10032411 3300009101 Bacteria 3175
275 Ga0105247_10057226 3300009101 Bacteria 2410
276 Ga0105247_10196345 3300009101 Bacteria 1353
277 Ga0105247_10274535 3300009101 Bacteria 1161
278 Ga0114129_10039587 3300009147 Bacteria 6646
279 Ga0114129_10042755 3300009147 Bacteria 6377
280 Ga0114129_10570794 3300009147 Bacteria 1469
281 Ga0105243_10002854 3300009148 Bacteria 14321
282 Ga0105243_10008993 3300009148 Bacteria 7635
283 Ga0105243_10067794 3300009148 Bacteria 2874
284 Ga0105243_10470894 3300009148 Bacteria 1183
285 Ga0105241_10001331 3300009174 Bacteria 18766
286 Ga0105241_10106665 3300009174 Bacteria 2236
287 Ga0105241_10141848 3300009174 Bacteria 1957
288 Ga0105242_10000036 3300009176 Bacteria 91470
289 Ga0105242_10022615 3300009176 Bacteria 4948
290 Ga0105242_10052059 3300009176 Bacteria 3339
291 Ga0105248_10043021 3300009177 Bacteria 5065
292 Ga0105248_10093214 3300009177 Bacteria 3392
293 Ga0105237_10030440 3300009545 Bacteria 5482
294 Ga0105237_10093691 3300009545 Bacteria 2993
295 Ga0105237_10170505 3300009545 Bacteria 2176
296 Ga0105237_10179751 3300009545 Bacteria 2116
297 Ga0105238_10787553 3300009551 Bacteria 966
298 Ga0105249_10018622 3300009553 Bacteria 6183
299 Ga0105249_10021070 3300009553 Bacteria 5834
300 Ga0105249_10274607 3300009553 Bacteria 1680
301 Ga0099796_10000963 3300010159 Bacteria 5386
302 Ga0099796_10104864 3300010159 Bacteria 1069
303 Ga0105239_10024026 3300010375 Bacteria 6713
304 Ga0105239_10049423 3300010375 Bacteria 4612
305 Ga0105239_10087245 3300010375 Bacteria 3440
306 Ga0105239_10250014 3300010375 Bacteria 1991
307 Ga0105246_10014421 3300011119 Bacteria 4971
308 Ga0105246_10047304 3300011119 Bacteria 2937
309 Ga0105246_11171327 3300011119 Unclassified 706
310 Ga0157336_1003052 3300012477 Bacteria 985
311 Ga0157325_1001007 3300012485 Bacteria 1214
312 Ga0157325_1004613 3300012485 Unclassified 816
313 Ga0157341_1000404 3300012494 Bacteria 2139
314 Ga0157338_1029864 3300012515 Bacteria 689
315 Ga0157373_10004533 3300013100 Bacteria 10449
316 Ga0157373_10589986 3300013100 Bacteria 808
317 Ga0157371_10310476 3300013102 Bacteria 1143
318 Ga0157374_10012850 3300013296 Bacteria 7292
319 Ga0157374_10067682 3300013296 Bacteria 3358
320 Ga0157374_11722277 3300013296 Bacteria 652
321 Ga0157378_10000462 3300013297 Bacteria 38648
322 Ga0157378_10006814 3300013297 Bacteria 9968
323 Ga0157378_10352312 3300013297 Bacteria 1438
324 Ga0157378_11379373 3300013297 Bacteria 747
325 Ga0163162_10002063 3300013306 Bacteria 18880
326 Ga0163162_10015790 3300013306 Bacteria 7380
327 Ga0163162_10700153 3300013306 Bacteria 1135
328 Ga0163162_11251370 3300013306 Bacteria 843
329 Ga0163162_11975955 3300013306 Bacteria 668
330 Ga0157372_10134691 3300013307 Bacteria 2844
331 Ga0157375_10017542 3300013308 Bacteria 6464
332 Ga0157375_10070657 3300013308 Bacteria 3502
333 Ga0157375_10096764 3300013308 Bacteria 3025
334 Ga0157375_10351257 3300013308 Bacteria 1640
335 Ga0163163_10041884 3300014325 Bacteria 4481
336 Ga0163163_10790875 3300014325 Bacteria 1012
337 Ga0163163_10987147 3300014325 Bacteria 905
338 Ga0157380_10000274 3300014326 Bacteria 30965
339 Ga0157380_10053723 3300014326 Bacteria 3195
340 Ga0157377_10000470 3300014745 Bacteria 17366
341 Ga0157379_10007174 3300014968 Bacteria 9642
342 Ga0157379_10048436 3300014968 Bacteria 3793
343 Ga0157379_10076194 3300014968 Bacteria 3003
344 Ga0157379_10094357 3300014968 Bacteria 2685
345 Ga0157379_11773273 3300014968 Unclassified 606
346 Ga0157376_10000508 3300014969 Bacteria 25164
347 Ga0157376_10031773 3300014969 Bacteria 4233
348 Ga0157376_10118645 3300014969 Bacteria 2341
349 Ga0157376_10185265 3300014969 Bacteria 1905
350 Ga0157376_11055612 3300014969 Bacteria 837
351 Ga0163161_10001910 3300017792 Bacteria 15223
352 Ga0163161_10053704 3300017792 Bacteria 2922
353 Ga0163161_10179198 3300017792 Bacteria 1624
354 Ga0207666_1000356 3300025271 Bacteria 6282
355 Ga0207666_1005293 3300025271 Bacteria 1646
356 Ga0207697_10004946 3300025315 Bacteria 6282
357 Ga0207697_10120937 3300025315 Bacteria 1126
358 Ga0207655_1156957 3300025728 Unclassified 715
359 Ga0207713_1017837 3300025735 Bacteria 3536
360 Ga0207682_10000135 3300025893 Bacteria 33308
361 Ga0207692_10043247 3300025898 Bacteria 2240
362 Ga0207642_10000073 3300025899 Bacteria 27837
363 Ga0207642_10043867 3300025899 Bacteria 1976
364 Ga0207710_10018190 3300025900 Bacteria 2987
365 Ga0207710_10038243 3300025900 Bacteria 2122
366 Ga0207710_10189427 3300025900 Bacteria 1012
367 Ga0207710_10238883 3300025900 Unclassified 906
368 Ga0207710_10484005 3300025900 Bacteria 641
369 Ga0207688_10006665 3300025901 Bacteria 6282
370 Ga0207688_10044363 3300025901 Bacteria 2478
371 Ga0207680_10007561 3300025903 Bacteria 5305
372 Ga0207680_10014423 3300025903 Bacteria 4089
373 Ga0207680_10198124 3300025903 Bacteria 1367
374 Ga0207647_10012910 3300025904 Bacteria 5804
375 Ga0207685_10004709 3300025905 Bacteria 3507
376 Ga0207699_10006915 3300025906 Bacteria 5520
377 Ga0207699_10031208 3300025906 Bacteria 2990
378 Ga0207699_10260099 3300025906 Bacteria 1199
379 Ga0207699_10568269 3300025906 Bacteria 824
380 Ga0207645_10000457 3300025907 Bacteria 33747
381 Ga0207645_10043906 3300025907 Bacteria 2860
382 Ga0207645_10092845 3300025907 Bacteria 1942
383 Ga0207645_10492574 3300025907 Bacteria 829
384 Ga0207643_10000853 3300025908 Bacteria 18464
385 Ga0207643_10133104 3300025908 Bacteria 1481
386 Ga0207654_10000638 3300025911 Bacteria 19789
387 Ga0207707_10017958 3300025912 Bacteria 6167
388 Ga0207707_10036744 3300025912 Bacteria 4282
389 Ga0207707_10102568 3300025912 Bacteria 2501
390 Ga0207707_10787122 3300025912 Bacteria 793
391 Ga0207695_10036170 3300025913 Bacteria 5341
392 Ga0207671_10032909 3300025914 Bacteria 3858
393 Ga0207671_10170577 3300025914 Bacteria 1689
394 Ga0207671_10347437 3300025914 Bacteria 1176
395 Ga0207693_10014951 3300025915 Bacteria 6233
396 Ga0207693_10069871 3300025915 Bacteria 2748
397 Ga0207663_10052024 3300025916 Bacteria 2553
398 Ga0207663_10060610 3300025916 Bacteria 2398
399 Ga0207663_10087616 3300025916 Bacteria 2056
400 Ga0207663_10118737 3300025916 Bacteria 1807
401 Ga0207663_10344888 3300025916 Bacteria 1126
402 Ga0207660_10001020 3300025917 Bacteria 18545
403 Ga0207660_10018103 3300025917 Bacteria 4692
404 Ga0207660_10217779 3300025917 Bacteria 1497
405 Ga0207660_10339648 3300025917 Unclassified 1202
406 Ga0207662_10005471 3300025918 Bacteria 6773
407 Ga0207662_10014776 3300025918 Bacteria 4384
408 Ga0207662_10268179 3300025918 Bacteria 1126
409 Ga0207657_10025718 3300025919 Bacteria 5422
410 Ga0207657_10031026 3300025919 Bacteria 4846
411 Ga0207657_10077962 3300025919 Bacteria 2792
412 Ga0207649_10000760 3300025920 Bacteria 20983
413 Ga0207649_10011720 3300025920 Bacteria 4845
414 Ga0207649_10068178 3300025920 Bacteria 2261
415 Ga0207652_10000764 3300025921 Bacteria 30807
416 Ga0207652_10141361 3300025921 Bacteria 2152
417 Ga0207652_10203626 3300025921 Bacteria 1781
418 Ga0207652_10798136 3300025921 Unclassified 838
419 Ga0207646_10257654 3300025922 Bacteria 1577
420 Ga0207681_10000065 3300025923 Bacteria 98832
421 Ga0207694_10399188 3300025924 Bacteria 1143
422 Ga0207650_10001773 3300025925 Bacteria 15269
423 Ga0207650_10594567 3300025925 Bacteria 930
424 Ga0207659_10000142 3300025926 Bacteria 42302
425 Ga0207659_10017702 3300025926 Bacteria 4657
426 Ga0207659_10253946 3300025926 Bacteria 1427
427 Ga0207687_10000125 3300025927 Bacteria 51567
428 Ga0207687_10498333 3300025927 Bacteria 1016
429 Ga0207687_10507615 3300025927 Bacteria 1007
430 Ga0207687_10808658 3300025927 Bacteria 800
431 Ga0207700_10010816 3300025928 Bacteria 5788
432 Ga0207700_10043361 3300025928 Bacteria 3304
433 Ga0207664_10101878 3300025929 Bacteria 2373
434 Ga0207644_10002125 3300025931 Bacteria 12862
435 Ga0207644_10004403 3300025931 Bacteria 9137
436 Ga0207644_10145342 3300025931 Bacteria 1830
437 Ga0207644_11044831 3300025931 Unclassified 686
438 Ga0207690_10003823 3300025932 Bacteria 8908
439 Ga0207690_10013751 3300025932 Bacteria 4872
440 Ga0207706_10019275 3300025933 Bacteria 6135
441 Ga0207706_10019316 3300025933 Bacteria 6129
442 Ga0207706_10025926 3300025933 Bacteria 5249
443 Ga0207706_10378065 3300025933 Unclassified 1229
444 Ga0207686_10000344 3300025934 Bacteria 33461
445 Ga0207686_10016499 3300025934 Bacteria 4146
446 Ga0207686_10083193 3300025934 Bacteria 2094
447 Ga0207709_10000183 3300025935 Bacteria 83374
448 Ga0207709_10045448 3300025935 Bacteria 2659
449 Ga0207709_10046256 3300025935 Bacteria 2640
450 Ga0207709_10260229 3300025935 Bacteria 1272
451 Ga0207670_10000288 3300025936 Bacteria 30769
452 Ga0207670_10034555 3300025936 Bacteria 3269
453 Ga0207670_10038515 3300025936 Bacteria 3123
454 Ga0207669_10000081 3300025937 Bacteria 48214
455 Ga0207669_10152204 3300025937 Bacteria 1622
456 Ga0207669_10864494 3300025937 Bacteria 753
457 Ga0207704_10000121 3300025938 Bacteria 42395
458 Ga0207704_10012634 3300025938 Bacteria 4195
459 Ga0207704_10056891 3300025938 Bacteria 2399
460 Ga0207704_10073584 3300025938 Bacteria 2177
461 Ga0207665_10002359 3300025939 Bacteria 12750
462 Ga0207691_10008864 3300025940 Bacteria 9655
463 Ga0207691_10095404 3300025940 Bacteria 2660
464 Ga0207711_10004044 3300025941 Bacteria 12590
465 Ga0207711_10043178 3300025941 Bacteria 3845
466 Ga0207711_10069734 3300025941 Bacteria 3048
467 Ga0207711_10098096 3300025941 Bacteria 2589
468 Ga0207689_10000696 3300025942 Bacteria 32214
469 Ga0207689_10169992 3300025942 Bacteria 1796
470 Ga0207661_10000286 3300025944 Bacteria 31850
471 Ga0207661_10532274 3300025944 Bacteria 1075
472 Ga0207679_10000064 3300025945 Bacteria 98118
473 Ga0207679_10059490 3300025945 Bacteria 2835
474 Ga0207679_10314830 3300025945 Bacteria 1353
475 Ga0207667_10007326 3300025949 Bacteria 13281
476 Ga0207667_10102130 3300025949 Bacteria 2958
477 Ga0207667_10104622 3300025949 Bacteria 2920
478 Ga0207651_10000395 3300025960 Bacteria 18475
479 Ga0207651_10006576 3300025960 Bacteria 6106
480 Ga0207651_10128535 3300025960 Bacteria 1935
481 Ga0207712_10000752 3300025961 Bacteria 24492
482 Ga0207712_10015902 3300025961 Bacteria 4862
483 Ga0207668_10000715 3300025972 Bacteria 20294
484 Ga0207668_10055847 3300025972 Bacteria 2747
485 Ga0207668_10131898 3300025972 Bacteria 1909
486 Ga0207640_10003491 3300025981 Bacteria 8467
487 Ga0207640_10094339 3300025981 Bacteria 2081
488 Ga0207658_10001038 3300025986 Bacteria 22571
489 Ga0207658_10084588 3300025986 Bacteria 2441
490 Ga0207658_10098487 3300025986 Bacteria 2285
491 Ga0207658_10336844 3300025986 Bacteria 1310
492 Ga0207658_10377723 3300025986 Bacteria 1240
493 Ga0207677_10000985 3300026023 Bacteria 15691
494 Ga0207677_10170894 3300026023 Bacteria 1699
495 Ga0207703_10001400 3300026035 Bacteria 21963
496 Ga0207703_10020429 3300026035 Bacteria 5179
497 Ga0207703_10091455 3300026035 Bacteria 2559
498 Ga0207703_10216388 3300026035 Bacteria 1711
499 Ga0207703_10295993 3300026035 Bacteria 1474
500 Ga0207639_10005141 3300026041 Bacteria 8820
501 Ga0207639_10046126 3300026041 Bacteria 3287
502 Ga0207639_11533059 3300026041 Bacteria 625
503 Ga0207678_10009603 3300026067 Bacteria 8508
504 Ga0207678_10034395 3300026067 Bacteria 4414
505 Ga0207678_10134606 3300026067 Bacteria 2109
506 Ga0207708_10012692 3300026075 Bacteria 6282
507 Ga0207708_10015109 3300026075 Bacteria 5784
508 Ga0207708_10095298 3300026075 Bacteria 2298
509 Ga0207708_10112366 3300026075 Bacteria 2116
510 Ga0207708_10191168 3300026075 Bacteria 1629
511 Ga0207702_10001395 3300026078 Bacteria 24082
512 Ga0207702_10418712 3300026078 Bacteria 1295
513 Ga0207702_10576329 3300026078 Bacteria 1103
514 Ga0207702_10733087 3300026078 Bacteria 975
515 Ga0207641_10003265 3300026088 Bacteria 14436
516 Ga0207641_10068229 3300026088 Bacteria 3048
517 Ga0207641_10264500 3300026088 Bacteria 1612
518 Ga0207641_10521470 3300026088 Unclassified 1156
519 Ga0207648_10008132 3300026089 Bacteria 10204
520 Ga0207648_10118095 3300026089 Bacteria 2331
521 Ga0207648_10551078 3300026089 Unclassified 1059
522 Ga0207676_10000079 3300026095 Bacteria 94811
523 Ga0207676_10004283 3300026095 Bacteria 10089
524 Ga0207676_11168801 3300026095 Unclassified 762
525 Ga0207674_10006886 3300026116 Bacteria 13321
526 Ga0207674_10270775 3300026116 Bacteria 1646
527 Ga0207675_100019734 3300026118 Bacteria 6291
528 Ga0207675_100023481 3300026118 Bacteria 5737
529 Ga0207675_101622671 3300026118 Bacteria 667
530 Ga0207683_10000037 3300026121 Bacteria 100920
531 Ga0207683_10006533 3300026121 Bacteria 9983
532 Ga0207683_10011735 3300026121 Bacteria 7478
533 Ga0207683_10040380 3300026121 Bacteria 4072
534 Ga0207698_10006345 3300026142 Bacteria 7368
535 Ga0207698_10062688 3300026142 Bacteria 2905
536 Ga0207698_11074951 3300026142 Bacteria 817
537 Ga0209973_1034280 3300027252 Bacteria 726
538 Ga0209967_1029468 3300027364 Bacteria 819
539 Ga0209179_1001119 3300027512 Bacteria 3129
540 Ga0209179_1003709 3300027512 Bacteria 2231
541 Ga0209970_1005518 3300027614 Bacteria 2088
542 Ga0210002_1001169 3300027617 Bacteria 3654
543 Ga0209971_1002495 3300027682 Bacteria 4413
544 Ga0209966_1001440 3300027695 Bacteria 4125
545 Ga0209998_10001960 3300027717 Bacteria 4829
546 Ga0209813_10057210 3300027866 Bacteria 1236
547 Ga0209974_10003753 3300027876 Bacteria 5440
548 Ga0209974_10017872 3300027876 Bacteria 2352
549 Ga0207428_10000292 3300027907 Bacteria 67070
550 Ga0207428_10002255 3300027907 Bacteria 19356
551 Ga0207428_10043033 3300027907 Bacteria 3650
552 Ga0268266_10014497 3300028379 Bacteria 6774
553 Ga0268265_10001133 3300028380 Bacteria 23531
554 Ga0268265_10009438 3300028380 Bacteria 6588
555 Ga0268264_10000805 3300028381 Bacteria 33825
556 Ga0268264_10178192 3300028381 Bacteria 1928
557 Ga0268264_10276005 3300028381 Bacteria 1572
558 Ga0268264_10584781 3300028381 Bacteria 1099
559 Ga0265325_10015804 3300031241 Bacteria 4234
560 Ga0265325_10121690 3300031241 Bacteria 1257
561 Ga0265340_10085097 3300031247 Bacteria 1484
562 Ga0265339_10008278 3300031249 Bacteria 6625
563 Ga0265316_10481371 3300031344 Unclassified 888
564 Ga0265313_10002244 3300031595 Bacteria 16997
565 Ga0307407_11075739 3300031903 Bacteria 624
566 Ga0373930_0001896 3300034816 Bacteria 3189
567 Ga0373930_0005241 3300034816 Bacteria 2147
568 Ga0373948_0000081 3300034817 Bacteria 9832
569 Ga0373948_0010170 3300034817 Bacteria 1638
570 Ga0373950_0003742 3300034818 Bacteria 2195
571 Ga0373958_0008357 3300034819 Bacteria 1674
572 Ga0373959_0000392 3300034820 Bacteria 8667
573 Ga0373959_0033741 3300034820 Bacteria 1045
574 Ga0373959_0159401 3300034820 Bacteria 575
575 Ga0373938_0000063 3300034957 Bacteria 13779
576 Ga0373938_0003923 3300034957 Bacteria 2461
577 Ga0373938_0005098 3300034957 Bacteria 2221
578 Ga0373926_0020321 3300035083 Bacteria 2294
579 Ga0373928_0001474 3300035084 Bacteria 4578
580 Ga0373928_0005009 3300035084 Bacteria 2524
581 Ga0373929_0001110 3300035085 Bacteria 5223
582 Ga0373929_0010975 3300035085 Bacteria 1700
583 Ga0373940_0000418 3300035088 Bacteria 6472
584 Ga0373940_0006847 3300035088 Bacteria 2549
585 Ga0373944_0015604 3300035089 Bacteria 2133
586 Ga0373944_0078723 3300035089 Bacteria 1085
587 Ga0373949_0000779 3300035090 Bacteria 10258
588 Ga0373949_0002326 3300035090 Bacteria 4938
589 Ga0373951_0001074 3300035091 Bacteria 7317
590 Ga0373951_0003704 3300035091 Bacteria 3688
591 Ga0373951_0005252 3300035091 Bacteria 3017
592 Ga0373952_0001672 3300035092 Bacteria 4033
593 Ga0373952_0003287 3300035092 Bacteria 2914
594 Ga0373923_0000419 3300035111 Bacteria 9940
595 Ga0373923_0052556 3300035111 Bacteria 1712
596 Ga0373923_0101479 3300035111 Bacteria 1269
597 Ga0373923_0363874 3300035111 Unclassified 692
598 Ga0373932_0000516 3300035112 Bacteria 11899
599 Ga0373932_0002506 3300035112 Bacteria 4619
600 Ga0373932_0002800 3300035112 Bacteria 4321
601 Ga0373932_0055942 3300035112 Bacteria 1185
602 Ga0373936_0000230 3300035113 Bacteria 18464
603 Ga0373936_0012305 3300035113 Bacteria 3253
604 Ga0373936_0148056 3300035113 Unclassified 1017
605 Ga0373939_0001269 3300035114 Bacteria 6162
606 Ga0373939_0003293 3300035114 Bacteria 3791
607 Ga0373939_0019437 3300035114 Bacteria 1833
608 Ga0373941_0001012 3300035115 Bacteria 5840
609 Ga0373941_0002320 3300035115 Bacteria 4170
610 Ga0373941_0064352 3300035115 Bacteria 1201
611 Ga0373945_0001082 3300035116 Bacteria 8196
612 Ga0373945_0010619 3300035116 Bacteria 3035
613 Ga0373945_0045730 3300035116 Bacteria 1595
614 Ga0373945_0060465 3300035116 Bacteria 1413
615 Ga0373945_0296320 3300035116 Unclassified 692
616 Ga0373953_0000282 3300035117 Bacteria 14066
617 Ga0373953_0005616 3300035117 Bacteria 4084
618 Ga0373953_0134580 3300035117 Unclassified 1055
619 Ga0373954_0000163 3300035118 Bacteria 23852
620 Ga0373954_0204860 3300035118 Bacteria 969
621 Ga0373956_0033016 3300035119 Bacteria 2274
622 Ga0373957_0011256 3300035120 Bacteria 2980
623 Ga0373960_0002055 3300035121 Bacteria 4527
624 Ga0373960_0002580 3300035121 Bacteria 4090
625 Ga0373960_0007020 3300035121 Bacteria 2656
626 Ga0373960_0122781 3300035121 Bacteria 863
627 Ga0373943_0017330 3300035170 Bacteria 3295
628 Ga0373943_0060003 3300035170 Bacteria 1898
629 Ga0373943_0432782 3300035170 Unclassified 762
630 Ga0373946_0000412 3300035171 Bacteria 13925
631 Ga0373946_0003737 3300035171 Bacteria 5398
632 Ga0373946_0053791 3300035171 Bacteria 1692
633 Ga0373946_0118446 3300035171 Bacteria 1206
634 Ga0373946_0243360 3300035171 Bacteria 875
635 Ga0373955_0000071 3300035172 Bacteria 40941
636 Ga0373955_0015938 3300035172 Bacteria 3689
637 Ga0373955_0023754 3300035172 Bacteria 3127
638 Ga0373955_0035556 3300035172 Bacteria 2638
639 Ga0373942_0000898 3300035207 Bacteria 8141
640 Ga0373942_0024768 3300035207 Bacteria 1541
641 Ga0373961_0003012 3300035241 Bacteria 4249
642 Ga0373961_0013509 3300035241 Bacteria 2060
643 Ga0373961_0099912 3300035241 Bacteria 938
644 Ga0373962_0006516 3300035242 Bacteria 2829
645 Ga0373962_0024611 3300035242 Bacteria 1611
646 Ga0373924_0002670 3300035410 Bacteria 6013
647 Ga0373924_0054259 3300035410 Bacteria 1666
648 Ga0373931_0002005 3300035691 Bacteria 8964
649 Ga0373931_0004422 3300035691 Bacteria 6420
650 Ga0373935_0001582 3300035692 Bacteria 12695
651 Ga0373935_0011061 3300035692 Bacteria 5421
652 Ga0373935_0048143 3300035692 Bacteria 2698
653 Ga0373935_0068391 3300035692 Bacteria 2285
654 Ga0373927_0001396 3300035695 Bacteria 18191
655 Ga0373927_0023381 3300035695 Bacteria 4047
656 Ga0373927_0073665 3300035695 Bacteria 2211
657 Ga0373927_0086810 3300035695 Bacteria 2031
658 Ga0373927_0098638 3300035695 Bacteria 1899
659 Ga0373933_0002030 3300035724 Bacteria 11646
660 Ga0373933_0051605 3300035724 Bacteria 2459
661 Ga0373933_0109401 3300035724 Bacteria 1722
662 Ga0373947_0000637 3300035725 Bacteria 20738
663 Ga0373947_0001895 3300035725 Bacteria 12777
664 Ga0373947_0156883 3300035725 Bacteria 1469
665 Ga0373937_0000162 3300036401 Bacteria 64742
666 Ga0373937_0001510 3300036401 Bacteria 19543
667 Ga0373937_0284846 3300036401 Bacteria 1561
668 Ga0373937_0516071 3300036401 Bacteria 1135
669 Ga0373937_0598338 3300036401 Bacteria 1047
670 Ga0373925_0000025 3300037068 Bacteria 154937
671 Ga0373925_0008479 3300037068 Bacteria 7492
672 Ga0373925_0104374 3300037068 Bacteria 2182
673 Ga0373925_0758266 3300037068 Bacteria 800
674 Ga0439448_0047442 3300042005 Bacteria 1401
675 Ga0466961_0211234 3300044693 Bacteria 1198
676 Ga0466963_0060629 3300044694 Bacteria 2527
677 Ga0453684_0590591 3300044712 Bacteria 1218
678 Ga0466971_0141098 3300044719 Unclassified 1122
679 Ga0466971_0257681 3300044719 Bacteria 832
680 Ga0466957_0195517 3300044842 Bacteria 1326
681 Ga0451576_0074642 3300045051 Bacteria 3529
682 Ga0466967_0344536 3300045976 Bacteria 1442
683 Ga0495617_043993 3300046452 Bacteria 1491
684 Ga0495592_0000132 3300046454 Bacteria 66310
685 Ga0495592_0132810 3300046454 Bacteria 1739
686 Ga0495603_0007685 3300046455 Bacteria 6495
687 Ga0495603_0096874 3300046455 Bacteria 1723
688 Ga0495629_0001003 3300046459 Bacteria 22634
689 Ga0495629_0013677 3300046459 Bacteria 5856
690 Ga0495629_0032442 3300046459 Bacteria 3698
691 Ga0495629_0181311 3300046459 Bacteria 1459
692 Ga0495629_0303900 3300046459 Bacteria 1092
693 Ga0495641_0027557 3300046461 Bacteria 2761
694 Ga0495651_0000308 3300046462 Bacteria 38022
695 Ga0495651_0012100 3300046462 Bacteria 6638
696 Ga0495653_0000041 3300046463 Bacteria 118366
697 Ga0495653_0000944 3300046463 Bacteria 22338
698 Ga0495580_0394786 3300046472 Unclassified 933
699 Ga0495582_0025753 3300046473 Bacteria 3222
700 Ga0495605_0199003 3300046474 Bacteria 874
701 Ga0495639_0011524 3300046475 Bacteria 3812
702 Ga0495639_0068574 3300046475 Bacteria 1635
703 Ga0495639_0104253 3300046475 Bacteria 1341
704 Ga0495662_0003042 3300046476 Bacteria 8456
705 Ga0495662_0030634 3300046476 Bacteria 2597
706 Ga0495662_0174406 3300046476 Bacteria 1059
707 Ga0495664_0000005 3300046477 Bacteria 439635
708 Ga0495664_0003269 3300046477 Bacteria 8808
709 Ga0495664_0065566 3300046477 Bacteria 2165
710 Ga0495584_0035734 3300046491 Bacteria 2511
711 Ga0495585_0004199 3300046492 Bacteria 9408
712 Ga0495594_0017659 3300046499 Bacteria 3772
713 Ga0495594_0045285 3300046499 Bacteria 2415
714 Ga0495607_0008348 3300046501 Bacteria 7084
715 Ga0495608_0000003 3300046511 Bacteria 369831
716 Ga0495608_0003838 3300046511 Bacteria 10802
717 Ga0495618_0000010 3300046514 Bacteria 189314
718 Ga0495618_0012117 3300046514 Bacteria 5234
719 Ga0495618_0493112 3300046514 Bacteria 739
720 Ga0495628_0000019 3300046516 Bacteria 154435
721 Ga0495630_0034834 3300046517 Bacteria 3761
722 Ga0495637_0045772 3300046520 Bacteria 1854
723 Ga0495637_0099064 3300046520 Bacteria 1141
724 Ga0495644_0001707 3300046523 Bacteria 8891
725 Ga0495666_0005800 3300046526 Bacteria 6224
726 Ga0495666_0023090 3300046526 Bacteria 3077
727 Ga0495666_0358899 3300046526 Unclassified 656
728 Ga0495652_0000028 3300046529 Bacteria 157336
729 Ga0495665_0029847 3300046531 Bacteria 2920
730 Ga0495640_0000014 3300046533 Bacteria 161741
731 Ga0495640_0019724 3300046533 Bacteria 4973
732 Ga0495640_0029249 3300046533 Bacteria 3958
733 Ga0495640_0059050 3300046533 Bacteria 2614
734 Ga0495586_0006928 3300046535 Bacteria 6037
735 Ga0495587_0000026 3300046536 Bacteria 147819
736 Ga0495587_0000520 3300046536 Bacteria 26784
737 Ga0495621_0041722 3300046539 Bacteria 1612
738 Ga0495645_0000005 3300046543 Bacteria 443917
739 Ga0495645_0068462 3300046543 Bacteria 2562
740 Ga0495645_0335078 3300046543 Bacteria 978
741 Ga0495622_0049938 3300046557 Bacteria 1942
742 Ga0495622_0159256 3300046557 Bacteria 1018
743 Ga0495633_0003249 3300046558 Bacteria 10952
744 Ga0495667_0000003 3300046559 Bacteria 295404
745 Ga0495667_0013996 3300046559 Bacteria 5416
746 Ga0495656_0000538 3300046615 Bacteria 12366
747 Ga0495634_0000017 3300046642 Bacteria 122411
748 Ga0495634_0109273 3300046642 Bacteria 1779
749 Ga0495634_0445112 3300046642 Bacteria 765
750 Ga0495611_0147671 3300046648 Bacteria 1097
751 Ga0495635_0000024 3300046663 Bacteria 148235
752 Ga0495635_0086535 3300046663 Bacteria 2144
753 Ga0495635_0789762 3300046663 Unclassified 612
754 Ga0495659_0004395 3300046664 Bacteria 4438
755 Ga0495661_0039583 3300046665 Bacteria 2929
756 Ga0495657_0000034 3300046675 Bacteria 122360
757 Ga0495599_0000017 3300046678 Bacteria 162507
758 Ga0495623_0000028 3300046679 Bacteria 87634
759 Ga0495623_0085678 3300046679 Bacteria 1943
760 Ga0495646_0000015 3300046680 Bacteria 141718
761 Ga0495646_0013001 3300046680 Bacteria 5292
762 Ga0495647_0002287 3300046681 Bacteria 6009
763 Ga0495647_0234204 3300046681 Unclassified 814
764 Ga0495647_0241297 3300046681 Bacteria 802
765 Ga0495647_0245496 3300046681 Unclassified 796
766 Ga0495658_0000814 3300046683 Bacteria 16758
767 Ga0495658_0542207 3300046683 Unclassified 745
768 Ga0495613_0009829 3300046689 Bacteria 7114
769 Ga0495613_0015645 3300046689 Bacteria 5646
770 Ga0495613_0300051 3300046689 Bacteria 1112
771 Ga0495613_0325835 3300046689 Bacteria 1059
772 Ga0495624_0077820 3300046690 Bacteria 2057
773 Ga0495624_0437415 3300046690 Bacteria 784
774 Ga0495624_0640513 3300046690 Bacteria 633
775 Ga0495670_0002388 3300046691 Bacteria 9251
776 Ga0495589_0049868 3300046794 Bacteria 2072
777 Ga0495600_0000058 3300046809 Bacteria 65689
778 Ga0495600_0314619 3300046809 Bacteria 985
779 Ga0495581_0001732 3300047315 Bacteria 12161
780 Ga0495581_0536787 3300047315 Unclassified 679
781 Ga0495604_0000021 3300047317 Bacteria 169432
782 Ga0495604_0407399 3300047317 Bacteria 894
783 Ga0495636_0024479 3300047318 Bacteria 2449
784 Ga0495674_0000005 3300047319 Bacteria 375129
785 Ga0495674_0005073 3300047319 Bacteria 12660
786 Ga0495674_0015663 3300047319 Bacteria 7078
787 Ga0495674_0036936 3300047319 Bacteria 4391
788 Ga0495676_0110984 3300047321 Bacteria 2012
789 Ga0495680_0000503 3300047322 Bacteria 44080
790 Ga0495680_0078375 3300047322 Bacteria 2500
791 Ga0495675_0000085 3300047444 Bacteria 65846
792 Ga0495675_0000462 3300047444 Bacteria 26793
793 Ga0495677_0028344 3300047445 Bacteria 2033
794 Ga0495679_042488 3300047446 Bacteria 1402
795 Ga0495684_0000001 3300047471 Bacteria 369809
796 Ga0495684_0069856 3300047471 Bacteria 2670
797 Ga0495593_0001873 3300047673 Bacteria 12527
798 Ga0495593_0005331 3300047673 Bacteria 7603
799 Ga0495593_0013840 3300047673 Bacteria 4596
800 Ga0495602_0000003 3300048088 Bacteria 357240
801 Ga0495602_0190424 3300048088 Bacteria 1573
802 Ga0495614_0244385 3300048089 Unclassified 820
803 Ga0496100_0000280 3300048903 Bacteria 25823
804 Ga0496100_0063094 3300048903 Bacteria 2447
805 Ga0496100_0490715 3300048903 Bacteria 945
806 Ga0496100_0641443 3300048903 Unclassified 826
807 Ga0496101_0000842 3300048904 Bacteria 18039
808 Ga0496101_0146317 3300048904 Bacteria 1804
809 Ga0496101_0202914 3300048904 Bacteria 1533
810 Ga0496101_0310723 3300048904 Bacteria 1236
811 Ga0496101_0790376 3300048904 Unclassified 748
812 Ga0496102_0001974 3300048905 Bacteria 17705
813 Ga0496102_0029775 3300048905 Bacteria 4885
814 Ga0496102_0080266 3300048905 Bacteria 3005
815 Ga0496102_0604560 3300048905 Bacteria 1019
816 Ga0496102_0637694 3300048905 Unclassified 988
817 Ga0496102_1150514 3300048905 Bacteria 695
818 Ga0496103_0000571 3300048906 Bacteria 29249
819 Ga0496103_0076208 3300048906 Bacteria 2104
820 Ga0496103_0091807 3300048906 Bacteria 1916
821 Ga0496103_0335983 3300048906 Bacteria 971
822 Ga0496104_0018615 3300048907 Bacteria 6338
823 Ga0496104_0084290 3300048907 Bacteria 3032
824 Ga0496104_0358944 3300048907 Bacteria 1369
825 Ga0496104_0459589 3300048907 Bacteria 1184
826 Ga0496105_0177532 3300048908 Unclassified 1744
827 Ga0496105_0348831 3300048908 Bacteria 1182
828 Ga0496105_0376308 3300048908 Unclassified 1130
829 Ga0496106_0005281 3300048909 Bacteria 9569
830 Ga0496106_0053120 3300048909 Bacteria 3059
831 Ga0496106_0350165 3300048909 Bacteria 1186
832 Ga0496107_0001700 3300048910 Bacteria 13784
833 Ga0496107_0014742 3300048910 Bacteria 5474
834 Ga0496107_0019205 3300048910 Bacteria 4822
835 Ga0496107_0021561 3300048910 Bacteria 4553
836 Ga0496107_0059648 3300048910 Bacteria 2761
837 Ga0496108_0006924 3300048911 Bacteria 9176
838 Ga0496108_0035403 3300048911 Bacteria 4150
839 Ga0496108_0058129 3300048911 Bacteria 3249
840 Ga0496109_0000260 3300048912 Bacteria 50877
841 Ga0496109_0030430 3300048912 Bacteria 4838
842 Ga0496109_0050809 3300048912 Bacteria 3775
843 Ga0496109_0121367 3300048912 Bacteria 2435
844 Ga0496109_0683562 3300048912 Bacteria 963
845 Ga0496109_1691428 3300048912 Unclassified 566
846 Ga0496110_0004713 3300048913 Bacteria 10609
847 Ga0496110_0024032 3300048913 Bacteria 5192
848 Ga0496110_0030828 3300048913 Bacteria 4624
849 Ga0496110_0155974 3300048913 Bacteria 2068
850 Ga0496110_0159711 3300048913 Bacteria 2043
851 Ga0496111_0155273 3300048914 Bacteria 1698
852 Ga0496111_0179959 3300048914 Bacteria 1571
853 Ga0496111_0217019 3300048914 Bacteria 1421
854 Ga0496111_0793617 3300048914 Bacteria 685
855 Ga0496112_0017732 3300048915 Bacteria 6700
856 Ga0496112_0092965 3300048915 Bacteria 2986
857 Ga0496112_0138679 3300048915 Bacteria 2402
858 Ga0496112_0259171 3300048915 Bacteria 1688
859 Ga0496113_0016864 3300048916 Bacteria 5055
860 Ga0496113_0032045 3300048916 Bacteria 3818
861 Ga0496113_0197993 3300048916 Bacteria 1596
862 Ga0496114_0010719 3300048917 Bacteria 7295
863 Ga0496114_0037495 3300048917 Bacteria 4009
864 Ga0496114_0500815 3300048917 Unclassified 1074
865 Ga0496114_1055880 3300048917 Bacteria 696
866 Ga0496115_0001610 3300048918 Bacteria 16223
867 Ga0496115_0059064 3300048918 Bacteria 3088
868 Ga0496115_0073306 3300048918 Bacteria 2779
869 Ga0496115_0115566 3300048918 Bacteria 2206
870 Ga0496115_0170764 3300048918 Bacteria 1798
871 Ga0496115_0503004 3300048918 Bacteria 973
872 Ga0496125_0342940 3300048928 Bacteria 896
873 Ga0496126_0445758 3300048929 Bacteria 1043
874 Ga0501033_0122276 3300049570 Bacteria 1888
875 Ga0501034_0537429 3300049571 Bacteria 1079
876 Ga0501034_1181547 3300049571 Bacteria 644
877 Ga0501036_0268183 3300049572 Bacteria 1430
878 Ga0501036_0311355 3300049572 Bacteria 1316
879 Ga0501047_0060498 3300049581 Bacteria 3655
880 Ga0501047_0247735 3300049581 Bacteria 1631
881 Ga0501070_0260191 3300049586 Unclassified 1418
882 Ga0501073_0337743 3300049589 Bacteria 1040
883 Ga0501077_0072649 3300049593 Bacteria 2180
884 Ga0501081_0156281 3300049743 Bacteria 1641
885 Ga0501083_0259950 3300049744 Bacteria 1130
886 Ga0501083_0580090 3300049744 Bacteria 730
887 Ga0501035_0100777 3300049822 Bacteria 2535
888 Ga0501035_0211061 3300049822 Bacteria 1661
889 Ga0501044_0051139 3300049823 Bacteria 4261
890 Ga0501044_0710743 3300049823 Unclassified 890
891 nmdc:mga04h51_251134_c1 3300050495 Bacteria 709
892 nmdc:mga07m45_206480_c1 3300050496 Bacteria 1143
893 nmdc:mga05p37_1109_c1 3300050507 Bacteria 30953
894 nmdc:mga09592_14828_c1 3300050508 Bacteria 6362
895 nmdc:mga0qj67_1459_c1 3300050509 Bacteria 16581
896 nmdc:mga06r32_19751_c1 3300050510 Bacteria 6192
897 nmdc:mga08y16_2292_c1 3300050511 Bacteria 19584
898 nmdc:mga08y16_855_c1 3300050511 Bacteria 29241
899 nmdc:mga08y16_8714_c1 3300050511 Bacteria 10636
900 nmdc:mga0n895_1286_c1 3300050512 Bacteria 18558
901 nmdc:mga0n895_219803_c1 3300050512 Bacteria 1929
902 nmdc:mga0n895_2848_c1 3300050512 Bacteria 13703
903 nmdc:mga0n895_77410_c1 3300050512 Bacteria 3309
904 nmdc:mga0n895_948732_c1 3300050512 Bacteria 844
905 nmdc:mga0rr50_181967_c1 3300050513 Bacteria 1719
906 nmdc:mga0rr50_58601_c1 3300050513 Bacteria 2887
907 nmdc:mga08x19_614070_c1 3300050514 Bacteria 771
908 nmdc:mga08x19_98914_c1 3300050514 Bacteria 1933
909 nmdc:mga0a205_160859_c1 3300050515 Bacteria 2142
910 nmdc:mga0a205_485_c1 3300050515 Bacteria 16164
911 nmdc:mga0a205_729_c1 3300050515 Bacteria 26502
912 Ga0495601_0000005 3300053077 Bacteria 387079
913 Ga0495601_0155041 3300053077 Bacteria 1495
914 Ga0495612_0000001 3300053078 Bacteria 418244
915 Ga0495612_0020051 3300053078 Bacteria 2678
916 Ga0495612_0054505 3300053078 Bacteria 1647
917 Ga0495595_0000166 3300053084 Bacteria 25987
918 Ga0495595_0005913 3300053084 Bacteria 4960
919 Ga0495619_0000007 3300053085 Bacteria 369936
920 Ga0495619_0000646 3300053085 Bacteria 22914
921 Ga0495619_0011191 3300053085 Bacteria 5642
922 Ga0495619_0051569 3300053085 Bacteria 2719
923 Ga0495619_0232748 3300053085 Bacteria 1276
924 Ga0500593_014970 3300053117 Bacteria 3335
925 Ga0500604_0064445 3300053151 Unclassified 1158
926 Ga0466962_0065625 3300061719 Bacteria 1733

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0156281 Ga0501081_0156281_14_448 141
2 3300046533 Ga0495640_0019724 Ga0495640_0019724_58_522 146
3 3300035112 Ga0373932_0055942 Ga0373932_0055942_16_471 147
4 3300006175 Ga0070712_100874989 Ga0070712_1008749891 151
5 3300005617 Ga0068859_100116623 Ga0068859_1001166232 154
6 3300006931 Ga0097620_100116630 Ga0097620_1001166303 154
7 3300025315 Ga0207697_10120937 Ga0207697_101209372 154
8 3300025931 Ga0207644_11044831 Ga0207644_110448311 154
9 3300026095 Ga0207676_11168801 Ga0207676_111688012 154
10 3300050496 nmdc:mga07m45_206480_c1 nmdc:mga07m45_206480_c1_649_1122 154
11 3300005549 Ga0070704_100445285 Ga0070704_1004452851 155
12 3300010375 Ga0105239_10250014 Ga0105239_102500143 155
13 3300026075 Ga0207708_10112366 Ga0207708_101123662 155
14 3300005458 Ga0070681_10017105 Ga0070681_100171054 157
15 3300005614 Ga0068856_100133395 Ga0068856_1001333953 157
16 3300005719 Ga0068861_100403951 Ga0068861_1004039512 157
17 3300006028 Ga0070717_10459021 Ga0070717_104590211 157
18 3300006163 Ga0070715_10053220 Ga0070715_100532201 157
19 3300006237 Ga0097621_100398693 Ga0097621_1003986932 157
20 3300006358 Ga0068871_100325530 Ga0068871_1003255302 157
21 3300017792 Ga0163161_10179198 Ga0163161_101791982 157
22 3300025900 Ga0207710_10189427 Ga0207710_101894272 157
23 3300025903 Ga0207680_10198124 Ga0207680_101981242 157
24 3300025914 Ga0207671_10347437 Ga0207671_103474372 157
25 3300025916 Ga0207663_10087616 Ga0207663_100876161 157
26 3300025919 Ga0207657_10077962 Ga0207657_100779623 157
27 3300025920 Ga0207649_10068178 Ga0207649_100681783 157
28 3300025921 Ga0207652_10141361 Ga0207652_101413613 157
29 3300025927 Ga0207687_10808658 Ga0207687_108086582 157
30 3300025931 Ga0207644_10145342 Ga0207644_101453422 157
31 3300025935 Ga0207709_10260229 Ga0207709_102602292 157
32 3300025937 Ga0207669_10864494 Ga0207669_108644941 157
33 3300025941 Ga0207711_10043178 Ga0207711_100431784 157
34 3300025949 Ga0207667_10102130 Ga0207667_101021302 157
35 3300025960 Ga0207651_10128535 Ga0207651_101285352 157
36 3300025986 Ga0207658_10336844 Ga0207658_103368442 157
37 3300026035 Ga0207703_10216388 Ga0207703_102163881 157
38 3300026041 Ga0207639_11533059 Ga0207639_115330591 157
39 3300026078 Ga0207702_10733087 Ga0207702_107330871 157
40 3300026121 Ga0207683_10006533 Ga0207683_100065334 157
41 3300028381 Ga0268264_10584781 Ga0268264_105847812 157
42 3300035089 Ga0373944_0015604 Ga0373944_0015604_1608_2093 157
43 3300044693 Ga0466961_0211234 Ga0466961_0211234_309_851 157
44 3300044694 Ga0466963_0060629 Ga0466963_0060629_544_1086 157
45 3300044719 Ga0466971_0141098 Ga0466971_0141098_196_741 157
46 3300044719 Ga0466971_0257681 Ga0466971_0257681_238_780 157
47 3300044842 Ga0466957_0195517 Ga0466957_0195517_248_790 157
48 3300045976 Ga0466967_0344536 Ga0466967_0344536_107_649 157
49 3300046476 Ga0495662_0174406 Ga0495662_0174406_15_500 157
50 3300048914 Ga0496111_0217019 Ga0496111_0217019_20_505 157
51 3300061719 Ga0466962_0065625 Ga0466962_0065625_384_926 157
52 3300005295 Ga0065707_10145805 Ga0065707_101458053 158
53 3300005434 Ga0070709_10673828 Ga0070709_106738281 158
54 3300005439 Ga0070711_100410003 Ga0070711_1004100032 158
55 3300006194 Ga0075427_10000518 Ga0075427_100005184 158
56 3300006852 Ga0075433_10000023 Ga0075433_1000002331 158
57 3300006852 Ga0075433_10664047 Ga0075433_106640471 158
58 3300006871 Ga0075434_100236708 Ga0075434_1002367083 158
59 3300006880 Ga0075429_100000227 Ga0075429_10000022711 158
60 3300006914 Ga0075436_100707989 Ga0075436_1007079891 158
61 3300007076 Ga0075435_100088892 Ga0075435_1000888924 158
62 3300025906 Ga0207699_10568269 Ga0207699_105682692 158
63 3300025916 Ga0207663_10344888 Ga0207663_103448882 158
64 3300035121 Ga0373960_0122781 Ga0373960_0122781_74_610 158
65 3300048904 Ga0496101_0310723 Ga0496101_0310723_589_1125 158
66 3300050512 nmdc:mga0n895_219803_c1 nmdc:mga0n895_219803_c1_1164_1700 158
67 3300050513 nmdc:mga0rr50_58601_c1 nmdc:mga0rr50_58601_c1_1634_2170 158
68 3300005543 Ga0070672_100526003 Ga0070672_1005260031 159
69 3300005718 Ga0068866_10087986 Ga0068866_100879862 159
70 3300005842 Ga0068858_100105846 Ga0068858_1001058462 159
71 3300006028 Ga0070717_10003856 Ga0070717_1000385614 159
72 3300006163 Ga0070715_10001764 Ga0070715_100017646 159
73 3300006173 Ga0070716_100028646 Ga0070716_1000286462 159
74 3300006237 Ga0097621_100028001 Ga0097621_1000280013 159
75 3300006358 Ga0068871_100034565 Ga0068871_1000345653 159
76 3300006881 Ga0068865_100085676 Ga0068865_1000856764 159
77 3300017792 Ga0163161_10053704 Ga0163161_100537042 159
78 3300025898 Ga0207692_10043247 Ga0207692_100432474 159
79 3300025899 Ga0207642_10043867 Ga0207642_100438672 159
80 3300025905 Ga0207685_10004709 Ga0207685_100047094 159
81 3300025907 Ga0207645_10092845 Ga0207645_100928452 159
82 3300025915 Ga0207693_10014951 Ga0207693_100149516 159
83 3300025916 Ga0207663_10052024 Ga0207663_100520243 159
84 3300025917 Ga0207660_10339648 Ga0207660_103396482 159
85 3300025918 Ga0207662_10268179 Ga0207662_102681791 159
86 3300025924 Ga0207694_10399188 Ga0207694_103991882 159
87 3300025927 Ga0207687_10507615 Ga0207687_105076152 159
88 3300025934 Ga0207686_10083193 Ga0207686_100831932 159
89 3300025935 Ga0207709_10046256 Ga0207709_100462564 159
90 3300025936 Ga0207670_10038515 Ga0207670_100385154 159
91 3300025938 Ga0207704_10056891 Ga0207704_100568912 159
92 3300025944 Ga0207661_10532274 Ga0207661_105322741 159
93 3300025945 Ga0207679_10314830 Ga0207679_103148301 159
94 3300025986 Ga0207658_10084588 Ga0207658_100845883 159
95 3300026067 Ga0207678_10134606 Ga0207678_101346062 159
96 3300026075 Ga0207708_10191168 Ga0207708_101911681 159
97 3300026088 Ga0207641_10068229 Ga0207641_100682292 159
98 3300026095 Ga0207676_10004283 Ga0207676_100042833 159
99 3300026121 Ga0207683_10040380 Ga0207683_100403802 159
100 3300028379 Ga0268266_10014497 Ga0268266_100144976 159
101 3300028381 Ga0268264_10178192 Ga0268264_101781922 159
102 3300047673 Ga0495593_0005331 Ga0495593_0005331_7078_7575 159
103 3300048905 Ga0496102_0604560 Ga0496102_0604560_35_532 159
104 3300048912 Ga0496109_1691428 Ga0496109_1691428_10_507 159
105 3300048914 Ga0496111_0793617 Ga0496111_0793617_156_653 159
106 3300013306 Ga0163162_11975955 Ga0163162_119759551 161
107 3300014968 Ga0157379_11773273 Ga0157379_117732731 162
108 3300005434 Ga0070709_10272693 Ga0070709_102726932 163
109 3300005435 Ga0070714_100069959 Ga0070714_1000699592 163
110 3300005439 Ga0070711_100974294 Ga0070711_1009742941 163
111 3300005614 Ga0068856_100354397 Ga0068856_1003543972 163
112 3300006175 Ga0070712_100108179 Ga0070712_1001081794 163
113 3300007265 Ga0099794_10010739 Ga0099794_100107392 163
114 3300010159 Ga0099796_10104864 Ga0099796_101048642 163
115 3300025906 Ga0207699_10260099 Ga0207699_102600992 163
116 3300025916 Ga0207663_10118737 Ga0207663_101187372 163
117 3300025929 Ga0207664_10101878 Ga0207664_101018782 163
118 3300027512 Ga0209179_1003709 Ga0209179_10037091 163
119 3300035085 Ga0373929_0001110 Ga0373929_0001110_18_509 163
120 3300035113 Ga0373936_0012305 Ga0373936_0012305_1892_2410 163
121 3300035242 Ga0373962_0006516 Ga0373962_0006516_2314_2814 163
122 3300035695 Ga0373927_0073665 Ga0373927_0073665_710_1228 163
123 3300035695 Ga0373927_0086810 Ga0373927_0086810_1111_1629 163
124 3300037068 Ga0373925_0758266 Ga0373925_0758266_89_607 163
125 3300046690 Ga0495624_0437415 Ga0495624_0437415_29_547 163
126 3300048912 Ga0496109_0121367 Ga0496109_0121367_26_517 163
127 3300005981 Ga0081538_10072545 Ga0081538_100725454 164
128 3300005290 Ga0065712_10073252 Ga0065712_100732523 165
129 3300005331 Ga0070670_100770912 Ga0070670_1007709122 165
130 3300005340 Ga0070689_100710855 Ga0070689_1007108552 165
131 3300005355 Ga0070671_101136440 Ga0070671_1011364401 165
132 3300005365 Ga0070688_100205517 Ga0070688_1002055172 165
133 3300005367 Ga0070667_100071592 Ga0070667_1000715923 165
134 3300005440 Ga0070705_100173743 Ga0070705_1001737432 165
135 3300005445 Ga0070708_101114220 Ga0070708_1011142201 165
136 3300005544 Ga0070686_100034442 Ga0070686_1000344422 165
137 3300005564 Ga0070664_100136293 Ga0070664_1001362931 165
138 3300005841 Ga0068863_100199343 Ga0068863_1001993433 165
139 3300005842 Ga0068858_100117158 Ga0068858_1001171581 165
140 3300006871 Ga0075434_100585618 Ga0075434_1005856182 165
141 3300009101 Ga0105247_10032411 Ga0105247_100324114 165
142 3300009177 Ga0105248_10093214 Ga0105248_100932144 165
143 3300014968 Ga0157379_10094357 Ga0157379_100943574 165
144 3300025941 Ga0207711_10098096 Ga0207711_100980961 165
145 3300025986 Ga0207658_10377723 Ga0207658_103777232 165
146 3300026035 Ga0207703_10091455 Ga0207703_100914551 165
147 3300026078 Ga0207702_10576329 Ga0207702_105763291 165
148 3300026088 Ga0207641_10264500 Ga0207641_102645002 165
149 3300048910 Ga0496107_0014742 Ga0496107_0014742_3099_3605 165
150 3300048911 Ga0496108_0035403 Ga0496108_0035403_1073_1579 165
151 3300048912 Ga0496109_0030430 Ga0496109_0030430_1475_1981 165
152 3300048913 Ga0496110_0159711 Ga0496110_0159711_589_1095 165
153 3300048914 Ga0496111_0155273 Ga0496111_0155273_151_657 165
154 3300048915 Ga0496112_0259171 Ga0496112_0259171_596_1102 165
155 3300048916 Ga0496113_0016864 Ga0496113_0016864_2734_3240 165
156 3300049586 Ga0501070_0260191 Ga0501070_0260191_49_603 165
157 3300007788 Ga0099795_10004198 Ga0099795_100041983 166
158 3300010159 Ga0099796_10000963 Ga0099796_100009632 166
159 3300027512 Ga0209179_1001119 Ga0209179_10011194 166
160 3300035111 Ga0373923_0052556 Ga0373923_0052556_912_1436 166
161 3300035111 Ga0373923_0101479 Ga0373923_0101479_160_729 166
162 3300035113 Ga0373936_0000230 Ga0373936_0000230_6038_6607 166
163 3300035116 Ga0373945_0001082 Ga0373945_0001082_7568_8137 166
164 3300035116 Ga0373945_0296320 Ga0373945_0296320_27_551 166
165 3300035117 Ga0373953_0000282 Ga0373953_0000282_13092_13661 166
166 3300035118 Ga0373954_0000163 Ga0373954_0000163_8979_9548 166
167 3300035170 Ga0373943_0060003 Ga0373943_0060003_298_867 166
168 3300035171 Ga0373946_0000412 Ga0373946_0000412_4192_4761 166
169 3300035172 Ga0373955_0000071 Ga0373955_0000071_28602_29171 166
170 3300035410 Ga0373924_0002670 Ga0373924_0002670_1592_2161 166
171 3300035692 Ga0373935_0001582 Ga0373935_0001582_2272_2841 166
172 3300035695 Ga0373927_0001396 Ga0373927_0001396_17287_17856 166
173 3300035724 Ga0373933_0002030 Ga0373933_0002030_3717_4286 166
174 3300035725 Ga0373947_0001895 Ga0373947_0001895_11209_11778 166
175 3300036401 Ga0373937_0000162 Ga0373937_0000162_12986_13555 166
176 3300037068 Ga0373925_0000025 Ga0373925_0000025_103181_103750 166
177 3300037068 Ga0373925_0104374 Ga0373925_0104374_1133_1657 166
178 3300046454 Ga0495592_0000132 Ga0495592_0000132_27306_27875 166
179 3300046459 Ga0495629_0013677 Ga0495629_0013677_3239_3808 166
180 3300046462 Ga0495651_0000308 Ga0495651_0000308_11322_11891 166
181 3300046463 Ga0495653_0000041 Ga0495653_0000041_86060_86629 166
182 3300046476 Ga0495662_0003042 Ga0495662_0003042_5445_6014 166
183 3300046477 Ga0495664_0000005 Ga0495664_0000005_120930_121499 166
184 3300046477 Ga0495664_0065566 Ga0495664_0065566_750_1274 166
185 3300046511 Ga0495608_0000003 Ga0495608_0000003_318079_318648 166
186 3300046514 Ga0495618_0000010 Ga0495618_0000010_96233_96802 166
187 3300046516 Ga0495628_0000019 Ga0495628_0000019_51188_51757 166
188 3300046529 Ga0495652_0000028 Ga0495652_0000028_51188_51757 166
189 3300046531 Ga0495665_0029847 Ga0495665_0029847_21_590 166
190 3300046533 Ga0495640_0000014 Ga0495640_0000014_109985_110554 166
191 3300046536 Ga0495587_0000026 Ga0495587_0000026_96063_96632 166
192 3300046543 Ga0495645_0000005 Ga0495645_0000005_120901_121470 166
193 3300046559 Ga0495667_0000003 Ga0495667_0000003_243163_243732 166
194 3300046642 Ga0495634_0000017 Ga0495634_0000017_72775_73344 166
195 3300046663 Ga0495635_0000024 Ga0495635_0000024_96457_97026 166
196 3300046675 Ga0495657_0000034 Ga0495657_0000034_31942_32511 166
197 3300046678 Ga0495599_0000017 Ga0495599_0000017_51507_52076 166
198 3300046679 Ga0495623_0000028 Ga0495623_0000028_21876_22445 166
199 3300046680 Ga0495646_0000015 Ga0495646_0000015_89964_90533 166
200 3300046689 Ga0495613_0015645 Ga0495613_0015645_3877_4446 166
201 3300046809 Ga0495600_0000058 Ga0495600_0000058_3562_4131 166
202 3300047315 Ga0495581_0001732 Ga0495581_0001732_4120_4689 166
203 3300047317 Ga0495604_0000021 Ga0495604_0000021_51185_51754 166
204 3300047319 Ga0495674_0000005 Ga0495674_0000005_323373_323942 166
205 3300047322 Ga0495680_0000503 Ga0495680_0000503_27351_27920 166
206 3300047444 Ga0495675_0000085 Ga0495675_0000085_28613_29182 166
207 3300047471 Ga0495684_0000001 Ga0495684_0000001_51164_51733 166
208 3300047673 Ga0495593_0001873 Ga0495593_0001873_7510_8079 166
209 3300048088 Ga0495602_0000003 Ga0495602_0000003_305484_306053 166
210 3300048917 Ga0496114_1055880 Ga0496114_1055880_153_677 166
211 3300049570 Ga0501033_0122276 Ga0501033_0122276_1228_1791 166
212 3300049581 Ga0501047_0060498 Ga0501047_0060498_2629_3192 166
213 3300049822 Ga0501035_0100777 Ga0501035_0100777_592_1155 166
214 3300049823 Ga0501044_0051139 Ga0501044_0051139_1963_2526 166
215 3300050495 nmdc:mga04h51_251134_c1 nmdc:mga04h51_251134_c1_55_564 166
216 3300053077 Ga0495601_0000005 Ga0495601_0000005_49068_49637 166
217 3300053078 Ga0495612_0000001 Ga0495612_0000001_366488_367057 166
218 3300053084 Ga0495595_0000166 Ga0495595_0000166_16569_17138 166
219 3300053085 Ga0495619_0000007 Ga0495619_0000007_51188_51757 166
220 3300005434 Ga0070709_10076401 Ga0070709_100764012 167
221 3300005436 Ga0070713_100416733 Ga0070713_1004167332 167
222 3300005439 Ga0070711_100054515 Ga0070711_1000545154 167
223 3300035171 Ga0373946_0053791 Ga0373946_0053791_1098_1628 167
224 3300035172 Ga0373955_0035556 Ga0373955_0035556_1530_2045 167
225 3300035725 Ga0373947_0156883 Ga0373947_0156883_32_562 167
226 3300046459 Ga0495629_0303900 Ga0495629_0303900_14_592 167
227 3300046681 Ga0495647_0234204 Ga0495647_0234204_252_782 167
228 3300046683 Ga0495658_0542207 Ga0495658_0542207_168_698 167
229 3300053117 Ga0500593_014970 Ga0500593_014970_1129_1674 167
230 3300005328 Ga0070676_10566619 Ga0070676_105666192 168
231 3300005337 Ga0070682_100074907 Ga0070682_1000749073 168
232 3300005341 Ga0070691_10049975 Ga0070691_100499752 168
233 3300005343 Ga0070687_100198356 Ga0070687_1001983562 168
234 3300005344 Ga0070661_100063143 Ga0070661_1000631432 168
235 3300005354 Ga0070675_100459874 Ga0070675_1004598741 168
236 3300005355 Ga0070671_100207883 Ga0070671_1002078832 168
237 3300005367 Ga0070667_100448698 Ga0070667_1004486981 168
238 3300005434 Ga0070709_10212169 Ga0070709_102121692 168
239 3300005435 Ga0070714_101010215 Ga0070714_1010102151 168
240 3300005436 Ga0070713_100203833 Ga0070713_1002038331 168
241 3300005439 Ga0070711_100376657 Ga0070711_1003766571 168
242 3300005444 Ga0070694_100308992 Ga0070694_1003089922 168
243 3300005456 Ga0070678_100172611 Ga0070678_1001726112 168
244 3300005459 Ga0068867_100112213 Ga0068867_1001122133 168
245 3300005539 Ga0068853_100916697 Ga0068853_1009166971 168
246 3300005545 Ga0070695_100269106 Ga0070695_1002691062 168
247 3300005546 Ga0070696_100476917 Ga0070696_1004769172 168
248 3300005547 Ga0070693_100047004 Ga0070693_1000470044 168
249 3300005842 Ga0068858_100169299 Ga0068858_1001692991 168
250 3300006237 Ga0097621_100039378 Ga0097621_1000393784 168
251 3300009098 Ga0105245_10306616 Ga0105245_103066161 168
252 3300009098 Ga0105245_10383915 Ga0105245_103839151 168
253 3300009101 Ga0105247_10057226 Ga0105247_100572263 168
254 3300009174 Ga0105241_10106665 Ga0105241_101066652 168
255 3300009176 Ga0105242_10052059 Ga0105242_100520592 168
256 3300009545 Ga0105237_10179751 Ga0105237_101797512 168
257 3300009553 Ga0105249_10274607 Ga0105249_102746071 168
258 3300010375 Ga0105239_10087245 Ga0105239_100872452 168
259 3300011119 Ga0105246_10047304 Ga0105246_100473042 168
260 3300013100 Ga0157373_10589986 Ga0157373_105899862 168
261 3300013296 Ga0157374_10067682 Ga0157374_100676823 168
262 3300013297 Ga0157378_10352312 Ga0157378_103523122 168
263 3300013297 Ga0157378_11379373 Ga0157378_113793731 168
264 3300013306 Ga0163162_11251370 Ga0163162_112513701 168
265 3300013308 Ga0157375_10070657 Ga0157375_100706571 168
266 3300014968 Ga0157379_10048436 Ga0157379_100484363 168
267 3300014969 Ga0157376_10031773 Ga0157376_100317735 168
268 3300014969 Ga0157376_10185265 Ga0157376_101852652 168
269 3300025906 Ga0207699_10031208 Ga0207699_100312081 168
270 3300025912 Ga0207707_10036744 Ga0207707_100367443 168
271 3300025927 Ga0207687_10498333 Ga0207687_104983331 168
272 3300025928 Ga0207700_10043361 Ga0207700_100433614 168
273 3300025933 Ga0207706_10025926 Ga0207706_100259263 168
274 3300025934 Ga0207686_10016499 Ga0207686_100164992 168
275 3300026067 Ga0207678_10034395 Ga0207678_100343954 168
276 3300034820 Ga0373959_0159401 Ga0373959_0159401_40_558 168
277 3300035111 Ga0373923_0363874 Ga0373923_0363874_20_538 168
278 3300035113 Ga0373936_0148056 Ga0373936_0148056_158_676 168
279 3300035116 Ga0373945_0045730 Ga0373945_0045730_153_671 168
280 3300035117 Ga0373953_0005616 Ga0373953_0005616_3520_4038 168
281 3300035118 Ga0373954_0204860 Ga0373954_0204860_396_914 168
282 3300035119 Ga0373956_0033016 Ga0373956_0033016_156_674 168
283 3300035120 Ga0373957_0011256 Ga0373957_0011256_179_697 168
284 3300035170 Ga0373943_0432782 Ga0373943_0432782_158_676 168
285 3300035171 Ga0373946_0118446 Ga0373946_0118446_78_596 168
286 3300035171 Ga0373946_0243360 Ga0373946_0243360_160_678 168
287 3300035172 Ga0373955_0015938 Ga0373955_0015938_588_1106 168
288 3300035241 Ga0373961_0099912 Ga0373961_0099912_67_585 168
289 3300035410 Ga0373924_0054259 Ga0373924_0054259_457_975 168
290 3300035692 Ga0373935_0068391 Ga0373935_0068391_1707_2225 168
291 3300035695 Ga0373927_0098638 Ga0373927_0098638_514_1032 168
292 3300035724 Ga0373933_0109401 Ga0373933_0109401_207_725 168
293 3300036401 Ga0373937_0001510 Ga0373937_0001510_12680_13198 168
294 3300046454 Ga0495592_0132810 Ga0495592_0132810_602_1120 168
295 3300046455 Ga0495603_0096874 Ga0495603_0096874_407_925 168
296 3300046459 Ga0495629_0032442 Ga0495629_0032442_92_610 168
297 3300046459 Ga0495629_0181311 Ga0495629_0181311_483_1001 168
298 3300046462 Ga0495651_0012100 Ga0495651_0012100_4265_4783 168
299 3300046463 Ga0495653_0000944 Ga0495653_0000944_20940_21458 168
300 3300046475 Ga0495639_0068574 Ga0495639_0068574_23_541 168
301 3300046499 Ga0495594_0045285 Ga0495594_0045285_16_534 168
302 3300046511 Ga0495608_0003838 Ga0495608_0003838_9665_10183 168
303 3300046514 Ga0495618_0012117 Ga0495618_0012117_2079_2597 168
304 3300046514 Ga0495618_0493112 Ga0495618_0493112_204_722 168
305 3300046517 Ga0495630_0034834 Ga0495630_0034834_133_651 168
306 3300046526 Ga0495666_0023090 Ga0495666_0023090_2149_2667 168
307 3300046533 Ga0495640_0029249 Ga0495640_0029249_2362_2880 168
308 3300046533 Ga0495640_0059050 Ga0495640_0059050_390_908 168
309 3300046535 Ga0495586_0006928 Ga0495586_0006928_4216_4734 168
310 3300046536 Ga0495587_0000520 Ga0495587_0000520_26247_26765 168
311 3300046543 Ga0495645_0068462 Ga0495645_0068462_1146_1664 168
312 3300046543 Ga0495645_0335078 Ga0495645_0335078_350_868 168
313 3300046557 Ga0495622_0049938 Ga0495622_0049938_1390_1908 168
314 3300046559 Ga0495667_0013996 Ga0495667_0013996_920_1438 168
315 3300046642 Ga0495634_0109273 Ga0495634_0109273_103_621 168
316 3300046642 Ga0495634_0445112 Ga0495634_0445112_20_538 168
317 3300046663 Ga0495635_0086535 Ga0495635_0086535_1133_1651 168
318 3300046663 Ga0495635_0789762 Ga0495635_0789762_51_569 168
319 3300046679 Ga0495623_0085678 Ga0495623_0085678_536_1054 168
320 3300046680 Ga0495646_0013001 Ga0495646_0013001_703_1221 168
321 3300046681 Ga0495647_0241297 Ga0495647_0241297_253_771 168
322 3300046681 Ga0495647_0245496 Ga0495647_0245496_118_636 168
323 3300046689 Ga0495613_0300051 Ga0495613_0300051_522_1040 168
324 3300046689 Ga0495613_0325835 Ga0495613_0325835_359_877 168
325 3300046690 Ga0495624_0077820 Ga0495624_0077820_616_1134 168
326 3300046690 Ga0495624_0640513 Ga0495624_0640513_25_543 168
327 3300046809 Ga0495600_0314619 Ga0495600_0314619_163_681 168
328 3300047315 Ga0495581_0536787 Ga0495581_0536787_81_599 168
329 3300047317 Ga0495604_0407399 Ga0495604_0407399_20_538 168
330 3300047319 Ga0495674_0005073 Ga0495674_0005073_867_1385 168
331 3300047319 Ga0495674_0015663 Ga0495674_0015663_4905_5423 168
332 3300047322 Ga0495680_0078375 Ga0495680_0078375_620_1138 168
333 3300047444 Ga0495675_0000462 Ga0495675_0000462_157_675 168
334 3300047471 Ga0495684_0069856 Ga0495684_0069856_1640_2158 168
335 3300047673 Ga0495593_0013840 Ga0495593_0013840_116_634 168
336 3300048088 Ga0495602_0190424 Ga0495602_0190424_175_693 168
337 3300048089 Ga0495614_0244385 Ga0495614_0244385_110_628 168
338 3300048903 Ga0496100_0490715 Ga0496100_0490715_82_600 168
339 3300048904 Ga0496101_0146317 Ga0496101_0146317_831_1349 168
340 3300048905 Ga0496102_0029775 Ga0496102_0029775_816_1334 168
341 3300048906 Ga0496103_0091807 Ga0496103_0091807_157_675 168
342 3300048907 Ga0496104_0084290 Ga0496104_0084290_1938_2456 168
343 3300048908 Ga0496105_0177532 Ga0496105_0177532_844_1362 168
344 3300048909 Ga0496106_0053120 Ga0496106_0053120_899_1417 168
345 3300048909 Ga0496106_0350165 Ga0496106_0350165_384_902 168
346 3300048910 Ga0496107_0021561 Ga0496107_0021561_3168_3686 168
347 3300048912 Ga0496109_0050809 Ga0496109_0050809_2375_2893 168
348 3300048913 Ga0496110_0155974 Ga0496110_0155974_525_1043 168
349 3300048915 Ga0496112_0138679 Ga0496112_0138679_769_1287 168
350 3300048917 Ga0496114_0037495 Ga0496114_0037495_516_1034 168
351 3300048918 Ga0496115_0059064 Ga0496115_0059064_566_1084 168
352 3300048918 Ga0496115_0115566 Ga0496115_0115566_816_1334 168
353 3300048918 Ga0496115_0170764 Ga0496115_0170764_631_1149 168
354 3300049571 Ga0501034_1181547 Ga0501034_1181547_39_572 168
355 3300049572 Ga0501036_0268183 Ga0501036_0268183_59_601 168
356 3300049822 Ga0501035_0211061 Ga0501035_0211061_902_1444 168
357 3300049823 Ga0501044_0710743 Ga0501044_0710743_306_848 168
358 3300053077 Ga0495601_0155041 Ga0495601_0155041_358_876 168
359 3300053078 Ga0495612_0020051 Ga0495612_0020051_868_1386 168
360 3300053078 Ga0495612_0054505 Ga0495612_0054505_868_1386 168
361 3300053084 Ga0495595_0005913 Ga0495595_0005913_602_1120 168
362 3300053085 Ga0495619_0011191 Ga0495619_0011191_2790_3308 168
363 3300053085 Ga0495619_0232748 Ga0495619_0232748_157_675 168
364 3300006058 Ga0075432_10002763 Ga0075432_100027634 169
365 3300006844 Ga0075428_100028729 Ga0075428_1000287295 169
366 3300006846 Ga0075430_100000571 Ga0075430_10000057129 169
367 3300006847 Ga0075431_100000808 Ga0075431_10000080828 169
368 3300006871 Ga0075434_100003484 Ga0075434_1000034842 169
369 3300009094 Ga0111539_10000561 Ga0111539_1000056128 169
370 3300009147 Ga0114129_10042755 Ga0114129_100427552 169
371 3300026089 Ga0207648_10551078 Ga0207648_105510782 169
372 3300027907 Ga0207428_10000292 Ga0207428_1000029214 169
373 3300031241 Ga0265325_10015804 Ga0265325_100158042 169
374 3300031249 Ga0265339_10008278 Ga0265339_100082787 169
375 3300031344 Ga0265316_10481371 Ga0265316_104813712 169
376 3300031595 Ga0265313_10002244 Ga0265313_1000224412 169
377 3300049744 Ga0501083_0580090 Ga0501083_0580090_122_658 169
378 3300050507 nmdc:mga05p37_1109_c1 nmdc:mga05p37_1109_c1_26295_26819 169
379 3300050508 nmdc:mga09592_14828_c1 nmdc:mga09592_14828_c1_437_961 169
380 3300050509 nmdc:mga0qj67_1459_c1 nmdc:mga0qj67_1459_c1_8426_8950 169
381 3300050510 nmdc:mga06r32_19751_c1 nmdc:mga06r32_19751_c1_4263_4787 169
382 3300050511 nmdc:mga08y16_855_c1 nmdc:mga08y16_855_c1_4390_4914 169
383 3300050512 nmdc:mga0n895_2848_c1 nmdc:mga0n895_2848_c1_12378_12902 169
384 3300050514 nmdc:mga08x19_614070_c1 nmdc:mga08x19_614070_c1_95_619 169
385 3300050515 nmdc:mga0a205_729_c1 nmdc:mga0a205_729_c1_457_981 169
386 3300005330 Ga0070690_100552976 Ga0070690_1005529762 170
387 3300005347 Ga0070668_100883041 Ga0070668_1008830412 170
388 3300005356 Ga0070674_100027684 Ga0070674_1000276843 170
389 3300005456 Ga0070678_100029338 Ga0070678_1000293384 170
390 3300005458 Ga0070681_10321151 Ga0070681_103211512 170
391 3300005544 Ga0070686_100829771 Ga0070686_1008297711 170
392 3300005937 Ga0081455_10001802 Ga0081455_1000180241 170
393 3300006237 Ga0097621_100638827 Ga0097621_1006388271 170
394 3300006358 Ga0068871_101108004 Ga0068871_1011080041 170
395 3300006881 Ga0068865_100167775 Ga0068865_1001677752 170
396 3300009098 Ga0105245_11135927 Ga0105245_111359271 170
397 3300009147 Ga0114129_10570794 Ga0114129_105707942 170
398 3300009148 Ga0105243_10470894 Ga0105243_104708941 170
399 3300014326 Ga0157380_10053723 Ga0157380_100537235 170
400 3300025912 Ga0207707_10102568 Ga0207707_101025683 170
401 3300025916 Ga0207663_10060610 Ga0207663_100606103 170
402 3300025933 Ga0207706_10378065 Ga0207706_103780652 170
403 3300025937 Ga0207669_10152204 Ga0207669_101522042 170
404 3300025938 Ga0207704_10073584 Ga0207704_100735842 170
405 3300026075 Ga0207708_10095298 Ga0207708_100952982 170
406 3300026118 Ga0207675_101622671 Ga0207675_1016226711 170
407 3300026121 Ga0207683_10011735 Ga0207683_100117355 170
408 3300031241 Ga0265325_10121690 Ga0265325_101216902 170
409 3300031247 Ga0265340_10085097 Ga0265340_100850972 170
410 3300031903 Ga0307407_11075739 Ga0307407_110757391 170
411 3300035116 Ga0373945_0060465 Ga0373945_0060465_116_661 170
412 3300036401 Ga0373937_0284846 Ga0373937_0284846_443_1021 170
413 3300049571 Ga0501034_0537429 Ga0501034_0537429_249_803 170
414 3300049572 Ga0501036_0311355 Ga0501036_0311355_82_636 170
415 3300049744 Ga0501083_0259950 Ga0501083_0259950_55_606 170
416 3300053085 Ga0495619_0051569 Ga0495619_0051569_596_1138 170
417 3300005327 Ga0070658_10317426 Ga0070658_103174262 171
418 3300005336 Ga0070680_100039387 Ga0070680_1000393872 171
419 3300005339 Ga0070660_100028614 Ga0070660_1000286143 171
420 3300005366 Ga0070659_100664178 Ga0070659_1006641781 171
421 3300005458 Ga0070681_10006902 Ga0070681_1000690210 171
422 3300005530 Ga0070679_100537601 Ga0070679_1005376011 171
423 3300009147 Ga0114129_10039587 Ga0114129_100395874 171
424 3300025917 Ga0207660_10018103 Ga0207660_100181035 171
425 3300053151 Ga0500604_0064445 Ga0500604_0064445_131_691 171
426 2209111006 2214772991 2213793003 172
427 3300000041 ARcpr5oldR_c000005 ARcpr5oldR_00000513 172
428 3300000042 ARSoilYngRDRAFT_c00062 ARSoilYngRDRAFT_0006212 172
429 3300000043 ARcpr5yngRDRAFT_c000168 ARcpr5yngRDRAFT_00016811 172
430 3300000044 ARSoilOldRDRAFT_c000012 ARSoilOldRDRAFT_00001214 172
431 3300000652 ARCol0yngRDRAFT_1001158 ARCol0yngRDRAFT_10011584 172
432 3300001430 JGI24032J14994_100787 JGI24032J14994_1007873 172
433 3300001976 JGI24752J21851_1009462 JGI24752J21851_10094622 172
434 3300001978 JGI24747J21853_1001463 JGI24747J21853_10014632 172
435 3300001989 JGI24739J22299_10002632 JGI24739J22299_100026325 172
436 3300001990 JGI24737J22298_10004262 JGI24737J22298_100042624 172
437 3300001990 JGI24737J22298_10010328 JGI24737J22298_100103282 172
438 3300001991 JGI24743J22301_10001995 JGI24743J22301_100019953 172
439 3300001991 JGI24743J22301_10065934 JGI24743J22301_100659342 172
440 3300002074 JGI24748J21848_1000352 JGI24748J21848_10003524 172
441 3300002075 JGI24738J21930_10000471 JGI24738J21930_100004716 172
442 3300002076 JGI24749J21850_1000776 JGI24749J21850_10007763 172
443 3300002077 JGI24744J21845_10019731 JGI24744J21845_100197312 172
444 3300002126 JGI24035J26624_1000132 JGI24035J26624_10001324 172
445 3300002155 JGI24033J26618_1000622 JGI24033J26618_10006224 172
446 3300002239 JGI24034J26672_10002780 JGI24034J26672_100027802 172
447 3300002244 JGI24742J22300_10000997 JGI24742J22300_100009974 172
448 3300003371 JGI26145J50221_1004394 JGI26145J50221_10043942 172
449 3300005276 Ga0065717_1002352 Ga0065717_10023522 172
450 3300005277 Ga0065716_1001728 Ga0065716_10017283 172
451 3300005288 Ga0065714_10233309 Ga0065714_102333091 172
452 3300005289 Ga0065704_10081191 Ga0065704_100811912 172
453 3300005290 Ga0065712_10002169 Ga0065712_100021694 172
454 3300005290 Ga0065712_10092767 Ga0065712_100927672 172
455 3300005293 Ga0065715_10001386 Ga0065715_100013864 172
456 3300005293 Ga0065715_10009694 Ga0065715_100096945 172
457 3300005328 Ga0070676_10001202 Ga0070676_1000120212 172
458 3300005328 Ga0070676_10036391 Ga0070676_100363914 172
459 3300005328 Ga0070676_10545829 Ga0070676_105458292 172
460 3300005329 Ga0070683_100000121 Ga0070683_10000012136 172
461 3300005329 Ga0070683_100494255 Ga0070683_1004942552 172
462 3300005330 Ga0070690_100012170 Ga0070690_1000121703 172
463 3300005330 Ga0070690_100018802 Ga0070690_1000188021 172
464 3300005331 Ga0070670_100005999 Ga0070670_1000059993 172
465 3300005331 Ga0070670_100588944 Ga0070670_1005889442 172
466 3300005333 Ga0070677_10000055 Ga0070677_100000555 172
467 3300005334 Ga0068869_100000507 Ga0068869_10000050720 172
468 3300005335 Ga0070666_10113417 Ga0070666_101134172 172
469 3300005336 Ga0070680_100011815 Ga0070680_1000118154 172
470 3300005337 Ga0070682_100000697 Ga0070682_1000006974 172
471 3300005337 Ga0070682_100693463 Ga0070682_1006934631 172
472 3300005338 Ga0068868_100002501 Ga0068868_1000025017 172
473 3300005338 Ga0068868_100035322 Ga0068868_1000353225 172
474 3300005339 Ga0070660_100010372 Ga0070660_1000103724 172
475 3300005339 Ga0070660_100021731 Ga0070660_1000217313 172
476 3300005340 Ga0070689_100012275 Ga0070689_1000122753 172
477 3300005340 Ga0070689_100016030 Ga0070689_1000160303 172
478 3300005341 Ga0070691_10000371 Ga0070691_1000037116 172
479 3300005341 Ga0070691_10124863 Ga0070691_101248631 172
480 3300005343 Ga0070687_100002788 Ga0070687_1000027885 172
481 3300005343 Ga0070687_100236967 Ga0070687_1002369672 172
482 3300005344 Ga0070661_100000881 Ga0070661_10000088119 172
483 3300005344 Ga0070661_100134575 Ga0070661_1001345752 172
484 3300005345 Ga0070692_10000573 Ga0070692_100005739 172
485 3300005345 Ga0070692_10114989 Ga0070692_101149891 172
486 3300005347 Ga0070668_100004237 Ga0070668_1000042374 172
487 3300005347 Ga0070668_100717399 Ga0070668_1007173991 172
488 3300005353 Ga0070669_100019063 Ga0070669_1000190634 172
489 3300005353 Ga0070669_100088954 Ga0070669_1000889544 172
490 3300005354 Ga0070675_100000698 Ga0070675_10000069819 172
491 3300005354 Ga0070675_100132075 Ga0070675_1001320754 172
492 3300005354 Ga0070675_100558554 Ga0070675_1005585541 172
493 3300005355 Ga0070671_100000344 Ga0070671_1000003444 172
494 3300005356 Ga0070674_100000116 Ga0070674_1000001165 172
495 3300005364 Ga0070673_100000335 Ga0070673_10000033512 172
496 3300005365 Ga0070688_100000565 Ga0070688_10000056519 172
497 3300005365 Ga0070688_100034718 Ga0070688_1000347183 172
498 3300005365 Ga0070688_100076623 Ga0070688_1000766231 172
499 3300005366 Ga0070659_100011128 Ga0070659_1000111285 172
500 3300005366 Ga0070659_100018339 Ga0070659_1000183393 172
501 3300005366 Ga0070659_100079053 Ga0070659_1000790532 172
502 3300005367 Ga0070667_100007699 Ga0070667_1000076995 172
503 3300005367 Ga0070667_100013516 Ga0070667_1000135165 172
504 3300005434 Ga0070709_10021059 Ga0070709_100210594 172
505 3300005435 Ga0070714_100065392 Ga0070714_1000653923 172
506 3300005436 Ga0070713_100002431 Ga0070713_1000024315 172
507 3300005437 Ga0070710_10009728 Ga0070710_100097283 172
508 3300005438 Ga0070701_10002810 Ga0070701_100028105 172
509 3300005438 Ga0070701_10054976 Ga0070701_100549761 172
510 3300005440 Ga0070705_100013561 Ga0070705_1000135614 172
511 3300005440 Ga0070705_100037987 Ga0070705_1000379872 172
512 3300005440 Ga0070705_100122110 Ga0070705_1001221101 172
513 3300005441 Ga0070700_100005744 Ga0070700_1000057444 172
514 3300005441 Ga0070700_100008316 Ga0070700_1000083163 172
515 3300005444 Ga0070694_100016106 Ga0070694_1000161064 172
516 3300005444 Ga0070694_100046557 Ga0070694_1000465573 172
517 3300005445 Ga0070708_100011088 Ga0070708_1000110886 172
518 3300005445 Ga0070708_100979878 Ga0070708_1009798781 172
519 3300005455 Ga0070663_100001736 Ga0070663_10000173613 172
520 3300005456 Ga0070678_100000684 Ga0070678_10000068416 172
521 3300005456 Ga0070678_100059106 Ga0070678_1000591063 172
522 3300005457 Ga0070662_100009413 Ga0070662_1000094134 172
523 3300005457 Ga0070662_100018312 Ga0070662_1000183124 172
524 3300005458 Ga0070681_10035745 Ga0070681_100357454 172
525 3300005458 Ga0070681_10048173 Ga0070681_100481733 172
526 3300005459 Ga0068867_100004625 Ga0068867_1000046257 172
527 3300005459 Ga0068867_100075112 Ga0068867_1000751124 172
528 3300005466 Ga0070685_10002368 Ga0070685_100023683 172
529 3300005466 Ga0070685_10016634 Ga0070685_100166344 172
530 3300005466 Ga0070685_10458801 Ga0070685_104588012 172
531 3300005468 Ga0070707_100697664 Ga0070707_1006976641 172
532 3300005530 Ga0070679_100001791 Ga0070679_10000179119 172
533 3300005530 Ga0070679_100091672 Ga0070679_1000916723 172
534 3300005535 Ga0070684_100036545 Ga0070684_1000365454 172
535 3300005536 Ga0070697_100061498 Ga0070697_1000614983 172
536 3300005539 Ga0068853_100019599 Ga0068853_1000195993 172
537 3300005539 Ga0068853_100389278 Ga0068853_1003892781 172
538 3300005543 Ga0070672_100000741 Ga0070672_10000074119 172
539 3300005543 Ga0070672_100111863 Ga0070672_1001118634 172
540 3300005544 Ga0070686_100009437 Ga0070686_1000094374 172
541 3300005544 Ga0070686_100018881 Ga0070686_1000188814 172
542 3300005544 Ga0070686_100123565 Ga0070686_1001235653 172
543 3300005545 Ga0070695_100015651 Ga0070695_1000156514 172
544 3300005545 Ga0070695_100017329 Ga0070695_1000173294 172
545 3300005546 Ga0070696_100007917 Ga0070696_1000079174 172
546 3300005546 Ga0070696_100049562 Ga0070696_1000495624 172
547 3300005546 Ga0070696_100518426 Ga0070696_1005184261 172
548 3300005547 Ga0070693_100001254 Ga0070693_10000125411 172
549 3300005547 Ga0070693_100244817 Ga0070693_1002448171 172
550 3300005549 Ga0070704_100016209 Ga0070704_1000162094 172
551 3300005549 Ga0070704_100561447 Ga0070704_1005614471 172
552 3300005563 Ga0068855_100046827 Ga0068855_1000468273 172
553 3300005563 Ga0068855_100305269 Ga0068855_1003052693 172
554 3300005564 Ga0070664_100015589 Ga0070664_1000155895 172
555 3300005564 Ga0070664_100109821 Ga0070664_1001098212 172
556 3300005564 Ga0070664_100211431 Ga0070664_1002114313 172
557 3300005577 Ga0068857_100000680 Ga0068857_10000068011 172
558 3300005577 Ga0068857_100862312 Ga0068857_1008623121 172
559 3300005578 Ga0068854_100000760 Ga0068854_1000007604 172
560 3300005578 Ga0068854_100422104 Ga0068854_1004221042 172
561 3300005614 Ga0068856_100021374 Ga0068856_1000213743 172
562 3300005614 Ga0068856_100469223 Ga0068856_1004692231 172
563 3300005615 Ga0070702_100000099 Ga0070702_10000009929 172
564 3300005615 Ga0070702_100091849 Ga0070702_1000918493 172
565 3300005616 Ga0068852_100008756 Ga0068852_1000087566 172
566 3300005617 Ga0068859_100040793 Ga0068859_1000407934 172
567 3300005617 Ga0068859_100050417 Ga0068859_1000504172 172
568 3300005618 Ga0068864_100016990 Ga0068864_1000169904 172
569 3300005618 Ga0068864_100032401 Ga0068864_1000324013 172
570 3300005718 Ga0068866_10271784 Ga0068866_102717842 172
571 3300005719 Ga0068861_100000354 Ga0068861_10000035428 172
572 3300005719 Ga0068861_100588337 Ga0068861_1005883372 172
573 3300005840 Ga0068870_10000395 Ga0068870_1000039514 172
574 3300005840 Ga0068870_10168481 Ga0068870_101684812 172
575 3300005841 Ga0068863_100013197 Ga0068863_1000131976 172
576 3300005842 Ga0068858_100017831 Ga0068858_1000178314 172
577 3300005842 Ga0068858_101160414 Ga0068858_1011604142 172
578 3300005843 Ga0068860_100007901 Ga0068860_1000079015 172
579 3300005843 Ga0068860_100116923 Ga0068860_1001169233 172
580 3300005844 Ga0068862_100013455 Ga0068862_1000134555 172
581 3300005844 Ga0068862_100043042 Ga0068862_1000430423 172
582 3300006237 Ga0097621_100000430 Ga0097621_10000043013 172
583 3300006358 Ga0068871_100000243 Ga0068871_10000024336 172
584 3300006852 Ga0075433_10027633 Ga0075433_100276334 172
585 3300006871 Ga0075434_100030033 Ga0075434_1000300334 172
586 3300006871 Ga0075434_100077844 Ga0075434_1000778443 172
587 3300006881 Ga0068865_100000675 Ga0068865_10000067519 172
588 3300006931 Ga0097620_100040793 Ga0097620_1000407934 172
589 3300006931 Ga0097620_100050415 Ga0097620_1000504152 172
590 3300007076 Ga0075435_100033874 Ga0075435_1000338742 172
591 3300009011 Ga0105251_10120382 Ga0105251_101203822 172
592 3300009036 Ga0105244_10099861 Ga0105244_100998612 172
593 3300009093 Ga0105240_10045886 Ga0105240_100458863 172
594 3300009094 Ga0111539_10004002 Ga0111539_1000400219 172
595 3300009094 Ga0111539_10004660 Ga0111539_1000466018 172
596 3300009098 Ga0105245_10000943 Ga0105245_1000094312 172
597 3300009098 Ga0105245_10242766 Ga0105245_102427662 172
598 3300009101 Ga0105247_10014588 Ga0105247_100145882 172
599 3300009101 Ga0105247_10196345 Ga0105247_101963452 172
600 3300009101 Ga0105247_10274535 Ga0105247_102745351 172
601 3300009148 Ga0105243_10002854 Ga0105243_1000285413 172
602 3300009148 Ga0105243_10008993 Ga0105243_100089934 172
603 3300009148 Ga0105243_10067794 Ga0105243_100677942 172
604 3300009174 Ga0105241_10001331 Ga0105241_1000133114 172
605 3300009174 Ga0105241_10141848 Ga0105241_101418481 172
606 3300009176 Ga0105242_10000036 Ga0105242_1000003634 172
607 3300009176 Ga0105242_10022615 Ga0105242_100226155 172
608 3300009177 Ga0105248_10043021 Ga0105248_100430212 172
609 3300009545 Ga0105237_10030440 Ga0105237_100304404 172
610 3300009545 Ga0105237_10093691 Ga0105237_100936913 172
611 3300009545 Ga0105237_10170505 Ga0105237_101705052 172
612 3300009551 Ga0105238_10787553 Ga0105238_107875532 172
613 3300009553 Ga0105249_10018622 Ga0105249_100186223 172
614 3300009553 Ga0105249_10021070 Ga0105249_100210703 172
615 3300010375 Ga0105239_10024026 Ga0105239_100240265 172
616 3300010375 Ga0105239_10049423 Ga0105239_100494234 172
617 3300011119 Ga0105246_10014421 Ga0105246_100144212 172
618 3300011119 Ga0105246_11171327 Ga0105246_111713271 172
619 3300012477 Ga0157336_1003052 Ga0157336_10030521 172
620 3300012485 Ga0157325_1001007 Ga0157325_10010072 172
621 3300012485 Ga0157325_1004613 Ga0157325_10046132 172
622 3300012494 Ga0157341_1000404 Ga0157341_10004043 172
623 3300012515 Ga0157338_1029864 Ga0157338_10298641 172
624 3300013100 Ga0157373_10004533 Ga0157373_100045336 172
625 3300013102 Ga0157371_10310476 Ga0157371_103104762 172
626 3300013296 Ga0157374_10012850 Ga0157374_100128505 172
627 3300013296 Ga0157374_11722277 Ga0157374_117222771 172
628 3300013297 Ga0157378_10000462 Ga0157378_1000046213 172
629 3300013297 Ga0157378_10006814 Ga0157378_100068142 172
630 3300013306 Ga0163162_10002063 Ga0163162_100020638 172
631 3300013306 Ga0163162_10015790 Ga0163162_100157906 172
632 3300013306 Ga0163162_10700153 Ga0163162_107001532 172
633 3300013307 Ga0157372_10134691 Ga0157372_101346913 172
634 3300013308 Ga0157375_10017542 Ga0157375_100175425 172
635 3300013308 Ga0157375_10096764 Ga0157375_100967644 172
636 3300013308 Ga0157375_10351257 Ga0157375_103512571 172
637 3300014325 Ga0163163_10041884 Ga0163163_100418842 172
638 3300014325 Ga0163163_10790875 Ga0163163_107908751 172
639 3300014325 Ga0163163_10987147 Ga0163163_109871472 172
640 3300014326 Ga0157380_10000274 Ga0157380_1000027414 172
641 3300014745 Ga0157377_10000470 Ga0157377_100004704 172
642 3300014968 Ga0157379_10007174 Ga0157379_100071747 172
643 3300014968 Ga0157379_10076194 Ga0157379_100761943 172
644 3300014969 Ga0157376_10000508 Ga0157376_1000050819 172
645 3300014969 Ga0157376_10118645 Ga0157376_101186454 172
646 3300014969 Ga0157376_11055612 Ga0157376_110556122 172
647 3300017792 Ga0163161_10001910 Ga0163161_100019102 172
648 3300025271 Ga0207666_1000356 Ga0207666_10003564 172
649 3300025271 Ga0207666_1005293 Ga0207666_10052932 172
650 3300025315 Ga0207697_10004946 Ga0207697_100049463 172
651 3300025728 Ga0207655_1156957 Ga0207655_11569572 172
652 3300025735 Ga0207713_1017837 Ga0207713_10178372 172
653 3300025893 Ga0207682_10000135 Ga0207682_100001358 172
654 3300025899 Ga0207642_10000073 Ga0207642_1000007311 172
655 3300025900 Ga0207710_10018190 Ga0207710_100181902 172
656 3300025900 Ga0207710_10038243 Ga0207710_100382432 172
657 3300025900 Ga0207710_10238883 Ga0207710_102388831 172
658 3300025900 Ga0207710_10484005 Ga0207710_104840051 172
659 3300025901 Ga0207688_10006665 Ga0207688_100066653 172
660 3300025901 Ga0207688_10044363 Ga0207688_100443632 172
661 3300025903 Ga0207680_10007561 Ga0207680_100075615 172
662 3300025903 Ga0207680_10014423 Ga0207680_100144233 172
663 3300025904 Ga0207647_10012910 Ga0207647_100129103 172
664 3300025906 Ga0207699_10006915 Ga0207699_100069154 172
665 3300025907 Ga0207645_10000457 Ga0207645_1000045727 172
666 3300025907 Ga0207645_10043906 Ga0207645_100439062 172
667 3300025907 Ga0207645_10492574 Ga0207645_104925742 172
668 3300025908 Ga0207643_10000853 Ga0207643_1000085317 172
669 3300025908 Ga0207643_10133104 Ga0207643_101331042 172
670 3300025911 Ga0207654_10000638 Ga0207654_1000063815 172
671 3300025912 Ga0207707_10017958 Ga0207707_100179584 172
672 3300025912 Ga0207707_10787122 Ga0207707_107871221 172
673 3300025913 Ga0207695_10036170 Ga0207695_100361703 172
674 3300025914 Ga0207671_10032909 Ga0207671_100329094 172
675 3300025914 Ga0207671_10170577 Ga0207671_101705772 172
676 3300025915 Ga0207693_10069871 Ga0207693_100698713 172
677 3300025917 Ga0207660_10001020 Ga0207660_100010206 172
678 3300025917 Ga0207660_10217779 Ga0207660_102177792 172
679 3300025918 Ga0207662_10005471 Ga0207662_100054714 172
680 3300025918 Ga0207662_10014776 Ga0207662_100147762 172
681 3300025919 Ga0207657_10025718 Ga0207657_100257183 172
682 3300025919 Ga0207657_10031026 Ga0207657_100310262 172
683 3300025920 Ga0207649_10000760 Ga0207649_1000076017 172
684 3300025920 Ga0207649_10011720 Ga0207649_100117204 172
685 3300025921 Ga0207652_10000764 Ga0207652_100007644 172
686 3300025921 Ga0207652_10203626 Ga0207652_102036262 172
687 3300025921 Ga0207652_10798136 Ga0207652_107981361 172
688 3300025922 Ga0207646_10257654 Ga0207646_102576542 172
689 3300025923 Ga0207681_10000065 Ga0207681_1000006570 172
690 3300025925 Ga0207650_10001773 Ga0207650_1000177310 172
691 3300025925 Ga0207650_10594567 Ga0207650_105945671 172
692 3300025926 Ga0207659_10000142 Ga0207659_1000014244 172
693 3300025926 Ga0207659_10017702 Ga0207659_100177024 172
694 3300025926 Ga0207659_10253946 Ga0207659_102539462 172
695 3300025927 Ga0207687_10000125 Ga0207687_1000012529 172
696 3300025928 Ga0207700_10010816 Ga0207700_100108167 172
697 3300025931 Ga0207644_10002125 Ga0207644_100021252 172
698 3300025931 Ga0207644_10004403 Ga0207644_100044037 172
699 3300025932 Ga0207690_10003823 Ga0207690_100038235 172
700 3300025932 Ga0207690_10013751 Ga0207690_100137513 172
701 3300025933 Ga0207706_10019275 Ga0207706_100192753 172
702 3300025933 Ga0207706_10019316 Ga0207706_100193163 172
703 3300025934 Ga0207686_10000344 Ga0207686_1000034412 172
704 3300025935 Ga0207709_10000183 Ga0207709_1000018316 172
705 3300025935 Ga0207709_10045448 Ga0207709_100454482 172
706 3300025936 Ga0207670_10000288 Ga0207670_100002884 172
707 3300025936 Ga0207670_10034555 Ga0207670_100345552 172
708 3300025937 Ga0207669_10000081 Ga0207669_1000008137 172
709 3300025938 Ga0207704_10000121 Ga0207704_1000012120 172
710 3300025938 Ga0207704_10012634 Ga0207704_100126342 172
711 3300025939 Ga0207665_10002359 Ga0207665_100023594 172
712 3300025940 Ga0207691_10008864 Ga0207691_100088644 172
713 3300025940 Ga0207691_10095404 Ga0207691_100954042 172
714 3300025941 Ga0207711_10004044 Ga0207711_100040442 172
715 3300025941 Ga0207711_10069734 Ga0207711_100697342 172
716 3300025942 Ga0207689_10000696 Ga0207689_100006964 172
717 3300025942 Ga0207689_10169992 Ga0207689_101699923 172
718 3300025944 Ga0207661_10000286 Ga0207661_1000028617 172
719 3300025945 Ga0207679_10000064 Ga0207679_1000006431 172
720 3300025945 Ga0207679_10059490 Ga0207679_100594901 172
721 3300025949 Ga0207667_10007326 Ga0207667_100073263 172
722 3300025949 Ga0207667_10104622 Ga0207667_101046223 172
723 3300025960 Ga0207651_10000395 Ga0207651_100003958 172
724 3300025960 Ga0207651_10006576 Ga0207651_100065761 172
725 3300025961 Ga0207712_10000752 Ga0207712_1000075221 172
726 3300025961 Ga0207712_10015902 Ga0207712_100159024 172
727 3300025972 Ga0207668_10000715 Ga0207668_1000071517 172
728 3300025972 Ga0207668_10055847 Ga0207668_100558473 172
729 3300025972 Ga0207668_10131898 Ga0207668_101318983 172
730 3300025981 Ga0207640_10003491 Ga0207640_100034914 172
731 3300025981 Ga0207640_10094339 Ga0207640_100943392 172
732 3300025986 Ga0207658_10001038 Ga0207658_100010388 172
733 3300025986 Ga0207658_10098487 Ga0207658_100984871 172
734 3300026023 Ga0207677_10000985 Ga0207677_100009854 172
735 3300026023 Ga0207677_10170894 Ga0207677_101708942 172
736 3300026035 Ga0207703_10001400 Ga0207703_100014004 172
737 3300026035 Ga0207703_10020429 Ga0207703_100204292 172
738 3300026035 Ga0207703_10295993 Ga0207703_102959933 172
739 3300026041 Ga0207639_10005141 Ga0207639_100051415 172
740 3300026041 Ga0207639_10046126 Ga0207639_100461263 172
741 3300026067 Ga0207678_10009603 Ga0207678_100096036 172
742 3300026075 Ga0207708_10012692 Ga0207708_100126924 172
743 3300026075 Ga0207708_10015109 Ga0207708_100151094 172
744 3300026078 Ga0207702_10001395 Ga0207702_1000139519 172
745 3300026078 Ga0207702_10418712 Ga0207702_104187123 172
746 3300026088 Ga0207641_10003265 Ga0207641_1000326513 172
747 3300026088 Ga0207641_10521470 Ga0207641_105214702 172
748 3300026089 Ga0207648_10008132 Ga0207648_100081323 172
749 3300026089 Ga0207648_10118095 Ga0207648_101180954 172
750 3300026095 Ga0207676_10000079 Ga0207676_1000007925 172
751 3300026116 Ga0207674_10006886 Ga0207674_100068863 172
752 3300026116 Ga0207674_10270775 Ga0207674_102707752 172
753 3300026118 Ga0207675_100019734 Ga0207675_1000197343 172
754 3300026118 Ga0207675_100023481 Ga0207675_1000234813 172
755 3300026121 Ga0207683_10000037 Ga0207683_1000003775 172
756 3300026142 Ga0207698_10006345 Ga0207698_100063455 172
757 3300026142 Ga0207698_10062688 Ga0207698_100626883 172
758 3300026142 Ga0207698_11074951 Ga0207698_110749511 172
759 3300027252 Ga0209973_1034280 Ga0209973_10342801 172
760 3300027364 Ga0209967_1029468 Ga0209967_10294681 172
761 3300027614 Ga0209970_1005518 Ga0209970_10055183 172
762 3300027617 Ga0210002_1001169 Ga0210002_10011693 172
763 3300027682 Ga0209971_1002495 Ga0209971_10024954 172
764 3300027695 Ga0209966_1001440 Ga0209966_10014403 172
765 3300027717 Ga0209998_10001960 Ga0209998_100019604 172
766 3300027866 Ga0209813_10057210 Ga0209813_100572102 172
767 3300027876 Ga0209974_10003753 Ga0209974_100037533 172
768 3300027876 Ga0209974_10017872 Ga0209974_100178722 172
769 3300027907 Ga0207428_10002255 Ga0207428_100022554 172
770 3300027907 Ga0207428_10043033 Ga0207428_100430335 172
771 3300028380 Ga0268265_10001133 Ga0268265_1000113317 172
772 3300028380 Ga0268265_10009438 Ga0268265_100094385 172
773 3300028381 Ga0268264_10000805 Ga0268264_1000080526 172
774 3300028381 Ga0268264_10276005 Ga0268264_102760052 172
775 3300034816 Ga0373930_0001896 Ga0373930_0001896_1513_2031 172
776 3300034816 Ga0373930_0005241 Ga0373930_0005241_493_1029 172
777 3300034817 Ga0373948_0000081 Ga0373948_0000081_9018_9536 172
778 3300034817 Ga0373948_0010170 Ga0373948_0010170_74_610 172
779 3300034818 Ga0373950_0003742 Ga0373950_0003742_302_820 172
780 3300034819 Ga0373958_0008357 Ga0373958_0008357_55_573 172
781 3300034820 Ga0373959_0000392 Ga0373959_0000392_6213_6731 172
782 3300034820 Ga0373959_0033741 Ga0373959_0033741_276_803 172
783 3300034957 Ga0373938_0000063 Ga0373938_0000063_4922_5440 172
784 3300034957 Ga0373938_0003923 Ga0373938_0003923_1023_1550 172
785 3300034957 Ga0373938_0005098 Ga0373938_0005098_1340_1876 172
786 3300035083 Ga0373926_0020321 Ga0373926_0020321_15_551 172
787 3300035084 Ga0373928_0001474 Ga0373928_0001474_1219_1737 172
788 3300035084 Ga0373928_0005009 Ga0373928_0005009_958_1485 172
789 3300035085 Ga0373929_0010975 Ga0373929_0010975_43_579 172
790 3300035088 Ga0373940_0000418 Ga0373940_0000418_3280_3798 172
791 3300035088 Ga0373940_0006847 Ga0373940_0006847_1072_1608 172
792 3300035089 Ga0373944_0078723 Ga0373944_0078723_258_794 172
793 3300035090 Ga0373949_0000779 Ga0373949_0000779_7391_7909 172
794 3300035090 Ga0373949_0002326 Ga0373949_0002326_1135_1662 172
795 3300035091 Ga0373951_0001074 Ga0373951_0001074_3947_4465 172
796 3300035091 Ga0373951_0003704 Ga0373951_0003704_2182_2709 172
797 3300035091 Ga0373951_0005252 Ga0373951_0005252_1227_1763 172
798 3300035092 Ga0373952_0001672 Ga0373952_0001672_2826_3344 172
799 3300035092 Ga0373952_0003287 Ga0373952_0003287_1171_1707 172
800 3300035111 Ga0373923_0000419 Ga0373923_0000419_8201_8737 172
801 3300035112 Ga0373932_0000516 Ga0373932_0000516_4643_5161 172
802 3300035112 Ga0373932_0002506 Ga0373932_0002506_3260_3796 172
803 3300035112 Ga0373932_0002800 Ga0373932_0002800_1455_1982 172
804 3300035114 Ga0373939_0001269 Ga0373939_0001269_3301_3828 172
805 3300035114 Ga0373939_0003293 Ga0373939_0003293_544_1062 172
806 3300035114 Ga0373939_0019437 Ga0373939_0019437_110_646 172
807 3300035115 Ga0373941_0001012 Ga0373941_0001012_2917_3444 172
808 3300035115 Ga0373941_0002320 Ga0373941_0002320_49_567 172
809 3300035115 Ga0373941_0064352 Ga0373941_0064352_32_568 172
810 3300035116 Ga0373945_0010619 Ga0373945_0010619_437_973 172
811 3300035117 Ga0373953_0134580 Ga0373953_0134580_472_1008 172
812 3300035121 Ga0373960_0002055 Ga0373960_0002055_3763_4290 172
813 3300035121 Ga0373960_0002580 Ga0373960_0002580_2474_2992 172
814 3300035121 Ga0373960_0007020 Ga0373960_0007020_48_584 172
815 3300035170 Ga0373943_0017330 Ga0373943_0017330_657_1193 172
816 3300035171 Ga0373946_0003737 Ga0373946_0003737_2687_3223 172
817 3300035172 Ga0373955_0023754 Ga0373955_0023754_529_1065 172
818 3300035207 Ga0373942_0000898 Ga0373942_0000898_2099_2617 172
819 3300035207 Ga0373942_0024768 Ga0373942_0024768_255_791 172
820 3300035241 Ga0373961_0003012 Ga0373961_0003012_691_1209 172
821 3300035241 Ga0373961_0013509 Ga0373961_0013509_972_1499 172
822 3300035242 Ga0373962_0024611 Ga0373962_0024611_255_773 172
823 3300035691 Ga0373931_0002005 Ga0373931_0002005_5138_5665 172
824 3300035691 Ga0373931_0004422 Ga0373931_0004422_3780_4316 172
825 3300035692 Ga0373935_0011061 Ga0373935_0011061_4582_5118 172
826 3300035692 Ga0373935_0048143 Ga0373935_0048143_304_840 172
827 3300035695 Ga0373927_0023381 Ga0373927_0023381_1134_1670 172
828 3300035724 Ga0373933_0051605 Ga0373933_0051605_26_562 172
829 3300035725 Ga0373947_0000637 Ga0373947_0000637_11304_11840 172
830 3300036401 Ga0373937_0516071 Ga0373937_0516071_269_805 172
831 3300036401 Ga0373937_0598338 Ga0373937_0598338_233_766 172
832 3300037068 Ga0373925_0008479 Ga0373925_0008479_6012_6548 172
833 3300042005 Ga0439448_0047442 Ga0439448_0047442_625_1152 172
834 3300044712 Ga0453684_0590591 Ga0453684_0590591_657_1175 172
835 3300045051 Ga0451576_0074642 Ga0451576_0074642_2651_3169 172
836 3300046452 Ga0495617_043993 Ga0495617_043993_294_830 172
837 3300046455 Ga0495603_0007685 Ga0495603_0007685_3185_3721 172
838 3300046459 Ga0495629_0001003 Ga0495629_0001003_16421_16957 172
839 3300046461 Ga0495641_0027557 Ga0495641_0027557_419_955 172
840 3300046472 Ga0495580_0394786 Ga0495580_0394786_10_546 172
841 3300046473 Ga0495582_0025753 Ga0495582_0025753_472_1008 172
842 3300046474 Ga0495605_0199003 Ga0495605_0199003_212_748 172
843 3300046475 Ga0495639_0011524 Ga0495639_0011524_70_606 172
844 3300046475 Ga0495639_0104253 Ga0495639_0104253_650_1186 172
845 3300046476 Ga0495662_0030634 Ga0495662_0030634_859_1395 172
846 3300046477 Ga0495664_0003269 Ga0495664_0003269_6377_6913 172
847 3300046491 Ga0495584_0035734 Ga0495584_0035734_1688_2224 172
848 3300046492 Ga0495585_0004199 Ga0495585_0004199_4547_5083 172
849 3300046499 Ga0495594_0017659 Ga0495594_0017659_1503_2039 172
850 3300046501 Ga0495607_0008348 Ga0495607_0008348_4225_4761 172
851 3300046520 Ga0495637_0045772 Ga0495637_0045772_459_995 172
852 3300046520 Ga0495637_0099064 Ga0495637_0099064_368_895 172
853 3300046523 Ga0495644_0001707 Ga0495644_0001707_3516_4052 172
854 3300046526 Ga0495666_0005800 Ga0495666_0005800_1166_1702 172
855 3300046526 Ga0495666_0358899 Ga0495666_0358899_30_566 172
856 3300046539 Ga0495621_0041722 Ga0495621_0041722_263_799 172
857 3300046557 Ga0495622_0159256 Ga0495622_0159256_330_866 172
858 3300046558 Ga0495633_0003249 Ga0495633_0003249_7056_7592 172
859 3300046615 Ga0495656_0000538 Ga0495656_0000538_4152_4688 172
860 3300046648 Ga0495611_0147671 Ga0495611_0147671_425_961 172
861 3300046664 Ga0495659_0004395 Ga0495659_0004395_3583_4119 172
862 3300046665 Ga0495661_0039583 Ga0495661_0039583_798_1334 172
863 3300046681 Ga0495647_0002287 Ga0495647_0002287_4086_4622 172
864 3300046683 Ga0495658_0000814 Ga0495658_0000814_6338_6874 172
865 3300046689 Ga0495613_0009829 Ga0495613_0009829_3402_3938 172
866 3300046691 Ga0495670_0002388 Ga0495670_0002388_1245_1781 172
867 3300046794 Ga0495589_0049868 Ga0495589_0049868_866_1402 172
868 3300047318 Ga0495636_0024479 Ga0495636_0024479_381_917 172
869 3300047319 Ga0495674_0036936 Ga0495674_0036936_248_784 172
870 3300047321 Ga0495676_0110984 Ga0495676_0110984_147_683 172
871 3300047445 Ga0495677_0028344 Ga0495677_0028344_874_1401 172
872 3300047446 Ga0495679_042488 Ga0495679_042488_716_1252 172
873 3300048903 Ga0496100_0000280 Ga0496100_0000280_13799_14326 172
874 3300048903 Ga0496100_0063094 Ga0496100_0063094_521_1057 172
875 3300048903 Ga0496100_0641443 Ga0496100_0641443_32_568 172
876 3300048904 Ga0496101_0000842 Ga0496101_0000842_5919_6446 172
877 3300048904 Ga0496101_0202914 Ga0496101_0202914_377_913 172
878 3300048904 Ga0496101_0790376 Ga0496101_0790376_99_635 172
879 3300048905 Ga0496102_0001974 Ga0496102_0001974_7342_7869 172
880 3300048905 Ga0496102_0080266 Ga0496102_0080266_1404_1922 172
881 3300048905 Ga0496102_0637694 Ga0496102_0637694_404_940 172
882 3300048905 Ga0496102_1150514 Ga0496102_1150514_66_602 172
883 3300048906 Ga0496103_0000571 Ga0496103_0000571_11847_12374 172
884 3300048906 Ga0496103_0076208 Ga0496103_0076208_671_1189 172
885 3300048906 Ga0496103_0335983 Ga0496103_0335983_218_754 172
886 3300048907 Ga0496104_0018615 Ga0496104_0018615_3500_4036 172
887 3300048907 Ga0496104_0358944 Ga0496104_0358944_430_966 172
888 3300048907 Ga0496104_0459589 Ga0496104_0459589_536_1063 172
889 3300048908 Ga0496105_0348831 Ga0496105_0348831_217_753 172
890 3300048908 Ga0496105_0376308 Ga0496105_0376308_493_1029 172
891 3300048909 Ga0496106_0005281 Ga0496106_0005281_3421_3948 172
892 3300048910 Ga0496107_0001700 Ga0496107_0001700_3421_3948 172
893 3300048910 Ga0496107_0019205 Ga0496107_0019205_425_961 172
894 3300048910 Ga0496107_0059648 Ga0496107_0059648_1169_1687 172
895 3300048911 Ga0496108_0006924 Ga0496108_0006924_1344_1871 172
896 3300048911 Ga0496108_0058129 Ga0496108_0058129_2310_2846 172
897 3300048912 Ga0496109_0000260 Ga0496109_0000260_14652_15179 172
898 3300048912 Ga0496109_0683562 Ga0496109_0683562_226_762 172
899 3300048913 Ga0496110_0004713 Ga0496110_0004713_9754_10290 172
900 3300048913 Ga0496110_0024032 Ga0496110_0024032_2266_2793 172
901 3300048913 Ga0496110_0030828 Ga0496110_0030828_2316_2852 172
902 3300048914 Ga0496111_0179959 Ga0496111_0179959_1037_1555 172
903 3300048915 Ga0496112_0017732 Ga0496112_0017732_2303_2839 172
904 3300048915 Ga0496112_0092965 Ga0496112_0092965_1380_1907 172
905 3300048916 Ga0496113_0032045 Ga0496113_0032045_1708_2235 172
906 3300048916 Ga0496113_0197993 Ga0496113_0197993_214_732 172
907 3300048917 Ga0496114_0010719 Ga0496114_0010719_1995_2522 172
908 3300048917 Ga0496114_0500815 Ga0496114_0500815_140_676 172
909 3300048918 Ga0496115_0001610 Ga0496115_0001610_10554_11081 172
910 3300048918 Ga0496115_0073306 Ga0496115_0073306_1219_1755 172
911 3300048918 Ga0496115_0503004 Ga0496115_0503004_235_771 172
912 3300048928 Ga0496125_0342940 Ga0496125_0342940_205_741 172
913 3300048929 Ga0496126_0445758 Ga0496126_0445758_282_818 172
914 3300049581 Ga0501047_0247735 Ga0501047_0247735_782_1381 172
915 3300049589 Ga0501073_0337743 Ga0501073_0337743_475_1002 172
916 3300049593 Ga0501077_0072649 Ga0501077_0072649_397_924 172
917 3300050511 nmdc:mga08y16_2292_c1 nmdc:mga08y16_2292_c1_7343_7870 172
918 3300050511 nmdc:mga08y16_8714_c1 nmdc:mga08y16_8714_c1_7442_7960 172
919 3300050512 nmdc:mga0n895_1286_c1 nmdc:mga0n895_1286_c1_13657_14184 172
920 3300050512 nmdc:mga0n895_77410_c1 nmdc:mga0n895_77410_c1_1204_1740 172
921 3300050512 nmdc:mga0n895_948732_c1 nmdc:mga0n895_948732_c1_272_808 172
922 3300050513 nmdc:mga0rr50_181967_c1 nmdc:mga0rr50_181967_c1_957_1493 172
923 3300050514 nmdc:mga08x19_98914_c1 nmdc:mga08x19_98914_c1_548_1084 172
924 3300050515 nmdc:mga0a205_160859_c1 nmdc:mga0a205_160859_c1_1074_1592 172
925 3300050515 nmdc:mga0a205_485_c1 nmdc:mga0a205_485_c1_12629_13156 172
926 3300053085 Ga0495619_0000646 Ga0495619_0000646_16540_17076 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

75

191

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iq0-assembly6.cif.gz_K crystal structure of hydrogen sulfide-bound superoxide dismutase in oxidized state 0.777 48 68
4p1x-assembly1.cif.gz_E crystal structure of staphylococcal luk prepore 0.6695 21 72
4p1x-assembly1.cif.gz_A crystal structure of staphylococcal luk prepore 0.6684 21 72
1sda-assembly2.cif.gz_G crystal structure of peroxynitrite-modified bovine cu,zn superoxide dismutase 0.6592 48 67
2qk7-assembly1.cif.gz_A a covalent s-f heterodimer of staphylococcal gamma-hemolysin 0.6432 21 72
ID Description Score Start End Superfamily
af_A3A5B9_40_185_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8169 58 95 2.60.40.1820
3k8aA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.5757 23 93 2.40.50.140
af_P53950_945_1158_1.20.1280.170 Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 0.5684 63 90 1.20.1280.170
af_K7LNG1_19_256_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.5665 21 69 2.70.98.10
af_I1KG56_670_809_2.60.40.1480 Mainly Beta;Sandwich;Immunoglobulin-like;Coatomer, gamma subunit, appendage domain 0.5529 48 91 2.60.40.1480
ID Description Score Start End GO Terms
AF-A0A258D1I9-F1-model_v4 DUF177 domain-containing protein 0.965 10 97
AF-A0A258D1I9-F1-model_v4 DUF177 domain-containing protein 0.9147 10 97
AF-A8I5L6-F1-model_v4 DUF177 domain-containing protein 0.8952 4 168
AF-A0A8A7CNT1-F1-model_v4 deleted 0.8941 4 167
AF-A0A380W725-F1-model_v4 Uncharacterized ACR, COG1399 0.8875 10 167

Feature Viewer

pLDDT pTM Quality
88.1 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map