F485914

General Info

Members Datasets Scaffolds Average Seq Length
926 383 926 77

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100077763|Ga0075434_1000777635
Length 89
Sequence MPSRGSSRRPGLAAADLVAYLARGLVDDPDAVRVESVEQDGALVIRLHVAPDEVGKVIGRQGRMARALRTIVRACAARSNRRLLLEIVE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
212 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
213 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
223 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
224 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
225 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
226 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
227 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
228 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 8.53
Rhizosphere 90.82
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10093479 3300005327 Bacteria 2480
2 Ga0070683_100033346 3300005329 Bacteria 4695
3 Ga0070683_101104419 3300005329 Bacteria 762
4 Ga0070670_100397215 3300005331 Bacteria 1217
5 Ga0070680_100177035 3300005336 Bacteria 1796
6 Ga0070682_100082642 3300005337 Bacteria 2082
7 Ga0070682_100651027 3300005337 Bacteria 839
8 Ga0068868_100311859 3300005338 Bacteria 1338
9 Ga0068868_100611557 3300005338 Bacteria 966
10 Ga0068868_100750976 3300005338 Bacteria 876
11 Ga0070660_100055136 3300005339 Bacteria 3071
12 Ga0070689_100110905 3300005340 Bacteria 2182
13 Ga0070689_102049872 3300005340 Bacteria 524
14 Ga0070661_100073947 3300005344 Bacteria 2509
15 Ga0070661_101253887 3300005344 Unclassified 621
16 Ga0070692_10083591 3300005345 Bacteria 1724
17 Ga0070668_100361639 3300005347 Bacteria 1231
18 Ga0070675_100051021 3300005354 Bacteria 3398
19 Ga0070675_101896470 3300005354 Bacteria 550
20 Ga0070671_100136876 3300005355 Bacteria 2065
21 Ga0070671_100432260 3300005355 Bacteria 1128
22 Ga0070671_100608511 3300005355 Bacteria 944
23 Ga0070671_101706839 3300005355 Bacteria 559
24 Ga0070674_101421182 3300005356 Bacteria 622
25 Ga0070673_100550992 3300005364 Bacteria 1048
26 Ga0070673_100890297 3300005364 Bacteria 825
27 Ga0070673_102261066 3300005364 Bacteria 517
28 Ga0070688_100702775 3300005365 Bacteria 783
29 Ga0070688_101598757 3300005365 Unclassified 532
30 Ga0070659_100024570 3300005366 Bacteria 4619
31 Ga0070659_101609997 3300005366 Bacteria 580
32 Ga0070709_10024136 3300005434 Bacteria 3577
33 Ga0070709_10218658 3300005434 Bacteria 1358
34 Ga0070709_10345926 3300005434 Bacteria 1097
35 Ga0070714_100004990 3300005435 Bacteria 10087
36 Ga0070714_100006640 3300005435 Bacteria 8953
37 Ga0070714_100013910 3300005435 Bacteria 6455
38 Ga0070714_100077181 3300005435 Bacteria 2893
39 Ga0070714_100351981 3300005435 Bacteria 1383
40 Ga0070714_101014830 3300005435 Bacteria 807
41 Ga0070714_101614554 3300005435 Bacteria 633
42 Ga0070713_100013273 3300005436 Bacteria 6076
43 Ga0070713_100196285 3300005436 Bacteria 1821
44 Ga0070713_100204352 3300005436 Bacteria 1785
45 Ga0070713_101430251 3300005436 Bacteria 671
46 Ga0070710_10013773 3300005437 Bacteria 4058
47 Ga0070710_10549242 3300005437 Bacteria 797
48 Ga0070701_11418078 3300005438 Bacteria 500
49 Ga0070711_100030354 3300005439 Bacteria 3577
50 Ga0070711_101053360 3300005439 Bacteria 699
51 Ga0070711_101110461 3300005439 Bacteria 681
52 Ga0070705_100125339 3300005440 Bacteria 1666
53 Ga0070700_100921485 3300005441 Bacteria 713
54 Ga0070700_101089409 3300005441 Bacteria 662
55 Ga0070694_100127068 3300005444 Bacteria 1836
56 Ga0070663_100640945 3300005455 Bacteria 898
57 Ga0070678_100075237 3300005456 Bacteria 2540
58 Ga0070662_101591548 3300005457 Unclassified 564
59 Ga0070681_10017999 3300005458 Bacteria 7059
60 Ga0070681_10055435 3300005458 Bacteria 3946
61 Ga0070681_10070898 3300005458 Bacteria 3449
62 Ga0070681_10364277 3300005458 Bacteria 1356
63 Ga0070681_11682271 3300005458 Bacteria 560
64 Ga0070681_11816076 3300005458 Bacteria 537
65 Ga0068867_100514805 3300005459 Bacteria 1031
66 Ga0068867_101192521 3300005459 Bacteria 699
67 Ga0070706_100317981 3300005467 Bacteria 1452
68 Ga0070707_100307125 3300005468 Bacteria 1542
69 Ga0070707_101756317 3300005468 Bacteria 588
70 Ga0070707_101944543 3300005468 Bacteria 555
71 Ga0070698_100092057 3300005471 Bacteria 3013
72 Ga0070699_100126495 3300005518 Bacteria 2251
73 Ga0070699_100584748 3300005518 Bacteria 1018
74 Ga0070679_100112791 3300005530 Bacteria 2704
75 Ga0070679_101411923 3300005530 Bacteria 642
76 Ga0070684_100218082 3300005535 Bacteria 1740
77 Ga0070684_100302945 3300005535 Bacteria 1467
78 Ga0070684_100444116 3300005535 Bacteria 1198
79 Ga0070684_100799726 3300005535 Bacteria 881
80 Ga0070684_101480506 3300005535 Bacteria 640
81 Ga0070672_100157353 3300005543 Bacteria 1883
82 Ga0070672_101145764 3300005543 Bacteria 692
83 Ga0070672_101261144 3300005543 Unclassified 659
84 Ga0070686_100041395 3300005544 Bacteria 2879
85 Ga0070686_100104651 3300005544 Bacteria 1917
86 Ga0070695_100000334 3300005545 Bacteria 24267
87 Ga0070695_100273716 3300005545 Bacteria 1238
88 Ga0070695_101135042 3300005545 Bacteria 641
89 Ga0070696_100384479 3300005546 Bacteria 1094
90 Ga0070696_100527814 3300005546 Bacteria 943
91 Ga0070693_100112440 3300005547 Bacteria 1677
92 Ga0070693_100483097 3300005547 Bacteria 875
93 Ga0070704_100356772 3300005549 Bacteria 1236
94 Ga0070704_102188619 3300005549 Bacteria 514
95 Ga0068855_100099403 3300005563 Bacteria 3351
96 Ga0068855_100837570 3300005563 Bacteria 975
97 Ga0068855_101108618 3300005563 Unclassified 827
98 Ga0068855_101924310 3300005563 Bacteria 599
99 Ga0070664_100155596 3300005564 Bacteria 2020
100 Ga0070664_100484890 3300005564 Bacteria 1138
101 Ga0070664_101939627 3300005564 Bacteria 559
102 Ga0068854_100017506 3300005578 Bacteria 4795
103 Ga0068856_100257473 3300005614 Bacteria 1760
104 Ga0068856_100277510 3300005614 Bacteria 1692
105 Ga0068856_101187269 3300005614 Bacteria 779
106 Ga0070702_100028049 3300005615 Bacteria 3046
107 Ga0070702_101394514 3300005615 Bacteria 573
108 Ga0068852_101508291 3300005616 Bacteria 694
109 Ga0068864_101532715 3300005618 Bacteria 670
110 Ga0068866_11293779 3300005718 Archaea 530
111 Ga0068870_10165339 3300005840 Bacteria 1316
112 Ga0068863_100204364 3300005841 Bacteria 1901
113 Ga0068863_102093770 3300005841 Bacteria 576
114 Ga0068858_100899222 3300005842 Bacteria 866
115 Ga0068858_101256939 3300005842 Bacteria 728
116 Ga0068860_101193666 3300005843 Bacteria 781
117 Ga0068860_101297249 3300005843 Bacteria 749
118 Ga0068862_102642739 3300005844 Bacteria 514
119 Ga0081455_10014606 3300005937 Bacteria 7685
120 Ga0081455_10028287 3300005937 Bacteria 5123
121 Ga0070717_10009831 3300006028 Bacteria 7203
122 Ga0070717_10031287 3300006028 Bacteria 4279
123 Ga0070717_10113541 3300006028 Bacteria 2313
124 Ga0070717_10487220 3300006028 Unclassified 1114
125 Ga0070717_11465630 3300006028 Bacteria 619
126 Ga0075432_10138145 3300006058 Bacteria 928
127 Ga0070715_10000828 3300006163 Bacteria 8480
128 Ga0070716_100041038 3300006173 Bacteria 2576
129 Ga0070716_100106023 3300006173 Bacteria 1732
130 Ga0070716_100439840 3300006173 Bacteria 948
131 Ga0070716_101316327 3300006173 Bacteria 584
132 Ga0070712_100107991 3300006175 Bacteria 2071
133 Ga0070712_100357163 3300006175 Unclassified 1197
134 Ga0070712_100461305 3300006175 Bacteria 1059
135 Ga0075367_11078854 3300006178 Bacteria 513
136 Ga0097621_100983539 3300006237 Bacteria 789
137 Ga0097621_101856085 3300006237 Bacteria 575
138 Ga0075428_101986613 3300006844 Bacteria 603
139 Ga0075430_100870158 3300006846 Bacteria 742
140 Ga0075431_100067662 3300006847 Bacteria 3687
141 Ga0075431_101667871 3300006847 Bacteria 594
142 Ga0075433_10309150 3300006852 Bacteria 1399
143 Ga0075434_100077763 3300006871 Bacteria 3313
144 Ga0075434_100127633 3300006871 Bacteria 2560
145 Ga0075429_100110768 3300006880 Bacteria 2399
146 Ga0068865_100414591 3300006881 Bacteria 1106
147 Ga0075436_100042448 3300006914 Bacteria 3136
148 Ga0075436_100197233 3300006914 Bacteria 1425
149 Ga0075436_101365960 3300006914 Bacteria 537
150 Ga0075435_101375441 3300007076 Unclassified 618
151 Ga0105240_10061979 3300009093 Bacteria 4658
152 Ga0105240_10751949 3300009093 Bacteria 1060
153 Ga0105240_10786652 3300009093 Bacteria 1032
154 Ga0105240_11654157 3300009093 Bacteria 669
155 Ga0111539_10568978 3300009094 Bacteria 1320
156 Ga0111539_10670627 3300009094 Bacteria 1207
157 Ga0111539_11871176 3300009094 Bacteria 696
158 Ga0111539_11882715 3300009094 Unclassified 694
159 Ga0105245_10023710 3300009098 Bacteria 5387
160 Ga0105245_10210097 3300009098 Bacteria 1873
161 Ga0105245_10250487 3300009098 Bacteria 1720
162 Ga0105245_10363355 3300009098 Bacteria 1437
163 Ga0105245_12859988 3300009098 Bacteria 535
164 Ga0105247_10056896 3300009101 Bacteria 2416
165 Ga0105247_10211950 3300009101 Bacteria 1307
166 Ga0105247_10750519 3300009101 Bacteria 740
167 Ga0114129_10074808 3300009147 Bacteria 4717
168 Ga0114129_10109054 3300009147 Bacteria 3821
169 Ga0114129_10738990 3300009147 Bacteria 1261
170 Ga0114129_12142471 3300009147 Bacteria 674
171 Ga0105243_10135016 3300009148 Bacteria 2098
172 Ga0105243_11154668 3300009148 Bacteria 785
173 Ga0105243_11166797 3300009148 Bacteria 782
174 Ga0105241_11064575 3300009174 Bacteria 760
175 Ga0105241_11100195 3300009174 Bacteria 748
176 Ga0105241_12320141 3300009174 Bacteria 534
177 Ga0105242_10114044 3300009176 Bacteria 2309
178 Ga0105242_13241787 3300009176 Bacteria 505
179 Ga0105248_10112254 3300009177 Bacteria 3074
180 Ga0105248_10253316 3300009177 Bacteria 1981
181 Ga0105248_12707521 3300009177 Unclassified 566
182 Ga0105248_12928016 3300009177 Bacteria 544
183 Ga0105237_10026151 3300009545 Bacteria 5964
184 Ga0105237_11711700 3300009545 Bacteria 636
185 Ga0105237_11793333 3300009545 Bacteria 621
186 Ga0105238_10118859 3300009551 Bacteria 2623
187 Ga0105238_11081270 3300009551 Bacteria 824
188 Ga0105238_11431623 3300009551 Bacteria 719
189 Ga0105249_12059326 3300009553 Bacteria 643
190 Ga0105030_104081 3300009987 Bacteria 1249
191 Ga0099796_10225322 3300010159 Bacteria 770
192 Ga0105239_10084330 3300010375 Bacteria 3499
193 Ga0105239_11407827 3300010375 Bacteria 805
194 Ga0105239_12094119 3300010375 Bacteria 657
195 Ga0105239_12429694 3300010375 Bacteria 610
196 Ga0157371_11073687 3300013102 Bacteria 617
197 Ga0157370_10413434 3300013104 Bacteria 1241
198 Ga0157369_10491542 3300013105 Bacteria 1270
199 Ga0157369_11138565 3300013105 Bacteria 797
200 Ga0157369_11216291 3300013105 Bacteria 769
201 Ga0157374_10265789 3300013296 Bacteria 1691
202 Ga0157374_11781422 3300013296 Bacteria 641
203 Ga0157378_10452806 3300013297 Bacteria 1274
204 Ga0163162_10418059 3300013306 Bacteria 1473
205 Ga0163162_10805839 3300013306 Bacteria 1056
206 Ga0157372_10018430 3300013307 Bacteria 7503
207 Ga0157372_10111220 3300013307 Bacteria 3138
208 Ga0157372_10156827 3300013307 Bacteria 2630
209 Ga0157375_10260119 3300013308 Bacteria 1897
210 Ga0157375_11086508 3300013308 Bacteria 936
211 Ga0157375_11116036 3300013308 Bacteria 923
212 Ga0157375_11598201 3300013308 Bacteria 771
213 Ga0163163_10461987 3300014325 Bacteria 1330
214 Ga0157380_10122016 3300014326 Bacteria 2209
215 Ga0157377_10122710 3300014745 Bacteria 1577
216 Ga0157377_10216151 3300014745 Bacteria 1225
217 Ga0157377_10641935 3300014745 Bacteria 763
218 Ga0157379_10208612 3300014968 Bacteria 1768
219 Ga0157379_10850184 3300014968 Bacteria 863
220 Ga0157376_10016558 3300014969 Bacteria 5601
221 Ga0157376_12886825 3300014969 Bacteria 520
222 Ga0182006_1109769 3300015261 Bacteria 969
223 Ga0197907_10181217 3300020069 Bacteria 550
224 Ga0197907_10665942 3300020069 Bacteria 941
225 Ga0197907_10905758 3300020069 Bacteria 1237
226 Ga0206356_10040951 3300020070 Bacteria 1042
227 Ga0206356_10662684 3300020070 Bacteria 3245
228 Ga0206356_11528012 3300020070 Bacteria 576
229 Ga0206352_11055702 3300020078 Bacteria 862
230 Ga0206354_11301243 3300020081 Bacteria 977
231 Ga0213874_10416647 3300021377 Bacteria 525
232 Ga0224712_10226339 3300022467 Bacteria 857
233 Ga0224712_10506495 3300022467 Bacteria 584
234 Ga0207692_10058612 3300025898 Bacteria 1984
235 Ga0207692_10334188 3300025898 Bacteria 930
236 Ga0207692_10971994 3300025898 Bacteria 560
237 Ga0207688_10133801 3300025901 Bacteria 1455
238 Ga0207688_10321841 3300025901 Bacteria 949
239 Ga0207685_10117897 3300025905 Bacteria 1161
240 Ga0207699_10007116 3300025906 Bacteria 5455
241 Ga0207699_10060384 3300025906 Bacteria 2276
242 Ga0207699_10308978 3300025906 Bacteria 1106
243 Ga0207643_10163444 3300025908 Bacteria 1340
244 Ga0207705_10195466 3300025909 Bacteria 1531
245 Ga0207654_10862261 3300025911 Bacteria 656
246 Ga0207707_10157753 3300025912 Bacteria 1984
247 Ga0207707_10340746 3300025912 Bacteria 1292
248 Ga0207707_10752645 3300025912 Bacteria 815
249 Ga0207707_11436219 3300025912 Bacteria 549
250 Ga0207695_10011313 3300025913 Bacteria 10818
251 Ga0207671_10107109 3300025914 Bacteria 2123
252 Ga0207693_10001626 3300025915 Bacteria 19847
253 Ga0207693_10017266 3300025915 Bacteria 5756
254 Ga0207693_10150761 3300025915 Bacteria 1829
255 Ga0207693_10347086 3300025915 Unclassified 1161
256 Ga0207663_10025086 3300025916 Bacteria 3441
257 Ga0207663_10037958 3300025916 Bacteria 2907
258 Ga0207660_10231942 3300025917 Bacteria 1452
259 Ga0207660_10365929 3300025917 Bacteria 1157
260 Ga0207657_10001172 3300025919 Bacteria 27807
261 Ga0207657_10227776 3300025919 Bacteria 1491
262 Ga0207652_10232970 3300025921 Bacteria 1660
263 Ga0207652_10654765 3300025921 Bacteria 939
264 Ga0207652_11102369 3300025921 Bacteria 694
265 Ga0207646_10613578 3300025922 Bacteria 976
266 Ga0207681_10848716 3300025923 Bacteria 764
267 Ga0207694_10128507 3300025924 Bacteria 2029
268 Ga0207659_10225399 3300025926 Bacteria 1509
269 Ga0207687_10106620 3300025927 Bacteria 2072
270 Ga0207687_10108056 3300025927 Bacteria 2059
271 Ga0207687_10183354 3300025927 Bacteria 1623
272 Ga0207687_10469270 3300025927 Bacteria 1046
273 Ga0207687_11062839 3300025927 Bacteria 695
274 Ga0207700_10018023 3300025928 Bacteria 4731
275 Ga0207700_10130618 3300025928 Bacteria 2050
276 Ga0207700_10134606 3300025928 Bacteria 2022
277 Ga0207664_10005865 3300025929 Bacteria 8399
278 Ga0207664_10016617 3300025929 Bacteria 5373
279 Ga0207664_10055511 3300025929 Bacteria 3143
280 Ga0207664_10069815 3300025929 Bacteria 2825
281 Ga0207664_10144708 3300025929 Bacteria 2014
282 Ga0207664_10620506 3300025929 Bacteria 971
283 Ga0207644_10241308 3300025931 Bacteria 1439
284 Ga0207644_10269856 3300025931 Bacteria 1363
285 Ga0207644_10467735 3300025931 Bacteria 1037
286 Ga0207706_10421842 3300025933 Bacteria 1156
287 Ga0207706_10510444 3300025933 Bacteria 1037
288 Ga0207686_10048920 3300025934 Bacteria 2622
289 Ga0207709_10042657 3300025935 Bacteria 2730
290 Ga0207670_11019127 3300025936 Bacteria 697
291 Ga0207704_10387689 3300025938 Bacteria 1099
292 Ga0207704_10693426 3300025938 Bacteria 842
293 Ga0207704_11254096 3300025938 Bacteria 633
294 Ga0207665_10024562 3300025939 Bacteria 3974
295 Ga0207665_10297216 3300025939 Bacteria 1206
296 Ga0207665_10412244 3300025939 Bacteria 1031
297 Ga0207665_10499459 3300025939 Bacteria 939
298 Ga0207665_11234612 3300025939 Bacteria 596
299 Ga0207691_10073098 3300025940 Bacteria 3092
300 Ga0207691_11011857 3300025940 Bacteria 693
301 Ga0207711_10307793 3300025941 Bacteria 1462
302 Ga0207689_10125116 3300025942 Bacteria 2115
303 Ga0207661_10010984 3300025944 Bacteria 6541
304 Ga0207661_11301007 3300025944 Bacteria 668
305 Ga0207679_10094600 3300025945 Bacteria 2320
306 Ga0207679_10140474 3300025945 Bacteria 1952
307 Ga0207667_10155798 3300025949 Bacteria 2351
308 Ga0207667_10403816 3300025949 Bacteria 1391
309 Ga0207651_10898085 3300025960 Unclassified 789
310 Ga0207651_11262318 3300025960 Bacteria 664
311 Ga0207651_12004624 3300025960 Bacteria 520
312 Ga0207668_12080532 3300025972 Bacteria 511
313 Ga0207640_10086461 3300025981 Bacteria 2159
314 Ga0207677_10167202 3300026023 Bacteria 1715
315 Ga0207677_11143427 3300026023 Bacteria 711
316 Ga0207703_10523956 3300026035 Bacteria 1115
317 Ga0207703_11671488 3300026035 Bacteria 612
318 Ga0207708_10643677 3300026075 Unclassified 902
319 Ga0207702_10785682 3300026078 Bacteria 941
320 Ga0207702_10995894 3300026078 Bacteria 831
321 Ga0207641_10111621 3300026088 Bacteria 2425
322 Ga0207641_10811404 3300026088 Bacteria 926
323 Ga0207648_10656375 3300026089 Bacteria 970
324 Ga0207648_11075891 3300026089 Bacteria 754
325 Ga0207676_10683765 3300026095 Bacteria 993
326 Ga0207675_100359663 3300026118 Bacteria 1428
327 Ga0207683_10157773 3300026121 Bacteria 2050
328 Ga0207698_10659500 3300026142 Bacteria 1037
329 Ga0209971_1078601 3300027682 Bacteria 803
330 Ga0207428_10155228 3300027907 Bacteria 1741
331 Ga0207428_10495778 3300027907 Unclassified 887
332 Ga0268266_11338137 3300028379 Bacteria 692
333 Ga0268265_11456006 3300028380 Bacteria 688
334 Ga0265326_10029810 3300028558 Bacteria 1555
335 Ga0265334_10030810 3300028573 Bacteria 2145
336 Ga0265336_10004451 3300028666 Bacteria 5293
337 Ga0265338_10011714 3300028800 Bacteria 10095
338 Ga0265338_10026816 3300028800 Bacteria 5798
339 Ga0265338_10255224 3300028800 Bacteria 1291
340 Ga0265324_10076549 3300029957 Bacteria 1138
341 Ga0265327_10173533 3300031251 Bacteria 989
342 Ga0265316_10615726 3300031344 Unclassified 769
343 Ga0307408_100133893 3300031548 Bacteria 1937
344 Ga0265313_10015960 3300031595 Bacteria 4343
345 Ga0307413_10717980 3300031824 Bacteria 832
346 Ga0307413_10906961 3300031824 Bacteria 749
347 Ga0307413_11193891 3300031824 Bacteria 661
348 Ga0307413_11749456 3300031824 Bacteria 555
349 Ga0307410_11664537 3300031852 Bacteria 565
350 Ga0307407_10575396 3300031903 Bacteria 836
351 Ga0307407_11461607 3300031903 Bacteria 540
352 Ga0307409_100120949 3300031995 Bacteria 2217
353 Ga0307409_100484609 3300031995 Bacteria 1201
354 Ga0307409_100702210 3300031995 Bacteria 1011
355 Ga0307409_100831742 3300031995 Bacteria 933
356 Ga0307409_100948464 3300031995 Bacteria 876
357 Ga0307416_100935322 3300032002 Unclassified 968
358 Ga0307416_101501839 3300032002 Bacteria 779
359 Ga0307416_101744079 3300032002 Bacteria 727
360 Ga0307416_101745106 3300032002 Bacteria 727
361 Ga0307416_103895203 3300032002 Bacteria 500
362 Ga0307411_10694364 3300032005 Bacteria 886
363 Ga0307411_11771550 3300032005 Unclassified 573
364 Ga0307415_102130496 3300032126 Bacteria 548
365 Ga0316593_10150305 3300032168 Bacteria 847
366 Ga0316593_10268019 3300032168 Bacteria 642
367 Ga0373938_0221535 3300034957 Bacteria 531
368 Ga0373926_0424381 3300035083 Bacteria 526
369 Ga0373934_0354053 3300035086 Bacteria 611
370 Ga0373940_0234628 3300035088 Bacteria 614
371 Ga0373944_0005337 3300035089 Bacteria 3381
372 Ga0373949_0152676 3300035090 Bacteria 669
373 Ga0373949_0286875 3300035090 Unclassified 519
374 Ga0373951_0089622 3300035091 Bacteria 806
375 Ga0373923_0208491 3300035111 Bacteria 905
376 Ga0373939_0010566 3300035114 Bacteria 2312
377 Ga0373939_0028882 3300035114 Bacteria 1582
378 Ga0373941_0201910 3300035115 Bacteria 756
379 Ga0373941_0441597 3300035115 Bacteria 545
380 Ga0373945_0003284 3300035116 Bacteria 5073
381 Ga0373953_0308466 3300035117 Bacteria 691
382 Ga0373956_0192401 3300035119 Unclassified 966
383 Ga0373960_0032084 3300035121 Bacteria 1474
384 Ga0373960_0299965 3300035121 Bacteria 597
385 Ga0373943_0015576 3300035170 Bacteria 3456
386 Ga0373946_0037702 3300035171 Bacteria 1966
387 Ga0373955_0229495 3300035172 Bacteria 1110
388 Ga0373942_0149928 3300035207 Bacteria 748
389 Ga0373962_0072283 3300035242 Bacteria 1033
390 Ga0373962_0271955 3300035242 Unclassified 594
391 Ga0373924_0040697 3300035410 Bacteria 1903
392 Ga0373924_0363867 3300035410 Unclassified 645
393 Ga0373931_0046837 3300035691 Bacteria 2287
394 Ga0373931_1165938 3300035691 Bacteria 526
395 Ga0373935_0008543 3300035692 Bacteria 6131
396 Ga0373933_0814604 3300035724 Unclassified 614
397 Ga0373933_0852239 3300035724 Bacteria 600
398 Ga0373947_0063830 3300035725 Bacteria 2244
399 Ga0373937_0018152 3300036401 Bacteria 6276
400 Ga0373937_0090109 3300036401 Bacteria 2840
401 Ga0373937_0365295 3300036401 Bacteria 1368
402 Ga0373925_0106104 3300037068 Bacteria 2165
403 Ga0373925_0971730 3300037068 Bacteria 700
404 Ga0395899_0009988 3300037312 Bacteria 7280
405 Ga0395899_0893938 3300037312 Bacteria 542
406 Ga0395900_0020924 3300037418 Bacteria 6685
407 Ga0395900_0444637 3300037418 Bacteria 1253
408 Ga0395898_0105139 3300037466 Bacteria 2707
409 Ga0395898_0291577 3300037466 Bacteria 1556
410 Ga0395898_0400369 3300037466 Bacteria 1309
411 Ga0395898_0634226 3300037466 Bacteria 1011
412 Ga0395905_0128781 3300037471 Bacteria 2380
413 Ga0395905_1378417 3300037471 Bacteria 609
414 Ga0395901_0060212 3300038443 Bacteria 3950
415 Ga0395901_0390962 3300038443 Bacteria 1430
416 Ga0395901_1542327 3300038443 Bacteria 619
417 Ga0436365_1683679 3300039437 Bacteria 829
418 Ga0436363_1379579 3300039450 Bacteria 1398
419 Ga0436363_1452544 3300039450 Bacteria 759
420 Ga0439436_0078138 3300041404 Bacteria 922
421 Ga0439438_022461 3300041405 Bacteria 1749
422 Ga0439453_0169369 3300041408 Unclassified 527
423 Ga0439461_0012464 3300041410 Bacteria 1592
424 Ga0439461_0117805 3300041410 Bacteria 661
425 Ga0439466_0132485 3300041411 Bacteria 767
426 Ga0451789_0212464 3300041443 Bacteria 674
427 Ga0439431_0041721 3300041997 Bacteria 1171
428 Ga0439445_0077202 3300042004 Bacteria 928
429 Ga0439454_087254 3300042011 Bacteria 573
430 Ga0439456_020324 3300042013 Bacteria 1401
431 Ga0439462_0044105 3300042015 Bacteria 1193
432 Ga0450923_077999 3300042125 Bacteria 742
433 Ga0450890_037123 3300042127 Unclassified 711
434 Ga0450891_016117 3300042129 Unclassified 712
435 Ga0450905_017378 3300042142 Bacteria 1043
436 Ga0450910_072723 3300042147 Bacteria 593
437 Ga0450910_087656 3300042147 Bacteria 549
438 Ga0439446_0005728 3300042156 Bacteria 3208
439 Ga0450909_045503 3300042185 Bacteria 680
440 Ga0439435_0260372 3300042436 Unclassified 586
441 Ga0439459_0040837 3300042438 Bacteria 985
442 Ga0451577_1027297 3300042876 Bacteria 740
443 Ga0466969_0026994 3300044656 Bacteria 2942
444 Ga0466969_0031342 3300044656 Bacteria 2706
445 Ga0466972_0014839 3300044658 Bacteria 3899
446 Ga0466965_0010775 3300044683 Bacteria 4277
447 Ga0466965_0105435 3300044683 Bacteria 1445
448 Ga0466965_0608364 3300044683 Bacteria 621
449 Ga0466966_0092816 3300044684 Bacteria 1872
450 Ga0466966_0132892 3300044684 Bacteria 1523
451 Ga0466961_0020602 3300044693 Bacteria 4244
452 Ga0466961_0048982 3300044693 Bacteria 2701
453 Ga0466961_0056553 3300044693 Bacteria 2500
454 Ga0466961_0127674 3300044693 Bacteria 1594
455 Ga0466961_0186151 3300044693 Bacteria 1288
456 Ga0466961_0187581 3300044693 Bacteria 1282
457 Ga0466961_0804411 3300044693 Bacteria 561
458 Ga0466963_0000118 3300044694 Bacteria 29387
459 Ga0466963_0002499 3300044694 Bacteria 10291
460 Ga0466963_0003979 3300044694 Bacteria 8544
461 Ga0466963_0004071 3300044694 Bacteria 8456
462 Ga0466963_0005177 3300044694 Bacteria 7613
463 Ga0466963_0012606 3300044694 Bacteria 5178
464 Ga0466963_0016631 3300044694 Bacteria 4576
465 Ga0466963_0023771 3300044694 Bacteria 3896
466 Ga0466963_0030926 3300044694 Bacteria 3457
467 Ga0466963_0040505 3300044694 Bacteria 3053
468 Ga0466963_0089158 3300044694 Bacteria 2098
469 Ga0466963_0299156 3300044694 Bacteria 1131
470 Ga0466963_0348102 3300044694 Bacteria 1043
471 Ga0466964_0004607 3300044706 Bacteria 5097
472 Ga0466964_0060975 3300044706 Bacteria 1570
473 Ga0466964_0093894 3300044706 Bacteria 1310
474 Ga0466964_0102831 3300044706 Bacteria 1262
475 Ga0466964_0103121 3300044706 Bacteria 1260
476 Ga0466964_0165291 3300044706 Bacteria 1037
477 Ga0466964_0270068 3300044706 Bacteria 846
478 Ga0466964_0875143 3300044706 Bacteria 512
479 Ga0453684_0891964 3300044712 Bacteria 953
480 Ga0466971_0000713 3300044719 Bacteria 13307
481 Ga0466971_0008839 3300044719 Bacteria 4398
482 Ga0466971_0032000 3300044719 Bacteria 2356
483 Ga0466971_0036573 3300044719 Bacteria 2202
484 Ga0466971_0048051 3300044719 Bacteria 1918
485 Ga0466968_0000530 3300044735 Bacteria 12949
486 Ga0466968_0003236 3300044735 Bacteria 6005
487 Ga0466968_0029539 3300044735 Bacteria 2267
488 Ga0466968_0081497 3300044735 Bacteria 1422
489 Ga0466970_0096285 3300044765 Bacteria 1609
490 Ga0466970_0338633 3300044765 Bacteria 852
491 Ga0466957_0004414 3300044842 Bacteria 7831
492 Ga0466957_0012200 3300044842 Bacteria 4973
493 Ga0466957_0050698 3300044842 Bacteria 2525
494 Ga0466957_0097236 3300044842 Bacteria 1851
495 Ga0466957_0106005 3300044842 Bacteria 1777
496 Ga0466957_0133717 3300044842 Bacteria 1592
497 Ga0466957_0201769 3300044842 Bacteria 1306
498 Ga0466957_0226169 3300044842 Bacteria 1237
499 Ga0466957_0233322 3300044842 Bacteria 1219
500 Ga0466960_0010158 3300044901 Bacteria 3904
501 Ga0466960_0012809 3300044901 Bacteria 3549
502 Ga0466960_0112428 3300044901 Bacteria 1417
503 Ga0466959_0012465 3300045049 Bacteria 6143
504 Ga0466959_0026888 3300045049 Bacteria 4267
505 Ga0466959_0038032 3300045049 Bacteria 3556
506 Ga0466959_0101050 3300045049 Bacteria 2064
507 Ga0466959_0304035 3300045049 Bacteria 1092
508 Ga0466958_0000495 3300045836 Bacteria 16502
509 Ga0466958_0002659 3300045836 Bacteria 9035
510 Ga0466958_0008925 3300045836 Bacteria 5570
511 Ga0466958_0016750 3300045836 Bacteria 4225
512 Ga0466958_0016911 3300045836 Bacteria 4208
513 Ga0466958_0038580 3300045836 Bacteria 2866
514 Ga0466958_0108168 3300045836 Bacteria 1734
515 Ga0466958_0443338 3300045836 Bacteria 840
516 Ga0466958_0732575 3300045836 Bacteria 644
517 Ga0466967_0005677 3300045976 Bacteria 8696
518 Ga0466967_0009665 3300045976 Bacteria 7174
519 Ga0466967_0021933 3300045976 Bacteria 5198
520 Ga0466967_0026507 3300045976 Bacteria 4802
521 Ga0466967_0029955 3300045976 Bacteria 4561
522 Ga0466967_0039231 3300045976 Bacteria 4069
523 Ga0466967_0063816 3300045976 Bacteria 3274
524 Ga0466967_0165771 3300045976 Bacteria 2076
525 Ga0466967_0194467 3300045976 Bacteria 1918
526 Ga0466967_0247906 3300045976 Bacteria 1700
527 Ga0466967_0291290 3300045976 Bacteria 1568
528 Ga0466967_0388260 3300045976 Bacteria 1356
529 Ga0466967_1313196 3300045976 Bacteria 720
530 Ga0466967_2056931 3300045976 Bacteria 567
531 Ga0466967_2538193 3300045976 Bacteria 507
532 Ga0495627_125876 3300046453 Bacteria 722
533 Ga0495592_0000125 3300046454 Bacteria 68045
534 Ga0495592_0005522 3300046454 Bacteria 9351
535 Ga0495592_0134964 3300046454 Bacteria 1722
536 Ga0495592_0507505 3300046454 Bacteria 747
537 Ga0495603_0015063 3300046455 Bacteria 4675
538 Ga0495603_0876958 3300046455 Unclassified 510
539 Ga0495591_154336 3300046458 Bacteria 551
540 Ga0495629_0348451 3300046459 Bacteria 1010
541 Ga0495629_1092382 3300046459 Unclassified 516
542 Ga0495641_0002166 3300046461 Bacteria 15735
543 Ga0495641_0019667 3300046461 Bacteria 3447
544 Ga0495641_0063276 3300046461 Bacteria 1668
545 Ga0495641_0198761 3300046461 Bacteria 898
546 Ga0495641_0277427 3300046461 Bacteria 754
547 Ga0495651_0000011 3300046462 Bacteria 147193
548 Ga0495651_0053221 3300046462 Bacteria 3117
549 Ga0495651_0053601 3300046462 Bacteria 3104
550 Ga0495653_0005067 3300046463 Bacteria 10691
551 Ga0495653_0007515 3300046463 Bacteria 8913
552 Ga0495653_0109332 3300046463 Bacteria 1989
553 Ga0495653_0228669 3300046463 Bacteria 1246
554 Ga0495653_0292154 3300046463 Bacteria 1066
555 Ga0495580_0026301 3300046472 Bacteria 4244
556 Ga0495582_0049302 3300046473 Bacteria 2318
557 Ga0495582_0066542 3300046473 Bacteria 1991
558 Ga0495582_0173848 3300046473 Bacteria 1226
559 Ga0495582_0346567 3300046473 Bacteria 855
560 Ga0495582_0414982 3300046473 Bacteria 776
561 Ga0495605_0229012 3300046474 Bacteria 801
562 Ga0495605_0369641 3300046474 Bacteria 599
563 Ga0495639_0002434 3300046475 Bacteria 8127
564 Ga0495662_0040226 3300046476 Bacteria 2257
565 Ga0495662_0294875 3300046476 Bacteria 798
566 Ga0495664_0066647 3300046477 Bacteria 2147
567 Ga0495664_0570473 3300046477 Bacteria 673
568 Ga0495664_0798566 3300046477 Bacteria 555
569 Ga0495584_0153293 3300046491 Bacteria 1171
570 Ga0495584_0199027 3300046491 Bacteria 1018
571 Ga0495584_0463026 3300046491 Bacteria 645
572 Ga0495584_0493230 3300046491 Bacteria 624
573 Ga0495585_0261347 3300046492 Bacteria 861
574 Ga0495594_0195783 3300046499 Bacteria 1152
575 Ga0495607_0008218 3300046501 Bacteria 7142
576 Ga0495607_0402215 3300046501 Unclassified 623
577 Ga0495608_0031190 3300046511 Bacteria 3605
578 Ga0495608_0067051 3300046511 Bacteria 2348
579 Ga0495608_0116995 3300046511 Bacteria 1710
580 Ga0495608_0143686 3300046511 Bacteria 1522
581 Ga0495608_0301873 3300046511 Bacteria 991
582 Ga0495608_0403909 3300046511 Bacteria 835
583 Ga0495608_0562881 3300046511 Bacteria 686
584 Ga0495608_0802511 3300046511 Bacteria 555
585 Ga0495618_0007063 3300046514 Bacteria 6792
586 Ga0495618_0083273 3300046514 Bacteria 2043
587 Ga0495618_0425776 3300046514 Bacteria 809
588 Ga0495618_0919265 3300046514 Bacteria 504
589 Ga0495628_0000040 3300046516 Bacteria 104506
590 Ga0495628_0164627 3300046516 Bacteria 1684
591 Ga0495628_0680174 3300046516 Bacteria 728
592 Ga0495628_0943723 3300046516 Bacteria 596
593 Ga0495630_0024760 3300046517 Bacteria 4436
594 Ga0495630_0215508 3300046517 Bacteria 1465
595 Ga0495631_0150953 3300046518 Bacteria 997
596 Ga0495631_0177932 3300046518 Bacteria 912
597 Ga0495637_0170544 3300046520 Bacteria 812
598 Ga0495644_0001368 3300046523 Bacteria 9959
599 Ga0495663_0092716 3300046525 Bacteria 986
600 Ga0495663_0361747 3300046525 Archaea 530
601 Ga0495666_0004106 3300046526 Bacteria 7353
602 Ga0495652_0000299 3300046529 Bacteria 58948
603 Ga0495652_0011344 3300046529 Bacteria 8058
604 Ga0495652_0025357 3300046529 Bacteria 5246
605 Ga0495652_0089135 3300046529 Bacteria 2526
606 Ga0495665_0010827 3300046531 Bacteria 4934
607 Ga0495640_0025758 3300046533 Bacteria 4260
608 Ga0495640_0222963 3300046533 Bacteria 1188
609 Ga0495640_0954950 3300046533 Bacteria 506
610 Ga0495586_0075959 3300046535 Bacteria 1840
611 Ga0495586_0106582 3300046535 Bacteria 1558
612 Ga0495586_0160344 3300046535 Bacteria 1268
613 Ga0495586_0259856 3300046535 Bacteria 991
614 Ga0495587_0000212 3300046536 Bacteria 43340
615 Ga0495587_0007700 3300046536 Bacteria 6969
616 Ga0495587_0245118 3300046536 Bacteria 1008
617 Ga0495598_0290964 3300046537 Bacteria 616
618 Ga0495609_0093411 3300046538 Bacteria 1307
619 Ga0495645_0000035 3300046543 Bacteria 102305
620 Ga0495645_0160431 3300046543 Bacteria 1555
621 Ga0495645_0248753 3300046543 Bacteria 1182
622 Ga0495645_0300131 3300046543 Bacteria 1049
623 Ga0495645_0652807 3300046543 Bacteria 642
624 Ga0495633_0311268 3300046558 Unclassified 715
625 Ga0495667_0071245 3300046559 Bacteria 2267
626 Ga0495667_0258736 3300046559 Bacteria 1107
627 Ga0495667_0275518 3300046559 Unclassified 1068
628 Ga0495667_0918867 3300046559 Bacteria 536
629 Ga0495656_0002084 3300046615 Bacteria 6601
630 Ga0495656_0266797 3300046615 Bacteria 869
631 Ga0495656_0823090 3300046615 Unclassified 502
632 Ga0495634_0008657 3300046642 Bacteria 7550
633 Ga0495634_0089487 3300046642 Bacteria 2001
634 Ga0495634_0134086 3300046642 Bacteria 1576
635 Ga0495611_0006116 3300046648 Bacteria 5135
636 Ga0495635_0016143 3300046663 Bacteria 5214
637 Ga0495635_0157134 3300046663 Bacteria 1547
638 Ga0495635_0640030 3300046663 Bacteria 692
639 Ga0495659_0002432 3300046664 Bacteria 6010
640 Ga0495657_0018821 3300046675 Bacteria 4991
641 Ga0495657_0080116 3300046675 Bacteria 2114
642 Ga0495657_0503046 3300046675 Bacteria 706
643 Ga0495657_0749995 3300046675 Bacteria 559
644 Ga0495599_0000009 3300046678 Bacteria 217299
645 Ga0495599_0370391 3300046678 Bacteria 856
646 Ga0495599_0439454 3300046678 Bacteria 773
647 Ga0495623_0002770 3300046679 Bacteria 11583
648 Ga0495623_0099293 3300046679 Bacteria 1775
649 Ga0495646_0004330 3300046680 Bacteria 8944
650 Ga0495646_0036960 3300046680 Bacteria 3023
651 Ga0495646_0185068 3300046680 Bacteria 1141
652 Ga0495646_0356241 3300046680 Bacteria 766
653 Ga0495647_0013798 3300046681 Bacteria 2806
654 Ga0495647_0024108 3300046681 Bacteria 2213
655 Ga0495647_0079293 3300046681 Bacteria 1329
656 Ga0495658_0058045 3300046683 Bacteria 2212
657 Ga0495658_0189684 3300046683 Bacteria 1277
658 Ga0495658_0194873 3300046683 Unclassified 1261
659 Ga0495658_0268558 3300046683 Bacteria 1075
660 Ga0495658_0960498 3300046683 Bacteria 546
661 Ga0495613_0072321 3300046689 Bacteria 2513
662 Ga0495613_0077722 3300046689 Bacteria 2414
663 Ga0495613_0130762 3300046689 Bacteria 1798
664 Ga0495613_0719236 3300046689 Bacteria 656
665 Ga0495613_0810412 3300046689 Bacteria 610
666 Ga0495624_0018533 3300046690 Bacteria 4655
667 Ga0495624_0397280 3300046690 Bacteria 828
668 Ga0495670_0111130 3300046691 Bacteria 1418
669 Ga0495670_0408487 3300046691 Bacteria 734
670 Ga0495649_0669616 3300046694 Bacteria 510
671 Ga0495589_0211995 3300046794 Bacteria 912
672 Ga0495600_0045430 3300046809 Bacteria 2866
673 Ga0495600_0092060 3300046809 Bacteria 1977
674 Ga0495600_0957845 3300046809 Bacteria 502
675 Ga0495581_0003407 3300047315 Bacteria 9134
676 Ga0495604_0000847 3300047317 Bacteria 25539
677 Ga0495604_0768930 3300047317 Bacteria 608
678 Ga0495636_0047163 3300047318 Bacteria 1799
679 Ga0495636_0331618 3300047318 Bacteria 716
680 Ga0495674_0061607 3300047319 Bacteria 3269
681 Ga0495674_0091709 3300047319 Bacteria 2594
682 Ga0495674_1043620 3300047319 Bacteria 625
683 Ga0495674_1224110 3300047319 Bacteria 566
684 Ga0495676_0039058 3300047321 Bacteria 3935
685 Ga0495676_0202175 3300047321 Bacteria 1380
686 Ga0495676_0519851 3300047321 Bacteria 780
687 Ga0495680_0022970 3300047322 Bacteria 5191
688 Ga0495680_0070522 3300047322 Bacteria 2664
689 Ga0495680_0118073 3300047322 Bacteria 1960
690 Ga0495680_0672712 3300047322 Bacteria 686
691 Ga0495687_246340 3300047443 Bacteria 536
692 Ga0495675_0000137 3300047444 Bacteria 50947
693 Ga0495675_0547176 3300047444 Bacteria 660
694 Ga0495677_0059240 3300047445 Bacteria 1418
695 Ga0495677_0110870 3300047445 Bacteria 1043
696 Ga0495681_0214812 3300047470 Bacteria 774
697 Ga0495684_0012535 3300047471 Bacteria 6534
698 Ga0495684_0103183 3300047471 Bacteria 2155
699 Ga0495684_0103727 3300047471 Bacteria 2149
700 Ga0495684_0244517 3300047471 Bacteria 1307
701 Ga0495684_0349069 3300047471 Bacteria 1051
702 Ga0495593_0008432 3300047673 Bacteria 5994
703 Ga0495602_0000733 3300048088 Bacteria 30967
704 Ga0495602_0235592 3300048088 Bacteria 1372
705 Ga0495602_0273539 3300048088 Bacteria 1247
706 Ga0495602_1067430 3300048088 Bacteria 530
707 Ga0495614_0004562 3300048089 Bacteria 6243
708 Ga0496100_0004812 3300048903 Bacteria 7210
709 Ga0496100_0148947 3300048903 Bacteria 1667
710 Ga0496100_0230211 3300048903 Bacteria 1363
711 Ga0496100_1084410 3300048903 Bacteria 631
712 Ga0496101_0159475 3300048904 Bacteria 1729
713 Ga0496101_0171204 3300048904 Bacteria 1669
714 Ga0496101_0599646 3300048904 Bacteria 871
715 Ga0496101_0648279 3300048904 Unclassified 834
716 Ga0496101_1280793 3300048904 Bacteria 573
717 Ga0496102_0001719 3300048905 Bacteria 19153
718 Ga0496102_0080567 3300048905 Bacteria 2999
719 Ga0496102_0126509 3300048905 Bacteria 2389
720 Ga0496102_0283621 3300048905 Bacteria 1561
721 Ga0496103_0080194 3300048906 Bacteria 2052
722 Ga0496103_0148716 3300048906 Bacteria 1500
723 Ga0496103_0271787 3300048906 Bacteria 1090
724 Ga0496103_0370795 3300048906 Bacteria 920
725 Ga0496103_0450129 3300048906 Bacteria 826
726 Ga0496104_0023791 3300048907 Bacteria 5633
727 Ga0496104_0095175 3300048907 Bacteria 2849
728 Ga0496104_0151405 3300048907 Bacteria 2226
729 Ga0496104_0466344 3300048907 Bacteria 1174
730 Ga0496104_0879008 3300048907 Bacteria 801
731 Ga0496104_0926232 3300048907 Bacteria 776
732 Ga0496104_1152905 3300048907 Bacteria 678
733 Ga0496105_0219865 3300048908 Bacteria 1546
734 Ga0496105_0320689 3300048908 Bacteria 1242
735 Ga0496106_0029860 3300048909 Bacteria 4063
736 Ga0496106_0065555 3300048909 Bacteria 2765
737 Ga0496106_0320136 3300048909 Bacteria 1245
738 Ga0496106_0372097 3300048909 Bacteria 1148
739 Ga0496106_0813229 3300048909 Bacteria 741
740 Ga0496106_0937594 3300048909 Bacteria 682
741 Ga0496107_0003518 3300048910 Bacteria 10486
742 Ga0496107_0080303 3300048910 Bacteria 2378
743 Ga0496107_0494864 3300048910 Bacteria 907
744 Ga0496107_0541779 3300048910 Bacteria 862
745 Ga0496107_0850685 3300048910 Unclassified 666
746 Ga0496108_0003564 3300048911 Bacteria 12475
747 Ga0496108_0077630 3300048911 Bacteria 2809
748 Ga0496108_0786651 3300048911 Bacteria 821
749 Ga0496108_1289988 3300048911 Bacteria 614
750 Ga0496109_0031188 3300048912 Bacteria 4781
751 Ga0496109_0089590 3300048912 Bacteria 2844
752 Ga0496109_0125045 3300048912 Bacteria 2397
753 Ga0496109_0138280 3300048912 Bacteria 2277
754 Ga0496109_0401832 3300048912 Bacteria 1294
755 Ga0496109_0789332 3300048912 Bacteria 888
756 Ga0496109_1220479 3300048912 Bacteria 688
757 Ga0496109_1780814 3300048912 Bacteria 549
758 Ga0496110_0052783 3300048913 Bacteria 3572
759 Ga0496110_0130099 3300048913 Bacteria 2272
760 Ga0496110_0258038 3300048913 Bacteria 1586
761 Ga0496111_0005894 3300048914 Bacteria 7902
762 Ga0496111_0027142 3300048914 Bacteria 4048
763 Ga0496111_0083665 3300048914 Bacteria 2332
764 Ga0496111_0091086 3300048914 Bacteria 2234
765 Ga0496111_0229057 3300048914 Bacteria 1380
766 Ga0496111_0817705 3300048914 Bacteria 674
767 Ga0496112_0005957 3300048915 Bacteria 10635
768 Ga0496112_0163212 3300048915 Bacteria 2194
769 Ga0496112_0310217 3300048915 Bacteria 1523
770 Ga0496112_0386318 3300048915 Bacteria 1340
771 Ga0496112_0396007 3300048915 Bacteria 1321
772 Ga0496112_0443895 3300048915 Bacteria 1235
773 Ga0496113_0086292 3300048916 Bacteria 2411
774 Ga0496113_0198838 3300048916 Bacteria 1593
775 Ga0496113_1053132 3300048916 Bacteria 639
776 Ga0496113_1221452 3300048916 Bacteria 586
777 Ga0496113_1451091 3300048916 Bacteria 530
778 Ga0496114_0011420 3300048917 Bacteria 7097
779 Ga0496114_0244124 3300048917 Bacteria 1579
780 Ga0496114_0328723 3300048917 Bacteria 1351
781 Ga0496114_0547627 3300048917 Bacteria 1022
782 Ga0496115_0003592 3300048918 Bacteria 11145
783 Ga0496115_0474854 3300048918 Bacteria 1007
784 Ga0496115_0746191 3300048918 Bacteria 766
785 Ga0496115_1014588 3300048918 Bacteria 633
786 Ga0501299_072641 3300049522 Bacteria 750
787 Ga0501031_0001067 3300049568 Bacteria 16637
788 Ga0501031_0376422 3300049568 Bacteria 919
789 Ga0501033_0049052 3300049570 Bacteria 3135
790 Ga0501036_0088574 3300049572 Bacteria 2616
791 Ga0501036_0780104 3300049572 Bacteria 788
792 Ga0501036_1080826 3300049572 Bacteria 656
793 Ga0501037_0207896 3300049573 Bacteria 1381
794 Ga0501038_0016739 3300049574 Bacteria 6641
795 Ga0501038_0585211 3300049574 Bacteria 846
796 Ga0501039_0019894 3300049575 Bacteria 5145
797 Ga0501040_0011907 3300049576 Bacteria 5690
798 Ga0501040_0135597 3300049576 Bacteria 1733
799 Ga0501040_0259456 3300049576 Bacteria 1240
800 Ga0501040_0527902 3300049576 Bacteria 851
801 Ga0501040_0792006 3300049576 Bacteria 686
802 Ga0501040_0846995 3300049576 Bacteria 662
803 Ga0501041_0013469 3300049577 Bacteria 4848
804 Ga0501041_0166991 3300049577 Bacteria 1377
805 Ga0501041_0405148 3300049577 Bacteria 864
806 Ga0501042_0021290 3300049578 Bacteria 4516
807 Ga0501042_0077759 3300049578 Bacteria 2376
808 Ga0501042_0606751 3300049578 Bacteria 796
809 Ga0501043_0017822 3300049579 Bacteria 5567
810 Ga0501043_0445460 3300049579 Bacteria 974
811 Ga0501047_1153841 3300049581 Bacteria 588
812 Ga0501047_1171040 3300049581 Bacteria 582
813 Ga0501048_0003924 3300049582 Bacteria 11299
814 Ga0501048_0455262 3300049582 Bacteria 917
815 Ga0501048_0477212 3300049582 Bacteria 894
816 Ga0501067_0067585 3300049583 Bacteria 1979
817 Ga0501067_0113289 3300049583 Unclassified 1508
818 Ga0501067_0349865 3300049583 Unclassified 824
819 Ga0501067_0897735 3300049583 Bacteria 500
820 Ga0501068_0105560 3300049584 Bacteria 1748
821 Ga0501069_0074742 3300049585 Bacteria 1902
822 Ga0501070_0030372 3300049586 Bacteria 4528
823 Ga0501070_1223207 3300049586 Bacteria 576
824 Ga0501071_0029040 3300049587 Bacteria 3900
825 Ga0501071_0949584 3300049587 Bacteria 664
826 Ga0501072_0008312 3300049588 Bacteria 7883
827 Ga0501072_0374638 3300049588 Bacteria 1130
828 Ga0501072_1527058 3300049588 Bacteria 515
829 Ga0501072_1550132 3300049588 Bacteria 511
830 Ga0501073_0152043 3300049589 Bacteria 1604
831 Ga0501074_0006779 3300049590 Bacteria 8267
832 Ga0501074_0942084 3300049590 Bacteria 607
833 Ga0501074_1075677 3300049590 Bacteria 565
834 Ga0501075_0334210 3300049591 Bacteria 1154
835 Ga0501075_0411238 3300049591 Bacteria 1031
836 Ga0501075_0480364 3300049591 Bacteria 948
837 Ga0501075_1383773 3300049591 Bacteria 533
838 Ga0501075_1384112 3300049591 Unclassified 533
839 Ga0501076_0013821 3300049592 Bacteria 6059
840 Ga0501076_0145007 3300049592 Bacteria 1930
841 Ga0501077_0007451 3300049593 Bacteria 6750
842 Ga0501077_0008854 3300049593 Bacteria 6245
843 Ga0501077_0073551 3300049593 Bacteria 2165
844 Ga0501077_0403495 3300049593 Unclassified 874
845 Ga0501079_0005553 3300049741 Bacteria 9405
846 Ga0501079_0144867 3300049741 Bacteria 1851
847 Ga0501079_1132473 3300049741 Bacteria 616
848 Ga0501080_0069088 3300049742 Bacteria 3285
849 Ga0501080_0818719 3300049742 Bacteria 816
850 Ga0501081_0022634 3300049743 Bacteria 4206
851 Ga0501081_0023948 3300049743 Bacteria 4096
852 Ga0501081_0827342 3300049743 Bacteria 697
853 Ga0501081_0875377 3300049743 Unclassified 677
854 Ga0501083_0197294 3300049744 Bacteria 1313
855 Ga0501035_0099401 3300049822 Bacteria 2554
856 Ga0501035_1073312 3300049822 Unclassified 630
857 Ga0501044_0447798 3300049823 Bacteria 1198
858 Ga0501045_0007617 3300049824 Bacteria 7525
859 Ga0501045_0487089 3300049824 Bacteria 916
860 Ga0501045_0640857 3300049824 Bacteria 786
861 Ga0501045_0740308 3300049824 Unclassified 725
862 Ga0501045_0807452 3300049824 Bacteria 691
863 Ga0501045_0970651 3300049824 Bacteria 623
864 nmdc:mga05p37_1364991_c1 3300050507 Bacteria 717
865 nmdc:mga05p37_1463306_c1 3300050507 Bacteria 683
866 nmdc:mga05p37_1807082_c1 3300050507 Bacteria 589
867 nmdc:mga05p37_41768_c1 3300050507 Bacteria 5631
868 nmdc:mga05p37_58255_c1 3300050507 Bacteria 3725
869 nmdc:mga05p37_994354_c1 3300050507 Bacteria 892
870 nmdc:mga09592_290734_c1 3300050508 Bacteria 1417
871 nmdc:mga0qj67_663541_c1 3300050509 Bacteria 831
872 nmdc:mga06r32_306332_c1 3300050510 Bacteria 1574
873 nmdc:mga08y16_187104_c1 3300050511 Bacteria 2148
874 nmdc:mga08y16_809306_c1 3300050511 Bacteria 929
875 nmdc:mga0n895_331074_c1 3300050512 Bacteria 1543
876 nmdc:mga0n895_513995_c1 3300050512 Bacteria 1206
877 nmdc:mga0n895_516161_c1 3300050512 Bacteria 1203
878 nmdc:mga0n895_581640_c1 3300050512 Bacteria 1123
879 nmdc:mga0rr50_1642956_c1 3300050513 Unclassified 542
880 nmdc:mga0rr50_662144_c1 3300050513 Bacteria 891
881 nmdc:mga08x19_1079139_c1 3300050514 Bacteria 570
882 nmdc:mga08x19_279209_c1 3300050514 Bacteria 1157
883 nmdc:mga08x19_44535_c1 3300050514 Bacteria 2833
884 nmdc:mga0a205_298849_c1 3300050515 Bacteria 1483
885 nmdc:mga0a205_461435_c1 3300050515 Bacteria 1130
886 nmdc:mga0a205_937546_c1 3300050515 Bacteria 712
887 Ga0495601_0002178 3300053077 Bacteria 11028
888 Ga0495601_0004792 3300053077 Bacteria 7843
889 Ga0495601_0011903 3300053077 Bacteria 5214
890 Ga0495601_0171877 3300053077 Bacteria 1416
891 Ga0495601_0495633 3300053077 Bacteria 788
892 Ga0495601_1036890 3300053077 Bacteria 515
893 Ga0495612_0023169 3300053078 Bacteria 2490
894 Ga0495612_0141548 3300053078 Bacteria 1043
895 Ga0495612_0199973 3300053078 Bacteria 881
896 Ga0495655_0109583 3300053083 Bacteria 828
897 Ga0495595_0116044 3300053084 Bacteria 1301
898 Ga0495619_0018551 3300053085 Bacteria 4414
899 Ga0495619_0177702 3300053085 Bacteria 1472
900 Ga0495619_0270515 3300053085 Bacteria 1177
901 Ga0495619_0304755 3300053085 Bacteria 1103
902 Ga0495619_0588705 3300053085 Bacteria 761
903 Ga0500566_0029077 3300053094 Bacteria 3229
904 Ga0501084_0237553 3300054114 Bacteria 1538
905 Ga0501084_0276622 3300054114 Bacteria 1417
906 Ga0501084_0904838 3300054114 Bacteria 742
907 Ga0501084_1068688 3300054114 Bacteria 678
908 Ga0590075_057663 3300059424 Bacteria 1000
909 Ga0590077_032479 3300059426 Bacteria 1144
910 Ga0501082_0030156 3300060353 Bacteria 4674
911 Ga0501082_0292369 3300060353 Bacteria 1418
912 Ga0501082_0703213 3300060353 Bacteria 885
913 Ga0501082_1069839 3300060353 Bacteria 705
914 Ga0501082_1171893 3300060353 Bacteria 672
915 Ga0466962_0003630 3300061719 Bacteria 7359
916 Ga0466962_0006235 3300061719 Bacteria 5727
917 Ga0466962_0007473 3300061719 Bacteria 5244
918 Ga0466962_0019218 3300061719 Bacteria 3281
919 Ga0466962_0076362 3300061719 Bacteria 1601
920 Ga0466962_0081564 3300061719 Bacteria 1547
921 Ga0466962_0458445 3300061719 Bacteria 642
922 Ga0530510_0036177 3300061734 Bacteria 3558
923 Ga0530510_0205028 3300061734 Bacteria 1465
924 Ga0530510_0489425 3300061734 Bacteria 932
925 Ga0530510_0555156 3300061734 Bacteria 872
926 Ga0530510_1042104 3300061734 Bacteria 626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10487220 Ga0070717_104872202 66
2 3300046454 Ga0495592_0005522 Ga0495592_0005522_1568_1801 66
3 3300046462 Ga0495651_0053221 Ga0495651_0053221_1543_1776 66
4 3300046463 Ga0495653_0007515 Ga0495653_0007515_7907_8140 66
5 3300046511 Ga0495608_0143686 Ga0495608_0143686_72_305 66
6 3300046511 Ga0495608_0802511 Ga0495608_0802511_127_360 66
7 3300046529 Ga0495652_0011344 Ga0495652_0011344_6981_7214 66
8 3300046533 Ga0495640_0954950 Ga0495640_0954950_259_492 66
9 3300046536 Ga0495587_0007700 Ga0495587_0007700_76_309 66
10 3300046543 Ga0495645_0300131 Ga0495645_0300131_740_973 66
11 3300046543 Ga0495645_0652807 Ga0495645_0652807_267_500 66
12 3300046559 Ga0495667_0918867 Ga0495667_0918867_47_280 66
13 3300046663 Ga0495635_0016143 Ga0495635_0016143_149_382 66
14 3300046675 Ga0495657_0080116 Ga0495657_0080116_1743_1976 66
15 3300046675 Ga0495657_0503046 Ga0495657_0503046_152_385 66
16 3300046678 Ga0495599_0439454 Ga0495599_0439454_501_734 66
17 3300046679 Ga0495623_0099293 Ga0495623_0099293_1478_1711 66
18 3300046680 Ga0495646_0185068 Ga0495646_0185068_633_866 66
19 3300046809 Ga0495600_0092060 Ga0495600_0092060_730_963 66
20 3300047319 Ga0495674_0061607 Ga0495674_0061607_2972_3205 66
21 3300047322 Ga0495680_0070522 Ga0495680_0070522_1600_1833 66
22 3300047444 Ga0495675_0547176 Ga0495675_0547176_352_585 66
23 3300047471 Ga0495684_0103727 Ga0495684_0103727_163_396 66
24 3300048088 Ga0495602_0273539 Ga0495602_0273539_950_1183 66
25 3300053077 Ga0495601_0004792 Ga0495601_0004792_973_1206 66
26 3300053078 Ga0495612_0023169 Ga0495612_0023169_26_259 66
27 3300009098 Ga0105245_10250487 Ga0105245_102504873 73
28 3300005331 Ga0070670_100397215 Ga0070670_1003972153 76
29 3300005337 Ga0070682_100651027 Ga0070682_1006510272 76
30 3300005338 Ga0068868_100750976 Ga0068868_1007509763 76
31 3300005340 Ga0070689_100110905 Ga0070689_1001109052 76
32 3300005340 Ga0070689_102049872 Ga0070689_1020498722 76
33 3300005345 Ga0070692_10083591 Ga0070692_100835913 76
34 3300005347 Ga0070668_100361639 Ga0070668_1003616391 76
35 3300005354 Ga0070675_100051021 Ga0070675_1000510213 76
36 3300005354 Ga0070675_101896470 Ga0070675_1018964701 76
37 3300005356 Ga0070674_101421182 Ga0070674_1014211821 76
38 3300005364 Ga0070673_100550992 Ga0070673_1005509922 76
39 3300005364 Ga0070673_102261066 Ga0070673_1022610662 76
40 3300005365 Ga0070688_101598757 Ga0070688_1015987572 76
41 3300005438 Ga0070701_11418078 Ga0070701_114180782 76
42 3300005441 Ga0070700_100921485 Ga0070700_1009214851 76
43 3300005441 Ga0070700_101089409 Ga0070700_1010894092 76
44 3300005455 Ga0070663_100640945 Ga0070663_1006409453 76
45 3300005456 Ga0070678_100075237 Ga0070678_1000752372 76
46 3300005457 Ga0070662_101591548 Ga0070662_1015915482 76
47 3300005458 Ga0070681_10364277 Ga0070681_103642773 76
48 3300005458 Ga0070681_11816076 Ga0070681_118160762 76
49 3300005459 Ga0068867_100514805 Ga0068867_1005148053 76
50 3300005459 Ga0068867_101192521 Ga0068867_1011925211 76
51 3300005467 Ga0070706_100317981 Ga0070706_1003179813 76
52 3300005471 Ga0070698_100092057 Ga0070698_1000920574 76
53 3300005518 Ga0070699_100126495 Ga0070699_1001264953 76
54 3300005518 Ga0070699_100584748 Ga0070699_1005847483 76
55 3300005535 Ga0070684_100302945 Ga0070684_1003029452 76
56 3300005535 Ga0070684_100444116 Ga0070684_1004441163 76
57 3300005535 Ga0070684_101480506 Ga0070684_1014805062 76
58 3300005543 Ga0070672_100157353 Ga0070672_1001573533 76
59 3300005543 Ga0070672_101145764 Ga0070672_1011457642 76
60 3300005543 Ga0070672_101261144 Ga0070672_1012611442 76
61 3300005544 Ga0070686_100041395 Ga0070686_1000413952 76
62 3300005545 Ga0070695_101135042 Ga0070695_1011350422 76
63 3300005546 Ga0070696_100527814 Ga0070696_1005278141 76
64 3300005547 Ga0070693_100112440 Ga0070693_1001124401 76
65 3300005549 Ga0070704_100356772 Ga0070704_1003567721 76
66 3300005563 Ga0068855_101108618 Ga0068855_1011086182 76
67 3300005563 Ga0068855_101924310 Ga0068855_1019243102 76
68 3300005564 Ga0070664_101939627 Ga0070664_1019396272 76
69 3300005578 Ga0068854_100017506 Ga0068854_1000175067 76
70 3300005615 Ga0070702_100028049 Ga0070702_1000280493 76
71 3300005718 Ga0068866_11293779 Ga0068866_112937792 76
72 3300005840 Ga0068870_10165339 Ga0068870_101653392 76
73 3300005841 Ga0068863_102093770 Ga0068863_1020937702 76
74 3300005842 Ga0068858_101256939 Ga0068858_1012569392 76
75 3300005843 Ga0068860_101297249 Ga0068860_1012972492 76
76 3300005844 Ga0068862_102642739 Ga0068862_1026427392 76
77 3300005937 Ga0081455_10014606 Ga0081455_100146066 76
78 3300005937 Ga0081455_10028287 Ga0081455_100282877 76
79 3300006178 Ga0075367_11078854 Ga0075367_110788542 76
80 3300006237 Ga0097621_101856085 Ga0097621_1018560852 76
81 3300006844 Ga0075428_101986613 Ga0075428_1019866132 76
82 3300006846 Ga0075430_100870158 Ga0075430_1008701582 76
83 3300006847 Ga0075431_100067662 Ga0075431_1000676623 76
84 3300006847 Ga0075431_101667871 Ga0075431_1016678712 76
85 3300006852 Ga0075433_10309150 Ga0075433_103091502 76
86 3300006871 Ga0075434_100077763 Ga0075434_1000777635 76
87 3300006880 Ga0075429_100110768 Ga0075429_1001107683 76
88 3300006881 Ga0068865_100414591 Ga0068865_1004145913 76
89 3300006914 Ga0075436_100042448 Ga0075436_1000424484 76
90 3300006914 Ga0075436_100197233 Ga0075436_1001972332 76
91 3300009093 Ga0105240_10786652 Ga0105240_107866521 76
92 3300009094 Ga0111539_10568978 Ga0111539_105689783 76
93 3300009094 Ga0111539_11871176 Ga0111539_118711762 76
94 3300009094 Ga0111539_11882715 Ga0111539_118827152 76
95 3300009098 Ga0105245_10023710 Ga0105245_100237106 76
96 3300009098 Ga0105245_10363355 Ga0105245_103633552 76
97 3300009101 Ga0105247_10211950 Ga0105247_102119501 76
98 3300009101 Ga0105247_10750519 Ga0105247_107505192 76
99 3300009147 Ga0114129_10074808 Ga0114129_100748084 76
100 3300009147 Ga0114129_10109054 Ga0114129_101090542 76
101 3300009147 Ga0114129_10738990 Ga0114129_107389903 76
102 3300009147 Ga0114129_12142471 Ga0114129_121424712 76
103 3300009148 Ga0105243_10135016 Ga0105243_101350162 76
104 3300009148 Ga0105243_11154668 Ga0105243_111546682 76
105 3300009148 Ga0105243_11166797 Ga0105243_111667972 76
106 3300009174 Ga0105241_12320141 Ga0105241_123201412 76
107 3300009177 Ga0105248_12707521 Ga0105248_127075212 76
108 3300009177 Ga0105248_12928016 Ga0105248_129280161 76
109 3300009553 Ga0105249_12059326 Ga0105249_120593262 76
110 3300009987 Ga0105030_104081 Ga0105030_1040813 76
111 3300010375 Ga0105239_10084330 Ga0105239_100843306 76
112 3300010375 Ga0105239_12429694 Ga0105239_124296942 76
113 3300013102 Ga0157371_11073687 Ga0157371_110736872 76
114 3300013296 Ga0157374_11781422 Ga0157374_117814222 76
115 3300013297 Ga0157378_10452806 Ga0157378_104528061 76
116 3300013306 Ga0163162_10805839 Ga0163162_108058393 76
117 3300013308 Ga0157375_10260119 Ga0157375_102601194 76
118 3300013308 Ga0157375_11116036 Ga0157375_111160363 76
119 3300013308 Ga0157375_11598201 Ga0157375_115982012 76
120 3300014325 Ga0163163_10461987 Ga0163163_104619873 76
121 3300014326 Ga0157380_10122016 Ga0157380_101220163 76
122 3300014745 Ga0157377_10216151 Ga0157377_102161512 76
123 3300014745 Ga0157377_10641935 Ga0157377_106419352 76
124 3300025901 Ga0207688_10133801 Ga0207688_101338012 76
125 3300025901 Ga0207688_10321841 Ga0207688_103218411 76
126 3300025908 Ga0207643_10163444 Ga0207643_101634443 76
127 3300025912 Ga0207707_10340746 Ga0207707_103407463 76
128 3300025912 Ga0207707_11436219 Ga0207707_114362191 76
129 3300025917 Ga0207660_10231942 Ga0207660_102319422 76
130 3300025919 Ga0207657_10227776 Ga0207657_102277762 76
131 3300025921 Ga0207652_10654765 Ga0207652_106547652 76
132 3300025923 Ga0207681_10848716 Ga0207681_108487162 76
133 3300025926 Ga0207659_10225399 Ga0207659_102253993 76
134 3300025927 Ga0207687_10183354 Ga0207687_101833543 76
135 3300025931 Ga0207644_10467735 Ga0207644_104677352 76
136 3300025933 Ga0207706_10421842 Ga0207706_104218423 76
137 3300025933 Ga0207706_10510444 Ga0207706_105104443 76
138 3300025935 Ga0207709_10042657 Ga0207709_100426574 76
139 3300025936 Ga0207670_11019127 Ga0207670_110191272 76
140 3300025938 Ga0207704_10387689 Ga0207704_103876891 76
141 3300025938 Ga0207704_10693426 Ga0207704_106934262 76
142 3300025938 Ga0207704_11254096 Ga0207704_112540962 76
143 3300025939 Ga0207665_10412244 Ga0207665_104122442 76
144 3300025940 Ga0207691_10073098 Ga0207691_100730983 76
145 3300025940 Ga0207691_11011857 Ga0207691_110118573 76
146 3300025942 Ga0207689_10125116 Ga0207689_101251163 76
147 3300025944 Ga0207661_11301007 Ga0207661_113010072 76
148 3300025945 Ga0207679_10140474 Ga0207679_101404743 76
149 3300025960 Ga0207651_11262318 Ga0207651_112623181 76
150 3300025960 Ga0207651_12004624 Ga0207651_120046242 76
151 3300025972 Ga0207668_12080532 Ga0207668_120805322 76
152 3300025981 Ga0207640_10086461 Ga0207640_100864612 76
153 3300026023 Ga0207677_11143427 Ga0207677_111434272 76
154 3300026035 Ga0207703_11671488 Ga0207703_116714883 76
155 3300026075 Ga0207708_10643677 Ga0207708_106436772 76
156 3300026078 Ga0207702_10995894 Ga0207702_109958943 76
157 3300026088 Ga0207641_10811404 Ga0207641_108114042 76
158 3300026089 Ga0207648_10656375 Ga0207648_106563752 76
159 3300026089 Ga0207648_11075891 Ga0207648_110758911 76
160 3300026095 Ga0207676_10683765 Ga0207676_106837653 76
161 3300026118 Ga0207675_100359663 Ga0207675_1003596632 76
162 3300026121 Ga0207683_10157773 Ga0207683_101577733 76
163 3300027682 Ga0209971_1078601 Ga0209971_10786011 76
164 3300027907 Ga0207428_10495778 Ga0207428_104957782 76
165 3300028379 Ga0268266_11338137 Ga0268266_113381372 76
166 3300028380 Ga0268265_11456006 Ga0268265_114560062 76
167 3300031548 Ga0307408_100133893 Ga0307408_1001338933 76
168 3300031824 Ga0307413_10717980 Ga0307413_107179802 76
169 3300031824 Ga0307413_10906961 Ga0307413_109069612 76
170 3300031824 Ga0307413_11193891 Ga0307413_111938911 76
171 3300031824 Ga0307413_11749456 Ga0307413_117494562 76
172 3300031852 Ga0307410_11664537 Ga0307410_116645371 76
173 3300031903 Ga0307407_10575396 Ga0307407_105753963 76
174 3300031903 Ga0307407_11461607 Ga0307407_114616072 76
175 3300031995 Ga0307409_100120949 Ga0307409_1001209493 76
176 3300031995 Ga0307409_100484609 Ga0307409_1004846093 76
177 3300031995 Ga0307409_100702210 Ga0307409_1007022103 76
178 3300031995 Ga0307409_100831742 Ga0307409_1008317423 76
179 3300031995 Ga0307409_100948464 Ga0307409_1009484642 76
180 3300032002 Ga0307416_100935322 Ga0307416_1009353223 76
181 3300032002 Ga0307416_101501839 Ga0307416_1015018393 76
182 3300032002 Ga0307416_101744079 Ga0307416_1017440792 76
183 3300032002 Ga0307416_101745106 Ga0307416_1017451062 76
184 3300032002 Ga0307416_103895203 Ga0307416_1038952031 76
185 3300032005 Ga0307411_10694364 Ga0307411_106943642 76
186 3300032005 Ga0307411_11771550 Ga0307411_117715502 76
187 3300032126 Ga0307415_102130496 Ga0307415_1021304961 76
188 3300032168 Ga0316593_10150305 Ga0316593_101503051 76
189 3300032168 Ga0316593_10268019 Ga0316593_102680192 76
190 3300035410 Ga0373924_0040697 Ga0373924_0040697_177_407 76
191 3300035724 Ga0373933_0852239 Ga0373933_0852239_240_488 76
192 3300037312 Ga0395899_0009988 Ga0395899_0009988_4704_4934 76
193 3300037418 Ga0395900_0020924 Ga0395900_0020924_616_846 76
194 3300037466 Ga0395898_0291577 Ga0395898_0291577_711_941 76
195 3300037466 Ga0395898_0634226 Ga0395898_0634226_530_760 76
196 3300037471 Ga0395905_0128781 Ga0395905_0128781_1997_2227 76
197 3300037471 Ga0395905_1378417 Ga0395905_1378417_358_588 76
198 3300038443 Ga0395901_0060212 Ga0395901_0060212_793_1023 76
199 3300038443 Ga0395901_1542327 Ga0395901_1542327_98_328 76
200 3300041404 Ga0439436_0078138 Ga0439436_0078138_598_828 76
201 3300041405 Ga0439438_022461 Ga0439438_022461_1014_1244 76
202 3300041408 Ga0439453_0169369 Ga0439453_0169369_52_282 76
203 3300041410 Ga0439461_0012464 Ga0439461_0012464_1105_1335 76
204 3300041410 Ga0439461_0117805 Ga0439461_0117805_72_302 76
205 3300041411 Ga0439466_0132485 Ga0439466_0132485_388_618 76
206 3300041443 Ga0451789_0212464 Ga0451789_0212464_141_380 76
207 3300041997 Ga0439431_0041721 Ga0439431_0041721_647_877 76
208 3300042004 Ga0439445_0077202 Ga0439445_0077202_226_456 76
209 3300042011 Ga0439454_087254 Ga0439454_087254_184_414 76
210 3300042013 Ga0439456_020324 Ga0439456_020324_767_997 76
211 3300042015 Ga0439462_0044105 Ga0439462_0044105_419_649 76
212 3300042125 Ga0450923_077999 Ga0450923_077999_318_548 76
213 3300042127 Ga0450890_037123 Ga0450890_037123_64_294 76
214 3300042129 Ga0450891_016117 Ga0450891_016117_138_368 76
215 3300042142 Ga0450905_017378 Ga0450905_017378_643_873 76
216 3300042147 Ga0450910_072723 Ga0450910_072723_246_476 76
217 3300042147 Ga0450910_087656 Ga0450910_087656_124_354 76
218 3300042156 Ga0439446_0005728 Ga0439446_0005728_2662_2892 76
219 3300042185 Ga0450909_045503 Ga0450909_045503_416_646 76
220 3300042436 Ga0439435_0260372 Ga0439435_0260372_197_427 76
221 3300042438 Ga0439459_0040837 Ga0439459_0040837_371_601 76
222 3300046458 Ga0495591_154336 Ga0495591_154336_238_468 76
223 3300046459 Ga0495629_1092382 Ga0495629_1092382_74_322 76
224 3300046474 Ga0495605_0229012 Ga0495605_0229012_54_284 76
225 3300046491 Ga0495584_0153293 Ga0495584_0153293_67_297 76
226 3300046491 Ga0495584_0463026 Ga0495584_0463026_217_447 76
227 3300046491 Ga0495584_0493230 Ga0495584_0493230_164_394 76
228 3300046492 Ga0495585_0261347 Ga0495585_0261347_348_578 76
229 3300046501 Ga0495607_0402215 Ga0495607_0402215_380_610 76
230 3300046518 Ga0495631_0177932 Ga0495631_0177932_363_593 76
231 3300046520 Ga0495637_0170544 Ga0495637_0170544_63_293 76
232 3300046525 Ga0495663_0092716 Ga0495663_0092716_580_810 76
233 3300046525 Ga0495663_0361747 Ga0495663_0361747_207_437 76
234 3300046537 Ga0495598_0290964 Ga0495598_0290964_238_468 76
235 3300046558 Ga0495633_0311268 Ga0495633_0311268_367_597 76
236 3300046615 Ga0495656_0266797 Ga0495656_0266797_573_803 76
237 3300046615 Ga0495656_0823090 Ga0495656_0823090_115_348 76
238 3300046642 Ga0495634_0089487 Ga0495634_0089487_521_766 76
239 3300046681 Ga0495647_0013798 Ga0495647_0013798_992_1237 76
240 3300046689 Ga0495613_0719236 Ga0495613_0719236_77_322 76
241 3300046691 Ga0495670_0408487 Ga0495670_0408487_430_675 76
242 3300046694 Ga0495649_0669616 Ga0495649_0669616_164_394 76
243 3300046794 Ga0495589_0211995 Ga0495589_0211995_607_837 76
244 3300047318 Ga0495636_0331618 Ga0495636_0331618_10_240 76
245 3300047321 Ga0495676_0519851 Ga0495676_0519851_11_250 76
246 3300047445 Ga0495677_0059240 Ga0495677_0059240_760_990 76
247 3300047470 Ga0495681_0214812 Ga0495681_0214812_214_444 76
248 3300048903 Ga0496100_0230211 Ga0496100_0230211_423_662 76
249 3300048904 Ga0496101_0171204 Ga0496101_0171204_504_743 76
250 3300048904 Ga0496101_1280793 Ga0496101_1280793_203_442 76
251 3300048905 Ga0496102_0126509 Ga0496102_0126509_1114_1353 76
252 3300048906 Ga0496103_0370795 Ga0496103_0370795_595_834 76
253 3300048906 Ga0496103_0450129 Ga0496103_0450129_382_621 76
254 3300048907 Ga0496104_0095175 Ga0496104_0095175_1659_1904 76
255 3300048907 Ga0496104_0466344 Ga0496104_0466344_320_559 76
256 3300048907 Ga0496104_0879008 Ga0496104_0879008_549_788 76
257 3300048907 Ga0496104_1152905 Ga0496104_1152905_10_249 76
258 3300048908 Ga0496105_0320689 Ga0496105_0320689_461_700 76
259 3300048909 Ga0496106_0065555 Ga0496106_0065555_1722_1961 76
260 3300048909 Ga0496106_0320136 Ga0496106_0320136_133_363 76
261 3300048909 Ga0496106_0372097 Ga0496106_0372097_562_801 76
262 3300048909 Ga0496106_0937594 Ga0496106_0937594_32_262 76
263 3300048910 Ga0496107_0080303 Ga0496107_0080303_270_509 76
264 3300048910 Ga0496107_0494864 Ga0496107_0494864_332_562 76
265 3300048910 Ga0496107_0541779 Ga0496107_0541779_443_679 76
266 3300048911 Ga0496108_0077630 Ga0496108_0077630_94_333 76
267 3300048911 Ga0496108_1289988 Ga0496108_1289988_333_569 76
268 3300048912 Ga0496109_0125045 Ga0496109_0125045_1616_1855 76
269 3300048912 Ga0496109_0138280 Ga0496109_0138280_1145_1384 76
270 3300048913 Ga0496110_0130099 Ga0496110_0130099_1865_2104 76
271 3300048913 Ga0496110_0258038 Ga0496110_0258038_471_710 76
272 3300048914 Ga0496111_0005894 Ga0496111_0005894_6578_6817 76
273 3300048914 Ga0496111_0229057 Ga0496111_0229057_327_566 76
274 3300048914 Ga0496111_0817705 Ga0496111_0817705_300_545 76
275 3300048915 Ga0496112_0310217 Ga0496112_0310217_206_445 76
276 3300048915 Ga0496112_0386318 Ga0496112_0386318_697_936 76
277 3300048915 Ga0496112_0443895 Ga0496112_0443895_58_297 76
278 3300048916 Ga0496113_0198838 Ga0496113_0198838_1301_1546 76
279 3300048916 Ga0496113_1221452 Ga0496113_1221452_187_426 76
280 3300048917 Ga0496114_0328723 Ga0496114_0328723_869_1108 76
281 3300048918 Ga0496115_0746191 Ga0496115_0746191_491_730 76
282 3300049522 Ga0501299_072641 Ga0501299_072641_438_668 76
283 3300049568 Ga0501031_0001067 Ga0501031_0001067_1635_1865 76
284 3300049568 Ga0501031_0376422 Ga0501031_0376422_43_273 76
285 3300049570 Ga0501033_0049052 Ga0501033_0049052_198_428 76
286 3300049572 Ga0501036_0088574 Ga0501036_0088574_633_863 76
287 3300049572 Ga0501036_0780104 Ga0501036_0780104_187_417 76
288 3300049572 Ga0501036_1080826 Ga0501036_1080826_19_249 76
289 3300049573 Ga0501037_0207896 Ga0501037_0207896_404_634 76
290 3300049574 Ga0501038_0016739 Ga0501038_0016739_2550_2780 76
291 3300049574 Ga0501038_0585211 Ga0501038_0585211_73_303 76
292 3300049575 Ga0501039_0019894 Ga0501039_0019894_2385_2615 76
293 3300049576 Ga0501040_0011907 Ga0501040_0011907_4701_4931 76
294 3300049576 Ga0501040_0135597 Ga0501040_0135597_886_1116 76
295 3300049576 Ga0501040_0259456 Ga0501040_0259456_159_389 76
296 3300049576 Ga0501040_0527902 Ga0501040_0527902_408_641 76
297 3300049576 Ga0501040_0792006 Ga0501040_0792006_130_381 76
298 3300049576 Ga0501040_0846995 Ga0501040_0846995_291_521 76
299 3300049577 Ga0501041_0013469 Ga0501041_0013469_755_985 76
300 3300049577 Ga0501041_0166991 Ga0501041_0166991_78_308 76
301 3300049577 Ga0501041_0405148 Ga0501041_0405148_398_628 76
302 3300049578 Ga0501042_0021290 Ga0501042_0021290_2644_2874 76
303 3300049578 Ga0501042_0077759 Ga0501042_0077759_1704_1937 76
304 3300049578 Ga0501042_0606751 Ga0501042_0606751_79_309 76
305 3300049579 Ga0501043_0017822 Ga0501043_0017822_371_601 76
306 3300049579 Ga0501043_0445460 Ga0501043_0445460_162_392 76
307 3300049581 Ga0501047_1153841 Ga0501047_1153841_323_556 76
308 3300049581 Ga0501047_1171040 Ga0501047_1171040_340_570 76
309 3300049582 Ga0501048_0003924 Ga0501048_0003924_5883_6113 76
310 3300049582 Ga0501048_0455262 Ga0501048_0455262_443_673 76
311 3300049582 Ga0501048_0477212 Ga0501048_0477212_332_565 76
312 3300049583 Ga0501067_0897735 Ga0501067_0897735_145_381 76
313 3300049584 Ga0501068_0105560 Ga0501068_0105560_370_600 76
314 3300049586 Ga0501070_0030372 Ga0501070_0030372_2770_3000 76
315 3300049586 Ga0501070_1223207 Ga0501070_1223207_183_413 76
316 3300049587 Ga0501071_0029040 Ga0501071_0029040_2750_2980 76
317 3300049587 Ga0501071_0949584 Ga0501071_0949584_275_505 76
318 3300049588 Ga0501072_0008312 Ga0501072_0008312_2794_3024 76
319 3300049588 Ga0501072_0374638 Ga0501072_0374638_374_604 76
320 3300049588 Ga0501072_1527058 Ga0501072_1527058_85_315 76
321 3300049588 Ga0501072_1550132 Ga0501072_1550132_267_500 76
322 3300049589 Ga0501073_0152043 Ga0501073_0152043_757_987 76
323 3300049590 Ga0501074_0006779 Ga0501074_0006779_2939_3169 76
324 3300049590 Ga0501074_0942084 Ga0501074_0942084_31_264 76
325 3300049590 Ga0501074_1075677 Ga0501074_1075677_103_333 76
326 3300049591 Ga0501075_0334210 Ga0501075_0334210_444_674 76
327 3300049591 Ga0501075_0411238 Ga0501075_0411238_423_656 76
328 3300049591 Ga0501075_0480364 Ga0501075_0480364_15_245 76
329 3300049591 Ga0501075_1383773 Ga0501075_1383773_282_512 76
330 3300049591 Ga0501075_1384112 Ga0501075_1384112_195_425 76
331 3300049592 Ga0501076_0013821 Ga0501076_0013821_4573_4803 76
332 3300049592 Ga0501076_0145007 Ga0501076_0145007_1516_1749 76
333 3300049593 Ga0501077_0007451 Ga0501077_0007451_5089_5322 76
334 3300049593 Ga0501077_0008854 Ga0501077_0008854_3882_4112 76
335 3300049593 Ga0501077_0073551 Ga0501077_0073551_1739_1969 76
336 3300049593 Ga0501077_0403495 Ga0501077_0403495_601_831 76
337 3300049741 Ga0501079_0005553 Ga0501079_0005553_839_1069 76
338 3300049741 Ga0501079_0144867 Ga0501079_0144867_316_546 76
339 3300049741 Ga0501079_1132473 Ga0501079_1132473_50_283 76
340 3300049742 Ga0501080_0069088 Ga0501080_0069088_2152_2382 76
341 3300049742 Ga0501080_0818719 Ga0501080_0818719_521_751 76
342 3300049743 Ga0501081_0022634 Ga0501081_0022634_3657_3887 76
343 3300049743 Ga0501081_0023948 Ga0501081_0023948_330_563 76
344 3300049743 Ga0501081_0827342 Ga0501081_0827342_155_385 76
345 3300049743 Ga0501081_0875377 Ga0501081_0875377_346_576 76
346 3300049744 Ga0501083_0197294 Ga0501083_0197294_195_425 76
347 3300049822 Ga0501035_0099401 Ga0501035_0099401_50_280 76
348 3300049822 Ga0501035_1073312 Ga0501035_1073312_377_607 76
349 3300049823 Ga0501044_0447798 Ga0501044_0447798_556_786 76
350 3300049824 Ga0501045_0007617 Ga0501045_0007617_1528_1758 76
351 3300049824 Ga0501045_0487089 Ga0501045_0487089_328_561 76
352 3300049824 Ga0501045_0640857 Ga0501045_0640857_295_525 76
353 3300049824 Ga0501045_0740308 Ga0501045_0740308_447_677 76
354 3300049824 Ga0501045_0807452 Ga0501045_0807452_69_299 76
355 3300049824 Ga0501045_0970651 Ga0501045_0970651_183_413 76
356 3300050507 nmdc:mga05p37_1364991_c1 nmdc:mga05p37_1364991_c1_162_392 76
357 3300050507 nmdc:mga05p37_1463306_c1 nmdc:mga05p37_1463306_c1_92_328 76
358 3300050507 nmdc:mga05p37_1807082_c1 nmdc:mga05p37_1807082_c1_192_422 76
359 3300050507 nmdc:mga05p37_41768_c1 nmdc:mga05p37_41768_c1_2429_2665 76
360 3300050507 nmdc:mga05p37_58255_c1 nmdc:mga05p37_58255_c1_2183_2419 76
361 3300050507 nmdc:mga05p37_994354_c1 nmdc:mga05p37_994354_c1_249_479 76
362 3300050508 nmdc:mga09592_290734_c1 nmdc:mga09592_290734_c1_269_499 76
363 3300050509 nmdc:mga0qj67_663541_c1 nmdc:mga0qj67_663541_c1_272_505 76
364 3300050510 nmdc:mga06r32_306332_c1 nmdc:mga06r32_306332_c1_369_599 76
365 3300050511 nmdc:mga08y16_809306_c1 nmdc:mga08y16_809306_c1_534_773 76
366 3300050512 nmdc:mga0n895_331074_c1 nmdc:mga0n895_331074_c1_996_1232 76
367 3300050512 nmdc:mga0n895_516161_c1 nmdc:mga0n895_516161_c1_200_436 76
368 3300050512 nmdc:mga0n895_581640_c1 nmdc:mga0n895_581640_c1_618_848 76
369 3300050513 nmdc:mga0rr50_1642956_c1 nmdc:mga0rr50_1642956_c1_171_401 76
370 3300050514 nmdc:mga08x19_279209_c1 nmdc:mga08x19_279209_c1_135_371 76
371 3300050514 nmdc:mga08x19_44535_c1 nmdc:mga08x19_44535_c1_241_471 76
372 3300050515 nmdc:mga0a205_298849_c1 nmdc:mga0a205_298849_c1_396_626 76
373 3300050515 nmdc:mga0a205_461435_c1 nmdc:mga0a205_461435_c1_648_884 76
374 3300050515 nmdc:mga0a205_937546_c1 nmdc:mga0a205_937546_c1_275_514 76
375 3300054114 Ga0501084_0237553 Ga0501084_0237553_1025_1255 76
376 3300054114 Ga0501084_0276622 Ga0501084_0276622_761_991 76
377 3300054114 Ga0501084_0904838 Ga0501084_0904838_403_633 76
378 3300054114 Ga0501084_1068688 Ga0501084_1068688_418_648 76
379 3300059424 Ga0590075_057663 Ga0590075_057663_384_614 76
380 3300059426 Ga0590077_032479 Ga0590077_032479_165_395 76
381 3300060353 Ga0501082_0030156 Ga0501082_0030156_1181_1411 76
382 3300060353 Ga0501082_0292369 Ga0501082_0292369_967_1200 76
383 3300060353 Ga0501082_0703213 Ga0501082_0703213_162_392 76
384 3300060353 Ga0501082_1069839 Ga0501082_1069839_267_497 76
385 3300060353 Ga0501082_1171893 Ga0501082_1171893_252_482 76
386 3300061734 Ga0530510_0036177 Ga0530510_0036177_1901_2131 76
387 3300061734 Ga0530510_0205028 Ga0530510_0205028_435_665 76
388 3300061734 Ga0530510_0489425 Ga0530510_0489425_376_609 76
389 3300061734 Ga0530510_0555156 Ga0530510_0555156_524_754 76
390 3300061734 Ga0530510_1042104 Ga0530510_1042104_237_467 76
391 3300005327 Ga0070658_10093479 Ga0070658_100934791 77
392 3300005329 Ga0070683_100033346 Ga0070683_1000333466 77
393 3300005329 Ga0070683_101104419 Ga0070683_1011044191 77
394 3300005336 Ga0070680_100177035 Ga0070680_1001770352 77
395 3300005337 Ga0070682_100082642 Ga0070682_1000826424 77
396 3300005338 Ga0068868_100311859 Ga0068868_1003118593 77
397 3300005338 Ga0068868_100611557 Ga0068868_1006115573 77
398 3300005339 Ga0070660_100055136 Ga0070660_1000551365 77
399 3300005344 Ga0070661_100073947 Ga0070661_1000739472 77
400 3300005344 Ga0070661_101253887 Ga0070661_1012538871 77
401 3300005355 Ga0070671_100136876 Ga0070671_1001368764 77
402 3300005355 Ga0070671_100432260 Ga0070671_1004322601 77
403 3300005355 Ga0070671_100608511 Ga0070671_1006085112 77
404 3300005355 Ga0070671_101706839 Ga0070671_1017068391 77
405 3300005364 Ga0070673_100890297 Ga0070673_1008902972 77
406 3300005365 Ga0070688_100702775 Ga0070688_1007027752 77
407 3300005366 Ga0070659_100024570 Ga0070659_1000245703 77
408 3300005366 Ga0070659_101609997 Ga0070659_1016099971 77
409 3300005434 Ga0070709_10024136 Ga0070709_100241362 77
410 3300005434 Ga0070709_10218658 Ga0070709_102186583 77
411 3300005434 Ga0070709_10345926 Ga0070709_103459262 77
412 3300005435 Ga0070714_100004990 Ga0070714_1000049904 77
413 3300005435 Ga0070714_100006640 Ga0070714_1000066403 77
414 3300005435 Ga0070714_100013910 Ga0070714_1000139109 77
415 3300005435 Ga0070714_100077181 Ga0070714_1000771811 77
416 3300005435 Ga0070714_100351981 Ga0070714_1003519813 77
417 3300005435 Ga0070714_101014830 Ga0070714_1010148302 77
418 3300005435 Ga0070714_101614554 Ga0070714_1016145542 77
419 3300005436 Ga0070713_100013273 Ga0070713_1000132732 77
420 3300005436 Ga0070713_100196285 Ga0070713_1001962853 77
421 3300005436 Ga0070713_100204352 Ga0070713_1002043524 77
422 3300005436 Ga0070713_101430251 Ga0070713_1014302512 77
423 3300005437 Ga0070710_10013773 Ga0070710_100137732 77
424 3300005437 Ga0070710_10549242 Ga0070710_105492422 77
425 3300005439 Ga0070711_100030354 Ga0070711_1000303542 77
426 3300005439 Ga0070711_101053360 Ga0070711_1010533602 77
427 3300005439 Ga0070711_101110461 Ga0070711_1011104612 77
428 3300005440 Ga0070705_100125339 Ga0070705_1001253392 77
429 3300005444 Ga0070694_100127068 Ga0070694_1001270682 77
430 3300005458 Ga0070681_10017999 Ga0070681_1001799912 77
431 3300005458 Ga0070681_10055435 Ga0070681_100554352 77
432 3300005458 Ga0070681_10070898 Ga0070681_100708984 77
433 3300005458 Ga0070681_11682271 Ga0070681_116822711 77
434 3300005468 Ga0070707_100307125 Ga0070707_1003071253 77
435 3300005468 Ga0070707_101756317 Ga0070707_1017563172 77
436 3300005468 Ga0070707_101944543 Ga0070707_1019445432 77
437 3300005530 Ga0070679_100112791 Ga0070679_1001127912 77
438 3300005530 Ga0070679_101411923 Ga0070679_1014119232 77
439 3300005535 Ga0070684_100218082 Ga0070684_1002180822 77
440 3300005535 Ga0070684_100799726 Ga0070684_1007997262 77
441 3300005544 Ga0070686_100104651 Ga0070686_1001046513 77
442 3300005545 Ga0070695_100000334 Ga0070695_10000033421 77
443 3300005545 Ga0070695_100273716 Ga0070695_1002737163 77
444 3300005546 Ga0070696_100384479 Ga0070696_1003844791 77
445 3300005547 Ga0070693_100483097 Ga0070693_1004830972 77
446 3300005549 Ga0070704_102188619 Ga0070704_1021886192 77
447 3300005563 Ga0068855_100099403 Ga0068855_1000994034 77
448 3300005563 Ga0068855_100837570 Ga0068855_1008375702 77
449 3300005564 Ga0070664_100155596 Ga0070664_1001555962 77
450 3300005564 Ga0070664_100484890 Ga0070664_1004848903 77
451 3300005614 Ga0068856_100257473 Ga0068856_1002574733 77
452 3300005614 Ga0068856_100277510 Ga0068856_1002775103 77
453 3300005614 Ga0068856_101187269 Ga0068856_1011872692 77
454 3300005615 Ga0070702_101394514 Ga0070702_1013945141 77
455 3300005616 Ga0068852_101508291 Ga0068852_1015082912 77
456 3300005618 Ga0068864_101532715 Ga0068864_1015327152 77
457 3300005841 Ga0068863_100204364 Ga0068863_1002043643 77
458 3300005842 Ga0068858_100899222 Ga0068858_1008992222 77
459 3300005843 Ga0068860_101193666 Ga0068860_1011936662 77
460 3300006028 Ga0070717_10009831 Ga0070717_100098316 77
461 3300006028 Ga0070717_10031287 Ga0070717_100312872 77
462 3300006028 Ga0070717_10113541 Ga0070717_101135413 77
463 3300006028 Ga0070717_11465630 Ga0070717_114656302 77
464 3300006058 Ga0075432_10138145 Ga0075432_101381452 77
465 3300006163 Ga0070715_10000828 Ga0070715_1000082810 77
466 3300006173 Ga0070716_100041038 Ga0070716_1000410385 77
467 3300006173 Ga0070716_100106023 Ga0070716_1001060233 77
468 3300006173 Ga0070716_100439840 Ga0070716_1004398402 77
469 3300006173 Ga0070716_101316327 Ga0070716_1013163272 77
470 3300006175 Ga0070712_100107991 Ga0070712_1001079912 77
471 3300006175 Ga0070712_100357163 Ga0070712_1003571632 77
472 3300006175 Ga0070712_100461305 Ga0070712_1004613052 77
473 3300006237 Ga0097621_100983539 Ga0097621_1009835392 77
474 3300006871 Ga0075434_100127633 Ga0075434_1001276334 77
475 3300006914 Ga0075436_101365960 Ga0075436_1013659602 77
476 3300007076 Ga0075435_101375441 Ga0075435_1013754412 77
477 3300009093 Ga0105240_10061979 Ga0105240_100619793 77
478 3300009093 Ga0105240_10751949 Ga0105240_107519491 77
479 3300009093 Ga0105240_11654157 Ga0105240_116541572 77
480 3300009094 Ga0111539_10670627 Ga0111539_106706273 77
481 3300009098 Ga0105245_10210097 Ga0105245_102100972 77
482 3300009098 Ga0105245_12859988 Ga0105245_128599882 77
483 3300009101 Ga0105247_10056896 Ga0105247_100568962 77
484 3300009174 Ga0105241_11064575 Ga0105241_110645752 77
485 3300009174 Ga0105241_11100195 Ga0105241_111001952 77
486 3300009176 Ga0105242_10114044 Ga0105242_101140443 77
487 3300009176 Ga0105242_13241787 Ga0105242_132417872 77
488 3300009177 Ga0105248_10112254 Ga0105248_101122543 77
489 3300009177 Ga0105248_10253316 Ga0105248_102533163 77
490 3300009545 Ga0105237_10026151 Ga0105237_100261513 77
491 3300009545 Ga0105237_11711700 Ga0105237_117117002 77
492 3300009545 Ga0105237_11793333 Ga0105237_117933332 77
493 3300009551 Ga0105238_10118859 Ga0105238_101188593 77
494 3300009551 Ga0105238_11081270 Ga0105238_110812702 77
495 3300009551 Ga0105238_11431623 Ga0105238_114316232 77
496 3300010159 Ga0099796_10225322 Ga0099796_102253223 77
497 3300010375 Ga0105239_11407827 Ga0105239_114078271 77
498 3300010375 Ga0105239_12094119 Ga0105239_120941192 77
499 3300013104 Ga0157370_10413434 Ga0157370_104134342 77
500 3300013105 Ga0157369_10491542 Ga0157369_104915423 77
501 3300013105 Ga0157369_11138565 Ga0157369_111385652 77
502 3300013105 Ga0157369_11216291 Ga0157369_112162912 77
503 3300013296 Ga0157374_10265789 Ga0157374_102657893 77
504 3300013306 Ga0163162_10418059 Ga0163162_104180592 77
505 3300013307 Ga0157372_10018430 Ga0157372_1001843011 77
506 3300013307 Ga0157372_10111220 Ga0157372_101112203 77
507 3300013307 Ga0157372_10156827 Ga0157372_101568273 77
508 3300013308 Ga0157375_11086508 Ga0157375_110865082 77
509 3300014745 Ga0157377_10122710 Ga0157377_101227103 77
510 3300014968 Ga0157379_10208612 Ga0157379_102086122 77
511 3300014968 Ga0157379_10850184 Ga0157379_108501842 77
512 3300014969 Ga0157376_10016558 Ga0157376_100165584 77
513 3300014969 Ga0157376_12886825 Ga0157376_128868252 77
514 3300015261 Ga0182006_1109769 Ga0182006_11097692 77
515 3300020069 Ga0197907_10181217 Ga0197907_101812172 77
516 3300020069 Ga0197907_10665942 Ga0197907_106659422 77
517 3300020069 Ga0197907_10905758 Ga0197907_109057582 77
518 3300020070 Ga0206356_10040951 Ga0206356_100409512 77
519 3300020070 Ga0206356_10662684 Ga0206356_106626844 77
520 3300020070 Ga0206356_11528012 Ga0206356_115280121 77
521 3300020078 Ga0206352_11055702 Ga0206352_110557022 77
522 3300020081 Ga0206354_11301243 Ga0206354_113012432 77
523 3300021377 Ga0213874_10416647 Ga0213874_104166471 77
524 3300022467 Ga0224712_10226339 Ga0224712_102263392 77
525 3300022467 Ga0224712_10506495 Ga0224712_105064952 77
526 3300025898 Ga0207692_10058612 Ga0207692_100586124 77
527 3300025898 Ga0207692_10334188 Ga0207692_103341883 77
528 3300025898 Ga0207692_10971994 Ga0207692_109719942 77
529 3300025905 Ga0207685_10117897 Ga0207685_101178972 77
530 3300025906 Ga0207699_10007116 Ga0207699_100071164 77
531 3300025906 Ga0207699_10060384 Ga0207699_100603841 77
532 3300025906 Ga0207699_10308978 Ga0207699_103089782 77
533 3300025909 Ga0207705_10195466 Ga0207705_101954663 77
534 3300025911 Ga0207654_10862261 Ga0207654_108622611 77
535 3300025912 Ga0207707_10157753 Ga0207707_101577533 77
536 3300025912 Ga0207707_10752645 Ga0207707_107526453 77
537 3300025913 Ga0207695_10011313 Ga0207695_100113139 77
538 3300025914 Ga0207671_10107109 Ga0207671_101071093 77
539 3300025915 Ga0207693_10001626 Ga0207693_1000162626 77
540 3300025915 Ga0207693_10017266 Ga0207693_100172662 77
541 3300025915 Ga0207693_10150761 Ga0207693_101507612 77
542 3300025915 Ga0207693_10347086 Ga0207693_103470863 77
543 3300025916 Ga0207663_10025086 Ga0207663_100250865 77
544 3300025916 Ga0207663_10037958 Ga0207663_100379582 77
545 3300025917 Ga0207660_10365929 Ga0207660_103659293 77
546 3300025919 Ga0207657_10001172 Ga0207657_100011729 77
547 3300025921 Ga0207652_10232970 Ga0207652_102329702 77
548 3300025921 Ga0207652_11102369 Ga0207652_111023692 77
549 3300025922 Ga0207646_10613578 Ga0207646_106135781 77
550 3300025924 Ga0207694_10128507 Ga0207694_101285073 77
551 3300025927 Ga0207687_10106620 Ga0207687_101066202 77
552 3300025927 Ga0207687_10108056 Ga0207687_101080562 77
553 3300025927 Ga0207687_10469270 Ga0207687_104692701 77
554 3300025927 Ga0207687_11062839 Ga0207687_110628392 77
555 3300025928 Ga0207700_10018023 Ga0207700_100180236 77
556 3300025928 Ga0207700_10130618 Ga0207700_101306183 77
557 3300025928 Ga0207700_10134606 Ga0207700_101346063 77
558 3300025929 Ga0207664_10005865 Ga0207664_100058656 77
559 3300025929 Ga0207664_10016617 Ga0207664_100166174 77
560 3300025929 Ga0207664_10055511 Ga0207664_100555111 77
561 3300025929 Ga0207664_10069815 Ga0207664_100698153 77
562 3300025929 Ga0207664_10144708 Ga0207664_101447084 77
563 3300025929 Ga0207664_10620506 Ga0207664_106205062 77
564 3300025931 Ga0207644_10241308 Ga0207644_102413084 77
565 3300025931 Ga0207644_10269856 Ga0207644_102698562 77
566 3300025934 Ga0207686_10048920 Ga0207686_100489204 77
567 3300025939 Ga0207665_10024562 Ga0207665_100245627 77
568 3300025939 Ga0207665_10297216 Ga0207665_102972163 77
569 3300025939 Ga0207665_10499459 Ga0207665_104994592 77
570 3300025939 Ga0207665_11234612 Ga0207665_112346122 77
571 3300025941 Ga0207711_10307793 Ga0207711_103077933 77
572 3300025944 Ga0207661_10010984 Ga0207661_100109844 77
573 3300025945 Ga0207679_10094600 Ga0207679_100946003 77
574 3300025949 Ga0207667_10155798 Ga0207667_101557983 77
575 3300025949 Ga0207667_10403816 Ga0207667_104038162 77
576 3300025960 Ga0207651_10898085 Ga0207651_108980852 77
577 3300026023 Ga0207677_10167202 Ga0207677_101672023 77
578 3300026035 Ga0207703_10523956 Ga0207703_105239562 77
579 3300026078 Ga0207702_10785682 Ga0207702_107856822 77
580 3300026088 Ga0207641_10111621 Ga0207641_101116213 77
581 3300026142 Ga0207698_10659500 Ga0207698_106595002 77
582 3300027907 Ga0207428_10155228 Ga0207428_101552282 77
583 3300028558 Ga0265326_10029810 Ga0265326_100298103 77
584 3300028573 Ga0265334_10030810 Ga0265334_100308104 77
585 3300028666 Ga0265336_10004451 Ga0265336_100044513 77
586 3300028800 Ga0265338_10011714 Ga0265338_100117149 77
587 3300028800 Ga0265338_10026816 Ga0265338_100268162 77
588 3300028800 Ga0265338_10255224 Ga0265338_102552242 77
589 3300029957 Ga0265324_10076549 Ga0265324_100765493 77
590 3300031251 Ga0265327_10173533 Ga0265327_101735332 77
591 3300031344 Ga0265316_10615726 Ga0265316_106157263 77
592 3300031595 Ga0265313_10015960 Ga0265313_100159604 77
593 3300034957 Ga0373938_0221535 Ga0373938_0221535_93_326 77
594 3300035083 Ga0373926_0424381 Ga0373926_0424381_236_469 77
595 3300035086 Ga0373934_0354053 Ga0373934_0354053_234_467 77
596 3300035088 Ga0373940_0234628 Ga0373940_0234628_232_465 77
597 3300035089 Ga0373944_0005337 Ga0373944_0005337_1902_2135 77
598 3300035090 Ga0373949_0152676 Ga0373949_0152676_400_633 77
599 3300035090 Ga0373949_0286875 Ga0373949_0286875_50_283 77
600 3300035091 Ga0373951_0089622 Ga0373951_0089622_18_251 77
601 3300035111 Ga0373923_0208491 Ga0373923_0208491_449_682 77
602 3300035114 Ga0373939_0010566 Ga0373939_0010566_1504_1737 77
603 3300035114 Ga0373939_0028882 Ga0373939_0028882_561_794 77
604 3300035115 Ga0373941_0201910 Ga0373941_0201910_474_707 77
605 3300035115 Ga0373941_0441597 Ga0373941_0441597_15_248 77
606 3300035116 Ga0373945_0003284 Ga0373945_0003284_4524_4757 77
607 3300035117 Ga0373953_0308466 Ga0373953_0308466_365_598 77
608 3300035119 Ga0373956_0192401 Ga0373956_0192401_185_418 77
609 3300035121 Ga0373960_0032084 Ga0373960_0032084_156_389 77
610 3300035121 Ga0373960_0299965 Ga0373960_0299965_50_283 77
611 3300035170 Ga0373943_0015576 Ga0373943_0015576_2816_3049 77
612 3300035171 Ga0373946_0037702 Ga0373946_0037702_239_472 77
613 3300035172 Ga0373955_0229495 Ga0373955_0229495_823_1056 77
614 3300035207 Ga0373942_0149928 Ga0373942_0149928_105_338 77
615 3300035242 Ga0373962_0072283 Ga0373962_0072283_549_782 77
616 3300035242 Ga0373962_0271955 Ga0373962_0271955_135_368 77
617 3300035410 Ga0373924_0363867 Ga0373924_0363867_282_515 77
618 3300035691 Ga0373931_0046837 Ga0373931_0046837_1991_2224 77
619 3300035691 Ga0373931_1165938 Ga0373931_1165938_55_288 77
620 3300035692 Ga0373935_0008543 Ga0373935_0008543_1585_1818 77
621 3300035724 Ga0373933_0814604 Ga0373933_0814604_130_363 77
622 3300035725 Ga0373947_0063830 Ga0373947_0063830_1310_1543 77
623 3300036401 Ga0373937_0018152 Ga0373937_0018152_53_286 77
624 3300036401 Ga0373937_0090109 Ga0373937_0090109_612_845 77
625 3300036401 Ga0373937_0365295 Ga0373937_0365295_1056_1289 77
626 3300037068 Ga0373925_0106104 Ga0373925_0106104_909_1142 77
627 3300037068 Ga0373925_0971730 Ga0373925_0971730_202_435 77
628 3300037312 Ga0395899_0893938 Ga0395899_0893938_291_524 77
629 3300037418 Ga0395900_0444637 Ga0395900_0444637_908_1141 77
630 3300037466 Ga0395898_0105139 Ga0395898_0105139_1272_1505 77
631 3300037466 Ga0395898_0400369 Ga0395898_0400369_70_303 77
632 3300038443 Ga0395901_0390962 Ga0395901_0390962_352_585 77
633 3300039437 Ga0436365_1683679 Ga0436365_1683679_260_493 77
634 3300039450 Ga0436363_1379579 Ga0436363_1379579_157_390 77
635 3300039450 Ga0436363_1452544 Ga0436363_1452544_32_265 77
636 3300042876 Ga0451577_1027297 Ga0451577_1027297_56_289 77
637 3300044656 Ga0466969_0026994 Ga0466969_0026994_1154_1387 77
638 3300044656 Ga0466969_0031342 Ga0466969_0031342_1592_1825 77
639 3300044658 Ga0466972_0014839 Ga0466972_0014839_870_1103 77
640 3300044683 Ga0466965_0010775 Ga0466965_0010775_3740_3973 77
641 3300044683 Ga0466965_0105435 Ga0466965_0105435_113_346 77
642 3300044683 Ga0466965_0608364 Ga0466965_0608364_308_541 77
643 3300044684 Ga0466966_0092816 Ga0466966_0092816_976_1209 77
644 3300044684 Ga0466966_0132892 Ga0466966_0132892_660_893 77
645 3300044693 Ga0466961_0020602 Ga0466961_0020602_2976_3209 77
646 3300044693 Ga0466961_0048982 Ga0466961_0048982_927_1160 77
647 3300044693 Ga0466961_0056553 Ga0466961_0056553_838_1071 77
648 3300044693 Ga0466961_0127674 Ga0466961_0127674_720_953 77
649 3300044693 Ga0466961_0186151 Ga0466961_0186151_214_447 77
650 3300044693 Ga0466961_0187581 Ga0466961_0187581_657_890 77
651 3300044693 Ga0466961_0804411 Ga0466961_0804411_68_301 77
652 3300044694 Ga0466963_0000118 Ga0466963_0000118_23488_23721 77
653 3300044694 Ga0466963_0002499 Ga0466963_0002499_371_604 77
654 3300044694 Ga0466963_0003979 Ga0466963_0003979_8051_8284 77
655 3300044694 Ga0466963_0004071 Ga0466963_0004071_3775_4008 77
656 3300044694 Ga0466963_0005177 Ga0466963_0005177_865_1098 77
657 3300044694 Ga0466963_0012606 Ga0466963_0012606_3365_3598 77
658 3300044694 Ga0466963_0016631 Ga0466963_0016631_2852_3085 77
659 3300044694 Ga0466963_0023771 Ga0466963_0023771_731_964 77
660 3300044694 Ga0466963_0030926 Ga0466963_0030926_1820_2053 77
661 3300044694 Ga0466963_0040505 Ga0466963_0040505_1947_2180 77
662 3300044694 Ga0466963_0089158 Ga0466963_0089158_805_1038 77
663 3300044694 Ga0466963_0299156 Ga0466963_0299156_224_457 77
664 3300044694 Ga0466963_0348102 Ga0466963_0348102_170_403 77
665 3300044706 Ga0466964_0004607 Ga0466964_0004607_2563_2796 77
666 3300044706 Ga0466964_0060975 Ga0466964_0060975_254_493 77
667 3300044706 Ga0466964_0093894 Ga0466964_0093894_279_512 77
668 3300044706 Ga0466964_0102831 Ga0466964_0102831_786_1019 77
669 3300044706 Ga0466964_0103121 Ga0466964_0103121_786_1019 77
670 3300044706 Ga0466964_0165291 Ga0466964_0165291_48_281 77
671 3300044706 Ga0466964_0270068 Ga0466964_0270068_435_668 77
672 3300044706 Ga0466964_0875143 Ga0466964_0875143_196_429 77
673 3300044712 Ga0453684_0891964 Ga0453684_0891964_453_686 77
674 3300044719 Ga0466971_0000713 Ga0466971_0000713_4196_4429 77
675 3300044719 Ga0466971_0008839 Ga0466971_0008839_3514_3747 77
676 3300044719 Ga0466971_0032000 Ga0466971_0032000_209_442 77
677 3300044719 Ga0466971_0036573 Ga0466971_0036573_402_635 77
678 3300044719 Ga0466971_0048051 Ga0466971_0048051_625_858 77
679 3300044735 Ga0466968_0000530 Ga0466968_0000530_8510_8743 77
680 3300044735 Ga0466968_0003236 Ga0466968_0003236_2282_2515 77
681 3300044735 Ga0466968_0029539 Ga0466968_0029539_721_954 77
682 3300044735 Ga0466968_0081497 Ga0466968_0081497_490_723 77
683 3300044765 Ga0466970_0096285 Ga0466970_0096285_243_476 77
684 3300044765 Ga0466970_0338633 Ga0466970_0338633_208_441 77
685 3300044842 Ga0466957_0004414 Ga0466957_0004414_6582_6815 77
686 3300044842 Ga0466957_0012200 Ga0466957_0012200_92_325 77
687 3300044842 Ga0466957_0050698 Ga0466957_0050698_1006_1239 77
688 3300044842 Ga0466957_0097236 Ga0466957_0097236_612_845 77
689 3300044842 Ga0466957_0106005 Ga0466957_0106005_761_994 77
690 3300044842 Ga0466957_0133717 Ga0466957_0133717_1117_1350 77
691 3300044842 Ga0466957_0201769 Ga0466957_0201769_710_943 77
692 3300044842 Ga0466957_0226169 Ga0466957_0226169_90_323 77
693 3300044842 Ga0466957_0233322 Ga0466957_0233322_715_948 77
694 3300044901 Ga0466960_0010158 Ga0466960_0010158_3213_3446 77
695 3300044901 Ga0466960_0012809 Ga0466960_0012809_922_1155 77
696 3300044901 Ga0466960_0112428 Ga0466960_0112428_255_488 77
697 3300045049 Ga0466959_0012465 Ga0466959_0012465_4694_4927 77
698 3300045049 Ga0466959_0026888 Ga0466959_0026888_409_642 77
699 3300045049 Ga0466959_0038032 Ga0466959_0038032_2496_2729 77
700 3300045049 Ga0466959_0101050 Ga0466959_0101050_1175_1408 77
701 3300045049 Ga0466959_0304035 Ga0466959_0304035_387_620 77
702 3300045836 Ga0466958_0000495 Ga0466958_0000495_3026_3259 77
703 3300045836 Ga0466958_0002659 Ga0466958_0002659_5307_5540 77
704 3300045836 Ga0466958_0008925 Ga0466958_0008925_2022_2255 77
705 3300045836 Ga0466958_0016750 Ga0466958_0016750_1007_1240 77
706 3300045836 Ga0466958_0016911 Ga0466958_0016911_194_427 77
707 3300045836 Ga0466958_0038580 Ga0466958_0038580_675_908 77
708 3300045836 Ga0466958_0108168 Ga0466958_0108168_675_908 77
709 3300045836 Ga0466958_0443338 Ga0466958_0443338_114_347 77
710 3300045836 Ga0466958_0732575 Ga0466958_0732575_157_390 77
711 3300045976 Ga0466967_0005677 Ga0466967_0005677_5584_5817 77
712 3300045976 Ga0466967_0009665 Ga0466967_0009665_3775_4008 77
713 3300045976 Ga0466967_0021933 Ga0466967_0021933_4578_4811 77
714 3300045976 Ga0466967_0026507 Ga0466967_0026507_72_305 77
715 3300045976 Ga0466967_0029955 Ga0466967_0029955_774_1007 77
716 3300045976 Ga0466967_0039231 Ga0466967_0039231_2212_2445 77
717 3300045976 Ga0466967_0063816 Ga0466967_0063816_822_1055 77
718 3300045976 Ga0466967_0165771 Ga0466967_0165771_1072_1305 77
719 3300045976 Ga0466967_0194467 Ga0466967_0194467_1474_1707 77
720 3300045976 Ga0466967_0247906 Ga0466967_0247906_1226_1459 77
721 3300045976 Ga0466967_0291290 Ga0466967_0291290_786_1019 77
722 3300045976 Ga0466967_0388260 Ga0466967_0388260_400_633 77
723 3300045976 Ga0466967_1313196 Ga0466967_1313196_65_298 77
724 3300045976 Ga0466967_2056931 Ga0466967_2056931_171_404 77
725 3300045976 Ga0466967_2538193 Ga0466967_2538193_242_475 77
726 3300046453 Ga0495627_125876 Ga0495627_125876_215_448 77
727 3300046454 Ga0495592_0000125 Ga0495592_0000125_34265_34498 77
728 3300046454 Ga0495592_0134964 Ga0495592_0134964_1015_1248 77
729 3300046454 Ga0495592_0507505 Ga0495592_0507505_438_671 77
730 3300046455 Ga0495603_0015063 Ga0495603_0015063_513_746 77
731 3300046455 Ga0495603_0876958 Ga0495603_0876958_111_344 77
732 3300046459 Ga0495629_0348451 Ga0495629_0348451_702_935 77
733 3300046461 Ga0495641_0002166 Ga0495641_0002166_14445_14678 77
734 3300046461 Ga0495641_0019667 Ga0495641_0019667_779_1012 77
735 3300046461 Ga0495641_0063276 Ga0495641_0063276_731_964 77
736 3300046461 Ga0495641_0198761 Ga0495641_0198761_194_427 77
737 3300046461 Ga0495641_0277427 Ga0495641_0277427_346_579 77
738 3300046462 Ga0495651_0000011 Ga0495651_0000011_15460_15693 77
739 3300046462 Ga0495651_0053601 Ga0495651_0053601_38_271 77
740 3300046463 Ga0495653_0005067 Ga0495653_0005067_195_428 77
741 3300046463 Ga0495653_0109332 Ga0495653_0109332_1722_1955 77
742 3300046463 Ga0495653_0228669 Ga0495653_0228669_841_1074 77
743 3300046463 Ga0495653_0292154 Ga0495653_0292154_539_772 77
744 3300046472 Ga0495580_0026301 Ga0495580_0026301_215_448 77
745 3300046473 Ga0495582_0049302 Ga0495582_0049302_626_859 77
746 3300046473 Ga0495582_0066542 Ga0495582_0066542_1566_1799 77
747 3300046473 Ga0495582_0173848 Ga0495582_0173848_38_271 77
748 3300046473 Ga0495582_0346567 Ga0495582_0346567_513_746 77
749 3300046473 Ga0495582_0414982 Ga0495582_0414982_319_552 77
750 3300046474 Ga0495605_0369641 Ga0495605_0369641_194_427 77
751 3300046475 Ga0495639_0002434 Ga0495639_0002434_1196_1429 77
752 3300046476 Ga0495662_0040226 Ga0495662_0040226_128_361 77
753 3300046476 Ga0495662_0294875 Ga0495662_0294875_459_692 77
754 3300046477 Ga0495664_0066647 Ga0495664_0066647_1897_2130 77
755 3300046477 Ga0495664_0570473 Ga0495664_0570473_370_603 77
756 3300046477 Ga0495664_0798566 Ga0495664_0798566_12_245 77
757 3300046491 Ga0495584_0199027 Ga0495584_0199027_471_704 77
758 3300046499 Ga0495594_0195783 Ga0495594_0195783_240_473 77
759 3300046501 Ga0495607_0008218 Ga0495607_0008218_5637_5870 77
760 3300046511 Ga0495608_0031190 Ga0495608_0031190_2903_3136 77
761 3300046511 Ga0495608_0067051 Ga0495608_0067051_1268_1501 77
762 3300046511 Ga0495608_0116995 Ga0495608_0116995_1369_1602 77
763 3300046511 Ga0495608_0301873 Ga0495608_0301873_711_944 77
764 3300046511 Ga0495608_0403909 Ga0495608_0403909_385_618 77
765 3300046511 Ga0495608_0562881 Ga0495608_0562881_21_254 77
766 3300046514 Ga0495618_0007063 Ga0495618_0007063_1801_2034 77
767 3300046514 Ga0495618_0083273 Ga0495618_0083273_1032_1265 77
768 3300046514 Ga0495618_0425776 Ga0495618_0425776_300_533 77
769 3300046514 Ga0495618_0919265 Ga0495618_0919265_129_362 77
770 3300046516 Ga0495628_0000040 Ga0495628_0000040_3800_4033 77
771 3300046516 Ga0495628_0164627 Ga0495628_0164627_564_797 77
772 3300046516 Ga0495628_0680174 Ga0495628_0680174_112_345 77
773 3300046516 Ga0495628_0943723 Ga0495628_0943723_198_431 77
774 3300046517 Ga0495630_0024760 Ga0495630_0024760_225_458 77
775 3300046517 Ga0495630_0215508 Ga0495630_0215508_1008_1241 77
776 3300046518 Ga0495631_0150953 Ga0495631_0150953_576_809 77
777 3300046523 Ga0495644_0001368 Ga0495644_0001368_1529_1762 77
778 3300046526 Ga0495666_0004106 Ga0495666_0004106_1662_1895 77
779 3300046529 Ga0495652_0000299 Ga0495652_0000299_8087_8320 77
780 3300046529 Ga0495652_0025357 Ga0495652_0025357_4760_4993 77
781 3300046529 Ga0495652_0089135 Ga0495652_0089135_1195_1428 77
782 3300046531 Ga0495665_0010827 Ga0495665_0010827_4409_4642 77
783 3300046533 Ga0495640_0025758 Ga0495640_0025758_2132_2365 77
784 3300046533 Ga0495640_0222963 Ga0495640_0222963_702_935 77
785 3300046535 Ga0495586_0075959 Ga0495586_0075959_1008_1241 77
786 3300046535 Ga0495586_0106582 Ga0495586_0106582_370_603 77
787 3300046535 Ga0495586_0160344 Ga0495586_0160344_31_264 77
788 3300046535 Ga0495586_0259856 Ga0495586_0259856_167_400 77
789 3300046536 Ga0495587_0000212 Ga0495587_0000212_11688_11921 77
790 3300046536 Ga0495587_0245118 Ga0495587_0245118_659_892 77
791 3300046538 Ga0495609_0093411 Ga0495609_0093411_1055_1288 77
792 3300046543 Ga0495645_0000035 Ga0495645_0000035_34205_34438 77
793 3300046543 Ga0495645_0160431 Ga0495645_0160431_1116_1349 77
794 3300046543 Ga0495645_0248753 Ga0495645_0248753_576_809 77
795 3300046559 Ga0495667_0071245 Ga0495667_0071245_741_974 77
796 3300046559 Ga0495667_0258736 Ga0495667_0258736_345_578 77
797 3300046559 Ga0495667_0275518 Ga0495667_0275518_718_951 77
798 3300046615 Ga0495656_0002084 Ga0495656_0002084_5256_5489 77
799 3300046642 Ga0495634_0008657 Ga0495634_0008657_6441_6674 77
800 3300046642 Ga0495634_0134086 Ga0495634_0134086_1160_1393 77
801 3300046648 Ga0495611_0006116 Ga0495611_0006116_3137_3370 77
802 3300046663 Ga0495635_0157134 Ga0495635_0157134_359_592 77
803 3300046663 Ga0495635_0640030 Ga0495635_0640030_235_468 77
804 3300046664 Ga0495659_0002432 Ga0495659_0002432_2459_2692 77
805 3300046675 Ga0495657_0018821 Ga0495657_0018821_1416_1649 77
806 3300046675 Ga0495657_0749995 Ga0495657_0749995_291_524 77
807 3300046678 Ga0495599_0000009 Ga0495599_0000009_45385_45618 77
808 3300046678 Ga0495599_0370391 Ga0495599_0370391_258_491 77
809 3300046679 Ga0495623_0002770 Ga0495623_0002770_3928_4161 77
810 3300046680 Ga0495646_0004330 Ga0495646_0004330_7786_8019 77
811 3300046680 Ga0495646_0036960 Ga0495646_0036960_1763_1996 77
812 3300046680 Ga0495646_0356241 Ga0495646_0356241_80_313 77
813 3300046681 Ga0495647_0024108 Ga0495647_0024108_212_445 77
814 3300046681 Ga0495647_0079293 Ga0495647_0079293_507_740 77
815 3300046683 Ga0495658_0058045 Ga0495658_0058045_956_1189 77
816 3300046683 Ga0495658_0189684 Ga0495658_0189684_18_251 77
817 3300046683 Ga0495658_0194873 Ga0495658_0194873_883_1116 77
818 3300046683 Ga0495658_0268558 Ga0495658_0268558_123_356 77
819 3300046683 Ga0495658_0960498 Ga0495658_0960498_59_292 77
820 3300046689 Ga0495613_0072321 Ga0495613_0072321_1687_1920 77
821 3300046689 Ga0495613_0077722 Ga0495613_0077722_2158_2391 77
822 3300046689 Ga0495613_0130762 Ga0495613_0130762_142_375 77
823 3300046689 Ga0495613_0810412 Ga0495613_0810412_302_535 77
824 3300046690 Ga0495624_0018533 Ga0495624_0018533_2521_2754 77
825 3300046690 Ga0495624_0397280 Ga0495624_0397280_145_378 77
826 3300046691 Ga0495670_0111130 Ga0495670_0111130_665_898 77
827 3300046809 Ga0495600_0045430 Ga0495600_0045430_1369_1602 77
828 3300046809 Ga0495600_0957845 Ga0495600_0957845_91_324 77
829 3300047315 Ga0495581_0003407 Ga0495581_0003407_614_847 77
830 3300047317 Ga0495604_0000847 Ga0495604_0000847_2038_2271 77
831 3300047317 Ga0495604_0768930 Ga0495604_0768930_334_567 77
832 3300047318 Ga0495636_0047163 Ga0495636_0047163_1358_1591 77
833 3300047319 Ga0495674_0091709 Ga0495674_0091709_2056_2289 77
834 3300047319 Ga0495674_1043620 Ga0495674_1043620_358_591 77
835 3300047319 Ga0495674_1224110 Ga0495674_1224110_23_256 77
836 3300047321 Ga0495676_0039058 Ga0495676_0039058_2393_2626 77
837 3300047321 Ga0495676_0202175 Ga0495676_0202175_659_892 77
838 3300047322 Ga0495680_0022970 Ga0495680_0022970_1674_1907 77
839 3300047322 Ga0495680_0118073 Ga0495680_0118073_34_267 77
840 3300047322 Ga0495680_0672712 Ga0495680_0672712_109_342 77
841 3300047443 Ga0495687_246340 Ga0495687_246340_184_417 77
842 3300047444 Ga0495675_0000137 Ga0495675_0000137_30257_30490 77
843 3300047445 Ga0495677_0110870 Ga0495677_0110870_778_1011 77
844 3300047471 Ga0495684_0012535 Ga0495684_0012535_1016_1249 77
845 3300047471 Ga0495684_0103183 Ga0495684_0103183_907_1140 77
846 3300047471 Ga0495684_0244517 Ga0495684_0244517_19_252 77
847 3300047471 Ga0495684_0349069 Ga0495684_0349069_507_740 77
848 3300047673 Ga0495593_0008432 Ga0495593_0008432_1024_1257 77
849 3300048088 Ga0495602_0000733 Ga0495602_0000733_11688_11921 77
850 3300048088 Ga0495602_0235592 Ga0495602_0235592_719_952 77
851 3300048088 Ga0495602_1067430 Ga0495602_1067430_232_465 77
852 3300048089 Ga0495614_0004562 Ga0495614_0004562_1348_1581 77
853 3300048903 Ga0496100_0004812 Ga0496100_0004812_2990_3223 77
854 3300048903 Ga0496100_0148947 Ga0496100_0148947_1105_1338 77
855 3300048903 Ga0496100_1084410 Ga0496100_1084410_250_483 77
856 3300048904 Ga0496101_0159475 Ga0496101_0159475_944_1177 77
857 3300048904 Ga0496101_0599646 Ga0496101_0599646_295_528 77
858 3300048904 Ga0496101_0648279 Ga0496101_0648279_439_672 77
859 3300048905 Ga0496102_0001719 Ga0496102_0001719_6750_6983 77
860 3300048905 Ga0496102_0080567 Ga0496102_0080567_2182_2415 77
861 3300048905 Ga0496102_0283621 Ga0496102_0283621_51_284 77
862 3300048906 Ga0496103_0080194 Ga0496103_0080194_1647_1880 77
863 3300048906 Ga0496103_0148716 Ga0496103_0148716_116_349 77
864 3300048906 Ga0496103_0271787 Ga0496103_0271787_621_854 77
865 3300048907 Ga0496104_0023791 Ga0496104_0023791_2106_2339 77
866 3300048907 Ga0496104_0151405 Ga0496104_0151405_1327_1560 77
867 3300048907 Ga0496104_0926232 Ga0496104_0926232_175_408 77
868 3300048908 Ga0496105_0219865 Ga0496105_0219865_647_880 77
869 3300048909 Ga0496106_0029860 Ga0496106_0029860_2944_3177 77
870 3300048909 Ga0496106_0813229 Ga0496106_0813229_352_585 77
871 3300048910 Ga0496107_0003518 Ga0496107_0003518_6216_6449 77
872 3300048910 Ga0496107_0850685 Ga0496107_0850685_159_392 77
873 3300048911 Ga0496108_0003564 Ga0496108_0003564_2086_2319 77
874 3300048911 Ga0496108_0786651 Ga0496108_0786651_85_318 77
875 3300048912 Ga0496109_0031188 Ga0496109_0031188_1455_1688 77
876 3300048912 Ga0496109_0089590 Ga0496109_0089590_340_573 77
877 3300048912 Ga0496109_0401832 Ga0496109_0401832_160_393 77
878 3300048912 Ga0496109_0789332 Ga0496109_0789332_241_474 77
879 3300048912 Ga0496109_1220479 Ga0496109_1220479_244_477 77
880 3300048912 Ga0496109_1780814 Ga0496109_1780814_283_516 77
881 3300048913 Ga0496110_0052783 Ga0496110_0052783_1196_1429 77
882 3300048914 Ga0496111_0027142 Ga0496111_0027142_3239_3472 77
883 3300048914 Ga0496111_0083665 Ga0496111_0083665_1885_2118 77
884 3300048914 Ga0496111_0091086 Ga0496111_0091086_1439_1672 77
885 3300048915 Ga0496112_0005957 Ga0496112_0005957_9444_9677 77
886 3300048915 Ga0496112_0163212 Ga0496112_0163212_1632_1865 77
887 3300048915 Ga0496112_0396007 Ga0496112_0396007_953_1186 77
888 3300048916 Ga0496113_0086292 Ga0496113_0086292_1092_1325 77
889 3300048916 Ga0496113_1053132 Ga0496113_1053132_268_501 77
890 3300048916 Ga0496113_1451091 Ga0496113_1451091_197_430 77
891 3300048917 Ga0496114_0011420 Ga0496114_0011420_887_1120 77
892 3300048917 Ga0496114_0244124 Ga0496114_0244124_1104_1337 77
893 3300048917 Ga0496114_0547627 Ga0496114_0547627_463_696 77
894 3300048918 Ga0496115_0003592 Ga0496115_0003592_4163_4396 77
895 3300048918 Ga0496115_0474854 Ga0496115_0474854_620_853 77
896 3300048918 Ga0496115_1014588 Ga0496115_1014588_203_436 77
897 3300049583 Ga0501067_0067585 Ga0501067_0067585_1056_1289 77
898 3300049583 Ga0501067_0113289 Ga0501067_0113289_160_393 77
899 3300049583 Ga0501067_0349865 Ga0501067_0349865_72_305 77
900 3300049585 Ga0501069_0074742 Ga0501069_0074742_812_1045 77
901 3300050511 nmdc:mga08y16_187104_c1 nmdc:mga08y16_187104_c1_743_976 77
902 3300050512 nmdc:mga0n895_513995_c1 nmdc:mga0n895_513995_c1_447_680 77
903 3300050513 nmdc:mga0rr50_662144_c1 nmdc:mga0rr50_662144_c1_221_454 77
904 3300050514 nmdc:mga08x19_1079139_c1 nmdc:mga08x19_1079139_c1_242_475 77
905 3300053077 Ga0495601_0002178 Ga0495601_0002178_1998_2231 77
906 3300053077 Ga0495601_0011903 Ga0495601_0011903_4257_4490 77
907 3300053077 Ga0495601_0171877 Ga0495601_0171877_193_426 77
908 3300053077 Ga0495601_0495633 Ga0495601_0495633_254_487 77
909 3300053077 Ga0495601_1036890 Ga0495601_1036890_172_405 77
910 3300053078 Ga0495612_0141548 Ga0495612_0141548_382_615 77
911 3300053078 Ga0495612_0199973 Ga0495612_0199973_563_796 77
912 3300053083 Ga0495655_0109583 Ga0495655_0109583_416_649 77
913 3300053084 Ga0495595_0116044 Ga0495595_0116044_324_557 77
914 3300053085 Ga0495619_0018551 Ga0495619_0018551_2600_2833 77
915 3300053085 Ga0495619_0177702 Ga0495619_0177702_443_676 77
916 3300053085 Ga0495619_0270515 Ga0495619_0270515_846_1079 77
917 3300053085 Ga0495619_0304755 Ga0495619_0304755_808_1041 77
918 3300053085 Ga0495619_0588705 Ga0495619_0588705_305_538 77
919 3300053094 Ga0500566_0029077 Ga0500566_0029077_2113_2346 77
920 3300061719 Ga0466962_0003630 Ga0466962_0003630_3621_3854 77
921 3300061719 Ga0466962_0006235 Ga0466962_0006235_3985_4218 77
922 3300061719 Ga0466962_0007473 Ga0466962_0007473_4635_4868 77
923 3300061719 Ga0466962_0019218 Ga0466962_0019218_379_612 77
924 3300061719 Ga0466962_0076362 Ga0466962_0076362_286_519 77
925 3300061719 Ga0466962_0081564 Ga0466962_0081564_868_1101 77
926 3300061719 Ga0466962_0458445 Ga0466962_0458445_191_424 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

15

87

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8crx-assembly1.cif.gz_G cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.7706 3 77
4jno-assembly1.cif.gz_A crystal structure of plasmodium falciparum erythrocyte binding antigen 140 (pfeba-140/baebl) region ii in complex with sialyllactose 0.7526 19 35
1g5i-assembly1.cif.gz_B crystal structure of the accessory subunit of murine mitochondrial polymerase gamma 0.7314 3 35
5c53-assembly1.cif.gz_B probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma 0.7267 6 35
3ikl-assembly1.cif.gz_A crystal structure of pol gb delta-i4. 0.7249 2 29
ID Description Score Start End Superfamily
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9197 6 77 3.30.300.20
af_P9WFM7_9_77_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8947 6 77 3.30.300.20
2cy1A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.762 1 76 3.30.300.20
2cy1A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7436 1 76 3.30.300.20
af_Q2G2S7_1_244_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7419 19 41 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1Q7ZK63-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9868 9 77 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A1W9RIV1-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9867 2 77 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555
AF-A0A538MA88-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9834 2 77 GO:0003723
GO:0005737
AF-A0A7W0ZGY8-F1-model_v4 KH domain-containing protein 0.9814 12 77 GO:0003723
GO:0005737
AF-A0A7Y3L329-F1-model_v4 RNA-binding protein KhpA (KH-domain protein A) 0.9744 1 76 GO:0003723
GO:0005737
GO:0008360
GO:0009252
GO:0071555

Feature Viewer

pLDDT pTM Quality
97.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map