F485928
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 926 | 398 | 926 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0247735|Ga0501047_0247735_782_1381 |
| Length | 199 |
| Sequence | MTKRASPSAKSAKPVSPAWSVPIAVTDVPESGRHVDLVADAAARDAIAKAGGLAGLARLEASFDLTRQGDDGLRATGRVTASVVQTCVVTLEPIESEVDEPIDLIFSADETAASADGGREPQSKPPKAVQALEAEDPPETLHNGMADLGAVATEFLLLGIDPYPRKPGVVFDAPPAGDPSSHPFAALAALKKDGGSKGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 19 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 22 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 23 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 138 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 139 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 140 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 236 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 237 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 247 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 248 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 259 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 265 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 276 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 277 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 397 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 398 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 7.45 |
| Rhizosphere | 91.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214772991 | 2209111006 | Bacteria | 11804 |
| 2 | ARcpr5oldR_c000005 | 3300000041 | Bacteria | 43151 |
| 3 | ARSoilYngRDRAFT_c00062 | 3300000042 | Bacteria | 17580 |
| 4 | ARcpr5yngRDRAFT_c000168 | 3300000043 | Bacteria | 10337 |
| 5 | ARSoilOldRDRAFT_c000012 | 3300000044 | Bacteria | 42830 |
| 6 | ARCol0yngRDRAFT_1001158 | 3300000652 | Bacteria | 2230 |
| 7 | JGI24032J14994_100787 | 3300001430 | Bacteria | 1607 |
| 8 | JGI24752J21851_1009462 | 3300001976 | Bacteria | 1272 |
| 9 | JGI24747J21853_1001463 | 3300001978 | Bacteria | 1774 |
| 10 | JGI24739J22299_10002632 | 3300001989 | Bacteria | 6914 |
| 11 | JGI24737J22298_10004262 | 3300001990 | Bacteria | 4995 |
| 12 | JGI24737J22298_10010328 | 3300001990 | Bacteria | 3083 |
| 13 | JGI24743J22301_10001995 | 3300001991 | Bacteria | 2981 |
| 14 | JGI24743J22301_10065934 | 3300001991 | Bacteria | 750 |
| 15 | JGI24748J21848_1000352 | 3300002074 | Bacteria | 5291 |
| 16 | JGI24738J21930_10000471 | 3300002075 | Bacteria | 11404 |
| 17 | JGI24749J21850_1000776 | 3300002076 | Bacteria | 4600 |
| 18 | JGI24744J21845_10019731 | 3300002077 | Bacteria | 1333 |
| 19 | JGI24035J26624_1000132 | 3300002126 | Bacteria | 6606 |
| 20 | JGI24033J26618_1000622 | 3300002155 | Bacteria | 3411 |
| 21 | JGI24034J26672_10002780 | 3300002239 | Bacteria | 2417 |
| 22 | JGI24742J22300_10000997 | 3300002244 | Bacteria | 4353 |
| 23 | JGI26145J50221_1004394 | 3300003371 | Bacteria | 1141 |
| 24 | Ga0065717_1002352 | 3300005276 | Bacteria | 2120 |
| 25 | Ga0065716_1001728 | 3300005277 | Bacteria | 3751 |
| 26 | Ga0065714_10233309 | 3300005288 | Bacteria | 811 |
| 27 | Ga0065704_10081191 | 3300005289 | Bacteria | 3805 |
| 28 | Ga0065712_10002169 | 3300005290 | Bacteria | 5824 |
| 29 | Ga0065712_10073252 | 3300005290 | Bacteria | 4450 |
| 30 | Ga0065712_10092767 | 3300005290 | Bacteria | 2282 |
| 31 | Ga0065715_10001386 | 3300005293 | Bacteria | 6343 |
| 32 | Ga0065715_10009694 | 3300005293 | Bacteria | 4472 |
| 33 | Ga0065707_10145805 | 3300005295 | Bacteria | 1715 |
| 34 | Ga0070658_10317426 | 3300005327 | Bacteria | 1330 |
| 35 | Ga0070676_10001202 | 3300005328 | Bacteria | 12981 |
| 36 | Ga0070676_10036391 | 3300005328 | Bacteria | 2836 |
| 37 | Ga0070676_10545829 | 3300005328 | Bacteria | 829 |
| 38 | Ga0070676_10566619 | 3300005328 | Bacteria | 815 |
| 39 | Ga0070683_100000121 | 3300005329 | Bacteria | 50845 |
| 40 | Ga0070683_100494255 | 3300005329 | Bacteria | 1168 |
| 41 | Ga0070690_100012170 | 3300005330 | Bacteria | 5057 |
| 42 | Ga0070690_100018802 | 3300005330 | Bacteria | 4181 |
| 43 | Ga0070690_100552976 | 3300005330 | Bacteria | 868 |
| 44 | Ga0070670_100005999 | 3300005331 | Bacteria | 10273 |
| 45 | Ga0070670_100588944 | 3300005331 | Bacteria | 994 |
| 46 | Ga0070670_100770912 | 3300005331 | Unclassified | 867 |
| 47 | Ga0070677_10000055 | 3300005333 | Bacteria | 35005 |
| 48 | Ga0068869_100000507 | 3300005334 | Bacteria | 21693 |
| 49 | Ga0070666_10113417 | 3300005335 | Bacteria | 1875 |
| 50 | Ga0070680_100011815 | 3300005336 | Bacteria | 6773 |
| 51 | Ga0070680_100039387 | 3300005336 | Bacteria | 3824 |
| 52 | Ga0070682_100000697 | 3300005337 | Bacteria | 20192 |
| 53 | Ga0070682_100074907 | 3300005337 | Bacteria | 2175 |
| 54 | Ga0070682_100693463 | 3300005337 | Unclassified | 816 |
| 55 | Ga0068868_100002501 | 3300005338 | Bacteria | 12763 |
| 56 | Ga0068868_100035322 | 3300005338 | Bacteria | 3863 |
| 57 | Ga0070660_100010372 | 3300005339 | Bacteria | 6584 |
| 58 | Ga0070660_100021731 | 3300005339 | Bacteria | 4737 |
| 59 | Ga0070660_100028614 | 3300005339 | Bacteria | 4171 |
| 60 | Ga0070689_100012275 | 3300005340 | Bacteria | 6165 |
| 61 | Ga0070689_100016030 | 3300005340 | Bacteria | 5479 |
| 62 | Ga0070689_100710855 | 3300005340 | Unclassified | 878 |
| 63 | Ga0070691_10000371 | 3300005341 | Bacteria | 16253 |
| 64 | Ga0070691_10049975 | 3300005341 | Bacteria | 1994 |
| 65 | Ga0070691_10124863 | 3300005341 | Bacteria | 1299 |
| 66 | Ga0070687_100002788 | 3300005343 | Bacteria | 6647 |
| 67 | Ga0070687_100198356 | 3300005343 | Bacteria | 1214 |
| 68 | Ga0070687_100236967 | 3300005343 | Bacteria | 1126 |
| 69 | Ga0070661_100000881 | 3300005344 | Bacteria | 21577 |
| 70 | Ga0070661_100063143 | 3300005344 | Bacteria | 2720 |
| 71 | Ga0070661_100134575 | 3300005344 | Bacteria | 1859 |
| 72 | Ga0070692_10000573 | 3300005345 | Bacteria | 11543 |
| 73 | Ga0070692_10114989 | 3300005345 | Bacteria | 1493 |
| 74 | Ga0070668_100004237 | 3300005347 | Bacteria | 10641 |
| 75 | Ga0070668_100717399 | 3300005347 | Unclassified | 883 |
| 76 | Ga0070668_100883041 | 3300005347 | Bacteria | 798 |
| 77 | Ga0070669_100019063 | 3300005353 | Bacteria | 4904 |
| 78 | Ga0070669_100088954 | 3300005353 | Bacteria | 2312 |
| 79 | Ga0070675_100000698 | 3300005354 | Bacteria | 23271 |
| 80 | Ga0070675_100132075 | 3300005354 | Bacteria | 2128 |
| 81 | Ga0070675_100459874 | 3300005354 | Bacteria | 1142 |
| 82 | Ga0070675_100558554 | 3300005354 | Bacteria | 1036 |
| 83 | Ga0070671_100000344 | 3300005355 | Bacteria | 31796 |
| 84 | Ga0070671_100207883 | 3300005355 | Bacteria | 1660 |
| 85 | Ga0070671_101136440 | 3300005355 | Unclassified | 686 |
| 86 | Ga0070674_100000116 | 3300005356 | Bacteria | 37121 |
| 87 | Ga0070674_100027684 | 3300005356 | Bacteria | 3716 |
| 88 | Ga0070673_100000335 | 3300005364 | Bacteria | 24640 |
| 89 | Ga0070688_100000565 | 3300005365 | Bacteria | 18794 |
| 90 | Ga0070688_100034718 | 3300005365 | Bacteria | 3057 |
| 91 | Ga0070688_100076623 | 3300005365 | Bacteria | 2152 |
| 92 | Ga0070688_100205517 | 3300005365 | Bacteria | 1380 |
| 93 | Ga0070659_100011128 | 3300005366 | Bacteria | 6647 |
| 94 | Ga0070659_100018339 | 3300005366 | Bacteria | 5282 |
| 95 | Ga0070659_100079053 | 3300005366 | Bacteria | 2625 |
| 96 | Ga0070659_100664178 | 3300005366 | Bacteria | 899 |
| 97 | Ga0070667_100007699 | 3300005367 | Bacteria | 8931 |
| 98 | Ga0070667_100013516 | 3300005367 | Bacteria | 6746 |
| 99 | Ga0070667_100071592 | 3300005367 | Bacteria | 2953 |
| 100 | Ga0070667_100448698 | 3300005367 | Bacteria | 1178 |
| 101 | Ga0070709_10021059 | 3300005434 | Bacteria | 3795 |
| 102 | Ga0070709_10076401 | 3300005434 | Bacteria | 2175 |
| 103 | Ga0070709_10212169 | 3300005434 | Bacteria | 1377 |
| 104 | Ga0070709_10272693 | 3300005434 | Bacteria | 1227 |
| 105 | Ga0070709_10673828 | 3300005434 | Bacteria | 803 |
| 106 | Ga0070714_100065392 | 3300005435 | Bacteria | 3132 |
| 107 | Ga0070714_100069959 | 3300005435 | Bacteria | 3032 |
| 108 | Ga0070714_101010215 | 3300005435 | Bacteria | 809 |
| 109 | Ga0070713_100002431 | 3300005436 | Bacteria | 12142 |
| 110 | Ga0070713_100203833 | 3300005436 | Bacteria | 1787 |
| 111 | Ga0070713_100416733 | 3300005436 | Bacteria | 1257 |
| 112 | Ga0070710_10009728 | 3300005437 | Bacteria | 4709 |
| 113 | Ga0070701_10002810 | 3300005438 | Bacteria | 6773 |
| 114 | Ga0070701_10054976 | 3300005438 | Bacteria | 2077 |
| 115 | Ga0070711_100054515 | 3300005439 | Bacteria | 2759 |
| 116 | Ga0070711_100376657 | 3300005439 | Bacteria | 1146 |
| 117 | Ga0070711_100410003 | 3300005439 | Bacteria | 1102 |
| 118 | Ga0070711_100974294 | 3300005439 | Unclassified | 727 |
| 119 | Ga0070705_100013561 | 3300005440 | Bacteria | 4172 |
| 120 | Ga0070705_100037987 | 3300005440 | Bacteria | 2720 |
| 121 | Ga0070705_100122110 | 3300005440 | Bacteria | 1683 |
| 122 | Ga0070705_100173743 | 3300005440 | Bacteria | 1453 |
| 123 | Ga0070700_100005744 | 3300005441 | Bacteria | 6584 |
| 124 | Ga0070700_100008316 | 3300005441 | Bacteria | 5647 |
| 125 | Ga0070694_100016106 | 3300005444 | Bacteria | 4705 |
| 126 | Ga0070694_100046557 | 3300005444 | Bacteria | 2912 |
| 127 | Ga0070694_100308992 | 3300005444 | Bacteria | 1214 |
| 128 | Ga0070708_100011088 | 3300005445 | Bacteria | 7325 |
| 129 | Ga0070708_100979878 | 3300005445 | Unclassified | 793 |
| 130 | Ga0070708_101114220 | 3300005445 | Unclassified | 739 |
| 131 | Ga0070663_100001736 | 3300005455 | Bacteria | 12106 |
| 132 | Ga0070678_100000684 | 3300005456 | Bacteria | 16710 |
| 133 | Ga0070678_100029338 | 3300005456 | Bacteria | 3765 |
| 134 | Ga0070678_100059106 | 3300005456 | Bacteria | 2816 |
| 135 | Ga0070678_100172611 | 3300005456 | Bacteria | 1762 |
| 136 | Ga0070662_100009413 | 3300005457 | Bacteria | 6385 |
| 137 | Ga0070662_100018312 | 3300005457 | Bacteria | 4736 |
| 138 | Ga0070681_10006902 | 3300005458 | Bacteria | 11053 |
| 139 | Ga0070681_10017105 | 3300005458 | Bacteria | 7248 |
| 140 | Ga0070681_10035745 | 3300005458 | Bacteria | 4990 |
| 141 | Ga0070681_10048173 | 3300005458 | Bacteria | 4259 |
| 142 | Ga0070681_10321151 | 3300005458 | Bacteria | 1458 |
| 143 | Ga0068867_100004625 | 3300005459 | Bacteria | 9680 |
| 144 | Ga0068867_100075112 | 3300005459 | Bacteria | 2535 |
| 145 | Ga0068867_100112213 | 3300005459 | Bacteria | 2096 |
| 146 | Ga0070685_10002368 | 3300005466 | Bacteria | 9702 |
| 147 | Ga0070685_10016634 | 3300005466 | Bacteria | 3922 |
| 148 | Ga0070685_10458801 | 3300005466 | Unclassified | 894 |
| 149 | Ga0070707_100697664 | 3300005468 | Unclassified | 978 |
| 150 | Ga0070679_100001791 | 3300005530 | Bacteria | 19375 |
| 151 | Ga0070679_100091672 | 3300005530 | Bacteria | 3027 |
| 152 | Ga0070679_100537601 | 3300005530 | Bacteria | 1112 |
| 153 | Ga0070684_100036545 | 3300005535 | Bacteria | 4209 |
| 154 | Ga0070697_100061498 | 3300005536 | Bacteria | 3063 |
| 155 | Ga0068853_100019599 | 3300005539 | Bacteria | 5612 |
| 156 | Ga0068853_100389278 | 3300005539 | Unclassified | 1303 |
| 157 | Ga0068853_100916697 | 3300005539 | Bacteria | 842 |
| 158 | Ga0070672_100000741 | 3300005543 | Bacteria | 19384 |
| 159 | Ga0070672_100111863 | 3300005543 | Bacteria | 2227 |
| 160 | Ga0070672_100526003 | 3300005543 | Unclassified | 1025 |
| 161 | Ga0070686_100009437 | 3300005544 | Bacteria | 5486 |
| 162 | Ga0070686_100018881 | 3300005544 | Bacteria | 4055 |
| 163 | Ga0070686_100034442 | 3300005544 | Bacteria | 3121 |
| 164 | Ga0070686_100123565 | 3300005544 | Bacteria | 1780 |
| 165 | Ga0070686_100829771 | 3300005544 | Bacteria | 747 |
| 166 | Ga0070695_100015651 | 3300005545 | Bacteria | 4581 |
| 167 | Ga0070695_100017329 | 3300005545 | Bacteria | 4367 |
| 168 | Ga0070695_100269106 | 3300005545 | Bacteria | 1248 |
| 169 | Ga0070696_100007917 | 3300005546 | Bacteria | 7095 |
| 170 | Ga0070696_100049562 | 3300005546 | Bacteria | 2917 |
| 171 | Ga0070696_100476917 | 3300005546 | Bacteria | 989 |
| 172 | Ga0070696_100518426 | 3300005546 | Bacteria | 951 |
| 173 | Ga0070693_100001254 | 3300005547 | Bacteria | 11478 |
| 174 | Ga0070693_100047004 | 3300005547 | Bacteria | 2454 |
| 175 | Ga0070693_100244817 | 3300005547 | Bacteria | 1186 |
| 176 | Ga0070704_100016209 | 3300005549 | Bacteria | 4705 |
| 177 | Ga0070704_100445285 | 3300005549 | Bacteria | 1114 |
| 178 | Ga0070704_100561447 | 3300005549 | Unclassified | 999 |
| 179 | Ga0068855_100046827 | 3300005563 | Bacteria | 5111 |
| 180 | Ga0068855_100305269 | 3300005563 | Bacteria | 1762 |
| 181 | Ga0070664_100015589 | 3300005564 | Bacteria | 6218 |
| 182 | Ga0070664_100109821 | 3300005564 | Bacteria | 2406 |
| 183 | Ga0070664_100136293 | 3300005564 | Bacteria | 2159 |
| 184 | Ga0070664_100211431 | 3300005564 | Bacteria | 1733 |
| 185 | Ga0068857_100000680 | 3300005577 | Bacteria | 25262 |
| 186 | Ga0068857_100862312 | 3300005577 | Unclassified | 867 |
| 187 | Ga0068854_100000760 | 3300005578 | Bacteria | 19146 |
| 188 | Ga0068854_100422104 | 3300005578 | Unclassified | 1108 |
| 189 | Ga0068856_100021374 | 3300005614 | Bacteria | 6291 |
| 190 | Ga0068856_100133395 | 3300005614 | Bacteria | 2489 |
| 191 | Ga0068856_100354397 | 3300005614 | Bacteria | 1486 |
| 192 | Ga0068856_100469223 | 3300005614 | Bacteria | 1279 |
| 193 | Ga0070702_100000099 | 3300005615 | Bacteria | 25765 |
| 194 | Ga0070702_100091849 | 3300005615 | Bacteria | 1843 |
| 195 | Ga0068852_100008756 | 3300005616 | Bacteria | 7484 |
| 196 | Ga0068859_100040793 | 3300005617 | Bacteria | 4661 |
| 197 | Ga0068859_100050417 | 3300005617 | Bacteria | 4181 |
| 198 | Ga0068859_100116623 | 3300005617 | Bacteria | 2735 |
| 199 | Ga0068864_100016990 | 3300005618 | Bacteria | 6063 |
| 200 | Ga0068864_100032401 | 3300005618 | Bacteria | 4441 |
| 201 | Ga0068866_10087986 | 3300005718 | Bacteria | 1685 |
| 202 | Ga0068866_10271784 | 3300005718 | Unclassified | 1046 |
| 203 | Ga0068861_100000354 | 3300005719 | Bacteria | 26182 |
| 204 | Ga0068861_100403951 | 3300005719 | Bacteria | 1213 |
| 205 | Ga0068861_100588337 | 3300005719 | Unclassified | 1020 |
| 206 | Ga0068870_10000395 | 3300005840 | Bacteria | 16399 |
| 207 | Ga0068870_10168481 | 3300005840 | Bacteria | 1305 |
| 208 | Ga0068863_100013197 | 3300005841 | Bacteria | 7969 |
| 209 | Ga0068863_100199343 | 3300005841 | Bacteria | 1925 |
| 210 | Ga0068858_100017831 | 3300005842 | Bacteria | 6647 |
| 211 | Ga0068858_100105846 | 3300005842 | Bacteria | 2625 |
| 212 | Ga0068858_100117158 | 3300005842 | Bacteria | 2489 |
| 213 | Ga0068858_100169299 | 3300005842 | Bacteria | 2059 |
| 214 | Ga0068858_101160414 | 3300005842 | Bacteria | 759 |
| 215 | Ga0068860_100007901 | 3300005843 | Bacteria | 10619 |
| 216 | Ga0068860_100116923 | 3300005843 | Bacteria | 2551 |
| 217 | Ga0068862_100013455 | 3300005844 | Bacteria | 6773 |
| 218 | Ga0068862_100043042 | 3300005844 | Bacteria | 3849 |
| 219 | Ga0081455_10001802 | 3300005937 | Bacteria | 25849 |
| 220 | Ga0081538_10072545 | 3300005981 | Bacteria | 1886 |
| 221 | Ga0070717_10003856 | 3300006028 | Bacteria | 10784 |
| 222 | Ga0070717_10459021 | 3300006028 | Bacteria | 1149 |
| 223 | Ga0075432_10002763 | 3300006058 | Bacteria | 5880 |
| 224 | Ga0070715_10001764 | 3300006163 | Bacteria | 6436 |
| 225 | Ga0070715_10053220 | 3300006163 | Bacteria | 1749 |
| 226 | Ga0070716_100028646 | 3300006173 | Bacteria | 3002 |
| 227 | Ga0070712_100108179 | 3300006175 | Bacteria | 2070 |
| 228 | Ga0070712_100874989 | 3300006175 | Bacteria | 774 |
| 229 | Ga0075427_10000518 | 3300006194 | Bacteria | 4424 |
| 230 | Ga0097621_100000430 | 3300006237 | Bacteria | 29289 |
| 231 | Ga0097621_100028001 | 3300006237 | Bacteria | 4436 |
| 232 | Ga0097621_100039378 | 3300006237 | Bacteria | 3796 |
| 233 | Ga0097621_100398693 | 3300006237 | Bacteria | 1231 |
| 234 | Ga0097621_100638827 | 3300006237 | Bacteria | 976 |
| 235 | Ga0068871_100000243 | 3300006358 | Bacteria | 37961 |
| 236 | Ga0068871_100034565 | 3300006358 | Bacteria | 4012 |
| 237 | Ga0068871_100325530 | 3300006358 | Bacteria | 1354 |
| 238 | Ga0068871_101108004 | 3300006358 | Bacteria | 740 |
| 239 | Ga0075428_100028729 | 3300006844 | Bacteria | 6153 |
| 240 | Ga0075430_100000571 | 3300006846 | Bacteria | 27962 |
| 241 | Ga0075431_100000808 | 3300006847 | Bacteria | 27366 |
| 242 | Ga0075433_10000023 | 3300006852 | Bacteria | 59195 |
| 243 | Ga0075433_10027633 | 3300006852 | Bacteria | 4814 |
| 244 | Ga0075433_10664047 | 3300006852 | Bacteria | 914 |
| 245 | Ga0075434_100003484 | 3300006871 | Bacteria | 14071 |
| 246 | Ga0075434_100030033 | 3300006871 | Bacteria | 5350 |
| 247 | Ga0075434_100077844 | 3300006871 | Bacteria | 3311 |
| 248 | Ga0075434_100236708 | 3300006871 | Bacteria | 1846 |
| 249 | Ga0075434_100585618 | 3300006871 | Bacteria | 1135 |
| 250 | Ga0075429_100000227 | 3300006880 | Bacteria | 38168 |
| 251 | Ga0068865_100000675 | 3300006881 | Bacteria | 19258 |
| 252 | Ga0068865_100085676 | 3300006881 | Bacteria | 2273 |
| 253 | Ga0068865_100167775 | 3300006881 | Unclassified | 1680 |
| 254 | Ga0075436_100707989 | 3300006914 | Bacteria | 746 |
| 255 | Ga0097620_100040793 | 3300006931 | Bacteria | 4661 |
| 256 | Ga0097620_100050415 | 3300006931 | Bacteria | 4181 |
| 257 | Ga0097620_100116630 | 3300006931 | Bacteria | 2735 |
| 258 | Ga0075435_100033874 | 3300007076 | Bacteria | 4042 |
| 259 | Ga0075435_100088892 | 3300007076 | Bacteria | 2547 |
| 260 | Ga0099794_10010739 | 3300007265 | Bacteria | 3897 |
| 261 | Ga0099795_10004198 | 3300007788 | Bacteria | 3687 |
| 262 | Ga0105251_10120382 | 3300009011 | Bacteria | 1192 |
| 263 | Ga0105244_10099861 | 3300009036 | Bacteria | 1420 |
| 264 | Ga0105240_10045886 | 3300009093 | Bacteria | 5541 |
| 265 | Ga0111539_10000561 | 3300009094 | Bacteria | 47610 |
| 266 | Ga0111539_10004002 | 3300009094 | Bacteria | 19352 |
| 267 | Ga0111539_10004660 | 3300009094 | Bacteria | 17922 |
| 268 | Ga0105245_10000943 | 3300009098 | Bacteria | 26432 |
| 269 | Ga0105245_10242766 | 3300009098 | Bacteria | 1747 |
| 270 | Ga0105245_10306616 | 3300009098 | Unclassified | 1560 |
| 271 | Ga0105245_10383915 | 3300009098 | Unclassified | 1399 |
| 272 | Ga0105245_11135927 | 3300009098 | Bacteria | 828 |
| 273 | Ga0105247_10014588 | 3300009101 | Bacteria | 4713 |
| 274 | Ga0105247_10032411 | 3300009101 | Bacteria | 3175 |
| 275 | Ga0105247_10057226 | 3300009101 | Bacteria | 2410 |
| 276 | Ga0105247_10196345 | 3300009101 | Bacteria | 1353 |
| 277 | Ga0105247_10274535 | 3300009101 | Bacteria | 1161 |
| 278 | Ga0114129_10039587 | 3300009147 | Bacteria | 6646 |
| 279 | Ga0114129_10042755 | 3300009147 | Bacteria | 6377 |
| 280 | Ga0114129_10570794 | 3300009147 | Bacteria | 1469 |
| 281 | Ga0105243_10002854 | 3300009148 | Bacteria | 14321 |
| 282 | Ga0105243_10008993 | 3300009148 | Bacteria | 7635 |
| 283 | Ga0105243_10067794 | 3300009148 | Bacteria | 2874 |
| 284 | Ga0105243_10470894 | 3300009148 | Bacteria | 1183 |
| 285 | Ga0105241_10001331 | 3300009174 | Bacteria | 18766 |
| 286 | Ga0105241_10106665 | 3300009174 | Bacteria | 2236 |
| 287 | Ga0105241_10141848 | 3300009174 | Bacteria | 1957 |
| 288 | Ga0105242_10000036 | 3300009176 | Bacteria | 91470 |
| 289 | Ga0105242_10022615 | 3300009176 | Bacteria | 4948 |
| 290 | Ga0105242_10052059 | 3300009176 | Bacteria | 3339 |
| 291 | Ga0105248_10043021 | 3300009177 | Bacteria | 5065 |
| 292 | Ga0105248_10093214 | 3300009177 | Bacteria | 3392 |
| 293 | Ga0105237_10030440 | 3300009545 | Bacteria | 5482 |
| 294 | Ga0105237_10093691 | 3300009545 | Bacteria | 2993 |
| 295 | Ga0105237_10170505 | 3300009545 | Bacteria | 2176 |
| 296 | Ga0105237_10179751 | 3300009545 | Bacteria | 2116 |
| 297 | Ga0105238_10787553 | 3300009551 | Bacteria | 966 |
| 298 | Ga0105249_10018622 | 3300009553 | Bacteria | 6183 |
| 299 | Ga0105249_10021070 | 3300009553 | Bacteria | 5834 |
| 300 | Ga0105249_10274607 | 3300009553 | Bacteria | 1680 |
| 301 | Ga0099796_10000963 | 3300010159 | Bacteria | 5386 |
| 302 | Ga0099796_10104864 | 3300010159 | Bacteria | 1069 |
| 303 | Ga0105239_10024026 | 3300010375 | Bacteria | 6713 |
| 304 | Ga0105239_10049423 | 3300010375 | Bacteria | 4612 |
| 305 | Ga0105239_10087245 | 3300010375 | Bacteria | 3440 |
| 306 | Ga0105239_10250014 | 3300010375 | Bacteria | 1991 |
| 307 | Ga0105246_10014421 | 3300011119 | Bacteria | 4971 |
| 308 | Ga0105246_10047304 | 3300011119 | Bacteria | 2937 |
| 309 | Ga0105246_11171327 | 3300011119 | Unclassified | 706 |
| 310 | Ga0157336_1003052 | 3300012477 | Bacteria | 985 |
| 311 | Ga0157325_1001007 | 3300012485 | Bacteria | 1214 |
| 312 | Ga0157325_1004613 | 3300012485 | Unclassified | 816 |
| 313 | Ga0157341_1000404 | 3300012494 | Bacteria | 2139 |
| 314 | Ga0157338_1029864 | 3300012515 | Bacteria | 689 |
| 315 | Ga0157373_10004533 | 3300013100 | Bacteria | 10449 |
| 316 | Ga0157373_10589986 | 3300013100 | Bacteria | 808 |
| 317 | Ga0157371_10310476 | 3300013102 | Bacteria | 1143 |
| 318 | Ga0157374_10012850 | 3300013296 | Bacteria | 7292 |
| 319 | Ga0157374_10067682 | 3300013296 | Bacteria | 3358 |
| 320 | Ga0157374_11722277 | 3300013296 | Bacteria | 652 |
| 321 | Ga0157378_10000462 | 3300013297 | Bacteria | 38648 |
| 322 | Ga0157378_10006814 | 3300013297 | Bacteria | 9968 |
| 323 | Ga0157378_10352312 | 3300013297 | Bacteria | 1438 |
| 324 | Ga0157378_11379373 | 3300013297 | Bacteria | 747 |
| 325 | Ga0163162_10002063 | 3300013306 | Bacteria | 18880 |
| 326 | Ga0163162_10015790 | 3300013306 | Bacteria | 7380 |
| 327 | Ga0163162_10700153 | 3300013306 | Bacteria | 1135 |
| 328 | Ga0163162_11251370 | 3300013306 | Bacteria | 843 |
| 329 | Ga0163162_11975955 | 3300013306 | Bacteria | 668 |
| 330 | Ga0157372_10134691 | 3300013307 | Bacteria | 2844 |
| 331 | Ga0157375_10017542 | 3300013308 | Bacteria | 6464 |
| 332 | Ga0157375_10070657 | 3300013308 | Bacteria | 3502 |
| 333 | Ga0157375_10096764 | 3300013308 | Bacteria | 3025 |
| 334 | Ga0157375_10351257 | 3300013308 | Bacteria | 1640 |
| 335 | Ga0163163_10041884 | 3300014325 | Bacteria | 4481 |
| 336 | Ga0163163_10790875 | 3300014325 | Bacteria | 1012 |
| 337 | Ga0163163_10987147 | 3300014325 | Bacteria | 905 |
| 338 | Ga0157380_10000274 | 3300014326 | Bacteria | 30965 |
| 339 | Ga0157380_10053723 | 3300014326 | Bacteria | 3195 |
| 340 | Ga0157377_10000470 | 3300014745 | Bacteria | 17366 |
| 341 | Ga0157379_10007174 | 3300014968 | Bacteria | 9642 |
| 342 | Ga0157379_10048436 | 3300014968 | Bacteria | 3793 |
| 343 | Ga0157379_10076194 | 3300014968 | Bacteria | 3003 |
| 344 | Ga0157379_10094357 | 3300014968 | Bacteria | 2685 |
| 345 | Ga0157379_11773273 | 3300014968 | Unclassified | 606 |
| 346 | Ga0157376_10000508 | 3300014969 | Bacteria | 25164 |
| 347 | Ga0157376_10031773 | 3300014969 | Bacteria | 4233 |
| 348 | Ga0157376_10118645 | 3300014969 | Bacteria | 2341 |
| 349 | Ga0157376_10185265 | 3300014969 | Bacteria | 1905 |
| 350 | Ga0157376_11055612 | 3300014969 | Bacteria | 837 |
| 351 | Ga0163161_10001910 | 3300017792 | Bacteria | 15223 |
| 352 | Ga0163161_10053704 | 3300017792 | Bacteria | 2922 |
| 353 | Ga0163161_10179198 | 3300017792 | Bacteria | 1624 |
| 354 | Ga0207666_1000356 | 3300025271 | Bacteria | 6282 |
| 355 | Ga0207666_1005293 | 3300025271 | Bacteria | 1646 |
| 356 | Ga0207697_10004946 | 3300025315 | Bacteria | 6282 |
| 357 | Ga0207697_10120937 | 3300025315 | Bacteria | 1126 |
| 358 | Ga0207655_1156957 | 3300025728 | Unclassified | 715 |
| 359 | Ga0207713_1017837 | 3300025735 | Bacteria | 3536 |
| 360 | Ga0207682_10000135 | 3300025893 | Bacteria | 33308 |
| 361 | Ga0207692_10043247 | 3300025898 | Bacteria | 2240 |
| 362 | Ga0207642_10000073 | 3300025899 | Bacteria | 27837 |
| 363 | Ga0207642_10043867 | 3300025899 | Bacteria | 1976 |
| 364 | Ga0207710_10018190 | 3300025900 | Bacteria | 2987 |
| 365 | Ga0207710_10038243 | 3300025900 | Bacteria | 2122 |
| 366 | Ga0207710_10189427 | 3300025900 | Bacteria | 1012 |
| 367 | Ga0207710_10238883 | 3300025900 | Unclassified | 906 |
| 368 | Ga0207710_10484005 | 3300025900 | Bacteria | 641 |
| 369 | Ga0207688_10006665 | 3300025901 | Bacteria | 6282 |
| 370 | Ga0207688_10044363 | 3300025901 | Bacteria | 2478 |
| 371 | Ga0207680_10007561 | 3300025903 | Bacteria | 5305 |
| 372 | Ga0207680_10014423 | 3300025903 | Bacteria | 4089 |
| 373 | Ga0207680_10198124 | 3300025903 | Bacteria | 1367 |
| 374 | Ga0207647_10012910 | 3300025904 | Bacteria | 5804 |
| 375 | Ga0207685_10004709 | 3300025905 | Bacteria | 3507 |
| 376 | Ga0207699_10006915 | 3300025906 | Bacteria | 5520 |
| 377 | Ga0207699_10031208 | 3300025906 | Bacteria | 2990 |
| 378 | Ga0207699_10260099 | 3300025906 | Bacteria | 1199 |
| 379 | Ga0207699_10568269 | 3300025906 | Bacteria | 824 |
| 380 | Ga0207645_10000457 | 3300025907 | Bacteria | 33747 |
| 381 | Ga0207645_10043906 | 3300025907 | Bacteria | 2860 |
| 382 | Ga0207645_10092845 | 3300025907 | Bacteria | 1942 |
| 383 | Ga0207645_10492574 | 3300025907 | Bacteria | 829 |
| 384 | Ga0207643_10000853 | 3300025908 | Bacteria | 18464 |
| 385 | Ga0207643_10133104 | 3300025908 | Bacteria | 1481 |
| 386 | Ga0207654_10000638 | 3300025911 | Bacteria | 19789 |
| 387 | Ga0207707_10017958 | 3300025912 | Bacteria | 6167 |
| 388 | Ga0207707_10036744 | 3300025912 | Bacteria | 4282 |
| 389 | Ga0207707_10102568 | 3300025912 | Bacteria | 2501 |
| 390 | Ga0207707_10787122 | 3300025912 | Bacteria | 793 |
| 391 | Ga0207695_10036170 | 3300025913 | Bacteria | 5341 |
| 392 | Ga0207671_10032909 | 3300025914 | Bacteria | 3858 |
| 393 | Ga0207671_10170577 | 3300025914 | Bacteria | 1689 |
| 394 | Ga0207671_10347437 | 3300025914 | Bacteria | 1176 |
| 395 | Ga0207693_10014951 | 3300025915 | Bacteria | 6233 |
| 396 | Ga0207693_10069871 | 3300025915 | Bacteria | 2748 |
| 397 | Ga0207663_10052024 | 3300025916 | Bacteria | 2553 |
| 398 | Ga0207663_10060610 | 3300025916 | Bacteria | 2398 |
| 399 | Ga0207663_10087616 | 3300025916 | Bacteria | 2056 |
| 400 | Ga0207663_10118737 | 3300025916 | Bacteria | 1807 |
| 401 | Ga0207663_10344888 | 3300025916 | Bacteria | 1126 |
| 402 | Ga0207660_10001020 | 3300025917 | Bacteria | 18545 |
| 403 | Ga0207660_10018103 | 3300025917 | Bacteria | 4692 |
| 404 | Ga0207660_10217779 | 3300025917 | Bacteria | 1497 |
| 405 | Ga0207660_10339648 | 3300025917 | Unclassified | 1202 |
| 406 | Ga0207662_10005471 | 3300025918 | Bacteria | 6773 |
| 407 | Ga0207662_10014776 | 3300025918 | Bacteria | 4384 |
| 408 | Ga0207662_10268179 | 3300025918 | Bacteria | 1126 |
| 409 | Ga0207657_10025718 | 3300025919 | Bacteria | 5422 |
| 410 | Ga0207657_10031026 | 3300025919 | Bacteria | 4846 |
| 411 | Ga0207657_10077962 | 3300025919 | Bacteria | 2792 |
| 412 | Ga0207649_10000760 | 3300025920 | Bacteria | 20983 |
| 413 | Ga0207649_10011720 | 3300025920 | Bacteria | 4845 |
| 414 | Ga0207649_10068178 | 3300025920 | Bacteria | 2261 |
| 415 | Ga0207652_10000764 | 3300025921 | Bacteria | 30807 |
| 416 | Ga0207652_10141361 | 3300025921 | Bacteria | 2152 |
| 417 | Ga0207652_10203626 | 3300025921 | Bacteria | 1781 |
| 418 | Ga0207652_10798136 | 3300025921 | Unclassified | 838 |
| 419 | Ga0207646_10257654 | 3300025922 | Bacteria | 1577 |
| 420 | Ga0207681_10000065 | 3300025923 | Bacteria | 98832 |
| 421 | Ga0207694_10399188 | 3300025924 | Bacteria | 1143 |
| 422 | Ga0207650_10001773 | 3300025925 | Bacteria | 15269 |
| 423 | Ga0207650_10594567 | 3300025925 | Bacteria | 930 |
| 424 | Ga0207659_10000142 | 3300025926 | Bacteria | 42302 |
| 425 | Ga0207659_10017702 | 3300025926 | Bacteria | 4657 |
| 426 | Ga0207659_10253946 | 3300025926 | Bacteria | 1427 |
| 427 | Ga0207687_10000125 | 3300025927 | Bacteria | 51567 |
| 428 | Ga0207687_10498333 | 3300025927 | Bacteria | 1016 |
| 429 | Ga0207687_10507615 | 3300025927 | Bacteria | 1007 |
| 430 | Ga0207687_10808658 | 3300025927 | Bacteria | 800 |
| 431 | Ga0207700_10010816 | 3300025928 | Bacteria | 5788 |
| 432 | Ga0207700_10043361 | 3300025928 | Bacteria | 3304 |
| 433 | Ga0207664_10101878 | 3300025929 | Bacteria | 2373 |
| 434 | Ga0207644_10002125 | 3300025931 | Bacteria | 12862 |
| 435 | Ga0207644_10004403 | 3300025931 | Bacteria | 9137 |
| 436 | Ga0207644_10145342 | 3300025931 | Bacteria | 1830 |
| 437 | Ga0207644_11044831 | 3300025931 | Unclassified | 686 |
| 438 | Ga0207690_10003823 | 3300025932 | Bacteria | 8908 |
| 439 | Ga0207690_10013751 | 3300025932 | Bacteria | 4872 |
| 440 | Ga0207706_10019275 | 3300025933 | Bacteria | 6135 |
| 441 | Ga0207706_10019316 | 3300025933 | Bacteria | 6129 |
| 442 | Ga0207706_10025926 | 3300025933 | Bacteria | 5249 |
| 443 | Ga0207706_10378065 | 3300025933 | Unclassified | 1229 |
| 444 | Ga0207686_10000344 | 3300025934 | Bacteria | 33461 |
| 445 | Ga0207686_10016499 | 3300025934 | Bacteria | 4146 |
| 446 | Ga0207686_10083193 | 3300025934 | Bacteria | 2094 |
| 447 | Ga0207709_10000183 | 3300025935 | Bacteria | 83374 |
| 448 | Ga0207709_10045448 | 3300025935 | Bacteria | 2659 |
| 449 | Ga0207709_10046256 | 3300025935 | Bacteria | 2640 |
| 450 | Ga0207709_10260229 | 3300025935 | Bacteria | 1272 |
| 451 | Ga0207670_10000288 | 3300025936 | Bacteria | 30769 |
| 452 | Ga0207670_10034555 | 3300025936 | Bacteria | 3269 |
| 453 | Ga0207670_10038515 | 3300025936 | Bacteria | 3123 |
| 454 | Ga0207669_10000081 | 3300025937 | Bacteria | 48214 |
| 455 | Ga0207669_10152204 | 3300025937 | Bacteria | 1622 |
| 456 | Ga0207669_10864494 | 3300025937 | Bacteria | 753 |
| 457 | Ga0207704_10000121 | 3300025938 | Bacteria | 42395 |
| 458 | Ga0207704_10012634 | 3300025938 | Bacteria | 4195 |
| 459 | Ga0207704_10056891 | 3300025938 | Bacteria | 2399 |
| 460 | Ga0207704_10073584 | 3300025938 | Bacteria | 2177 |
| 461 | Ga0207665_10002359 | 3300025939 | Bacteria | 12750 |
| 462 | Ga0207691_10008864 | 3300025940 | Bacteria | 9655 |
| 463 | Ga0207691_10095404 | 3300025940 | Bacteria | 2660 |
| 464 | Ga0207711_10004044 | 3300025941 | Bacteria | 12590 |
| 465 | Ga0207711_10043178 | 3300025941 | Bacteria | 3845 |
| 466 | Ga0207711_10069734 | 3300025941 | Bacteria | 3048 |
| 467 | Ga0207711_10098096 | 3300025941 | Bacteria | 2589 |
| 468 | Ga0207689_10000696 | 3300025942 | Bacteria | 32214 |
| 469 | Ga0207689_10169992 | 3300025942 | Bacteria | 1796 |
| 470 | Ga0207661_10000286 | 3300025944 | Bacteria | 31850 |
| 471 | Ga0207661_10532274 | 3300025944 | Bacteria | 1075 |
| 472 | Ga0207679_10000064 | 3300025945 | Bacteria | 98118 |
| 473 | Ga0207679_10059490 | 3300025945 | Bacteria | 2835 |
| 474 | Ga0207679_10314830 | 3300025945 | Bacteria | 1353 |
| 475 | Ga0207667_10007326 | 3300025949 | Bacteria | 13281 |
| 476 | Ga0207667_10102130 | 3300025949 | Bacteria | 2958 |
| 477 | Ga0207667_10104622 | 3300025949 | Bacteria | 2920 |
| 478 | Ga0207651_10000395 | 3300025960 | Bacteria | 18475 |
| 479 | Ga0207651_10006576 | 3300025960 | Bacteria | 6106 |
| 480 | Ga0207651_10128535 | 3300025960 | Bacteria | 1935 |
| 481 | Ga0207712_10000752 | 3300025961 | Bacteria | 24492 |
| 482 | Ga0207712_10015902 | 3300025961 | Bacteria | 4862 |
| 483 | Ga0207668_10000715 | 3300025972 | Bacteria | 20294 |
| 484 | Ga0207668_10055847 | 3300025972 | Bacteria | 2747 |
| 485 | Ga0207668_10131898 | 3300025972 | Bacteria | 1909 |
| 486 | Ga0207640_10003491 | 3300025981 | Bacteria | 8467 |
| 487 | Ga0207640_10094339 | 3300025981 | Bacteria | 2081 |
| 488 | Ga0207658_10001038 | 3300025986 | Bacteria | 22571 |
| 489 | Ga0207658_10084588 | 3300025986 | Bacteria | 2441 |
| 490 | Ga0207658_10098487 | 3300025986 | Bacteria | 2285 |
| 491 | Ga0207658_10336844 | 3300025986 | Bacteria | 1310 |
| 492 | Ga0207658_10377723 | 3300025986 | Bacteria | 1240 |
| 493 | Ga0207677_10000985 | 3300026023 | Bacteria | 15691 |
| 494 | Ga0207677_10170894 | 3300026023 | Bacteria | 1699 |
| 495 | Ga0207703_10001400 | 3300026035 | Bacteria | 21963 |
| 496 | Ga0207703_10020429 | 3300026035 | Bacteria | 5179 |
| 497 | Ga0207703_10091455 | 3300026035 | Bacteria | 2559 |
| 498 | Ga0207703_10216388 | 3300026035 | Bacteria | 1711 |
| 499 | Ga0207703_10295993 | 3300026035 | Bacteria | 1474 |
| 500 | Ga0207639_10005141 | 3300026041 | Bacteria | 8820 |
| 501 | Ga0207639_10046126 | 3300026041 | Bacteria | 3287 |
| 502 | Ga0207639_11533059 | 3300026041 | Bacteria | 625 |
| 503 | Ga0207678_10009603 | 3300026067 | Bacteria | 8508 |
| 504 | Ga0207678_10034395 | 3300026067 | Bacteria | 4414 |
| 505 | Ga0207678_10134606 | 3300026067 | Bacteria | 2109 |
| 506 | Ga0207708_10012692 | 3300026075 | Bacteria | 6282 |
| 507 | Ga0207708_10015109 | 3300026075 | Bacteria | 5784 |
| 508 | Ga0207708_10095298 | 3300026075 | Bacteria | 2298 |
| 509 | Ga0207708_10112366 | 3300026075 | Bacteria | 2116 |
| 510 | Ga0207708_10191168 | 3300026075 | Bacteria | 1629 |
| 511 | Ga0207702_10001395 | 3300026078 | Bacteria | 24082 |
| 512 | Ga0207702_10418712 | 3300026078 | Bacteria | 1295 |
| 513 | Ga0207702_10576329 | 3300026078 | Bacteria | 1103 |
| 514 | Ga0207702_10733087 | 3300026078 | Bacteria | 975 |
| 515 | Ga0207641_10003265 | 3300026088 | Bacteria | 14436 |
| 516 | Ga0207641_10068229 | 3300026088 | Bacteria | 3048 |
| 517 | Ga0207641_10264500 | 3300026088 | Bacteria | 1612 |
| 518 | Ga0207641_10521470 | 3300026088 | Unclassified | 1156 |
| 519 | Ga0207648_10008132 | 3300026089 | Bacteria | 10204 |
| 520 | Ga0207648_10118095 | 3300026089 | Bacteria | 2331 |
| 521 | Ga0207648_10551078 | 3300026089 | Unclassified | 1059 |
| 522 | Ga0207676_10000079 | 3300026095 | Bacteria | 94811 |
| 523 | Ga0207676_10004283 | 3300026095 | Bacteria | 10089 |
| 524 | Ga0207676_11168801 | 3300026095 | Unclassified | 762 |
| 525 | Ga0207674_10006886 | 3300026116 | Bacteria | 13321 |
| 526 | Ga0207674_10270775 | 3300026116 | Bacteria | 1646 |
| 527 | Ga0207675_100019734 | 3300026118 | Bacteria | 6291 |
| 528 | Ga0207675_100023481 | 3300026118 | Bacteria | 5737 |
| 529 | Ga0207675_101622671 | 3300026118 | Bacteria | 667 |
| 530 | Ga0207683_10000037 | 3300026121 | Bacteria | 100920 |
| 531 | Ga0207683_10006533 | 3300026121 | Bacteria | 9983 |
| 532 | Ga0207683_10011735 | 3300026121 | Bacteria | 7478 |
| 533 | Ga0207683_10040380 | 3300026121 | Bacteria | 4072 |
| 534 | Ga0207698_10006345 | 3300026142 | Bacteria | 7368 |
| 535 | Ga0207698_10062688 | 3300026142 | Bacteria | 2905 |
| 536 | Ga0207698_11074951 | 3300026142 | Bacteria | 817 |
| 537 | Ga0209973_1034280 | 3300027252 | Bacteria | 726 |
| 538 | Ga0209967_1029468 | 3300027364 | Bacteria | 819 |
| 539 | Ga0209179_1001119 | 3300027512 | Bacteria | 3129 |
| 540 | Ga0209179_1003709 | 3300027512 | Bacteria | 2231 |
| 541 | Ga0209970_1005518 | 3300027614 | Bacteria | 2088 |
| 542 | Ga0210002_1001169 | 3300027617 | Bacteria | 3654 |
| 543 | Ga0209971_1002495 | 3300027682 | Bacteria | 4413 |
| 544 | Ga0209966_1001440 | 3300027695 | Bacteria | 4125 |
| 545 | Ga0209998_10001960 | 3300027717 | Bacteria | 4829 |
| 546 | Ga0209813_10057210 | 3300027866 | Bacteria | 1236 |
| 547 | Ga0209974_10003753 | 3300027876 | Bacteria | 5440 |
| 548 | Ga0209974_10017872 | 3300027876 | Bacteria | 2352 |
| 549 | Ga0207428_10000292 | 3300027907 | Bacteria | 67070 |
| 550 | Ga0207428_10002255 | 3300027907 | Bacteria | 19356 |
| 551 | Ga0207428_10043033 | 3300027907 | Bacteria | 3650 |
| 552 | Ga0268266_10014497 | 3300028379 | Bacteria | 6774 |
| 553 | Ga0268265_10001133 | 3300028380 | Bacteria | 23531 |
| 554 | Ga0268265_10009438 | 3300028380 | Bacteria | 6588 |
| 555 | Ga0268264_10000805 | 3300028381 | Bacteria | 33825 |
| 556 | Ga0268264_10178192 | 3300028381 | Bacteria | 1928 |
| 557 | Ga0268264_10276005 | 3300028381 | Bacteria | 1572 |
| 558 | Ga0268264_10584781 | 3300028381 | Bacteria | 1099 |
| 559 | Ga0265325_10015804 | 3300031241 | Bacteria | 4234 |
| 560 | Ga0265325_10121690 | 3300031241 | Bacteria | 1257 |
| 561 | Ga0265340_10085097 | 3300031247 | Bacteria | 1484 |
| 562 | Ga0265339_10008278 | 3300031249 | Bacteria | 6625 |
| 563 | Ga0265316_10481371 | 3300031344 | Unclassified | 888 |
| 564 | Ga0265313_10002244 | 3300031595 | Bacteria | 16997 |
| 565 | Ga0307407_11075739 | 3300031903 | Bacteria | 624 |
| 566 | Ga0373930_0001896 | 3300034816 | Bacteria | 3189 |
| 567 | Ga0373930_0005241 | 3300034816 | Bacteria | 2147 |
| 568 | Ga0373948_0000081 | 3300034817 | Bacteria | 9832 |
| 569 | Ga0373948_0010170 | 3300034817 | Bacteria | 1638 |
| 570 | Ga0373950_0003742 | 3300034818 | Bacteria | 2195 |
| 571 | Ga0373958_0008357 | 3300034819 | Bacteria | 1674 |
| 572 | Ga0373959_0000392 | 3300034820 | Bacteria | 8667 |
| 573 | Ga0373959_0033741 | 3300034820 | Bacteria | 1045 |
| 574 | Ga0373959_0159401 | 3300034820 | Bacteria | 575 |
| 575 | Ga0373938_0000063 | 3300034957 | Bacteria | 13779 |
| 576 | Ga0373938_0003923 | 3300034957 | Bacteria | 2461 |
| 577 | Ga0373938_0005098 | 3300034957 | Bacteria | 2221 |
| 578 | Ga0373926_0020321 | 3300035083 | Bacteria | 2294 |
| 579 | Ga0373928_0001474 | 3300035084 | Bacteria | 4578 |
| 580 | Ga0373928_0005009 | 3300035084 | Bacteria | 2524 |
| 581 | Ga0373929_0001110 | 3300035085 | Bacteria | 5223 |
| 582 | Ga0373929_0010975 | 3300035085 | Bacteria | 1700 |
| 583 | Ga0373940_0000418 | 3300035088 | Bacteria | 6472 |
| 584 | Ga0373940_0006847 | 3300035088 | Bacteria | 2549 |
| 585 | Ga0373944_0015604 | 3300035089 | Bacteria | 2133 |
| 586 | Ga0373944_0078723 | 3300035089 | Bacteria | 1085 |
| 587 | Ga0373949_0000779 | 3300035090 | Bacteria | 10258 |
| 588 | Ga0373949_0002326 | 3300035090 | Bacteria | 4938 |
| 589 | Ga0373951_0001074 | 3300035091 | Bacteria | 7317 |
| 590 | Ga0373951_0003704 | 3300035091 | Bacteria | 3688 |
| 591 | Ga0373951_0005252 | 3300035091 | Bacteria | 3017 |
| 592 | Ga0373952_0001672 | 3300035092 | Bacteria | 4033 |
| 593 | Ga0373952_0003287 | 3300035092 | Bacteria | 2914 |
| 594 | Ga0373923_0000419 | 3300035111 | Bacteria | 9940 |
| 595 | Ga0373923_0052556 | 3300035111 | Bacteria | 1712 |
| 596 | Ga0373923_0101479 | 3300035111 | Bacteria | 1269 |
| 597 | Ga0373923_0363874 | 3300035111 | Unclassified | 692 |
| 598 | Ga0373932_0000516 | 3300035112 | Bacteria | 11899 |
| 599 | Ga0373932_0002506 | 3300035112 | Bacteria | 4619 |
| 600 | Ga0373932_0002800 | 3300035112 | Bacteria | 4321 |
| 601 | Ga0373932_0055942 | 3300035112 | Bacteria | 1185 |
| 602 | Ga0373936_0000230 | 3300035113 | Bacteria | 18464 |
| 603 | Ga0373936_0012305 | 3300035113 | Bacteria | 3253 |
| 604 | Ga0373936_0148056 | 3300035113 | Unclassified | 1017 |
| 605 | Ga0373939_0001269 | 3300035114 | Bacteria | 6162 |
| 606 | Ga0373939_0003293 | 3300035114 | Bacteria | 3791 |
| 607 | Ga0373939_0019437 | 3300035114 | Bacteria | 1833 |
| 608 | Ga0373941_0001012 | 3300035115 | Bacteria | 5840 |
| 609 | Ga0373941_0002320 | 3300035115 | Bacteria | 4170 |
| 610 | Ga0373941_0064352 | 3300035115 | Bacteria | 1201 |
| 611 | Ga0373945_0001082 | 3300035116 | Bacteria | 8196 |
| 612 | Ga0373945_0010619 | 3300035116 | Bacteria | 3035 |
| 613 | Ga0373945_0045730 | 3300035116 | Bacteria | 1595 |
| 614 | Ga0373945_0060465 | 3300035116 | Bacteria | 1413 |
| 615 | Ga0373945_0296320 | 3300035116 | Unclassified | 692 |
| 616 | Ga0373953_0000282 | 3300035117 | Bacteria | 14066 |
| 617 | Ga0373953_0005616 | 3300035117 | Bacteria | 4084 |
| 618 | Ga0373953_0134580 | 3300035117 | Unclassified | 1055 |
| 619 | Ga0373954_0000163 | 3300035118 | Bacteria | 23852 |
| 620 | Ga0373954_0204860 | 3300035118 | Bacteria | 969 |
| 621 | Ga0373956_0033016 | 3300035119 | Bacteria | 2274 |
| 622 | Ga0373957_0011256 | 3300035120 | Bacteria | 2980 |
| 623 | Ga0373960_0002055 | 3300035121 | Bacteria | 4527 |
| 624 | Ga0373960_0002580 | 3300035121 | Bacteria | 4090 |
| 625 | Ga0373960_0007020 | 3300035121 | Bacteria | 2656 |
| 626 | Ga0373960_0122781 | 3300035121 | Bacteria | 863 |
| 627 | Ga0373943_0017330 | 3300035170 | Bacteria | 3295 |
| 628 | Ga0373943_0060003 | 3300035170 | Bacteria | 1898 |
| 629 | Ga0373943_0432782 | 3300035170 | Unclassified | 762 |
| 630 | Ga0373946_0000412 | 3300035171 | Bacteria | 13925 |
| 631 | Ga0373946_0003737 | 3300035171 | Bacteria | 5398 |
| 632 | Ga0373946_0053791 | 3300035171 | Bacteria | 1692 |
| 633 | Ga0373946_0118446 | 3300035171 | Bacteria | 1206 |
| 634 | Ga0373946_0243360 | 3300035171 | Bacteria | 875 |
| 635 | Ga0373955_0000071 | 3300035172 | Bacteria | 40941 |
| 636 | Ga0373955_0015938 | 3300035172 | Bacteria | 3689 |
| 637 | Ga0373955_0023754 | 3300035172 | Bacteria | 3127 |
| 638 | Ga0373955_0035556 | 3300035172 | Bacteria | 2638 |
| 639 | Ga0373942_0000898 | 3300035207 | Bacteria | 8141 |
| 640 | Ga0373942_0024768 | 3300035207 | Bacteria | 1541 |
| 641 | Ga0373961_0003012 | 3300035241 | Bacteria | 4249 |
| 642 | Ga0373961_0013509 | 3300035241 | Bacteria | 2060 |
| 643 | Ga0373961_0099912 | 3300035241 | Bacteria | 938 |
| 644 | Ga0373962_0006516 | 3300035242 | Bacteria | 2829 |
| 645 | Ga0373962_0024611 | 3300035242 | Bacteria | 1611 |
| 646 | Ga0373924_0002670 | 3300035410 | Bacteria | 6013 |
| 647 | Ga0373924_0054259 | 3300035410 | Bacteria | 1666 |
| 648 | Ga0373931_0002005 | 3300035691 | Bacteria | 8964 |
| 649 | Ga0373931_0004422 | 3300035691 | Bacteria | 6420 |
| 650 | Ga0373935_0001582 | 3300035692 | Bacteria | 12695 |
| 651 | Ga0373935_0011061 | 3300035692 | Bacteria | 5421 |
| 652 | Ga0373935_0048143 | 3300035692 | Bacteria | 2698 |
| 653 | Ga0373935_0068391 | 3300035692 | Bacteria | 2285 |
| 654 | Ga0373927_0001396 | 3300035695 | Bacteria | 18191 |
| 655 | Ga0373927_0023381 | 3300035695 | Bacteria | 4047 |
| 656 | Ga0373927_0073665 | 3300035695 | Bacteria | 2211 |
| 657 | Ga0373927_0086810 | 3300035695 | Bacteria | 2031 |
| 658 | Ga0373927_0098638 | 3300035695 | Bacteria | 1899 |
| 659 | Ga0373933_0002030 | 3300035724 | Bacteria | 11646 |
| 660 | Ga0373933_0051605 | 3300035724 | Bacteria | 2459 |
| 661 | Ga0373933_0109401 | 3300035724 | Bacteria | 1722 |
| 662 | Ga0373947_0000637 | 3300035725 | Bacteria | 20738 |
| 663 | Ga0373947_0001895 | 3300035725 | Bacteria | 12777 |
| 664 | Ga0373947_0156883 | 3300035725 | Bacteria | 1469 |
| 665 | Ga0373937_0000162 | 3300036401 | Bacteria | 64742 |
| 666 | Ga0373937_0001510 | 3300036401 | Bacteria | 19543 |
| 667 | Ga0373937_0284846 | 3300036401 | Bacteria | 1561 |
| 668 | Ga0373937_0516071 | 3300036401 | Bacteria | 1135 |
| 669 | Ga0373937_0598338 | 3300036401 | Bacteria | 1047 |
| 670 | Ga0373925_0000025 | 3300037068 | Bacteria | 154937 |
| 671 | Ga0373925_0008479 | 3300037068 | Bacteria | 7492 |
| 672 | Ga0373925_0104374 | 3300037068 | Bacteria | 2182 |
| 673 | Ga0373925_0758266 | 3300037068 | Bacteria | 800 |
| 674 | Ga0439448_0047442 | 3300042005 | Bacteria | 1401 |
| 675 | Ga0466961_0211234 | 3300044693 | Bacteria | 1198 |
| 676 | Ga0466963_0060629 | 3300044694 | Bacteria | 2527 |
| 677 | Ga0453684_0590591 | 3300044712 | Bacteria | 1218 |
| 678 | Ga0466971_0141098 | 3300044719 | Unclassified | 1122 |
| 679 | Ga0466971_0257681 | 3300044719 | Bacteria | 832 |
| 680 | Ga0466957_0195517 | 3300044842 | Bacteria | 1326 |
| 681 | Ga0451576_0074642 | 3300045051 | Bacteria | 3529 |
| 682 | Ga0466967_0344536 | 3300045976 | Bacteria | 1442 |
| 683 | Ga0495617_043993 | 3300046452 | Bacteria | 1491 |
| 684 | Ga0495592_0000132 | 3300046454 | Bacteria | 66310 |
| 685 | Ga0495592_0132810 | 3300046454 | Bacteria | 1739 |
| 686 | Ga0495603_0007685 | 3300046455 | Bacteria | 6495 |
| 687 | Ga0495603_0096874 | 3300046455 | Bacteria | 1723 |
| 688 | Ga0495629_0001003 | 3300046459 | Bacteria | 22634 |
| 689 | Ga0495629_0013677 | 3300046459 | Bacteria | 5856 |
| 690 | Ga0495629_0032442 | 3300046459 | Bacteria | 3698 |
| 691 | Ga0495629_0181311 | 3300046459 | Bacteria | 1459 |
| 692 | Ga0495629_0303900 | 3300046459 | Bacteria | 1092 |
| 693 | Ga0495641_0027557 | 3300046461 | Bacteria | 2761 |
| 694 | Ga0495651_0000308 | 3300046462 | Bacteria | 38022 |
| 695 | Ga0495651_0012100 | 3300046462 | Bacteria | 6638 |
| 696 | Ga0495653_0000041 | 3300046463 | Bacteria | 118366 |
| 697 | Ga0495653_0000944 | 3300046463 | Bacteria | 22338 |
| 698 | Ga0495580_0394786 | 3300046472 | Unclassified | 933 |
| 699 | Ga0495582_0025753 | 3300046473 | Bacteria | 3222 |
| 700 | Ga0495605_0199003 | 3300046474 | Bacteria | 874 |
| 701 | Ga0495639_0011524 | 3300046475 | Bacteria | 3812 |
| 702 | Ga0495639_0068574 | 3300046475 | Bacteria | 1635 |
| 703 | Ga0495639_0104253 | 3300046475 | Bacteria | 1341 |
| 704 | Ga0495662_0003042 | 3300046476 | Bacteria | 8456 |
| 705 | Ga0495662_0030634 | 3300046476 | Bacteria | 2597 |
| 706 | Ga0495662_0174406 | 3300046476 | Bacteria | 1059 |
| 707 | Ga0495664_0000005 | 3300046477 | Bacteria | 439635 |
| 708 | Ga0495664_0003269 | 3300046477 | Bacteria | 8808 |
| 709 | Ga0495664_0065566 | 3300046477 | Bacteria | 2165 |
| 710 | Ga0495584_0035734 | 3300046491 | Bacteria | 2511 |
| 711 | Ga0495585_0004199 | 3300046492 | Bacteria | 9408 |
| 712 | Ga0495594_0017659 | 3300046499 | Bacteria | 3772 |
| 713 | Ga0495594_0045285 | 3300046499 | Bacteria | 2415 |
| 714 | Ga0495607_0008348 | 3300046501 | Bacteria | 7084 |
| 715 | Ga0495608_0000003 | 3300046511 | Bacteria | 369831 |
| 716 | Ga0495608_0003838 | 3300046511 | Bacteria | 10802 |
| 717 | Ga0495618_0000010 | 3300046514 | Bacteria | 189314 |
| 718 | Ga0495618_0012117 | 3300046514 | Bacteria | 5234 |
| 719 | Ga0495618_0493112 | 3300046514 | Bacteria | 739 |
| 720 | Ga0495628_0000019 | 3300046516 | Bacteria | 154435 |
| 721 | Ga0495630_0034834 | 3300046517 | Bacteria | 3761 |
| 722 | Ga0495637_0045772 | 3300046520 | Bacteria | 1854 |
| 723 | Ga0495637_0099064 | 3300046520 | Bacteria | 1141 |
| 724 | Ga0495644_0001707 | 3300046523 | Bacteria | 8891 |
| 725 | Ga0495666_0005800 | 3300046526 | Bacteria | 6224 |
| 726 | Ga0495666_0023090 | 3300046526 | Bacteria | 3077 |
| 727 | Ga0495666_0358899 | 3300046526 | Unclassified | 656 |
| 728 | Ga0495652_0000028 | 3300046529 | Bacteria | 157336 |
| 729 | Ga0495665_0029847 | 3300046531 | Bacteria | 2920 |
| 730 | Ga0495640_0000014 | 3300046533 | Bacteria | 161741 |
| 731 | Ga0495640_0019724 | 3300046533 | Bacteria | 4973 |
| 732 | Ga0495640_0029249 | 3300046533 | Bacteria | 3958 |
| 733 | Ga0495640_0059050 | 3300046533 | Bacteria | 2614 |
| 734 | Ga0495586_0006928 | 3300046535 | Bacteria | 6037 |
| 735 | Ga0495587_0000026 | 3300046536 | Bacteria | 147819 |
| 736 | Ga0495587_0000520 | 3300046536 | Bacteria | 26784 |
| 737 | Ga0495621_0041722 | 3300046539 | Bacteria | 1612 |
| 738 | Ga0495645_0000005 | 3300046543 | Bacteria | 443917 |
| 739 | Ga0495645_0068462 | 3300046543 | Bacteria | 2562 |
| 740 | Ga0495645_0335078 | 3300046543 | Bacteria | 978 |
| 741 | Ga0495622_0049938 | 3300046557 | Bacteria | 1942 |
| 742 | Ga0495622_0159256 | 3300046557 | Bacteria | 1018 |
| 743 | Ga0495633_0003249 | 3300046558 | Bacteria | 10952 |
| 744 | Ga0495667_0000003 | 3300046559 | Bacteria | 295404 |
| 745 | Ga0495667_0013996 | 3300046559 | Bacteria | 5416 |
| 746 | Ga0495656_0000538 | 3300046615 | Bacteria | 12366 |
| 747 | Ga0495634_0000017 | 3300046642 | Bacteria | 122411 |
| 748 | Ga0495634_0109273 | 3300046642 | Bacteria | 1779 |
| 749 | Ga0495634_0445112 | 3300046642 | Bacteria | 765 |
| 750 | Ga0495611_0147671 | 3300046648 | Bacteria | 1097 |
| 751 | Ga0495635_0000024 | 3300046663 | Bacteria | 148235 |
| 752 | Ga0495635_0086535 | 3300046663 | Bacteria | 2144 |
| 753 | Ga0495635_0789762 | 3300046663 | Unclassified | 612 |
| 754 | Ga0495659_0004395 | 3300046664 | Bacteria | 4438 |
| 755 | Ga0495661_0039583 | 3300046665 | Bacteria | 2929 |
| 756 | Ga0495657_0000034 | 3300046675 | Bacteria | 122360 |
| 757 | Ga0495599_0000017 | 3300046678 | Bacteria | 162507 |
| 758 | Ga0495623_0000028 | 3300046679 | Bacteria | 87634 |
| 759 | Ga0495623_0085678 | 3300046679 | Bacteria | 1943 |
| 760 | Ga0495646_0000015 | 3300046680 | Bacteria | 141718 |
| 761 | Ga0495646_0013001 | 3300046680 | Bacteria | 5292 |
| 762 | Ga0495647_0002287 | 3300046681 | Bacteria | 6009 |
| 763 | Ga0495647_0234204 | 3300046681 | Unclassified | 814 |
| 764 | Ga0495647_0241297 | 3300046681 | Bacteria | 802 |
| 765 | Ga0495647_0245496 | 3300046681 | Unclassified | 796 |
| 766 | Ga0495658_0000814 | 3300046683 | Bacteria | 16758 |
| 767 | Ga0495658_0542207 | 3300046683 | Unclassified | 745 |
| 768 | Ga0495613_0009829 | 3300046689 | Bacteria | 7114 |
| 769 | Ga0495613_0015645 | 3300046689 | Bacteria | 5646 |
| 770 | Ga0495613_0300051 | 3300046689 | Bacteria | 1112 |
| 771 | Ga0495613_0325835 | 3300046689 | Bacteria | 1059 |
| 772 | Ga0495624_0077820 | 3300046690 | Bacteria | 2057 |
| 773 | Ga0495624_0437415 | 3300046690 | Bacteria | 784 |
| 774 | Ga0495624_0640513 | 3300046690 | Bacteria | 633 |
| 775 | Ga0495670_0002388 | 3300046691 | Bacteria | 9251 |
| 776 | Ga0495589_0049868 | 3300046794 | Bacteria | 2072 |
| 777 | Ga0495600_0000058 | 3300046809 | Bacteria | 65689 |
| 778 | Ga0495600_0314619 | 3300046809 | Bacteria | 985 |
| 779 | Ga0495581_0001732 | 3300047315 | Bacteria | 12161 |
| 780 | Ga0495581_0536787 | 3300047315 | Unclassified | 679 |
| 781 | Ga0495604_0000021 | 3300047317 | Bacteria | 169432 |
| 782 | Ga0495604_0407399 | 3300047317 | Bacteria | 894 |
| 783 | Ga0495636_0024479 | 3300047318 | Bacteria | 2449 |
| 784 | Ga0495674_0000005 | 3300047319 | Bacteria | 375129 |
| 785 | Ga0495674_0005073 | 3300047319 | Bacteria | 12660 |
| 786 | Ga0495674_0015663 | 3300047319 | Bacteria | 7078 |
| 787 | Ga0495674_0036936 | 3300047319 | Bacteria | 4391 |
| 788 | Ga0495676_0110984 | 3300047321 | Bacteria | 2012 |
| 789 | Ga0495680_0000503 | 3300047322 | Bacteria | 44080 |
| 790 | Ga0495680_0078375 | 3300047322 | Bacteria | 2500 |
| 791 | Ga0495675_0000085 | 3300047444 | Bacteria | 65846 |
| 792 | Ga0495675_0000462 | 3300047444 | Bacteria | 26793 |
| 793 | Ga0495677_0028344 | 3300047445 | Bacteria | 2033 |
| 794 | Ga0495679_042488 | 3300047446 | Bacteria | 1402 |
| 795 | Ga0495684_0000001 | 3300047471 | Bacteria | 369809 |
| 796 | Ga0495684_0069856 | 3300047471 | Bacteria | 2670 |
| 797 | Ga0495593_0001873 | 3300047673 | Bacteria | 12527 |
| 798 | Ga0495593_0005331 | 3300047673 | Bacteria | 7603 |
| 799 | Ga0495593_0013840 | 3300047673 | Bacteria | 4596 |
| 800 | Ga0495602_0000003 | 3300048088 | Bacteria | 357240 |
| 801 | Ga0495602_0190424 | 3300048088 | Bacteria | 1573 |
| 802 | Ga0495614_0244385 | 3300048089 | Unclassified | 820 |
| 803 | Ga0496100_0000280 | 3300048903 | Bacteria | 25823 |
| 804 | Ga0496100_0063094 | 3300048903 | Bacteria | 2447 |
| 805 | Ga0496100_0490715 | 3300048903 | Bacteria | 945 |
| 806 | Ga0496100_0641443 | 3300048903 | Unclassified | 826 |
| 807 | Ga0496101_0000842 | 3300048904 | Bacteria | 18039 |
| 808 | Ga0496101_0146317 | 3300048904 | Bacteria | 1804 |
| 809 | Ga0496101_0202914 | 3300048904 | Bacteria | 1533 |
| 810 | Ga0496101_0310723 | 3300048904 | Bacteria | 1236 |
| 811 | Ga0496101_0790376 | 3300048904 | Unclassified | 748 |
| 812 | Ga0496102_0001974 | 3300048905 | Bacteria | 17705 |
| 813 | Ga0496102_0029775 | 3300048905 | Bacteria | 4885 |
| 814 | Ga0496102_0080266 | 3300048905 | Bacteria | 3005 |
| 815 | Ga0496102_0604560 | 3300048905 | Bacteria | 1019 |
| 816 | Ga0496102_0637694 | 3300048905 | Unclassified | 988 |
| 817 | Ga0496102_1150514 | 3300048905 | Bacteria | 695 |
| 818 | Ga0496103_0000571 | 3300048906 | Bacteria | 29249 |
| 819 | Ga0496103_0076208 | 3300048906 | Bacteria | 2104 |
| 820 | Ga0496103_0091807 | 3300048906 | Bacteria | 1916 |
| 821 | Ga0496103_0335983 | 3300048906 | Bacteria | 971 |
| 822 | Ga0496104_0018615 | 3300048907 | Bacteria | 6338 |
| 823 | Ga0496104_0084290 | 3300048907 | Bacteria | 3032 |
| 824 | Ga0496104_0358944 | 3300048907 | Bacteria | 1369 |
| 825 | Ga0496104_0459589 | 3300048907 | Bacteria | 1184 |
| 826 | Ga0496105_0177532 | 3300048908 | Unclassified | 1744 |
| 827 | Ga0496105_0348831 | 3300048908 | Bacteria | 1182 |
| 828 | Ga0496105_0376308 | 3300048908 | Unclassified | 1130 |
| 829 | Ga0496106_0005281 | 3300048909 | Bacteria | 9569 |
| 830 | Ga0496106_0053120 | 3300048909 | Bacteria | 3059 |
| 831 | Ga0496106_0350165 | 3300048909 | Bacteria | 1186 |
| 832 | Ga0496107_0001700 | 3300048910 | Bacteria | 13784 |
| 833 | Ga0496107_0014742 | 3300048910 | Bacteria | 5474 |
| 834 | Ga0496107_0019205 | 3300048910 | Bacteria | 4822 |
| 835 | Ga0496107_0021561 | 3300048910 | Bacteria | 4553 |
| 836 | Ga0496107_0059648 | 3300048910 | Bacteria | 2761 |
| 837 | Ga0496108_0006924 | 3300048911 | Bacteria | 9176 |
| 838 | Ga0496108_0035403 | 3300048911 | Bacteria | 4150 |
| 839 | Ga0496108_0058129 | 3300048911 | Bacteria | 3249 |
| 840 | Ga0496109_0000260 | 3300048912 | Bacteria | 50877 |
| 841 | Ga0496109_0030430 | 3300048912 | Bacteria | 4838 |
| 842 | Ga0496109_0050809 | 3300048912 | Bacteria | 3775 |
| 843 | Ga0496109_0121367 | 3300048912 | Bacteria | 2435 |
| 844 | Ga0496109_0683562 | 3300048912 | Bacteria | 963 |
| 845 | Ga0496109_1691428 | 3300048912 | Unclassified | 566 |
| 846 | Ga0496110_0004713 | 3300048913 | Bacteria | 10609 |
| 847 | Ga0496110_0024032 | 3300048913 | Bacteria | 5192 |
| 848 | Ga0496110_0030828 | 3300048913 | Bacteria | 4624 |
| 849 | Ga0496110_0155974 | 3300048913 | Bacteria | 2068 |
| 850 | Ga0496110_0159711 | 3300048913 | Bacteria | 2043 |
| 851 | Ga0496111_0155273 | 3300048914 | Bacteria | 1698 |
| 852 | Ga0496111_0179959 | 3300048914 | Bacteria | 1571 |
| 853 | Ga0496111_0217019 | 3300048914 | Bacteria | 1421 |
| 854 | Ga0496111_0793617 | 3300048914 | Bacteria | 685 |
| 855 | Ga0496112_0017732 | 3300048915 | Bacteria | 6700 |
| 856 | Ga0496112_0092965 | 3300048915 | Bacteria | 2986 |
| 857 | Ga0496112_0138679 | 3300048915 | Bacteria | 2402 |
| 858 | Ga0496112_0259171 | 3300048915 | Bacteria | 1688 |
| 859 | Ga0496113_0016864 | 3300048916 | Bacteria | 5055 |
| 860 | Ga0496113_0032045 | 3300048916 | Bacteria | 3818 |
| 861 | Ga0496113_0197993 | 3300048916 | Bacteria | 1596 |
| 862 | Ga0496114_0010719 | 3300048917 | Bacteria | 7295 |
| 863 | Ga0496114_0037495 | 3300048917 | Bacteria | 4009 |
| 864 | Ga0496114_0500815 | 3300048917 | Unclassified | 1074 |
| 865 | Ga0496114_1055880 | 3300048917 | Bacteria | 696 |
| 866 | Ga0496115_0001610 | 3300048918 | Bacteria | 16223 |
| 867 | Ga0496115_0059064 | 3300048918 | Bacteria | 3088 |
| 868 | Ga0496115_0073306 | 3300048918 | Bacteria | 2779 |
| 869 | Ga0496115_0115566 | 3300048918 | Bacteria | 2206 |
| 870 | Ga0496115_0170764 | 3300048918 | Bacteria | 1798 |
| 871 | Ga0496115_0503004 | 3300048918 | Bacteria | 973 |
| 872 | Ga0496125_0342940 | 3300048928 | Bacteria | 896 |
| 873 | Ga0496126_0445758 | 3300048929 | Bacteria | 1043 |
| 874 | Ga0501033_0122276 | 3300049570 | Bacteria | 1888 |
| 875 | Ga0501034_0537429 | 3300049571 | Bacteria | 1079 |
| 876 | Ga0501034_1181547 | 3300049571 | Bacteria | 644 |
| 877 | Ga0501036_0268183 | 3300049572 | Bacteria | 1430 |
| 878 | Ga0501036_0311355 | 3300049572 | Bacteria | 1316 |
| 879 | Ga0501047_0060498 | 3300049581 | Bacteria | 3655 |
| 880 | Ga0501047_0247735 | 3300049581 | Bacteria | 1631 |
| 881 | Ga0501070_0260191 | 3300049586 | Unclassified | 1418 |
| 882 | Ga0501073_0337743 | 3300049589 | Bacteria | 1040 |
| 883 | Ga0501077_0072649 | 3300049593 | Bacteria | 2180 |
| 884 | Ga0501081_0156281 | 3300049743 | Bacteria | 1641 |
| 885 | Ga0501083_0259950 | 3300049744 | Bacteria | 1130 |
| 886 | Ga0501083_0580090 | 3300049744 | Bacteria | 730 |
| 887 | Ga0501035_0100777 | 3300049822 | Bacteria | 2535 |
| 888 | Ga0501035_0211061 | 3300049822 | Bacteria | 1661 |
| 889 | Ga0501044_0051139 | 3300049823 | Bacteria | 4261 |
| 890 | Ga0501044_0710743 | 3300049823 | Unclassified | 890 |
| 891 | nmdc:mga04h51_251134_c1 | 3300050495 | Bacteria | 709 |
| 892 | nmdc:mga07m45_206480_c1 | 3300050496 | Bacteria | 1143 |
| 893 | nmdc:mga05p37_1109_c1 | 3300050507 | Bacteria | 30953 |
| 894 | nmdc:mga09592_14828_c1 | 3300050508 | Bacteria | 6362 |
| 895 | nmdc:mga0qj67_1459_c1 | 3300050509 | Bacteria | 16581 |
| 896 | nmdc:mga06r32_19751_c1 | 3300050510 | Bacteria | 6192 |
| 897 | nmdc:mga08y16_2292_c1 | 3300050511 | Bacteria | 19584 |
| 898 | nmdc:mga08y16_855_c1 | 3300050511 | Bacteria | 29241 |
| 899 | nmdc:mga08y16_8714_c1 | 3300050511 | Bacteria | 10636 |
| 900 | nmdc:mga0n895_1286_c1 | 3300050512 | Bacteria | 18558 |
| 901 | nmdc:mga0n895_219803_c1 | 3300050512 | Bacteria | 1929 |
| 902 | nmdc:mga0n895_2848_c1 | 3300050512 | Bacteria | 13703 |
| 903 | nmdc:mga0n895_77410_c1 | 3300050512 | Bacteria | 3309 |
| 904 | nmdc:mga0n895_948732_c1 | 3300050512 | Bacteria | 844 |
| 905 | nmdc:mga0rr50_181967_c1 | 3300050513 | Bacteria | 1719 |
| 906 | nmdc:mga0rr50_58601_c1 | 3300050513 | Bacteria | 2887 |
| 907 | nmdc:mga08x19_614070_c1 | 3300050514 | Bacteria | 771 |
| 908 | nmdc:mga08x19_98914_c1 | 3300050514 | Bacteria | 1933 |
| 909 | nmdc:mga0a205_160859_c1 | 3300050515 | Bacteria | 2142 |
| 910 | nmdc:mga0a205_485_c1 | 3300050515 | Bacteria | 16164 |
| 911 | nmdc:mga0a205_729_c1 | 3300050515 | Bacteria | 26502 |
| 912 | Ga0495601_0000005 | 3300053077 | Bacteria | 387079 |
| 913 | Ga0495601_0155041 | 3300053077 | Bacteria | 1495 |
| 914 | Ga0495612_0000001 | 3300053078 | Bacteria | 418244 |
| 915 | Ga0495612_0020051 | 3300053078 | Bacteria | 2678 |
| 916 | Ga0495612_0054505 | 3300053078 | Bacteria | 1647 |
| 917 | Ga0495595_0000166 | 3300053084 | Bacteria | 25987 |
| 918 | Ga0495595_0005913 | 3300053084 | Bacteria | 4960 |
| 919 | Ga0495619_0000007 | 3300053085 | Bacteria | 369936 |
| 920 | Ga0495619_0000646 | 3300053085 | Bacteria | 22914 |
| 921 | Ga0495619_0011191 | 3300053085 | Bacteria | 5642 |
| 922 | Ga0495619_0051569 | 3300053085 | Bacteria | 2719 |
| 923 | Ga0495619_0232748 | 3300053085 | Bacteria | 1276 |
| 924 | Ga0500593_014970 | 3300053117 | Bacteria | 3335 |
| 925 | Ga0500604_0064445 | 3300053151 | Unclassified | 1158 |
| 926 | Ga0466962_0065625 | 3300061719 | Bacteria | 1733 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0156281 | Ga0501081_0156281_14_448 | 141 |
| 2 | 3300046533 | Ga0495640_0019724 | Ga0495640_0019724_58_522 | 146 |
| 3 | 3300035112 | Ga0373932_0055942 | Ga0373932_0055942_16_471 | 147 |
| 4 | 3300006175 | Ga0070712_100874989 | Ga0070712_1008749891 | 151 |
| 5 | 3300005617 | Ga0068859_100116623 | Ga0068859_1001166232 | 154 |
| 6 | 3300006931 | Ga0097620_100116630 | Ga0097620_1001166303 | 154 |
| 7 | 3300025315 | Ga0207697_10120937 | Ga0207697_101209372 | 154 |
| 8 | 3300025931 | Ga0207644_11044831 | Ga0207644_110448311 | 154 |
| 9 | 3300026095 | Ga0207676_11168801 | Ga0207676_111688012 | 154 |
| 10 | 3300050496 | nmdc:mga07m45_206480_c1 | nmdc:mga07m45_206480_c1_649_1122 | 154 |
| 11 | 3300005549 | Ga0070704_100445285 | Ga0070704_1004452851 | 155 |
| 12 | 3300010375 | Ga0105239_10250014 | Ga0105239_102500143 | 155 |
| 13 | 3300026075 | Ga0207708_10112366 | Ga0207708_101123662 | 155 |
| 14 | 3300005458 | Ga0070681_10017105 | Ga0070681_100171054 | 157 |
| 15 | 3300005614 | Ga0068856_100133395 | Ga0068856_1001333953 | 157 |
| 16 | 3300005719 | Ga0068861_100403951 | Ga0068861_1004039512 | 157 |
| 17 | 3300006028 | Ga0070717_10459021 | Ga0070717_104590211 | 157 |
| 18 | 3300006163 | Ga0070715_10053220 | Ga0070715_100532201 | 157 |
| 19 | 3300006237 | Ga0097621_100398693 | Ga0097621_1003986932 | 157 |
| 20 | 3300006358 | Ga0068871_100325530 | Ga0068871_1003255302 | 157 |
| 21 | 3300017792 | Ga0163161_10179198 | Ga0163161_101791982 | 157 |
| 22 | 3300025900 | Ga0207710_10189427 | Ga0207710_101894272 | 157 |
| 23 | 3300025903 | Ga0207680_10198124 | Ga0207680_101981242 | 157 |
| 24 | 3300025914 | Ga0207671_10347437 | Ga0207671_103474372 | 157 |
| 25 | 3300025916 | Ga0207663_10087616 | Ga0207663_100876161 | 157 |
| 26 | 3300025919 | Ga0207657_10077962 | Ga0207657_100779623 | 157 |
| 27 | 3300025920 | Ga0207649_10068178 | Ga0207649_100681783 | 157 |
| 28 | 3300025921 | Ga0207652_10141361 | Ga0207652_101413613 | 157 |
| 29 | 3300025927 | Ga0207687_10808658 | Ga0207687_108086582 | 157 |
| 30 | 3300025931 | Ga0207644_10145342 | Ga0207644_101453422 | 157 |
| 31 | 3300025935 | Ga0207709_10260229 | Ga0207709_102602292 | 157 |
| 32 | 3300025937 | Ga0207669_10864494 | Ga0207669_108644941 | 157 |
| 33 | 3300025941 | Ga0207711_10043178 | Ga0207711_100431784 | 157 |
| 34 | 3300025949 | Ga0207667_10102130 | Ga0207667_101021302 | 157 |
| 35 | 3300025960 | Ga0207651_10128535 | Ga0207651_101285352 | 157 |
| 36 | 3300025986 | Ga0207658_10336844 | Ga0207658_103368442 | 157 |
| 37 | 3300026035 | Ga0207703_10216388 | Ga0207703_102163881 | 157 |
| 38 | 3300026041 | Ga0207639_11533059 | Ga0207639_115330591 | 157 |
| 39 | 3300026078 | Ga0207702_10733087 | Ga0207702_107330871 | 157 |
| 40 | 3300026121 | Ga0207683_10006533 | Ga0207683_100065334 | 157 |
| 41 | 3300028381 | Ga0268264_10584781 | Ga0268264_105847812 | 157 |
| 42 | 3300035089 | Ga0373944_0015604 | Ga0373944_0015604_1608_2093 | 157 |
| 43 | 3300044693 | Ga0466961_0211234 | Ga0466961_0211234_309_851 | 157 |
| 44 | 3300044694 | Ga0466963_0060629 | Ga0466963_0060629_544_1086 | 157 |
| 45 | 3300044719 | Ga0466971_0141098 | Ga0466971_0141098_196_741 | 157 |
| 46 | 3300044719 | Ga0466971_0257681 | Ga0466971_0257681_238_780 | 157 |
| 47 | 3300044842 | Ga0466957_0195517 | Ga0466957_0195517_248_790 | 157 |
| 48 | 3300045976 | Ga0466967_0344536 | Ga0466967_0344536_107_649 | 157 |
| 49 | 3300046476 | Ga0495662_0174406 | Ga0495662_0174406_15_500 | 157 |
| 50 | 3300048914 | Ga0496111_0217019 | Ga0496111_0217019_20_505 | 157 |
| 51 | 3300061719 | Ga0466962_0065625 | Ga0466962_0065625_384_926 | 157 |
| 52 | 3300005295 | Ga0065707_10145805 | Ga0065707_101458053 | 158 |
| 53 | 3300005434 | Ga0070709_10673828 | Ga0070709_106738281 | 158 |
| 54 | 3300005439 | Ga0070711_100410003 | Ga0070711_1004100032 | 158 |
| 55 | 3300006194 | Ga0075427_10000518 | Ga0075427_100005184 | 158 |
| 56 | 3300006852 | Ga0075433_10000023 | Ga0075433_1000002331 | 158 |
| 57 | 3300006852 | Ga0075433_10664047 | Ga0075433_106640471 | 158 |
| 58 | 3300006871 | Ga0075434_100236708 | Ga0075434_1002367083 | 158 |
| 59 | 3300006880 | Ga0075429_100000227 | Ga0075429_10000022711 | 158 |
| 60 | 3300006914 | Ga0075436_100707989 | Ga0075436_1007079891 | 158 |
| 61 | 3300007076 | Ga0075435_100088892 | Ga0075435_1000888924 | 158 |
| 62 | 3300025906 | Ga0207699_10568269 | Ga0207699_105682692 | 158 |
| 63 | 3300025916 | Ga0207663_10344888 | Ga0207663_103448882 | 158 |
| 64 | 3300035121 | Ga0373960_0122781 | Ga0373960_0122781_74_610 | 158 |
| 65 | 3300048904 | Ga0496101_0310723 | Ga0496101_0310723_589_1125 | 158 |
| 66 | 3300050512 | nmdc:mga0n895_219803_c1 | nmdc:mga0n895_219803_c1_1164_1700 | 158 |
| 67 | 3300050513 | nmdc:mga0rr50_58601_c1 | nmdc:mga0rr50_58601_c1_1634_2170 | 158 |
| 68 | 3300005543 | Ga0070672_100526003 | Ga0070672_1005260031 | 159 |
| 69 | 3300005718 | Ga0068866_10087986 | Ga0068866_100879862 | 159 |
| 70 | 3300005842 | Ga0068858_100105846 | Ga0068858_1001058462 | 159 |
| 71 | 3300006028 | Ga0070717_10003856 | Ga0070717_1000385614 | 159 |
| 72 | 3300006163 | Ga0070715_10001764 | Ga0070715_100017646 | 159 |
| 73 | 3300006173 | Ga0070716_100028646 | Ga0070716_1000286462 | 159 |
| 74 | 3300006237 | Ga0097621_100028001 | Ga0097621_1000280013 | 159 |
| 75 | 3300006358 | Ga0068871_100034565 | Ga0068871_1000345653 | 159 |
| 76 | 3300006881 | Ga0068865_100085676 | Ga0068865_1000856764 | 159 |
| 77 | 3300017792 | Ga0163161_10053704 | Ga0163161_100537042 | 159 |
| 78 | 3300025898 | Ga0207692_10043247 | Ga0207692_100432474 | 159 |
| 79 | 3300025899 | Ga0207642_10043867 | Ga0207642_100438672 | 159 |
| 80 | 3300025905 | Ga0207685_10004709 | Ga0207685_100047094 | 159 |
| 81 | 3300025907 | Ga0207645_10092845 | Ga0207645_100928452 | 159 |
| 82 | 3300025915 | Ga0207693_10014951 | Ga0207693_100149516 | 159 |
| 83 | 3300025916 | Ga0207663_10052024 | Ga0207663_100520243 | 159 |
| 84 | 3300025917 | Ga0207660_10339648 | Ga0207660_103396482 | 159 |
| 85 | 3300025918 | Ga0207662_10268179 | Ga0207662_102681791 | 159 |
| 86 | 3300025924 | Ga0207694_10399188 | Ga0207694_103991882 | 159 |
| 87 | 3300025927 | Ga0207687_10507615 | Ga0207687_105076152 | 159 |
| 88 | 3300025934 | Ga0207686_10083193 | Ga0207686_100831932 | 159 |
| 89 | 3300025935 | Ga0207709_10046256 | Ga0207709_100462564 | 159 |
| 90 | 3300025936 | Ga0207670_10038515 | Ga0207670_100385154 | 159 |
| 91 | 3300025938 | Ga0207704_10056891 | Ga0207704_100568912 | 159 |
| 92 | 3300025944 | Ga0207661_10532274 | Ga0207661_105322741 | 159 |
| 93 | 3300025945 | Ga0207679_10314830 | Ga0207679_103148301 | 159 |
| 94 | 3300025986 | Ga0207658_10084588 | Ga0207658_100845883 | 159 |
| 95 | 3300026067 | Ga0207678_10134606 | Ga0207678_101346062 | 159 |
| 96 | 3300026075 | Ga0207708_10191168 | Ga0207708_101911681 | 159 |
| 97 | 3300026088 | Ga0207641_10068229 | Ga0207641_100682292 | 159 |
| 98 | 3300026095 | Ga0207676_10004283 | Ga0207676_100042833 | 159 |
| 99 | 3300026121 | Ga0207683_10040380 | Ga0207683_100403802 | 159 |
| 100 | 3300028379 | Ga0268266_10014497 | Ga0268266_100144976 | 159 |
| 101 | 3300028381 | Ga0268264_10178192 | Ga0268264_101781922 | 159 |
| 102 | 3300047673 | Ga0495593_0005331 | Ga0495593_0005331_7078_7575 | 159 |
| 103 | 3300048905 | Ga0496102_0604560 | Ga0496102_0604560_35_532 | 159 |
| 104 | 3300048912 | Ga0496109_1691428 | Ga0496109_1691428_10_507 | 159 |
| 105 | 3300048914 | Ga0496111_0793617 | Ga0496111_0793617_156_653 | 159 |
| 106 | 3300013306 | Ga0163162_11975955 | Ga0163162_119759551 | 161 |
| 107 | 3300014968 | Ga0157379_11773273 | Ga0157379_117732731 | 162 |
| 108 | 3300005434 | Ga0070709_10272693 | Ga0070709_102726932 | 163 |
| 109 | 3300005435 | Ga0070714_100069959 | Ga0070714_1000699592 | 163 |
| 110 | 3300005439 | Ga0070711_100974294 | Ga0070711_1009742941 | 163 |
| 111 | 3300005614 | Ga0068856_100354397 | Ga0068856_1003543972 | 163 |
| 112 | 3300006175 | Ga0070712_100108179 | Ga0070712_1001081794 | 163 |
| 113 | 3300007265 | Ga0099794_10010739 | Ga0099794_100107392 | 163 |
| 114 | 3300010159 | Ga0099796_10104864 | Ga0099796_101048642 | 163 |
| 115 | 3300025906 | Ga0207699_10260099 | Ga0207699_102600992 | 163 |
| 116 | 3300025916 | Ga0207663_10118737 | Ga0207663_101187372 | 163 |
| 117 | 3300025929 | Ga0207664_10101878 | Ga0207664_101018782 | 163 |
| 118 | 3300027512 | Ga0209179_1003709 | Ga0209179_10037091 | 163 |
| 119 | 3300035085 | Ga0373929_0001110 | Ga0373929_0001110_18_509 | 163 |
| 120 | 3300035113 | Ga0373936_0012305 | Ga0373936_0012305_1892_2410 | 163 |
| 121 | 3300035242 | Ga0373962_0006516 | Ga0373962_0006516_2314_2814 | 163 |
| 122 | 3300035695 | Ga0373927_0073665 | Ga0373927_0073665_710_1228 | 163 |
| 123 | 3300035695 | Ga0373927_0086810 | Ga0373927_0086810_1111_1629 | 163 |
| 124 | 3300037068 | Ga0373925_0758266 | Ga0373925_0758266_89_607 | 163 |
| 125 | 3300046690 | Ga0495624_0437415 | Ga0495624_0437415_29_547 | 163 |
| 126 | 3300048912 | Ga0496109_0121367 | Ga0496109_0121367_26_517 | 163 |
| 127 | 3300005981 | Ga0081538_10072545 | Ga0081538_100725454 | 164 |
| 128 | 3300005290 | Ga0065712_10073252 | Ga0065712_100732523 | 165 |
| 129 | 3300005331 | Ga0070670_100770912 | Ga0070670_1007709122 | 165 |
| 130 | 3300005340 | Ga0070689_100710855 | Ga0070689_1007108552 | 165 |
| 131 | 3300005355 | Ga0070671_101136440 | Ga0070671_1011364401 | 165 |
| 132 | 3300005365 | Ga0070688_100205517 | Ga0070688_1002055172 | 165 |
| 133 | 3300005367 | Ga0070667_100071592 | Ga0070667_1000715923 | 165 |
| 134 | 3300005440 | Ga0070705_100173743 | Ga0070705_1001737432 | 165 |
| 135 | 3300005445 | Ga0070708_101114220 | Ga0070708_1011142201 | 165 |
| 136 | 3300005544 | Ga0070686_100034442 | Ga0070686_1000344422 | 165 |
| 137 | 3300005564 | Ga0070664_100136293 | Ga0070664_1001362931 | 165 |
| 138 | 3300005841 | Ga0068863_100199343 | Ga0068863_1001993433 | 165 |
| 139 | 3300005842 | Ga0068858_100117158 | Ga0068858_1001171581 | 165 |
| 140 | 3300006871 | Ga0075434_100585618 | Ga0075434_1005856182 | 165 |
| 141 | 3300009101 | Ga0105247_10032411 | Ga0105247_100324114 | 165 |
| 142 | 3300009177 | Ga0105248_10093214 | Ga0105248_100932144 | 165 |
| 143 | 3300014968 | Ga0157379_10094357 | Ga0157379_100943574 | 165 |
| 144 | 3300025941 | Ga0207711_10098096 | Ga0207711_100980961 | 165 |
| 145 | 3300025986 | Ga0207658_10377723 | Ga0207658_103777232 | 165 |
| 146 | 3300026035 | Ga0207703_10091455 | Ga0207703_100914551 | 165 |
| 147 | 3300026078 | Ga0207702_10576329 | Ga0207702_105763291 | 165 |
| 148 | 3300026088 | Ga0207641_10264500 | Ga0207641_102645002 | 165 |
| 149 | 3300048910 | Ga0496107_0014742 | Ga0496107_0014742_3099_3605 | 165 |
| 150 | 3300048911 | Ga0496108_0035403 | Ga0496108_0035403_1073_1579 | 165 |
| 151 | 3300048912 | Ga0496109_0030430 | Ga0496109_0030430_1475_1981 | 165 |
| 152 | 3300048913 | Ga0496110_0159711 | Ga0496110_0159711_589_1095 | 165 |
| 153 | 3300048914 | Ga0496111_0155273 | Ga0496111_0155273_151_657 | 165 |
| 154 | 3300048915 | Ga0496112_0259171 | Ga0496112_0259171_596_1102 | 165 |
| 155 | 3300048916 | Ga0496113_0016864 | Ga0496113_0016864_2734_3240 | 165 |
| 156 | 3300049586 | Ga0501070_0260191 | Ga0501070_0260191_49_603 | 165 |
| 157 | 3300007788 | Ga0099795_10004198 | Ga0099795_100041983 | 166 |
| 158 | 3300010159 | Ga0099796_10000963 | Ga0099796_100009632 | 166 |
| 159 | 3300027512 | Ga0209179_1001119 | Ga0209179_10011194 | 166 |
| 160 | 3300035111 | Ga0373923_0052556 | Ga0373923_0052556_912_1436 | 166 |
| 161 | 3300035111 | Ga0373923_0101479 | Ga0373923_0101479_160_729 | 166 |
| 162 | 3300035113 | Ga0373936_0000230 | Ga0373936_0000230_6038_6607 | 166 |
| 163 | 3300035116 | Ga0373945_0001082 | Ga0373945_0001082_7568_8137 | 166 |
| 164 | 3300035116 | Ga0373945_0296320 | Ga0373945_0296320_27_551 | 166 |
| 165 | 3300035117 | Ga0373953_0000282 | Ga0373953_0000282_13092_13661 | 166 |
| 166 | 3300035118 | Ga0373954_0000163 | Ga0373954_0000163_8979_9548 | 166 |
| 167 | 3300035170 | Ga0373943_0060003 | Ga0373943_0060003_298_867 | 166 |
| 168 | 3300035171 | Ga0373946_0000412 | Ga0373946_0000412_4192_4761 | 166 |
| 169 | 3300035172 | Ga0373955_0000071 | Ga0373955_0000071_28602_29171 | 166 |
| 170 | 3300035410 | Ga0373924_0002670 | Ga0373924_0002670_1592_2161 | 166 |
| 171 | 3300035692 | Ga0373935_0001582 | Ga0373935_0001582_2272_2841 | 166 |
| 172 | 3300035695 | Ga0373927_0001396 | Ga0373927_0001396_17287_17856 | 166 |
| 173 | 3300035724 | Ga0373933_0002030 | Ga0373933_0002030_3717_4286 | 166 |
| 174 | 3300035725 | Ga0373947_0001895 | Ga0373947_0001895_11209_11778 | 166 |
| 175 | 3300036401 | Ga0373937_0000162 | Ga0373937_0000162_12986_13555 | 166 |
| 176 | 3300037068 | Ga0373925_0000025 | Ga0373925_0000025_103181_103750 | 166 |
| 177 | 3300037068 | Ga0373925_0104374 | Ga0373925_0104374_1133_1657 | 166 |
| 178 | 3300046454 | Ga0495592_0000132 | Ga0495592_0000132_27306_27875 | 166 |
| 179 | 3300046459 | Ga0495629_0013677 | Ga0495629_0013677_3239_3808 | 166 |
| 180 | 3300046462 | Ga0495651_0000308 | Ga0495651_0000308_11322_11891 | 166 |
| 181 | 3300046463 | Ga0495653_0000041 | Ga0495653_0000041_86060_86629 | 166 |
| 182 | 3300046476 | Ga0495662_0003042 | Ga0495662_0003042_5445_6014 | 166 |
| 183 | 3300046477 | Ga0495664_0000005 | Ga0495664_0000005_120930_121499 | 166 |
| 184 | 3300046477 | Ga0495664_0065566 | Ga0495664_0065566_750_1274 | 166 |
| 185 | 3300046511 | Ga0495608_0000003 | Ga0495608_0000003_318079_318648 | 166 |
| 186 | 3300046514 | Ga0495618_0000010 | Ga0495618_0000010_96233_96802 | 166 |
| 187 | 3300046516 | Ga0495628_0000019 | Ga0495628_0000019_51188_51757 | 166 |
| 188 | 3300046529 | Ga0495652_0000028 | Ga0495652_0000028_51188_51757 | 166 |
| 189 | 3300046531 | Ga0495665_0029847 | Ga0495665_0029847_21_590 | 166 |
| 190 | 3300046533 | Ga0495640_0000014 | Ga0495640_0000014_109985_110554 | 166 |
| 191 | 3300046536 | Ga0495587_0000026 | Ga0495587_0000026_96063_96632 | 166 |
| 192 | 3300046543 | Ga0495645_0000005 | Ga0495645_0000005_120901_121470 | 166 |
| 193 | 3300046559 | Ga0495667_0000003 | Ga0495667_0000003_243163_243732 | 166 |
| 194 | 3300046642 | Ga0495634_0000017 | Ga0495634_0000017_72775_73344 | 166 |
| 195 | 3300046663 | Ga0495635_0000024 | Ga0495635_0000024_96457_97026 | 166 |
| 196 | 3300046675 | Ga0495657_0000034 | Ga0495657_0000034_31942_32511 | 166 |
| 197 | 3300046678 | Ga0495599_0000017 | Ga0495599_0000017_51507_52076 | 166 |
| 198 | 3300046679 | Ga0495623_0000028 | Ga0495623_0000028_21876_22445 | 166 |
| 199 | 3300046680 | Ga0495646_0000015 | Ga0495646_0000015_89964_90533 | 166 |
| 200 | 3300046689 | Ga0495613_0015645 | Ga0495613_0015645_3877_4446 | 166 |
| 201 | 3300046809 | Ga0495600_0000058 | Ga0495600_0000058_3562_4131 | 166 |
| 202 | 3300047315 | Ga0495581_0001732 | Ga0495581_0001732_4120_4689 | 166 |
| 203 | 3300047317 | Ga0495604_0000021 | Ga0495604_0000021_51185_51754 | 166 |
| 204 | 3300047319 | Ga0495674_0000005 | Ga0495674_0000005_323373_323942 | 166 |
| 205 | 3300047322 | Ga0495680_0000503 | Ga0495680_0000503_27351_27920 | 166 |
| 206 | 3300047444 | Ga0495675_0000085 | Ga0495675_0000085_28613_29182 | 166 |
| 207 | 3300047471 | Ga0495684_0000001 | Ga0495684_0000001_51164_51733 | 166 |
| 208 | 3300047673 | Ga0495593_0001873 | Ga0495593_0001873_7510_8079 | 166 |
| 209 | 3300048088 | Ga0495602_0000003 | Ga0495602_0000003_305484_306053 | 166 |
| 210 | 3300048917 | Ga0496114_1055880 | Ga0496114_1055880_153_677 | 166 |
| 211 | 3300049570 | Ga0501033_0122276 | Ga0501033_0122276_1228_1791 | 166 |
| 212 | 3300049581 | Ga0501047_0060498 | Ga0501047_0060498_2629_3192 | 166 |
| 213 | 3300049822 | Ga0501035_0100777 | Ga0501035_0100777_592_1155 | 166 |
| 214 | 3300049823 | Ga0501044_0051139 | Ga0501044_0051139_1963_2526 | 166 |
| 215 | 3300050495 | nmdc:mga04h51_251134_c1 | nmdc:mga04h51_251134_c1_55_564 | 166 |
| 216 | 3300053077 | Ga0495601_0000005 | Ga0495601_0000005_49068_49637 | 166 |
| 217 | 3300053078 | Ga0495612_0000001 | Ga0495612_0000001_366488_367057 | 166 |
| 218 | 3300053084 | Ga0495595_0000166 | Ga0495595_0000166_16569_17138 | 166 |
| 219 | 3300053085 | Ga0495619_0000007 | Ga0495619_0000007_51188_51757 | 166 |
| 220 | 3300005434 | Ga0070709_10076401 | Ga0070709_100764012 | 167 |
| 221 | 3300005436 | Ga0070713_100416733 | Ga0070713_1004167332 | 167 |
| 222 | 3300005439 | Ga0070711_100054515 | Ga0070711_1000545154 | 167 |
| 223 | 3300035171 | Ga0373946_0053791 | Ga0373946_0053791_1098_1628 | 167 |
| 224 | 3300035172 | Ga0373955_0035556 | Ga0373955_0035556_1530_2045 | 167 |
| 225 | 3300035725 | Ga0373947_0156883 | Ga0373947_0156883_32_562 | 167 |
| 226 | 3300046459 | Ga0495629_0303900 | Ga0495629_0303900_14_592 | 167 |
| 227 | 3300046681 | Ga0495647_0234204 | Ga0495647_0234204_252_782 | 167 |
| 228 | 3300046683 | Ga0495658_0542207 | Ga0495658_0542207_168_698 | 167 |
| 229 | 3300053117 | Ga0500593_014970 | Ga0500593_014970_1129_1674 | 167 |
| 230 | 3300005328 | Ga0070676_10566619 | Ga0070676_105666192 | 168 |
| 231 | 3300005337 | Ga0070682_100074907 | Ga0070682_1000749073 | 168 |
| 232 | 3300005341 | Ga0070691_10049975 | Ga0070691_100499752 | 168 |
| 233 | 3300005343 | Ga0070687_100198356 | Ga0070687_1001983562 | 168 |
| 234 | 3300005344 | Ga0070661_100063143 | Ga0070661_1000631432 | 168 |
| 235 | 3300005354 | Ga0070675_100459874 | Ga0070675_1004598741 | 168 |
| 236 | 3300005355 | Ga0070671_100207883 | Ga0070671_1002078832 | 168 |
| 237 | 3300005367 | Ga0070667_100448698 | Ga0070667_1004486981 | 168 |
| 238 | 3300005434 | Ga0070709_10212169 | Ga0070709_102121692 | 168 |
| 239 | 3300005435 | Ga0070714_101010215 | Ga0070714_1010102151 | 168 |
| 240 | 3300005436 | Ga0070713_100203833 | Ga0070713_1002038331 | 168 |
| 241 | 3300005439 | Ga0070711_100376657 | Ga0070711_1003766571 | 168 |
| 242 | 3300005444 | Ga0070694_100308992 | Ga0070694_1003089922 | 168 |
| 243 | 3300005456 | Ga0070678_100172611 | Ga0070678_1001726112 | 168 |
| 244 | 3300005459 | Ga0068867_100112213 | Ga0068867_1001122133 | 168 |
| 245 | 3300005539 | Ga0068853_100916697 | Ga0068853_1009166971 | 168 |
| 246 | 3300005545 | Ga0070695_100269106 | Ga0070695_1002691062 | 168 |
| 247 | 3300005546 | Ga0070696_100476917 | Ga0070696_1004769172 | 168 |
| 248 | 3300005547 | Ga0070693_100047004 | Ga0070693_1000470044 | 168 |
| 249 | 3300005842 | Ga0068858_100169299 | Ga0068858_1001692991 | 168 |
| 250 | 3300006237 | Ga0097621_100039378 | Ga0097621_1000393784 | 168 |
| 251 | 3300009098 | Ga0105245_10306616 | Ga0105245_103066161 | 168 |
| 252 | 3300009098 | Ga0105245_10383915 | Ga0105245_103839151 | 168 |
| 253 | 3300009101 | Ga0105247_10057226 | Ga0105247_100572263 | 168 |
| 254 | 3300009174 | Ga0105241_10106665 | Ga0105241_101066652 | 168 |
| 255 | 3300009176 | Ga0105242_10052059 | Ga0105242_100520592 | 168 |
| 256 | 3300009545 | Ga0105237_10179751 | Ga0105237_101797512 | 168 |
| 257 | 3300009553 | Ga0105249_10274607 | Ga0105249_102746071 | 168 |
| 258 | 3300010375 | Ga0105239_10087245 | Ga0105239_100872452 | 168 |
| 259 | 3300011119 | Ga0105246_10047304 | Ga0105246_100473042 | 168 |
| 260 | 3300013100 | Ga0157373_10589986 | Ga0157373_105899862 | 168 |
| 261 | 3300013296 | Ga0157374_10067682 | Ga0157374_100676823 | 168 |
| 262 | 3300013297 | Ga0157378_10352312 | Ga0157378_103523122 | 168 |
| 263 | 3300013297 | Ga0157378_11379373 | Ga0157378_113793731 | 168 |
| 264 | 3300013306 | Ga0163162_11251370 | Ga0163162_112513701 | 168 |
| 265 | 3300013308 | Ga0157375_10070657 | Ga0157375_100706571 | 168 |
| 266 | 3300014968 | Ga0157379_10048436 | Ga0157379_100484363 | 168 |
| 267 | 3300014969 | Ga0157376_10031773 | Ga0157376_100317735 | 168 |
| 268 | 3300014969 | Ga0157376_10185265 | Ga0157376_101852652 | 168 |
| 269 | 3300025906 | Ga0207699_10031208 | Ga0207699_100312081 | 168 |
| 270 | 3300025912 | Ga0207707_10036744 | Ga0207707_100367443 | 168 |
| 271 | 3300025927 | Ga0207687_10498333 | Ga0207687_104983331 | 168 |
| 272 | 3300025928 | Ga0207700_10043361 | Ga0207700_100433614 | 168 |
| 273 | 3300025933 | Ga0207706_10025926 | Ga0207706_100259263 | 168 |
| 274 | 3300025934 | Ga0207686_10016499 | Ga0207686_100164992 | 168 |
| 275 | 3300026067 | Ga0207678_10034395 | Ga0207678_100343954 | 168 |
| 276 | 3300034820 | Ga0373959_0159401 | Ga0373959_0159401_40_558 | 168 |
| 277 | 3300035111 | Ga0373923_0363874 | Ga0373923_0363874_20_538 | 168 |
| 278 | 3300035113 | Ga0373936_0148056 | Ga0373936_0148056_158_676 | 168 |
| 279 | 3300035116 | Ga0373945_0045730 | Ga0373945_0045730_153_671 | 168 |
| 280 | 3300035117 | Ga0373953_0005616 | Ga0373953_0005616_3520_4038 | 168 |
| 281 | 3300035118 | Ga0373954_0204860 | Ga0373954_0204860_396_914 | 168 |
| 282 | 3300035119 | Ga0373956_0033016 | Ga0373956_0033016_156_674 | 168 |
| 283 | 3300035120 | Ga0373957_0011256 | Ga0373957_0011256_179_697 | 168 |
| 284 | 3300035170 | Ga0373943_0432782 | Ga0373943_0432782_158_676 | 168 |
| 285 | 3300035171 | Ga0373946_0118446 | Ga0373946_0118446_78_596 | 168 |
| 286 | 3300035171 | Ga0373946_0243360 | Ga0373946_0243360_160_678 | 168 |
| 287 | 3300035172 | Ga0373955_0015938 | Ga0373955_0015938_588_1106 | 168 |
| 288 | 3300035241 | Ga0373961_0099912 | Ga0373961_0099912_67_585 | 168 |
| 289 | 3300035410 | Ga0373924_0054259 | Ga0373924_0054259_457_975 | 168 |
| 290 | 3300035692 | Ga0373935_0068391 | Ga0373935_0068391_1707_2225 | 168 |
| 291 | 3300035695 | Ga0373927_0098638 | Ga0373927_0098638_514_1032 | 168 |
| 292 | 3300035724 | Ga0373933_0109401 | Ga0373933_0109401_207_725 | 168 |
| 293 | 3300036401 | Ga0373937_0001510 | Ga0373937_0001510_12680_13198 | 168 |
| 294 | 3300046454 | Ga0495592_0132810 | Ga0495592_0132810_602_1120 | 168 |
| 295 | 3300046455 | Ga0495603_0096874 | Ga0495603_0096874_407_925 | 168 |
| 296 | 3300046459 | Ga0495629_0032442 | Ga0495629_0032442_92_610 | 168 |
| 297 | 3300046459 | Ga0495629_0181311 | Ga0495629_0181311_483_1001 | 168 |
| 298 | 3300046462 | Ga0495651_0012100 | Ga0495651_0012100_4265_4783 | 168 |
| 299 | 3300046463 | Ga0495653_0000944 | Ga0495653_0000944_20940_21458 | 168 |
| 300 | 3300046475 | Ga0495639_0068574 | Ga0495639_0068574_23_541 | 168 |
| 301 | 3300046499 | Ga0495594_0045285 | Ga0495594_0045285_16_534 | 168 |
| 302 | 3300046511 | Ga0495608_0003838 | Ga0495608_0003838_9665_10183 | 168 |
| 303 | 3300046514 | Ga0495618_0012117 | Ga0495618_0012117_2079_2597 | 168 |
| 304 | 3300046514 | Ga0495618_0493112 | Ga0495618_0493112_204_722 | 168 |
| 305 | 3300046517 | Ga0495630_0034834 | Ga0495630_0034834_133_651 | 168 |
| 306 | 3300046526 | Ga0495666_0023090 | Ga0495666_0023090_2149_2667 | 168 |
| 307 | 3300046533 | Ga0495640_0029249 | Ga0495640_0029249_2362_2880 | 168 |
| 308 | 3300046533 | Ga0495640_0059050 | Ga0495640_0059050_390_908 | 168 |
| 309 | 3300046535 | Ga0495586_0006928 | Ga0495586_0006928_4216_4734 | 168 |
| 310 | 3300046536 | Ga0495587_0000520 | Ga0495587_0000520_26247_26765 | 168 |
| 311 | 3300046543 | Ga0495645_0068462 | Ga0495645_0068462_1146_1664 | 168 |
| 312 | 3300046543 | Ga0495645_0335078 | Ga0495645_0335078_350_868 | 168 |
| 313 | 3300046557 | Ga0495622_0049938 | Ga0495622_0049938_1390_1908 | 168 |
| 314 | 3300046559 | Ga0495667_0013996 | Ga0495667_0013996_920_1438 | 168 |
| 315 | 3300046642 | Ga0495634_0109273 | Ga0495634_0109273_103_621 | 168 |
| 316 | 3300046642 | Ga0495634_0445112 | Ga0495634_0445112_20_538 | 168 |
| 317 | 3300046663 | Ga0495635_0086535 | Ga0495635_0086535_1133_1651 | 168 |
| 318 | 3300046663 | Ga0495635_0789762 | Ga0495635_0789762_51_569 | 168 |
| 319 | 3300046679 | Ga0495623_0085678 | Ga0495623_0085678_536_1054 | 168 |
| 320 | 3300046680 | Ga0495646_0013001 | Ga0495646_0013001_703_1221 | 168 |
| 321 | 3300046681 | Ga0495647_0241297 | Ga0495647_0241297_253_771 | 168 |
| 322 | 3300046681 | Ga0495647_0245496 | Ga0495647_0245496_118_636 | 168 |
| 323 | 3300046689 | Ga0495613_0300051 | Ga0495613_0300051_522_1040 | 168 |
| 324 | 3300046689 | Ga0495613_0325835 | Ga0495613_0325835_359_877 | 168 |
| 325 | 3300046690 | Ga0495624_0077820 | Ga0495624_0077820_616_1134 | 168 |
| 326 | 3300046690 | Ga0495624_0640513 | Ga0495624_0640513_25_543 | 168 |
| 327 | 3300046809 | Ga0495600_0314619 | Ga0495600_0314619_163_681 | 168 |
| 328 | 3300047315 | Ga0495581_0536787 | Ga0495581_0536787_81_599 | 168 |
| 329 | 3300047317 | Ga0495604_0407399 | Ga0495604_0407399_20_538 | 168 |
| 330 | 3300047319 | Ga0495674_0005073 | Ga0495674_0005073_867_1385 | 168 |
| 331 | 3300047319 | Ga0495674_0015663 | Ga0495674_0015663_4905_5423 | 168 |
| 332 | 3300047322 | Ga0495680_0078375 | Ga0495680_0078375_620_1138 | 168 |
| 333 | 3300047444 | Ga0495675_0000462 | Ga0495675_0000462_157_675 | 168 |
| 334 | 3300047471 | Ga0495684_0069856 | Ga0495684_0069856_1640_2158 | 168 |
| 335 | 3300047673 | Ga0495593_0013840 | Ga0495593_0013840_116_634 | 168 |
| 336 | 3300048088 | Ga0495602_0190424 | Ga0495602_0190424_175_693 | 168 |
| 337 | 3300048089 | Ga0495614_0244385 | Ga0495614_0244385_110_628 | 168 |
| 338 | 3300048903 | Ga0496100_0490715 | Ga0496100_0490715_82_600 | 168 |
| 339 | 3300048904 | Ga0496101_0146317 | Ga0496101_0146317_831_1349 | 168 |
| 340 | 3300048905 | Ga0496102_0029775 | Ga0496102_0029775_816_1334 | 168 |
| 341 | 3300048906 | Ga0496103_0091807 | Ga0496103_0091807_157_675 | 168 |
| 342 | 3300048907 | Ga0496104_0084290 | Ga0496104_0084290_1938_2456 | 168 |
| 343 | 3300048908 | Ga0496105_0177532 | Ga0496105_0177532_844_1362 | 168 |
| 344 | 3300048909 | Ga0496106_0053120 | Ga0496106_0053120_899_1417 | 168 |
| 345 | 3300048909 | Ga0496106_0350165 | Ga0496106_0350165_384_902 | 168 |
| 346 | 3300048910 | Ga0496107_0021561 | Ga0496107_0021561_3168_3686 | 168 |
| 347 | 3300048912 | Ga0496109_0050809 | Ga0496109_0050809_2375_2893 | 168 |
| 348 | 3300048913 | Ga0496110_0155974 | Ga0496110_0155974_525_1043 | 168 |
| 349 | 3300048915 | Ga0496112_0138679 | Ga0496112_0138679_769_1287 | 168 |
| 350 | 3300048917 | Ga0496114_0037495 | Ga0496114_0037495_516_1034 | 168 |
| 351 | 3300048918 | Ga0496115_0059064 | Ga0496115_0059064_566_1084 | 168 |
| 352 | 3300048918 | Ga0496115_0115566 | Ga0496115_0115566_816_1334 | 168 |
| 353 | 3300048918 | Ga0496115_0170764 | Ga0496115_0170764_631_1149 | 168 |
| 354 | 3300049571 | Ga0501034_1181547 | Ga0501034_1181547_39_572 | 168 |
| 355 | 3300049572 | Ga0501036_0268183 | Ga0501036_0268183_59_601 | 168 |
| 356 | 3300049822 | Ga0501035_0211061 | Ga0501035_0211061_902_1444 | 168 |
| 357 | 3300049823 | Ga0501044_0710743 | Ga0501044_0710743_306_848 | 168 |
| 358 | 3300053077 | Ga0495601_0155041 | Ga0495601_0155041_358_876 | 168 |
| 359 | 3300053078 | Ga0495612_0020051 | Ga0495612_0020051_868_1386 | 168 |
| 360 | 3300053078 | Ga0495612_0054505 | Ga0495612_0054505_868_1386 | 168 |
| 361 | 3300053084 | Ga0495595_0005913 | Ga0495595_0005913_602_1120 | 168 |
| 362 | 3300053085 | Ga0495619_0011191 | Ga0495619_0011191_2790_3308 | 168 |
| 363 | 3300053085 | Ga0495619_0232748 | Ga0495619_0232748_157_675 | 168 |
| 364 | 3300006058 | Ga0075432_10002763 | Ga0075432_100027634 | 169 |
| 365 | 3300006844 | Ga0075428_100028729 | Ga0075428_1000287295 | 169 |
| 366 | 3300006846 | Ga0075430_100000571 | Ga0075430_10000057129 | 169 |
| 367 | 3300006847 | Ga0075431_100000808 | Ga0075431_10000080828 | 169 |
| 368 | 3300006871 | Ga0075434_100003484 | Ga0075434_1000034842 | 169 |
| 369 | 3300009094 | Ga0111539_10000561 | Ga0111539_1000056128 | 169 |
| 370 | 3300009147 | Ga0114129_10042755 | Ga0114129_100427552 | 169 |
| 371 | 3300026089 | Ga0207648_10551078 | Ga0207648_105510782 | 169 |
| 372 | 3300027907 | Ga0207428_10000292 | Ga0207428_1000029214 | 169 |
| 373 | 3300031241 | Ga0265325_10015804 | Ga0265325_100158042 | 169 |
| 374 | 3300031249 | Ga0265339_10008278 | Ga0265339_100082787 | 169 |
| 375 | 3300031344 | Ga0265316_10481371 | Ga0265316_104813712 | 169 |
| 376 | 3300031595 | Ga0265313_10002244 | Ga0265313_1000224412 | 169 |
| 377 | 3300049744 | Ga0501083_0580090 | Ga0501083_0580090_122_658 | 169 |
| 378 | 3300050507 | nmdc:mga05p37_1109_c1 | nmdc:mga05p37_1109_c1_26295_26819 | 169 |
| 379 | 3300050508 | nmdc:mga09592_14828_c1 | nmdc:mga09592_14828_c1_437_961 | 169 |
| 380 | 3300050509 | nmdc:mga0qj67_1459_c1 | nmdc:mga0qj67_1459_c1_8426_8950 | 169 |
| 381 | 3300050510 | nmdc:mga06r32_19751_c1 | nmdc:mga06r32_19751_c1_4263_4787 | 169 |
| 382 | 3300050511 | nmdc:mga08y16_855_c1 | nmdc:mga08y16_855_c1_4390_4914 | 169 |
| 383 | 3300050512 | nmdc:mga0n895_2848_c1 | nmdc:mga0n895_2848_c1_12378_12902 | 169 |
| 384 | 3300050514 | nmdc:mga08x19_614070_c1 | nmdc:mga08x19_614070_c1_95_619 | 169 |
| 385 | 3300050515 | nmdc:mga0a205_729_c1 | nmdc:mga0a205_729_c1_457_981 | 169 |
| 386 | 3300005330 | Ga0070690_100552976 | Ga0070690_1005529762 | 170 |
| 387 | 3300005347 | Ga0070668_100883041 | Ga0070668_1008830412 | 170 |
| 388 | 3300005356 | Ga0070674_100027684 | Ga0070674_1000276843 | 170 |
| 389 | 3300005456 | Ga0070678_100029338 | Ga0070678_1000293384 | 170 |
| 390 | 3300005458 | Ga0070681_10321151 | Ga0070681_103211512 | 170 |
| 391 | 3300005544 | Ga0070686_100829771 | Ga0070686_1008297711 | 170 |
| 392 | 3300005937 | Ga0081455_10001802 | Ga0081455_1000180241 | 170 |
| 393 | 3300006237 | Ga0097621_100638827 | Ga0097621_1006388271 | 170 |
| 394 | 3300006358 | Ga0068871_101108004 | Ga0068871_1011080041 | 170 |
| 395 | 3300006881 | Ga0068865_100167775 | Ga0068865_1001677752 | 170 |
| 396 | 3300009098 | Ga0105245_11135927 | Ga0105245_111359271 | 170 |
| 397 | 3300009147 | Ga0114129_10570794 | Ga0114129_105707942 | 170 |
| 398 | 3300009148 | Ga0105243_10470894 | Ga0105243_104708941 | 170 |
| 399 | 3300014326 | Ga0157380_10053723 | Ga0157380_100537235 | 170 |
| 400 | 3300025912 | Ga0207707_10102568 | Ga0207707_101025683 | 170 |
| 401 | 3300025916 | Ga0207663_10060610 | Ga0207663_100606103 | 170 |
| 402 | 3300025933 | Ga0207706_10378065 | Ga0207706_103780652 | 170 |
| 403 | 3300025937 | Ga0207669_10152204 | Ga0207669_101522042 | 170 |
| 404 | 3300025938 | Ga0207704_10073584 | Ga0207704_100735842 | 170 |
| 405 | 3300026075 | Ga0207708_10095298 | Ga0207708_100952982 | 170 |
| 406 | 3300026118 | Ga0207675_101622671 | Ga0207675_1016226711 | 170 |
| 407 | 3300026121 | Ga0207683_10011735 | Ga0207683_100117355 | 170 |
| 408 | 3300031241 | Ga0265325_10121690 | Ga0265325_101216902 | 170 |
| 409 | 3300031247 | Ga0265340_10085097 | Ga0265340_100850972 | 170 |
| 410 | 3300031903 | Ga0307407_11075739 | Ga0307407_110757391 | 170 |
| 411 | 3300035116 | Ga0373945_0060465 | Ga0373945_0060465_116_661 | 170 |
| 412 | 3300036401 | Ga0373937_0284846 | Ga0373937_0284846_443_1021 | 170 |
| 413 | 3300049571 | Ga0501034_0537429 | Ga0501034_0537429_249_803 | 170 |
| 414 | 3300049572 | Ga0501036_0311355 | Ga0501036_0311355_82_636 | 170 |
| 415 | 3300049744 | Ga0501083_0259950 | Ga0501083_0259950_55_606 | 170 |
| 416 | 3300053085 | Ga0495619_0051569 | Ga0495619_0051569_596_1138 | 170 |
| 417 | 3300005327 | Ga0070658_10317426 | Ga0070658_103174262 | 171 |
| 418 | 3300005336 | Ga0070680_100039387 | Ga0070680_1000393872 | 171 |
| 419 | 3300005339 | Ga0070660_100028614 | Ga0070660_1000286143 | 171 |
| 420 | 3300005366 | Ga0070659_100664178 | Ga0070659_1006641781 | 171 |
| 421 | 3300005458 | Ga0070681_10006902 | Ga0070681_1000690210 | 171 |
| 422 | 3300005530 | Ga0070679_100537601 | Ga0070679_1005376011 | 171 |
| 423 | 3300009147 | Ga0114129_10039587 | Ga0114129_100395874 | 171 |
| 424 | 3300025917 | Ga0207660_10018103 | Ga0207660_100181035 | 171 |
| 425 | 3300053151 | Ga0500604_0064445 | Ga0500604_0064445_131_691 | 171 |
| 426 | 2209111006 | 2214772991 | 2213793003 | 172 |
| 427 | 3300000041 | ARcpr5oldR_c000005 | ARcpr5oldR_00000513 | 172 |
| 428 | 3300000042 | ARSoilYngRDRAFT_c00062 | ARSoilYngRDRAFT_0006212 | 172 |
| 429 | 3300000043 | ARcpr5yngRDRAFT_c000168 | ARcpr5yngRDRAFT_00016811 | 172 |
| 430 | 3300000044 | ARSoilOldRDRAFT_c000012 | ARSoilOldRDRAFT_00001214 | 172 |
| 431 | 3300000652 | ARCol0yngRDRAFT_1001158 | ARCol0yngRDRAFT_10011584 | 172 |
| 432 | 3300001430 | JGI24032J14994_100787 | JGI24032J14994_1007873 | 172 |
| 433 | 3300001976 | JGI24752J21851_1009462 | JGI24752J21851_10094622 | 172 |
| 434 | 3300001978 | JGI24747J21853_1001463 | JGI24747J21853_10014632 | 172 |
| 435 | 3300001989 | JGI24739J22299_10002632 | JGI24739J22299_100026325 | 172 |
| 436 | 3300001990 | JGI24737J22298_10004262 | JGI24737J22298_100042624 | 172 |
| 437 | 3300001990 | JGI24737J22298_10010328 | JGI24737J22298_100103282 | 172 |
| 438 | 3300001991 | JGI24743J22301_10001995 | JGI24743J22301_100019953 | 172 |
| 439 | 3300001991 | JGI24743J22301_10065934 | JGI24743J22301_100659342 | 172 |
| 440 | 3300002074 | JGI24748J21848_1000352 | JGI24748J21848_10003524 | 172 |
| 441 | 3300002075 | JGI24738J21930_10000471 | JGI24738J21930_100004716 | 172 |
| 442 | 3300002076 | JGI24749J21850_1000776 | JGI24749J21850_10007763 | 172 |
| 443 | 3300002077 | JGI24744J21845_10019731 | JGI24744J21845_100197312 | 172 |
| 444 | 3300002126 | JGI24035J26624_1000132 | JGI24035J26624_10001324 | 172 |
| 445 | 3300002155 | JGI24033J26618_1000622 | JGI24033J26618_10006224 | 172 |
| 446 | 3300002239 | JGI24034J26672_10002780 | JGI24034J26672_100027802 | 172 |
| 447 | 3300002244 | JGI24742J22300_10000997 | JGI24742J22300_100009974 | 172 |
| 448 | 3300003371 | JGI26145J50221_1004394 | JGI26145J50221_10043942 | 172 |
| 449 | 3300005276 | Ga0065717_1002352 | Ga0065717_10023522 | 172 |
| 450 | 3300005277 | Ga0065716_1001728 | Ga0065716_10017283 | 172 |
| 451 | 3300005288 | Ga0065714_10233309 | Ga0065714_102333091 | 172 |
| 452 | 3300005289 | Ga0065704_10081191 | Ga0065704_100811912 | 172 |
| 453 | 3300005290 | Ga0065712_10002169 | Ga0065712_100021694 | 172 |
| 454 | 3300005290 | Ga0065712_10092767 | Ga0065712_100927672 | 172 |
| 455 | 3300005293 | Ga0065715_10001386 | Ga0065715_100013864 | 172 |
| 456 | 3300005293 | Ga0065715_10009694 | Ga0065715_100096945 | 172 |
| 457 | 3300005328 | Ga0070676_10001202 | Ga0070676_1000120212 | 172 |
| 458 | 3300005328 | Ga0070676_10036391 | Ga0070676_100363914 | 172 |
| 459 | 3300005328 | Ga0070676_10545829 | Ga0070676_105458292 | 172 |
| 460 | 3300005329 | Ga0070683_100000121 | Ga0070683_10000012136 | 172 |
| 461 | 3300005329 | Ga0070683_100494255 | Ga0070683_1004942552 | 172 |
| 462 | 3300005330 | Ga0070690_100012170 | Ga0070690_1000121703 | 172 |
| 463 | 3300005330 | Ga0070690_100018802 | Ga0070690_1000188021 | 172 |
| 464 | 3300005331 | Ga0070670_100005999 | Ga0070670_1000059993 | 172 |
| 465 | 3300005331 | Ga0070670_100588944 | Ga0070670_1005889442 | 172 |
| 466 | 3300005333 | Ga0070677_10000055 | Ga0070677_100000555 | 172 |
| 467 | 3300005334 | Ga0068869_100000507 | Ga0068869_10000050720 | 172 |
| 468 | 3300005335 | Ga0070666_10113417 | Ga0070666_101134172 | 172 |
| 469 | 3300005336 | Ga0070680_100011815 | Ga0070680_1000118154 | 172 |
| 470 | 3300005337 | Ga0070682_100000697 | Ga0070682_1000006974 | 172 |
| 471 | 3300005337 | Ga0070682_100693463 | Ga0070682_1006934631 | 172 |
| 472 | 3300005338 | Ga0068868_100002501 | Ga0068868_1000025017 | 172 |
| 473 | 3300005338 | Ga0068868_100035322 | Ga0068868_1000353225 | 172 |
| 474 | 3300005339 | Ga0070660_100010372 | Ga0070660_1000103724 | 172 |
| 475 | 3300005339 | Ga0070660_100021731 | Ga0070660_1000217313 | 172 |
| 476 | 3300005340 | Ga0070689_100012275 | Ga0070689_1000122753 | 172 |
| 477 | 3300005340 | Ga0070689_100016030 | Ga0070689_1000160303 | 172 |
| 478 | 3300005341 | Ga0070691_10000371 | Ga0070691_1000037116 | 172 |
| 479 | 3300005341 | Ga0070691_10124863 | Ga0070691_101248631 | 172 |
| 480 | 3300005343 | Ga0070687_100002788 | Ga0070687_1000027885 | 172 |
| 481 | 3300005343 | Ga0070687_100236967 | Ga0070687_1002369672 | 172 |
| 482 | 3300005344 | Ga0070661_100000881 | Ga0070661_10000088119 | 172 |
| 483 | 3300005344 | Ga0070661_100134575 | Ga0070661_1001345752 | 172 |
| 484 | 3300005345 | Ga0070692_10000573 | Ga0070692_100005739 | 172 |
| 485 | 3300005345 | Ga0070692_10114989 | Ga0070692_101149891 | 172 |
| 486 | 3300005347 | Ga0070668_100004237 | Ga0070668_1000042374 | 172 |
| 487 | 3300005347 | Ga0070668_100717399 | Ga0070668_1007173991 | 172 |
| 488 | 3300005353 | Ga0070669_100019063 | Ga0070669_1000190634 | 172 |
| 489 | 3300005353 | Ga0070669_100088954 | Ga0070669_1000889544 | 172 |
| 490 | 3300005354 | Ga0070675_100000698 | Ga0070675_10000069819 | 172 |
| 491 | 3300005354 | Ga0070675_100132075 | Ga0070675_1001320754 | 172 |
| 492 | 3300005354 | Ga0070675_100558554 | Ga0070675_1005585541 | 172 |
| 493 | 3300005355 | Ga0070671_100000344 | Ga0070671_1000003444 | 172 |
| 494 | 3300005356 | Ga0070674_100000116 | Ga0070674_1000001165 | 172 |
| 495 | 3300005364 | Ga0070673_100000335 | Ga0070673_10000033512 | 172 |
| 496 | 3300005365 | Ga0070688_100000565 | Ga0070688_10000056519 | 172 |
| 497 | 3300005365 | Ga0070688_100034718 | Ga0070688_1000347183 | 172 |
| 498 | 3300005365 | Ga0070688_100076623 | Ga0070688_1000766231 | 172 |
| 499 | 3300005366 | Ga0070659_100011128 | Ga0070659_1000111285 | 172 |
| 500 | 3300005366 | Ga0070659_100018339 | Ga0070659_1000183393 | 172 |
| 501 | 3300005366 | Ga0070659_100079053 | Ga0070659_1000790532 | 172 |
| 502 | 3300005367 | Ga0070667_100007699 | Ga0070667_1000076995 | 172 |
| 503 | 3300005367 | Ga0070667_100013516 | Ga0070667_1000135165 | 172 |
| 504 | 3300005434 | Ga0070709_10021059 | Ga0070709_100210594 | 172 |
| 505 | 3300005435 | Ga0070714_100065392 | Ga0070714_1000653923 | 172 |
| 506 | 3300005436 | Ga0070713_100002431 | Ga0070713_1000024315 | 172 |
| 507 | 3300005437 | Ga0070710_10009728 | Ga0070710_100097283 | 172 |
| 508 | 3300005438 | Ga0070701_10002810 | Ga0070701_100028105 | 172 |
| 509 | 3300005438 | Ga0070701_10054976 | Ga0070701_100549761 | 172 |
| 510 | 3300005440 | Ga0070705_100013561 | Ga0070705_1000135614 | 172 |
| 511 | 3300005440 | Ga0070705_100037987 | Ga0070705_1000379872 | 172 |
| 512 | 3300005440 | Ga0070705_100122110 | Ga0070705_1001221101 | 172 |
| 513 | 3300005441 | Ga0070700_100005744 | Ga0070700_1000057444 | 172 |
| 514 | 3300005441 | Ga0070700_100008316 | Ga0070700_1000083163 | 172 |
| 515 | 3300005444 | Ga0070694_100016106 | Ga0070694_1000161064 | 172 |
| 516 | 3300005444 | Ga0070694_100046557 | Ga0070694_1000465573 | 172 |
| 517 | 3300005445 | Ga0070708_100011088 | Ga0070708_1000110886 | 172 |
| 518 | 3300005445 | Ga0070708_100979878 | Ga0070708_1009798781 | 172 |
| 519 | 3300005455 | Ga0070663_100001736 | Ga0070663_10000173613 | 172 |
| 520 | 3300005456 | Ga0070678_100000684 | Ga0070678_10000068416 | 172 |
| 521 | 3300005456 | Ga0070678_100059106 | Ga0070678_1000591063 | 172 |
| 522 | 3300005457 | Ga0070662_100009413 | Ga0070662_1000094134 | 172 |
| 523 | 3300005457 | Ga0070662_100018312 | Ga0070662_1000183124 | 172 |
| 524 | 3300005458 | Ga0070681_10035745 | Ga0070681_100357454 | 172 |
| 525 | 3300005458 | Ga0070681_10048173 | Ga0070681_100481733 | 172 |
| 526 | 3300005459 | Ga0068867_100004625 | Ga0068867_1000046257 | 172 |
| 527 | 3300005459 | Ga0068867_100075112 | Ga0068867_1000751124 | 172 |
| 528 | 3300005466 | Ga0070685_10002368 | Ga0070685_100023683 | 172 |
| 529 | 3300005466 | Ga0070685_10016634 | Ga0070685_100166344 | 172 |
| 530 | 3300005466 | Ga0070685_10458801 | Ga0070685_104588012 | 172 |
| 531 | 3300005468 | Ga0070707_100697664 | Ga0070707_1006976641 | 172 |
| 532 | 3300005530 | Ga0070679_100001791 | Ga0070679_10000179119 | 172 |
| 533 | 3300005530 | Ga0070679_100091672 | Ga0070679_1000916723 | 172 |
| 534 | 3300005535 | Ga0070684_100036545 | Ga0070684_1000365454 | 172 |
| 535 | 3300005536 | Ga0070697_100061498 | Ga0070697_1000614983 | 172 |
| 536 | 3300005539 | Ga0068853_100019599 | Ga0068853_1000195993 | 172 |
| 537 | 3300005539 | Ga0068853_100389278 | Ga0068853_1003892781 | 172 |
| 538 | 3300005543 | Ga0070672_100000741 | Ga0070672_10000074119 | 172 |
| 539 | 3300005543 | Ga0070672_100111863 | Ga0070672_1001118634 | 172 |
| 540 | 3300005544 | Ga0070686_100009437 | Ga0070686_1000094374 | 172 |
| 541 | 3300005544 | Ga0070686_100018881 | Ga0070686_1000188814 | 172 |
| 542 | 3300005544 | Ga0070686_100123565 | Ga0070686_1001235653 | 172 |
| 543 | 3300005545 | Ga0070695_100015651 | Ga0070695_1000156514 | 172 |
| 544 | 3300005545 | Ga0070695_100017329 | Ga0070695_1000173294 | 172 |
| 545 | 3300005546 | Ga0070696_100007917 | Ga0070696_1000079174 | 172 |
| 546 | 3300005546 | Ga0070696_100049562 | Ga0070696_1000495624 | 172 |
| 547 | 3300005546 | Ga0070696_100518426 | Ga0070696_1005184261 | 172 |
| 548 | 3300005547 | Ga0070693_100001254 | Ga0070693_10000125411 | 172 |
| 549 | 3300005547 | Ga0070693_100244817 | Ga0070693_1002448171 | 172 |
| 550 | 3300005549 | Ga0070704_100016209 | Ga0070704_1000162094 | 172 |
| 551 | 3300005549 | Ga0070704_100561447 | Ga0070704_1005614471 | 172 |
| 552 | 3300005563 | Ga0068855_100046827 | Ga0068855_1000468273 | 172 |
| 553 | 3300005563 | Ga0068855_100305269 | Ga0068855_1003052693 | 172 |
| 554 | 3300005564 | Ga0070664_100015589 | Ga0070664_1000155895 | 172 |
| 555 | 3300005564 | Ga0070664_100109821 | Ga0070664_1001098212 | 172 |
| 556 | 3300005564 | Ga0070664_100211431 | Ga0070664_1002114313 | 172 |
| 557 | 3300005577 | Ga0068857_100000680 | Ga0068857_10000068011 | 172 |
| 558 | 3300005577 | Ga0068857_100862312 | Ga0068857_1008623121 | 172 |
| 559 | 3300005578 | Ga0068854_100000760 | Ga0068854_1000007604 | 172 |
| 560 | 3300005578 | Ga0068854_100422104 | Ga0068854_1004221042 | 172 |
| 561 | 3300005614 | Ga0068856_100021374 | Ga0068856_1000213743 | 172 |
| 562 | 3300005614 | Ga0068856_100469223 | Ga0068856_1004692231 | 172 |
| 563 | 3300005615 | Ga0070702_100000099 | Ga0070702_10000009929 | 172 |
| 564 | 3300005615 | Ga0070702_100091849 | Ga0070702_1000918493 | 172 |
| 565 | 3300005616 | Ga0068852_100008756 | Ga0068852_1000087566 | 172 |
| 566 | 3300005617 | Ga0068859_100040793 | Ga0068859_1000407934 | 172 |
| 567 | 3300005617 | Ga0068859_100050417 | Ga0068859_1000504172 | 172 |
| 568 | 3300005618 | Ga0068864_100016990 | Ga0068864_1000169904 | 172 |
| 569 | 3300005618 | Ga0068864_100032401 | Ga0068864_1000324013 | 172 |
| 570 | 3300005718 | Ga0068866_10271784 | Ga0068866_102717842 | 172 |
| 571 | 3300005719 | Ga0068861_100000354 | Ga0068861_10000035428 | 172 |
| 572 | 3300005719 | Ga0068861_100588337 | Ga0068861_1005883372 | 172 |
| 573 | 3300005840 | Ga0068870_10000395 | Ga0068870_1000039514 | 172 |
| 574 | 3300005840 | Ga0068870_10168481 | Ga0068870_101684812 | 172 |
| 575 | 3300005841 | Ga0068863_100013197 | Ga0068863_1000131976 | 172 |
| 576 | 3300005842 | Ga0068858_100017831 | Ga0068858_1000178314 | 172 |
| 577 | 3300005842 | Ga0068858_101160414 | Ga0068858_1011604142 | 172 |
| 578 | 3300005843 | Ga0068860_100007901 | Ga0068860_1000079015 | 172 |
| 579 | 3300005843 | Ga0068860_100116923 | Ga0068860_1001169233 | 172 |
| 580 | 3300005844 | Ga0068862_100013455 | Ga0068862_1000134555 | 172 |
| 581 | 3300005844 | Ga0068862_100043042 | Ga0068862_1000430423 | 172 |
| 582 | 3300006237 | Ga0097621_100000430 | Ga0097621_10000043013 | 172 |
| 583 | 3300006358 | Ga0068871_100000243 | Ga0068871_10000024336 | 172 |
| 584 | 3300006852 | Ga0075433_10027633 | Ga0075433_100276334 | 172 |
| 585 | 3300006871 | Ga0075434_100030033 | Ga0075434_1000300334 | 172 |
| 586 | 3300006871 | Ga0075434_100077844 | Ga0075434_1000778443 | 172 |
| 587 | 3300006881 | Ga0068865_100000675 | Ga0068865_10000067519 | 172 |
| 588 | 3300006931 | Ga0097620_100040793 | Ga0097620_1000407934 | 172 |
| 589 | 3300006931 | Ga0097620_100050415 | Ga0097620_1000504152 | 172 |
| 590 | 3300007076 | Ga0075435_100033874 | Ga0075435_1000338742 | 172 |
| 591 | 3300009011 | Ga0105251_10120382 | Ga0105251_101203822 | 172 |
| 592 | 3300009036 | Ga0105244_10099861 | Ga0105244_100998612 | 172 |
| 593 | 3300009093 | Ga0105240_10045886 | Ga0105240_100458863 | 172 |
| 594 | 3300009094 | Ga0111539_10004002 | Ga0111539_1000400219 | 172 |
| 595 | 3300009094 | Ga0111539_10004660 | Ga0111539_1000466018 | 172 |
| 596 | 3300009098 | Ga0105245_10000943 | Ga0105245_1000094312 | 172 |
| 597 | 3300009098 | Ga0105245_10242766 | Ga0105245_102427662 | 172 |
| 598 | 3300009101 | Ga0105247_10014588 | Ga0105247_100145882 | 172 |
| 599 | 3300009101 | Ga0105247_10196345 | Ga0105247_101963452 | 172 |
| 600 | 3300009101 | Ga0105247_10274535 | Ga0105247_102745351 | 172 |
| 601 | 3300009148 | Ga0105243_10002854 | Ga0105243_1000285413 | 172 |
| 602 | 3300009148 | Ga0105243_10008993 | Ga0105243_100089934 | 172 |
| 603 | 3300009148 | Ga0105243_10067794 | Ga0105243_100677942 | 172 |
| 604 | 3300009174 | Ga0105241_10001331 | Ga0105241_1000133114 | 172 |
| 605 | 3300009174 | Ga0105241_10141848 | Ga0105241_101418481 | 172 |
| 606 | 3300009176 | Ga0105242_10000036 | Ga0105242_1000003634 | 172 |
| 607 | 3300009176 | Ga0105242_10022615 | Ga0105242_100226155 | 172 |
| 608 | 3300009177 | Ga0105248_10043021 | Ga0105248_100430212 | 172 |
| 609 | 3300009545 | Ga0105237_10030440 | Ga0105237_100304404 | 172 |
| 610 | 3300009545 | Ga0105237_10093691 | Ga0105237_100936913 | 172 |
| 611 | 3300009545 | Ga0105237_10170505 | Ga0105237_101705052 | 172 |
| 612 | 3300009551 | Ga0105238_10787553 | Ga0105238_107875532 | 172 |
| 613 | 3300009553 | Ga0105249_10018622 | Ga0105249_100186223 | 172 |
| 614 | 3300009553 | Ga0105249_10021070 | Ga0105249_100210703 | 172 |
| 615 | 3300010375 | Ga0105239_10024026 | Ga0105239_100240265 | 172 |
| 616 | 3300010375 | Ga0105239_10049423 | Ga0105239_100494234 | 172 |
| 617 | 3300011119 | Ga0105246_10014421 | Ga0105246_100144212 | 172 |
| 618 | 3300011119 | Ga0105246_11171327 | Ga0105246_111713271 | 172 |
| 619 | 3300012477 | Ga0157336_1003052 | Ga0157336_10030521 | 172 |
| 620 | 3300012485 | Ga0157325_1001007 | Ga0157325_10010072 | 172 |
| 621 | 3300012485 | Ga0157325_1004613 | Ga0157325_10046132 | 172 |
| 622 | 3300012494 | Ga0157341_1000404 | Ga0157341_10004043 | 172 |
| 623 | 3300012515 | Ga0157338_1029864 | Ga0157338_10298641 | 172 |
| 624 | 3300013100 | Ga0157373_10004533 | Ga0157373_100045336 | 172 |
| 625 | 3300013102 | Ga0157371_10310476 | Ga0157371_103104762 | 172 |
| 626 | 3300013296 | Ga0157374_10012850 | Ga0157374_100128505 | 172 |
| 627 | 3300013296 | Ga0157374_11722277 | Ga0157374_117222771 | 172 |
| 628 | 3300013297 | Ga0157378_10000462 | Ga0157378_1000046213 | 172 |
| 629 | 3300013297 | Ga0157378_10006814 | Ga0157378_100068142 | 172 |
| 630 | 3300013306 | Ga0163162_10002063 | Ga0163162_100020638 | 172 |
| 631 | 3300013306 | Ga0163162_10015790 | Ga0163162_100157906 | 172 |
| 632 | 3300013306 | Ga0163162_10700153 | Ga0163162_107001532 | 172 |
| 633 | 3300013307 | Ga0157372_10134691 | Ga0157372_101346913 | 172 |
| 634 | 3300013308 | Ga0157375_10017542 | Ga0157375_100175425 | 172 |
| 635 | 3300013308 | Ga0157375_10096764 | Ga0157375_100967644 | 172 |
| 636 | 3300013308 | Ga0157375_10351257 | Ga0157375_103512571 | 172 |
| 637 | 3300014325 | Ga0163163_10041884 | Ga0163163_100418842 | 172 |
| 638 | 3300014325 | Ga0163163_10790875 | Ga0163163_107908751 | 172 |
| 639 | 3300014325 | Ga0163163_10987147 | Ga0163163_109871472 | 172 |
| 640 | 3300014326 | Ga0157380_10000274 | Ga0157380_1000027414 | 172 |
| 641 | 3300014745 | Ga0157377_10000470 | Ga0157377_100004704 | 172 |
| 642 | 3300014968 | Ga0157379_10007174 | Ga0157379_100071747 | 172 |
| 643 | 3300014968 | Ga0157379_10076194 | Ga0157379_100761943 | 172 |
| 644 | 3300014969 | Ga0157376_10000508 | Ga0157376_1000050819 | 172 |
| 645 | 3300014969 | Ga0157376_10118645 | Ga0157376_101186454 | 172 |
| 646 | 3300014969 | Ga0157376_11055612 | Ga0157376_110556122 | 172 |
| 647 | 3300017792 | Ga0163161_10001910 | Ga0163161_100019102 | 172 |
| 648 | 3300025271 | Ga0207666_1000356 | Ga0207666_10003564 | 172 |
| 649 | 3300025271 | Ga0207666_1005293 | Ga0207666_10052932 | 172 |
| 650 | 3300025315 | Ga0207697_10004946 | Ga0207697_100049463 | 172 |
| 651 | 3300025728 | Ga0207655_1156957 | Ga0207655_11569572 | 172 |
| 652 | 3300025735 | Ga0207713_1017837 | Ga0207713_10178372 | 172 |
| 653 | 3300025893 | Ga0207682_10000135 | Ga0207682_100001358 | 172 |
| 654 | 3300025899 | Ga0207642_10000073 | Ga0207642_1000007311 | 172 |
| 655 | 3300025900 | Ga0207710_10018190 | Ga0207710_100181902 | 172 |
| 656 | 3300025900 | Ga0207710_10038243 | Ga0207710_100382432 | 172 |
| 657 | 3300025900 | Ga0207710_10238883 | Ga0207710_102388831 | 172 |
| 658 | 3300025900 | Ga0207710_10484005 | Ga0207710_104840051 | 172 |
| 659 | 3300025901 | Ga0207688_10006665 | Ga0207688_100066653 | 172 |
| 660 | 3300025901 | Ga0207688_10044363 | Ga0207688_100443632 | 172 |
| 661 | 3300025903 | Ga0207680_10007561 | Ga0207680_100075615 | 172 |
| 662 | 3300025903 | Ga0207680_10014423 | Ga0207680_100144233 | 172 |
| 663 | 3300025904 | Ga0207647_10012910 | Ga0207647_100129103 | 172 |
| 664 | 3300025906 | Ga0207699_10006915 | Ga0207699_100069154 | 172 |
| 665 | 3300025907 | Ga0207645_10000457 | Ga0207645_1000045727 | 172 |
| 666 | 3300025907 | Ga0207645_10043906 | Ga0207645_100439062 | 172 |
| 667 | 3300025907 | Ga0207645_10492574 | Ga0207645_104925742 | 172 |
| 668 | 3300025908 | Ga0207643_10000853 | Ga0207643_1000085317 | 172 |
| 669 | 3300025908 | Ga0207643_10133104 | Ga0207643_101331042 | 172 |
| 670 | 3300025911 | Ga0207654_10000638 | Ga0207654_1000063815 | 172 |
| 671 | 3300025912 | Ga0207707_10017958 | Ga0207707_100179584 | 172 |
| 672 | 3300025912 | Ga0207707_10787122 | Ga0207707_107871221 | 172 |
| 673 | 3300025913 | Ga0207695_10036170 | Ga0207695_100361703 | 172 |
| 674 | 3300025914 | Ga0207671_10032909 | Ga0207671_100329094 | 172 |
| 675 | 3300025914 | Ga0207671_10170577 | Ga0207671_101705772 | 172 |
| 676 | 3300025915 | Ga0207693_10069871 | Ga0207693_100698713 | 172 |
| 677 | 3300025917 | Ga0207660_10001020 | Ga0207660_100010206 | 172 |
| 678 | 3300025917 | Ga0207660_10217779 | Ga0207660_102177792 | 172 |
| 679 | 3300025918 | Ga0207662_10005471 | Ga0207662_100054714 | 172 |
| 680 | 3300025918 | Ga0207662_10014776 | Ga0207662_100147762 | 172 |
| 681 | 3300025919 | Ga0207657_10025718 | Ga0207657_100257183 | 172 |
| 682 | 3300025919 | Ga0207657_10031026 | Ga0207657_100310262 | 172 |
| 683 | 3300025920 | Ga0207649_10000760 | Ga0207649_1000076017 | 172 |
| 684 | 3300025920 | Ga0207649_10011720 | Ga0207649_100117204 | 172 |
| 685 | 3300025921 | Ga0207652_10000764 | Ga0207652_100007644 | 172 |
| 686 | 3300025921 | Ga0207652_10203626 | Ga0207652_102036262 | 172 |
| 687 | 3300025921 | Ga0207652_10798136 | Ga0207652_107981361 | 172 |
| 688 | 3300025922 | Ga0207646_10257654 | Ga0207646_102576542 | 172 |
| 689 | 3300025923 | Ga0207681_10000065 | Ga0207681_1000006570 | 172 |
| 690 | 3300025925 | Ga0207650_10001773 | Ga0207650_1000177310 | 172 |
| 691 | 3300025925 | Ga0207650_10594567 | Ga0207650_105945671 | 172 |
| 692 | 3300025926 | Ga0207659_10000142 | Ga0207659_1000014244 | 172 |
| 693 | 3300025926 | Ga0207659_10017702 | Ga0207659_100177024 | 172 |
| 694 | 3300025926 | Ga0207659_10253946 | Ga0207659_102539462 | 172 |
| 695 | 3300025927 | Ga0207687_10000125 | Ga0207687_1000012529 | 172 |
| 696 | 3300025928 | Ga0207700_10010816 | Ga0207700_100108167 | 172 |
| 697 | 3300025931 | Ga0207644_10002125 | Ga0207644_100021252 | 172 |
| 698 | 3300025931 | Ga0207644_10004403 | Ga0207644_100044037 | 172 |
| 699 | 3300025932 | Ga0207690_10003823 | Ga0207690_100038235 | 172 |
| 700 | 3300025932 | Ga0207690_10013751 | Ga0207690_100137513 | 172 |
| 701 | 3300025933 | Ga0207706_10019275 | Ga0207706_100192753 | 172 |
| 702 | 3300025933 | Ga0207706_10019316 | Ga0207706_100193163 | 172 |
| 703 | 3300025934 | Ga0207686_10000344 | Ga0207686_1000034412 | 172 |
| 704 | 3300025935 | Ga0207709_10000183 | Ga0207709_1000018316 | 172 |
| 705 | 3300025935 | Ga0207709_10045448 | Ga0207709_100454482 | 172 |
| 706 | 3300025936 | Ga0207670_10000288 | Ga0207670_100002884 | 172 |
| 707 | 3300025936 | Ga0207670_10034555 | Ga0207670_100345552 | 172 |
| 708 | 3300025937 | Ga0207669_10000081 | Ga0207669_1000008137 | 172 |
| 709 | 3300025938 | Ga0207704_10000121 | Ga0207704_1000012120 | 172 |
| 710 | 3300025938 | Ga0207704_10012634 | Ga0207704_100126342 | 172 |
| 711 | 3300025939 | Ga0207665_10002359 | Ga0207665_100023594 | 172 |
| 712 | 3300025940 | Ga0207691_10008864 | Ga0207691_100088644 | 172 |
| 713 | 3300025940 | Ga0207691_10095404 | Ga0207691_100954042 | 172 |
| 714 | 3300025941 | Ga0207711_10004044 | Ga0207711_100040442 | 172 |
| 715 | 3300025941 | Ga0207711_10069734 | Ga0207711_100697342 | 172 |
| 716 | 3300025942 | Ga0207689_10000696 | Ga0207689_100006964 | 172 |
| 717 | 3300025942 | Ga0207689_10169992 | Ga0207689_101699923 | 172 |
| 718 | 3300025944 | Ga0207661_10000286 | Ga0207661_1000028617 | 172 |
| 719 | 3300025945 | Ga0207679_10000064 | Ga0207679_1000006431 | 172 |
| 720 | 3300025945 | Ga0207679_10059490 | Ga0207679_100594901 | 172 |
| 721 | 3300025949 | Ga0207667_10007326 | Ga0207667_100073263 | 172 |
| 722 | 3300025949 | Ga0207667_10104622 | Ga0207667_101046223 | 172 |
| 723 | 3300025960 | Ga0207651_10000395 | Ga0207651_100003958 | 172 |
| 724 | 3300025960 | Ga0207651_10006576 | Ga0207651_100065761 | 172 |
| 725 | 3300025961 | Ga0207712_10000752 | Ga0207712_1000075221 | 172 |
| 726 | 3300025961 | Ga0207712_10015902 | Ga0207712_100159024 | 172 |
| 727 | 3300025972 | Ga0207668_10000715 | Ga0207668_1000071517 | 172 |
| 728 | 3300025972 | Ga0207668_10055847 | Ga0207668_100558473 | 172 |
| 729 | 3300025972 | Ga0207668_10131898 | Ga0207668_101318983 | 172 |
| 730 | 3300025981 | Ga0207640_10003491 | Ga0207640_100034914 | 172 |
| 731 | 3300025981 | Ga0207640_10094339 | Ga0207640_100943392 | 172 |
| 732 | 3300025986 | Ga0207658_10001038 | Ga0207658_100010388 | 172 |
| 733 | 3300025986 | Ga0207658_10098487 | Ga0207658_100984871 | 172 |
| 734 | 3300026023 | Ga0207677_10000985 | Ga0207677_100009854 | 172 |
| 735 | 3300026023 | Ga0207677_10170894 | Ga0207677_101708942 | 172 |
| 736 | 3300026035 | Ga0207703_10001400 | Ga0207703_100014004 | 172 |
| 737 | 3300026035 | Ga0207703_10020429 | Ga0207703_100204292 | 172 |
| 738 | 3300026035 | Ga0207703_10295993 | Ga0207703_102959933 | 172 |
| 739 | 3300026041 | Ga0207639_10005141 | Ga0207639_100051415 | 172 |
| 740 | 3300026041 | Ga0207639_10046126 | Ga0207639_100461263 | 172 |
| 741 | 3300026067 | Ga0207678_10009603 | Ga0207678_100096036 | 172 |
| 742 | 3300026075 | Ga0207708_10012692 | Ga0207708_100126924 | 172 |
| 743 | 3300026075 | Ga0207708_10015109 | Ga0207708_100151094 | 172 |
| 744 | 3300026078 | Ga0207702_10001395 | Ga0207702_1000139519 | 172 |
| 745 | 3300026078 | Ga0207702_10418712 | Ga0207702_104187123 | 172 |
| 746 | 3300026088 | Ga0207641_10003265 | Ga0207641_1000326513 | 172 |
| 747 | 3300026088 | Ga0207641_10521470 | Ga0207641_105214702 | 172 |
| 748 | 3300026089 | Ga0207648_10008132 | Ga0207648_100081323 | 172 |
| 749 | 3300026089 | Ga0207648_10118095 | Ga0207648_101180954 | 172 |
| 750 | 3300026095 | Ga0207676_10000079 | Ga0207676_1000007925 | 172 |
| 751 | 3300026116 | Ga0207674_10006886 | Ga0207674_100068863 | 172 |
| 752 | 3300026116 | Ga0207674_10270775 | Ga0207674_102707752 | 172 |
| 753 | 3300026118 | Ga0207675_100019734 | Ga0207675_1000197343 | 172 |
| 754 | 3300026118 | Ga0207675_100023481 | Ga0207675_1000234813 | 172 |
| 755 | 3300026121 | Ga0207683_10000037 | Ga0207683_1000003775 | 172 |
| 756 | 3300026142 | Ga0207698_10006345 | Ga0207698_100063455 | 172 |
| 757 | 3300026142 | Ga0207698_10062688 | Ga0207698_100626883 | 172 |
| 758 | 3300026142 | Ga0207698_11074951 | Ga0207698_110749511 | 172 |
| 759 | 3300027252 | Ga0209973_1034280 | Ga0209973_10342801 | 172 |
| 760 | 3300027364 | Ga0209967_1029468 | Ga0209967_10294681 | 172 |
| 761 | 3300027614 | Ga0209970_1005518 | Ga0209970_10055183 | 172 |
| 762 | 3300027617 | Ga0210002_1001169 | Ga0210002_10011693 | 172 |
| 763 | 3300027682 | Ga0209971_1002495 | Ga0209971_10024954 | 172 |
| 764 | 3300027695 | Ga0209966_1001440 | Ga0209966_10014403 | 172 |
| 765 | 3300027717 | Ga0209998_10001960 | Ga0209998_100019604 | 172 |
| 766 | 3300027866 | Ga0209813_10057210 | Ga0209813_100572102 | 172 |
| 767 | 3300027876 | Ga0209974_10003753 | Ga0209974_100037533 | 172 |
| 768 | 3300027876 | Ga0209974_10017872 | Ga0209974_100178722 | 172 |
| 769 | 3300027907 | Ga0207428_10002255 | Ga0207428_100022554 | 172 |
| 770 | 3300027907 | Ga0207428_10043033 | Ga0207428_100430335 | 172 |
| 771 | 3300028380 | Ga0268265_10001133 | Ga0268265_1000113317 | 172 |
| 772 | 3300028380 | Ga0268265_10009438 | Ga0268265_100094385 | 172 |
| 773 | 3300028381 | Ga0268264_10000805 | Ga0268264_1000080526 | 172 |
| 774 | 3300028381 | Ga0268264_10276005 | Ga0268264_102760052 | 172 |
| 775 | 3300034816 | Ga0373930_0001896 | Ga0373930_0001896_1513_2031 | 172 |
| 776 | 3300034816 | Ga0373930_0005241 | Ga0373930_0005241_493_1029 | 172 |
| 777 | 3300034817 | Ga0373948_0000081 | Ga0373948_0000081_9018_9536 | 172 |
| 778 | 3300034817 | Ga0373948_0010170 | Ga0373948_0010170_74_610 | 172 |
| 779 | 3300034818 | Ga0373950_0003742 | Ga0373950_0003742_302_820 | 172 |
| 780 | 3300034819 | Ga0373958_0008357 | Ga0373958_0008357_55_573 | 172 |
| 781 | 3300034820 | Ga0373959_0000392 | Ga0373959_0000392_6213_6731 | 172 |
| 782 | 3300034820 | Ga0373959_0033741 | Ga0373959_0033741_276_803 | 172 |
| 783 | 3300034957 | Ga0373938_0000063 | Ga0373938_0000063_4922_5440 | 172 |
| 784 | 3300034957 | Ga0373938_0003923 | Ga0373938_0003923_1023_1550 | 172 |
| 785 | 3300034957 | Ga0373938_0005098 | Ga0373938_0005098_1340_1876 | 172 |
| 786 | 3300035083 | Ga0373926_0020321 | Ga0373926_0020321_15_551 | 172 |
| 787 | 3300035084 | Ga0373928_0001474 | Ga0373928_0001474_1219_1737 | 172 |
| 788 | 3300035084 | Ga0373928_0005009 | Ga0373928_0005009_958_1485 | 172 |
| 789 | 3300035085 | Ga0373929_0010975 | Ga0373929_0010975_43_579 | 172 |
| 790 | 3300035088 | Ga0373940_0000418 | Ga0373940_0000418_3280_3798 | 172 |
| 791 | 3300035088 | Ga0373940_0006847 | Ga0373940_0006847_1072_1608 | 172 |
| 792 | 3300035089 | Ga0373944_0078723 | Ga0373944_0078723_258_794 | 172 |
| 793 | 3300035090 | Ga0373949_0000779 | Ga0373949_0000779_7391_7909 | 172 |
| 794 | 3300035090 | Ga0373949_0002326 | Ga0373949_0002326_1135_1662 | 172 |
| 795 | 3300035091 | Ga0373951_0001074 | Ga0373951_0001074_3947_4465 | 172 |
| 796 | 3300035091 | Ga0373951_0003704 | Ga0373951_0003704_2182_2709 | 172 |
| 797 | 3300035091 | Ga0373951_0005252 | Ga0373951_0005252_1227_1763 | 172 |
| 798 | 3300035092 | Ga0373952_0001672 | Ga0373952_0001672_2826_3344 | 172 |
| 799 | 3300035092 | Ga0373952_0003287 | Ga0373952_0003287_1171_1707 | 172 |
| 800 | 3300035111 | Ga0373923_0000419 | Ga0373923_0000419_8201_8737 | 172 |
| 801 | 3300035112 | Ga0373932_0000516 | Ga0373932_0000516_4643_5161 | 172 |
| 802 | 3300035112 | Ga0373932_0002506 | Ga0373932_0002506_3260_3796 | 172 |
| 803 | 3300035112 | Ga0373932_0002800 | Ga0373932_0002800_1455_1982 | 172 |
| 804 | 3300035114 | Ga0373939_0001269 | Ga0373939_0001269_3301_3828 | 172 |
| 805 | 3300035114 | Ga0373939_0003293 | Ga0373939_0003293_544_1062 | 172 |
| 806 | 3300035114 | Ga0373939_0019437 | Ga0373939_0019437_110_646 | 172 |
| 807 | 3300035115 | Ga0373941_0001012 | Ga0373941_0001012_2917_3444 | 172 |
| 808 | 3300035115 | Ga0373941_0002320 | Ga0373941_0002320_49_567 | 172 |
| 809 | 3300035115 | Ga0373941_0064352 | Ga0373941_0064352_32_568 | 172 |
| 810 | 3300035116 | Ga0373945_0010619 | Ga0373945_0010619_437_973 | 172 |
| 811 | 3300035117 | Ga0373953_0134580 | Ga0373953_0134580_472_1008 | 172 |
| 812 | 3300035121 | Ga0373960_0002055 | Ga0373960_0002055_3763_4290 | 172 |
| 813 | 3300035121 | Ga0373960_0002580 | Ga0373960_0002580_2474_2992 | 172 |
| 814 | 3300035121 | Ga0373960_0007020 | Ga0373960_0007020_48_584 | 172 |
| 815 | 3300035170 | Ga0373943_0017330 | Ga0373943_0017330_657_1193 | 172 |
| 816 | 3300035171 | Ga0373946_0003737 | Ga0373946_0003737_2687_3223 | 172 |
| 817 | 3300035172 | Ga0373955_0023754 | Ga0373955_0023754_529_1065 | 172 |
| 818 | 3300035207 | Ga0373942_0000898 | Ga0373942_0000898_2099_2617 | 172 |
| 819 | 3300035207 | Ga0373942_0024768 | Ga0373942_0024768_255_791 | 172 |
| 820 | 3300035241 | Ga0373961_0003012 | Ga0373961_0003012_691_1209 | 172 |
| 821 | 3300035241 | Ga0373961_0013509 | Ga0373961_0013509_972_1499 | 172 |
| 822 | 3300035242 | Ga0373962_0024611 | Ga0373962_0024611_255_773 | 172 |
| 823 | 3300035691 | Ga0373931_0002005 | Ga0373931_0002005_5138_5665 | 172 |
| 824 | 3300035691 | Ga0373931_0004422 | Ga0373931_0004422_3780_4316 | 172 |
| 825 | 3300035692 | Ga0373935_0011061 | Ga0373935_0011061_4582_5118 | 172 |
| 826 | 3300035692 | Ga0373935_0048143 | Ga0373935_0048143_304_840 | 172 |
| 827 | 3300035695 | Ga0373927_0023381 | Ga0373927_0023381_1134_1670 | 172 |
| 828 | 3300035724 | Ga0373933_0051605 | Ga0373933_0051605_26_562 | 172 |
| 829 | 3300035725 | Ga0373947_0000637 | Ga0373947_0000637_11304_11840 | 172 |
| 830 | 3300036401 | Ga0373937_0516071 | Ga0373937_0516071_269_805 | 172 |
| 831 | 3300036401 | Ga0373937_0598338 | Ga0373937_0598338_233_766 | 172 |
| 832 | 3300037068 | Ga0373925_0008479 | Ga0373925_0008479_6012_6548 | 172 |
| 833 | 3300042005 | Ga0439448_0047442 | Ga0439448_0047442_625_1152 | 172 |
| 834 | 3300044712 | Ga0453684_0590591 | Ga0453684_0590591_657_1175 | 172 |
| 835 | 3300045051 | Ga0451576_0074642 | Ga0451576_0074642_2651_3169 | 172 |
| 836 | 3300046452 | Ga0495617_043993 | Ga0495617_043993_294_830 | 172 |
| 837 | 3300046455 | Ga0495603_0007685 | Ga0495603_0007685_3185_3721 | 172 |
| 838 | 3300046459 | Ga0495629_0001003 | Ga0495629_0001003_16421_16957 | 172 |
| 839 | 3300046461 | Ga0495641_0027557 | Ga0495641_0027557_419_955 | 172 |
| 840 | 3300046472 | Ga0495580_0394786 | Ga0495580_0394786_10_546 | 172 |
| 841 | 3300046473 | Ga0495582_0025753 | Ga0495582_0025753_472_1008 | 172 |
| 842 | 3300046474 | Ga0495605_0199003 | Ga0495605_0199003_212_748 | 172 |
| 843 | 3300046475 | Ga0495639_0011524 | Ga0495639_0011524_70_606 | 172 |
| 844 | 3300046475 | Ga0495639_0104253 | Ga0495639_0104253_650_1186 | 172 |
| 845 | 3300046476 | Ga0495662_0030634 | Ga0495662_0030634_859_1395 | 172 |
| 846 | 3300046477 | Ga0495664_0003269 | Ga0495664_0003269_6377_6913 | 172 |
| 847 | 3300046491 | Ga0495584_0035734 | Ga0495584_0035734_1688_2224 | 172 |
| 848 | 3300046492 | Ga0495585_0004199 | Ga0495585_0004199_4547_5083 | 172 |
| 849 | 3300046499 | Ga0495594_0017659 | Ga0495594_0017659_1503_2039 | 172 |
| 850 | 3300046501 | Ga0495607_0008348 | Ga0495607_0008348_4225_4761 | 172 |
| 851 | 3300046520 | Ga0495637_0045772 | Ga0495637_0045772_459_995 | 172 |
| 852 | 3300046520 | Ga0495637_0099064 | Ga0495637_0099064_368_895 | 172 |
| 853 | 3300046523 | Ga0495644_0001707 | Ga0495644_0001707_3516_4052 | 172 |
| 854 | 3300046526 | Ga0495666_0005800 | Ga0495666_0005800_1166_1702 | 172 |
| 855 | 3300046526 | Ga0495666_0358899 | Ga0495666_0358899_30_566 | 172 |
| 856 | 3300046539 | Ga0495621_0041722 | Ga0495621_0041722_263_799 | 172 |
| 857 | 3300046557 | Ga0495622_0159256 | Ga0495622_0159256_330_866 | 172 |
| 858 | 3300046558 | Ga0495633_0003249 | Ga0495633_0003249_7056_7592 | 172 |
| 859 | 3300046615 | Ga0495656_0000538 | Ga0495656_0000538_4152_4688 | 172 |
| 860 | 3300046648 | Ga0495611_0147671 | Ga0495611_0147671_425_961 | 172 |
| 861 | 3300046664 | Ga0495659_0004395 | Ga0495659_0004395_3583_4119 | 172 |
| 862 | 3300046665 | Ga0495661_0039583 | Ga0495661_0039583_798_1334 | 172 |
| 863 | 3300046681 | Ga0495647_0002287 | Ga0495647_0002287_4086_4622 | 172 |
| 864 | 3300046683 | Ga0495658_0000814 | Ga0495658_0000814_6338_6874 | 172 |
| 865 | 3300046689 | Ga0495613_0009829 | Ga0495613_0009829_3402_3938 | 172 |
| 866 | 3300046691 | Ga0495670_0002388 | Ga0495670_0002388_1245_1781 | 172 |
| 867 | 3300046794 | Ga0495589_0049868 | Ga0495589_0049868_866_1402 | 172 |
| 868 | 3300047318 | Ga0495636_0024479 | Ga0495636_0024479_381_917 | 172 |
| 869 | 3300047319 | Ga0495674_0036936 | Ga0495674_0036936_248_784 | 172 |
| 870 | 3300047321 | Ga0495676_0110984 | Ga0495676_0110984_147_683 | 172 |
| 871 | 3300047445 | Ga0495677_0028344 | Ga0495677_0028344_874_1401 | 172 |
| 872 | 3300047446 | Ga0495679_042488 | Ga0495679_042488_716_1252 | 172 |
| 873 | 3300048903 | Ga0496100_0000280 | Ga0496100_0000280_13799_14326 | 172 |
| 874 | 3300048903 | Ga0496100_0063094 | Ga0496100_0063094_521_1057 | 172 |
| 875 | 3300048903 | Ga0496100_0641443 | Ga0496100_0641443_32_568 | 172 |
| 876 | 3300048904 | Ga0496101_0000842 | Ga0496101_0000842_5919_6446 | 172 |
| 877 | 3300048904 | Ga0496101_0202914 | Ga0496101_0202914_377_913 | 172 |
| 878 | 3300048904 | Ga0496101_0790376 | Ga0496101_0790376_99_635 | 172 |
| 879 | 3300048905 | Ga0496102_0001974 | Ga0496102_0001974_7342_7869 | 172 |
| 880 | 3300048905 | Ga0496102_0080266 | Ga0496102_0080266_1404_1922 | 172 |
| 881 | 3300048905 | Ga0496102_0637694 | Ga0496102_0637694_404_940 | 172 |
| 882 | 3300048905 | Ga0496102_1150514 | Ga0496102_1150514_66_602 | 172 |
| 883 | 3300048906 | Ga0496103_0000571 | Ga0496103_0000571_11847_12374 | 172 |
| 884 | 3300048906 | Ga0496103_0076208 | Ga0496103_0076208_671_1189 | 172 |
| 885 | 3300048906 | Ga0496103_0335983 | Ga0496103_0335983_218_754 | 172 |
| 886 | 3300048907 | Ga0496104_0018615 | Ga0496104_0018615_3500_4036 | 172 |
| 887 | 3300048907 | Ga0496104_0358944 | Ga0496104_0358944_430_966 | 172 |
| 888 | 3300048907 | Ga0496104_0459589 | Ga0496104_0459589_536_1063 | 172 |
| 889 | 3300048908 | Ga0496105_0348831 | Ga0496105_0348831_217_753 | 172 |
| 890 | 3300048908 | Ga0496105_0376308 | Ga0496105_0376308_493_1029 | 172 |
| 891 | 3300048909 | Ga0496106_0005281 | Ga0496106_0005281_3421_3948 | 172 |
| 892 | 3300048910 | Ga0496107_0001700 | Ga0496107_0001700_3421_3948 | 172 |
| 893 | 3300048910 | Ga0496107_0019205 | Ga0496107_0019205_425_961 | 172 |
| 894 | 3300048910 | Ga0496107_0059648 | Ga0496107_0059648_1169_1687 | 172 |
| 895 | 3300048911 | Ga0496108_0006924 | Ga0496108_0006924_1344_1871 | 172 |
| 896 | 3300048911 | Ga0496108_0058129 | Ga0496108_0058129_2310_2846 | 172 |
| 897 | 3300048912 | Ga0496109_0000260 | Ga0496109_0000260_14652_15179 | 172 |
| 898 | 3300048912 | Ga0496109_0683562 | Ga0496109_0683562_226_762 | 172 |
| 899 | 3300048913 | Ga0496110_0004713 | Ga0496110_0004713_9754_10290 | 172 |
| 900 | 3300048913 | Ga0496110_0024032 | Ga0496110_0024032_2266_2793 | 172 |
| 901 | 3300048913 | Ga0496110_0030828 | Ga0496110_0030828_2316_2852 | 172 |
| 902 | 3300048914 | Ga0496111_0179959 | Ga0496111_0179959_1037_1555 | 172 |
| 903 | 3300048915 | Ga0496112_0017732 | Ga0496112_0017732_2303_2839 | 172 |
| 904 | 3300048915 | Ga0496112_0092965 | Ga0496112_0092965_1380_1907 | 172 |
| 905 | 3300048916 | Ga0496113_0032045 | Ga0496113_0032045_1708_2235 | 172 |
| 906 | 3300048916 | Ga0496113_0197993 | Ga0496113_0197993_214_732 | 172 |
| 907 | 3300048917 | Ga0496114_0010719 | Ga0496114_0010719_1995_2522 | 172 |
| 908 | 3300048917 | Ga0496114_0500815 | Ga0496114_0500815_140_676 | 172 |
| 909 | 3300048918 | Ga0496115_0001610 | Ga0496115_0001610_10554_11081 | 172 |
| 910 | 3300048918 | Ga0496115_0073306 | Ga0496115_0073306_1219_1755 | 172 |
| 911 | 3300048918 | Ga0496115_0503004 | Ga0496115_0503004_235_771 | 172 |
| 912 | 3300048928 | Ga0496125_0342940 | Ga0496125_0342940_205_741 | 172 |
| 913 | 3300048929 | Ga0496126_0445758 | Ga0496126_0445758_282_818 | 172 |
| 914 | 3300049581 | Ga0501047_0247735 | Ga0501047_0247735_782_1381 | 172 |
| 915 | 3300049589 | Ga0501073_0337743 | Ga0501073_0337743_475_1002 | 172 |
| 916 | 3300049593 | Ga0501077_0072649 | Ga0501077_0072649_397_924 | 172 |
| 917 | 3300050511 | nmdc:mga08y16_2292_c1 | nmdc:mga08y16_2292_c1_7343_7870 | 172 |
| 918 | 3300050511 | nmdc:mga08y16_8714_c1 | nmdc:mga08y16_8714_c1_7442_7960 | 172 |
| 919 | 3300050512 | nmdc:mga0n895_1286_c1 | nmdc:mga0n895_1286_c1_13657_14184 | 172 |
| 920 | 3300050512 | nmdc:mga0n895_77410_c1 | nmdc:mga0n895_77410_c1_1204_1740 | 172 |
| 921 | 3300050512 | nmdc:mga0n895_948732_c1 | nmdc:mga0n895_948732_c1_272_808 | 172 |
| 922 | 3300050513 | nmdc:mga0rr50_181967_c1 | nmdc:mga0rr50_181967_c1_957_1493 | 172 |
| 923 | 3300050514 | nmdc:mga08x19_98914_c1 | nmdc:mga08x19_98914_c1_548_1084 | 172 |
| 924 | 3300050515 | nmdc:mga0a205_160859_c1 | nmdc:mga0a205_160859_c1_1074_1592 | 172 |
| 925 | 3300050515 | nmdc:mga0a205_485_c1 | nmdc:mga0a205_485_c1_12629_13156 | 172 |
| 926 | 3300053085 | Ga0495619_0000646 | Ga0495619_0000646_16540_17076 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8iq0-assembly6.cif.gz_K | crystal structure of hydrogen sulfide-bound superoxide dismutase in oxidized state | 0.777 | 48 | 68 |
| 4p1x-assembly1.cif.gz_E | crystal structure of staphylococcal luk prepore | 0.6695 | 21 | 72 |
| 4p1x-assembly1.cif.gz_A | crystal structure of staphylococcal luk prepore | 0.6684 | 21 | 72 |
| 1sda-assembly2.cif.gz_G | crystal structure of peroxynitrite-modified bovine cu,zn superoxide dismutase | 0.6592 | 48 | 67 |
| 2qk7-assembly1.cif.gz_A | a covalent s-f heterodimer of staphylococcal gamma-hemolysin | 0.6432 | 21 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A3A5B9_40_185_2.60.40.1820 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8169 | 58 | 95 | 2.60.40.1820 |
| 3k8aA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.5757 | 23 | 93 | 2.40.50.140 |
| af_P53950_945_1158_1.20.1280.170 | Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 | 0.5684 | 63 | 90 | 1.20.1280.170 |
| af_K7LNG1_19_256_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.5665 | 21 | 69 | 2.70.98.10 |
| af_I1KG56_670_809_2.60.40.1480 | Mainly Beta;Sandwich;Immunoglobulin-like;Coatomer, gamma subunit, appendage domain | 0.5529 | 48 | 91 | 2.60.40.1480 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258D1I9-F1-model_v4 | DUF177 domain-containing protein | 0.965 | 10 | 97 |
|
| AF-A0A258D1I9-F1-model_v4 | DUF177 domain-containing protein | 0.9147 | 10 | 97 |
|
| AF-A8I5L6-F1-model_v4 | DUF177 domain-containing protein | 0.8952 | 4 | 168 |
|
| AF-A0A8A7CNT1-F1-model_v4 | deleted | 0.8941 | 4 | 167 |
|
| AF-A0A380W725-F1-model_v4 | Uncharacterized ACR, COG1399 | 0.8875 | 10 | 167 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar