F485914
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 926 | 383 | 926 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100077763|Ga0075434_1000777635 |
| Length | 89 |
| Sequence | MPSRGSSRRPGLAAADLVAYLARGLVDDPDAVRVESVEQDGALVIRLHVAPDEVGKVIGRQGRMARALRTIVRACAARSNRRLLLEIVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 212 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 213 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 214 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 215 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 216 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 219 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 220 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 223 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 224 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 225 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 226 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 227 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 228 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 229 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 230 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 1.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 8.53 |
| Rhizosphere | 90.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10093479 | 3300005327 | Bacteria | 2480 |
| 2 | Ga0070683_100033346 | 3300005329 | Bacteria | 4695 |
| 3 | Ga0070683_101104419 | 3300005329 | Bacteria | 762 |
| 4 | Ga0070670_100397215 | 3300005331 | Bacteria | 1217 |
| 5 | Ga0070680_100177035 | 3300005336 | Bacteria | 1796 |
| 6 | Ga0070682_100082642 | 3300005337 | Bacteria | 2082 |
| 7 | Ga0070682_100651027 | 3300005337 | Bacteria | 839 |
| 8 | Ga0068868_100311859 | 3300005338 | Bacteria | 1338 |
| 9 | Ga0068868_100611557 | 3300005338 | Bacteria | 966 |
| 10 | Ga0068868_100750976 | 3300005338 | Bacteria | 876 |
| 11 | Ga0070660_100055136 | 3300005339 | Bacteria | 3071 |
| 12 | Ga0070689_100110905 | 3300005340 | Bacteria | 2182 |
| 13 | Ga0070689_102049872 | 3300005340 | Bacteria | 524 |
| 14 | Ga0070661_100073947 | 3300005344 | Bacteria | 2509 |
| 15 | Ga0070661_101253887 | 3300005344 | Unclassified | 621 |
| 16 | Ga0070692_10083591 | 3300005345 | Bacteria | 1724 |
| 17 | Ga0070668_100361639 | 3300005347 | Bacteria | 1231 |
| 18 | Ga0070675_100051021 | 3300005354 | Bacteria | 3398 |
| 19 | Ga0070675_101896470 | 3300005354 | Bacteria | 550 |
| 20 | Ga0070671_100136876 | 3300005355 | Bacteria | 2065 |
| 21 | Ga0070671_100432260 | 3300005355 | Bacteria | 1128 |
| 22 | Ga0070671_100608511 | 3300005355 | Bacteria | 944 |
| 23 | Ga0070671_101706839 | 3300005355 | Bacteria | 559 |
| 24 | Ga0070674_101421182 | 3300005356 | Bacteria | 622 |
| 25 | Ga0070673_100550992 | 3300005364 | Bacteria | 1048 |
| 26 | Ga0070673_100890297 | 3300005364 | Bacteria | 825 |
| 27 | Ga0070673_102261066 | 3300005364 | Bacteria | 517 |
| 28 | Ga0070688_100702775 | 3300005365 | Bacteria | 783 |
| 29 | Ga0070688_101598757 | 3300005365 | Unclassified | 532 |
| 30 | Ga0070659_100024570 | 3300005366 | Bacteria | 4619 |
| 31 | Ga0070659_101609997 | 3300005366 | Bacteria | 580 |
| 32 | Ga0070709_10024136 | 3300005434 | Bacteria | 3577 |
| 33 | Ga0070709_10218658 | 3300005434 | Bacteria | 1358 |
| 34 | Ga0070709_10345926 | 3300005434 | Bacteria | 1097 |
| 35 | Ga0070714_100004990 | 3300005435 | Bacteria | 10087 |
| 36 | Ga0070714_100006640 | 3300005435 | Bacteria | 8953 |
| 37 | Ga0070714_100013910 | 3300005435 | Bacteria | 6455 |
| 38 | Ga0070714_100077181 | 3300005435 | Bacteria | 2893 |
| 39 | Ga0070714_100351981 | 3300005435 | Bacteria | 1383 |
| 40 | Ga0070714_101014830 | 3300005435 | Bacteria | 807 |
| 41 | Ga0070714_101614554 | 3300005435 | Bacteria | 633 |
| 42 | Ga0070713_100013273 | 3300005436 | Bacteria | 6076 |
| 43 | Ga0070713_100196285 | 3300005436 | Bacteria | 1821 |
| 44 | Ga0070713_100204352 | 3300005436 | Bacteria | 1785 |
| 45 | Ga0070713_101430251 | 3300005436 | Bacteria | 671 |
| 46 | Ga0070710_10013773 | 3300005437 | Bacteria | 4058 |
| 47 | Ga0070710_10549242 | 3300005437 | Bacteria | 797 |
| 48 | Ga0070701_11418078 | 3300005438 | Bacteria | 500 |
| 49 | Ga0070711_100030354 | 3300005439 | Bacteria | 3577 |
| 50 | Ga0070711_101053360 | 3300005439 | Bacteria | 699 |
| 51 | Ga0070711_101110461 | 3300005439 | Bacteria | 681 |
| 52 | Ga0070705_100125339 | 3300005440 | Bacteria | 1666 |
| 53 | Ga0070700_100921485 | 3300005441 | Bacteria | 713 |
| 54 | Ga0070700_101089409 | 3300005441 | Bacteria | 662 |
| 55 | Ga0070694_100127068 | 3300005444 | Bacteria | 1836 |
| 56 | Ga0070663_100640945 | 3300005455 | Bacteria | 898 |
| 57 | Ga0070678_100075237 | 3300005456 | Bacteria | 2540 |
| 58 | Ga0070662_101591548 | 3300005457 | Unclassified | 564 |
| 59 | Ga0070681_10017999 | 3300005458 | Bacteria | 7059 |
| 60 | Ga0070681_10055435 | 3300005458 | Bacteria | 3946 |
| 61 | Ga0070681_10070898 | 3300005458 | Bacteria | 3449 |
| 62 | Ga0070681_10364277 | 3300005458 | Bacteria | 1356 |
| 63 | Ga0070681_11682271 | 3300005458 | Bacteria | 560 |
| 64 | Ga0070681_11816076 | 3300005458 | Bacteria | 537 |
| 65 | Ga0068867_100514805 | 3300005459 | Bacteria | 1031 |
| 66 | Ga0068867_101192521 | 3300005459 | Bacteria | 699 |
| 67 | Ga0070706_100317981 | 3300005467 | Bacteria | 1452 |
| 68 | Ga0070707_100307125 | 3300005468 | Bacteria | 1542 |
| 69 | Ga0070707_101756317 | 3300005468 | Bacteria | 588 |
| 70 | Ga0070707_101944543 | 3300005468 | Bacteria | 555 |
| 71 | Ga0070698_100092057 | 3300005471 | Bacteria | 3013 |
| 72 | Ga0070699_100126495 | 3300005518 | Bacteria | 2251 |
| 73 | Ga0070699_100584748 | 3300005518 | Bacteria | 1018 |
| 74 | Ga0070679_100112791 | 3300005530 | Bacteria | 2704 |
| 75 | Ga0070679_101411923 | 3300005530 | Bacteria | 642 |
| 76 | Ga0070684_100218082 | 3300005535 | Bacteria | 1740 |
| 77 | Ga0070684_100302945 | 3300005535 | Bacteria | 1467 |
| 78 | Ga0070684_100444116 | 3300005535 | Bacteria | 1198 |
| 79 | Ga0070684_100799726 | 3300005535 | Bacteria | 881 |
| 80 | Ga0070684_101480506 | 3300005535 | Bacteria | 640 |
| 81 | Ga0070672_100157353 | 3300005543 | Bacteria | 1883 |
| 82 | Ga0070672_101145764 | 3300005543 | Bacteria | 692 |
| 83 | Ga0070672_101261144 | 3300005543 | Unclassified | 659 |
| 84 | Ga0070686_100041395 | 3300005544 | Bacteria | 2879 |
| 85 | Ga0070686_100104651 | 3300005544 | Bacteria | 1917 |
| 86 | Ga0070695_100000334 | 3300005545 | Bacteria | 24267 |
| 87 | Ga0070695_100273716 | 3300005545 | Bacteria | 1238 |
| 88 | Ga0070695_101135042 | 3300005545 | Bacteria | 641 |
| 89 | Ga0070696_100384479 | 3300005546 | Bacteria | 1094 |
| 90 | Ga0070696_100527814 | 3300005546 | Bacteria | 943 |
| 91 | Ga0070693_100112440 | 3300005547 | Bacteria | 1677 |
| 92 | Ga0070693_100483097 | 3300005547 | Bacteria | 875 |
| 93 | Ga0070704_100356772 | 3300005549 | Bacteria | 1236 |
| 94 | Ga0070704_102188619 | 3300005549 | Bacteria | 514 |
| 95 | Ga0068855_100099403 | 3300005563 | Bacteria | 3351 |
| 96 | Ga0068855_100837570 | 3300005563 | Bacteria | 975 |
| 97 | Ga0068855_101108618 | 3300005563 | Unclassified | 827 |
| 98 | Ga0068855_101924310 | 3300005563 | Bacteria | 599 |
| 99 | Ga0070664_100155596 | 3300005564 | Bacteria | 2020 |
| 100 | Ga0070664_100484890 | 3300005564 | Bacteria | 1138 |
| 101 | Ga0070664_101939627 | 3300005564 | Bacteria | 559 |
| 102 | Ga0068854_100017506 | 3300005578 | Bacteria | 4795 |
| 103 | Ga0068856_100257473 | 3300005614 | Bacteria | 1760 |
| 104 | Ga0068856_100277510 | 3300005614 | Bacteria | 1692 |
| 105 | Ga0068856_101187269 | 3300005614 | Bacteria | 779 |
| 106 | Ga0070702_100028049 | 3300005615 | Bacteria | 3046 |
| 107 | Ga0070702_101394514 | 3300005615 | Bacteria | 573 |
| 108 | Ga0068852_101508291 | 3300005616 | Bacteria | 694 |
| 109 | Ga0068864_101532715 | 3300005618 | Bacteria | 670 |
| 110 | Ga0068866_11293779 | 3300005718 | Archaea | 530 |
| 111 | Ga0068870_10165339 | 3300005840 | Bacteria | 1316 |
| 112 | Ga0068863_100204364 | 3300005841 | Bacteria | 1901 |
| 113 | Ga0068863_102093770 | 3300005841 | Bacteria | 576 |
| 114 | Ga0068858_100899222 | 3300005842 | Bacteria | 866 |
| 115 | Ga0068858_101256939 | 3300005842 | Bacteria | 728 |
| 116 | Ga0068860_101193666 | 3300005843 | Bacteria | 781 |
| 117 | Ga0068860_101297249 | 3300005843 | Bacteria | 749 |
| 118 | Ga0068862_102642739 | 3300005844 | Bacteria | 514 |
| 119 | Ga0081455_10014606 | 3300005937 | Bacteria | 7685 |
| 120 | Ga0081455_10028287 | 3300005937 | Bacteria | 5123 |
| 121 | Ga0070717_10009831 | 3300006028 | Bacteria | 7203 |
| 122 | Ga0070717_10031287 | 3300006028 | Bacteria | 4279 |
| 123 | Ga0070717_10113541 | 3300006028 | Bacteria | 2313 |
| 124 | Ga0070717_10487220 | 3300006028 | Unclassified | 1114 |
| 125 | Ga0070717_11465630 | 3300006028 | Bacteria | 619 |
| 126 | Ga0075432_10138145 | 3300006058 | Bacteria | 928 |
| 127 | Ga0070715_10000828 | 3300006163 | Bacteria | 8480 |
| 128 | Ga0070716_100041038 | 3300006173 | Bacteria | 2576 |
| 129 | Ga0070716_100106023 | 3300006173 | Bacteria | 1732 |
| 130 | Ga0070716_100439840 | 3300006173 | Bacteria | 948 |
| 131 | Ga0070716_101316327 | 3300006173 | Bacteria | 584 |
| 132 | Ga0070712_100107991 | 3300006175 | Bacteria | 2071 |
| 133 | Ga0070712_100357163 | 3300006175 | Unclassified | 1197 |
| 134 | Ga0070712_100461305 | 3300006175 | Bacteria | 1059 |
| 135 | Ga0075367_11078854 | 3300006178 | Bacteria | 513 |
| 136 | Ga0097621_100983539 | 3300006237 | Bacteria | 789 |
| 137 | Ga0097621_101856085 | 3300006237 | Bacteria | 575 |
| 138 | Ga0075428_101986613 | 3300006844 | Bacteria | 603 |
| 139 | Ga0075430_100870158 | 3300006846 | Bacteria | 742 |
| 140 | Ga0075431_100067662 | 3300006847 | Bacteria | 3687 |
| 141 | Ga0075431_101667871 | 3300006847 | Bacteria | 594 |
| 142 | Ga0075433_10309150 | 3300006852 | Bacteria | 1399 |
| 143 | Ga0075434_100077763 | 3300006871 | Bacteria | 3313 |
| 144 | Ga0075434_100127633 | 3300006871 | Bacteria | 2560 |
| 145 | Ga0075429_100110768 | 3300006880 | Bacteria | 2399 |
| 146 | Ga0068865_100414591 | 3300006881 | Bacteria | 1106 |
| 147 | Ga0075436_100042448 | 3300006914 | Bacteria | 3136 |
| 148 | Ga0075436_100197233 | 3300006914 | Bacteria | 1425 |
| 149 | Ga0075436_101365960 | 3300006914 | Bacteria | 537 |
| 150 | Ga0075435_101375441 | 3300007076 | Unclassified | 618 |
| 151 | Ga0105240_10061979 | 3300009093 | Bacteria | 4658 |
| 152 | Ga0105240_10751949 | 3300009093 | Bacteria | 1060 |
| 153 | Ga0105240_10786652 | 3300009093 | Bacteria | 1032 |
| 154 | Ga0105240_11654157 | 3300009093 | Bacteria | 669 |
| 155 | Ga0111539_10568978 | 3300009094 | Bacteria | 1320 |
| 156 | Ga0111539_10670627 | 3300009094 | Bacteria | 1207 |
| 157 | Ga0111539_11871176 | 3300009094 | Bacteria | 696 |
| 158 | Ga0111539_11882715 | 3300009094 | Unclassified | 694 |
| 159 | Ga0105245_10023710 | 3300009098 | Bacteria | 5387 |
| 160 | Ga0105245_10210097 | 3300009098 | Bacteria | 1873 |
| 161 | Ga0105245_10250487 | 3300009098 | Bacteria | 1720 |
| 162 | Ga0105245_10363355 | 3300009098 | Bacteria | 1437 |
| 163 | Ga0105245_12859988 | 3300009098 | Bacteria | 535 |
| 164 | Ga0105247_10056896 | 3300009101 | Bacteria | 2416 |
| 165 | Ga0105247_10211950 | 3300009101 | Bacteria | 1307 |
| 166 | Ga0105247_10750519 | 3300009101 | Bacteria | 740 |
| 167 | Ga0114129_10074808 | 3300009147 | Bacteria | 4717 |
| 168 | Ga0114129_10109054 | 3300009147 | Bacteria | 3821 |
| 169 | Ga0114129_10738990 | 3300009147 | Bacteria | 1261 |
| 170 | Ga0114129_12142471 | 3300009147 | Bacteria | 674 |
| 171 | Ga0105243_10135016 | 3300009148 | Bacteria | 2098 |
| 172 | Ga0105243_11154668 | 3300009148 | Bacteria | 785 |
| 173 | Ga0105243_11166797 | 3300009148 | Bacteria | 782 |
| 174 | Ga0105241_11064575 | 3300009174 | Bacteria | 760 |
| 175 | Ga0105241_11100195 | 3300009174 | Bacteria | 748 |
| 176 | Ga0105241_12320141 | 3300009174 | Bacteria | 534 |
| 177 | Ga0105242_10114044 | 3300009176 | Bacteria | 2309 |
| 178 | Ga0105242_13241787 | 3300009176 | Bacteria | 505 |
| 179 | Ga0105248_10112254 | 3300009177 | Bacteria | 3074 |
| 180 | Ga0105248_10253316 | 3300009177 | Bacteria | 1981 |
| 181 | Ga0105248_12707521 | 3300009177 | Unclassified | 566 |
| 182 | Ga0105248_12928016 | 3300009177 | Bacteria | 544 |
| 183 | Ga0105237_10026151 | 3300009545 | Bacteria | 5964 |
| 184 | Ga0105237_11711700 | 3300009545 | Bacteria | 636 |
| 185 | Ga0105237_11793333 | 3300009545 | Bacteria | 621 |
| 186 | Ga0105238_10118859 | 3300009551 | Bacteria | 2623 |
| 187 | Ga0105238_11081270 | 3300009551 | Bacteria | 824 |
| 188 | Ga0105238_11431623 | 3300009551 | Bacteria | 719 |
| 189 | Ga0105249_12059326 | 3300009553 | Bacteria | 643 |
| 190 | Ga0105030_104081 | 3300009987 | Bacteria | 1249 |
| 191 | Ga0099796_10225322 | 3300010159 | Bacteria | 770 |
| 192 | Ga0105239_10084330 | 3300010375 | Bacteria | 3499 |
| 193 | Ga0105239_11407827 | 3300010375 | Bacteria | 805 |
| 194 | Ga0105239_12094119 | 3300010375 | Bacteria | 657 |
| 195 | Ga0105239_12429694 | 3300010375 | Bacteria | 610 |
| 196 | Ga0157371_11073687 | 3300013102 | Bacteria | 617 |
| 197 | Ga0157370_10413434 | 3300013104 | Bacteria | 1241 |
| 198 | Ga0157369_10491542 | 3300013105 | Bacteria | 1270 |
| 199 | Ga0157369_11138565 | 3300013105 | Bacteria | 797 |
| 200 | Ga0157369_11216291 | 3300013105 | Bacteria | 769 |
| 201 | Ga0157374_10265789 | 3300013296 | Bacteria | 1691 |
| 202 | Ga0157374_11781422 | 3300013296 | Bacteria | 641 |
| 203 | Ga0157378_10452806 | 3300013297 | Bacteria | 1274 |
| 204 | Ga0163162_10418059 | 3300013306 | Bacteria | 1473 |
| 205 | Ga0163162_10805839 | 3300013306 | Bacteria | 1056 |
| 206 | Ga0157372_10018430 | 3300013307 | Bacteria | 7503 |
| 207 | Ga0157372_10111220 | 3300013307 | Bacteria | 3138 |
| 208 | Ga0157372_10156827 | 3300013307 | Bacteria | 2630 |
| 209 | Ga0157375_10260119 | 3300013308 | Bacteria | 1897 |
| 210 | Ga0157375_11086508 | 3300013308 | Bacteria | 936 |
| 211 | Ga0157375_11116036 | 3300013308 | Bacteria | 923 |
| 212 | Ga0157375_11598201 | 3300013308 | Bacteria | 771 |
| 213 | Ga0163163_10461987 | 3300014325 | Bacteria | 1330 |
| 214 | Ga0157380_10122016 | 3300014326 | Bacteria | 2209 |
| 215 | Ga0157377_10122710 | 3300014745 | Bacteria | 1577 |
| 216 | Ga0157377_10216151 | 3300014745 | Bacteria | 1225 |
| 217 | Ga0157377_10641935 | 3300014745 | Bacteria | 763 |
| 218 | Ga0157379_10208612 | 3300014968 | Bacteria | 1768 |
| 219 | Ga0157379_10850184 | 3300014968 | Bacteria | 863 |
| 220 | Ga0157376_10016558 | 3300014969 | Bacteria | 5601 |
| 221 | Ga0157376_12886825 | 3300014969 | Bacteria | 520 |
| 222 | Ga0182006_1109769 | 3300015261 | Bacteria | 969 |
| 223 | Ga0197907_10181217 | 3300020069 | Bacteria | 550 |
| 224 | Ga0197907_10665942 | 3300020069 | Bacteria | 941 |
| 225 | Ga0197907_10905758 | 3300020069 | Bacteria | 1237 |
| 226 | Ga0206356_10040951 | 3300020070 | Bacteria | 1042 |
| 227 | Ga0206356_10662684 | 3300020070 | Bacteria | 3245 |
| 228 | Ga0206356_11528012 | 3300020070 | Bacteria | 576 |
| 229 | Ga0206352_11055702 | 3300020078 | Bacteria | 862 |
| 230 | Ga0206354_11301243 | 3300020081 | Bacteria | 977 |
| 231 | Ga0213874_10416647 | 3300021377 | Bacteria | 525 |
| 232 | Ga0224712_10226339 | 3300022467 | Bacteria | 857 |
| 233 | Ga0224712_10506495 | 3300022467 | Bacteria | 584 |
| 234 | Ga0207692_10058612 | 3300025898 | Bacteria | 1984 |
| 235 | Ga0207692_10334188 | 3300025898 | Bacteria | 930 |
| 236 | Ga0207692_10971994 | 3300025898 | Bacteria | 560 |
| 237 | Ga0207688_10133801 | 3300025901 | Bacteria | 1455 |
| 238 | Ga0207688_10321841 | 3300025901 | Bacteria | 949 |
| 239 | Ga0207685_10117897 | 3300025905 | Bacteria | 1161 |
| 240 | Ga0207699_10007116 | 3300025906 | Bacteria | 5455 |
| 241 | Ga0207699_10060384 | 3300025906 | Bacteria | 2276 |
| 242 | Ga0207699_10308978 | 3300025906 | Bacteria | 1106 |
| 243 | Ga0207643_10163444 | 3300025908 | Bacteria | 1340 |
| 244 | Ga0207705_10195466 | 3300025909 | Bacteria | 1531 |
| 245 | Ga0207654_10862261 | 3300025911 | Bacteria | 656 |
| 246 | Ga0207707_10157753 | 3300025912 | Bacteria | 1984 |
| 247 | Ga0207707_10340746 | 3300025912 | Bacteria | 1292 |
| 248 | Ga0207707_10752645 | 3300025912 | Bacteria | 815 |
| 249 | Ga0207707_11436219 | 3300025912 | Bacteria | 549 |
| 250 | Ga0207695_10011313 | 3300025913 | Bacteria | 10818 |
| 251 | Ga0207671_10107109 | 3300025914 | Bacteria | 2123 |
| 252 | Ga0207693_10001626 | 3300025915 | Bacteria | 19847 |
| 253 | Ga0207693_10017266 | 3300025915 | Bacteria | 5756 |
| 254 | Ga0207693_10150761 | 3300025915 | Bacteria | 1829 |
| 255 | Ga0207693_10347086 | 3300025915 | Unclassified | 1161 |
| 256 | Ga0207663_10025086 | 3300025916 | Bacteria | 3441 |
| 257 | Ga0207663_10037958 | 3300025916 | Bacteria | 2907 |
| 258 | Ga0207660_10231942 | 3300025917 | Bacteria | 1452 |
| 259 | Ga0207660_10365929 | 3300025917 | Bacteria | 1157 |
| 260 | Ga0207657_10001172 | 3300025919 | Bacteria | 27807 |
| 261 | Ga0207657_10227776 | 3300025919 | Bacteria | 1491 |
| 262 | Ga0207652_10232970 | 3300025921 | Bacteria | 1660 |
| 263 | Ga0207652_10654765 | 3300025921 | Bacteria | 939 |
| 264 | Ga0207652_11102369 | 3300025921 | Bacteria | 694 |
| 265 | Ga0207646_10613578 | 3300025922 | Bacteria | 976 |
| 266 | Ga0207681_10848716 | 3300025923 | Bacteria | 764 |
| 267 | Ga0207694_10128507 | 3300025924 | Bacteria | 2029 |
| 268 | Ga0207659_10225399 | 3300025926 | Bacteria | 1509 |
| 269 | Ga0207687_10106620 | 3300025927 | Bacteria | 2072 |
| 270 | Ga0207687_10108056 | 3300025927 | Bacteria | 2059 |
| 271 | Ga0207687_10183354 | 3300025927 | Bacteria | 1623 |
| 272 | Ga0207687_10469270 | 3300025927 | Bacteria | 1046 |
| 273 | Ga0207687_11062839 | 3300025927 | Bacteria | 695 |
| 274 | Ga0207700_10018023 | 3300025928 | Bacteria | 4731 |
| 275 | Ga0207700_10130618 | 3300025928 | Bacteria | 2050 |
| 276 | Ga0207700_10134606 | 3300025928 | Bacteria | 2022 |
| 277 | Ga0207664_10005865 | 3300025929 | Bacteria | 8399 |
| 278 | Ga0207664_10016617 | 3300025929 | Bacteria | 5373 |
| 279 | Ga0207664_10055511 | 3300025929 | Bacteria | 3143 |
| 280 | Ga0207664_10069815 | 3300025929 | Bacteria | 2825 |
| 281 | Ga0207664_10144708 | 3300025929 | Bacteria | 2014 |
| 282 | Ga0207664_10620506 | 3300025929 | Bacteria | 971 |
| 283 | Ga0207644_10241308 | 3300025931 | Bacteria | 1439 |
| 284 | Ga0207644_10269856 | 3300025931 | Bacteria | 1363 |
| 285 | Ga0207644_10467735 | 3300025931 | Bacteria | 1037 |
| 286 | Ga0207706_10421842 | 3300025933 | Bacteria | 1156 |
| 287 | Ga0207706_10510444 | 3300025933 | Bacteria | 1037 |
| 288 | Ga0207686_10048920 | 3300025934 | Bacteria | 2622 |
| 289 | Ga0207709_10042657 | 3300025935 | Bacteria | 2730 |
| 290 | Ga0207670_11019127 | 3300025936 | Bacteria | 697 |
| 291 | Ga0207704_10387689 | 3300025938 | Bacteria | 1099 |
| 292 | Ga0207704_10693426 | 3300025938 | Bacteria | 842 |
| 293 | Ga0207704_11254096 | 3300025938 | Bacteria | 633 |
| 294 | Ga0207665_10024562 | 3300025939 | Bacteria | 3974 |
| 295 | Ga0207665_10297216 | 3300025939 | Bacteria | 1206 |
| 296 | Ga0207665_10412244 | 3300025939 | Bacteria | 1031 |
| 297 | Ga0207665_10499459 | 3300025939 | Bacteria | 939 |
| 298 | Ga0207665_11234612 | 3300025939 | Bacteria | 596 |
| 299 | Ga0207691_10073098 | 3300025940 | Bacteria | 3092 |
| 300 | Ga0207691_11011857 | 3300025940 | Bacteria | 693 |
| 301 | Ga0207711_10307793 | 3300025941 | Bacteria | 1462 |
| 302 | Ga0207689_10125116 | 3300025942 | Bacteria | 2115 |
| 303 | Ga0207661_10010984 | 3300025944 | Bacteria | 6541 |
| 304 | Ga0207661_11301007 | 3300025944 | Bacteria | 668 |
| 305 | Ga0207679_10094600 | 3300025945 | Bacteria | 2320 |
| 306 | Ga0207679_10140474 | 3300025945 | Bacteria | 1952 |
| 307 | Ga0207667_10155798 | 3300025949 | Bacteria | 2351 |
| 308 | Ga0207667_10403816 | 3300025949 | Bacteria | 1391 |
| 309 | Ga0207651_10898085 | 3300025960 | Unclassified | 789 |
| 310 | Ga0207651_11262318 | 3300025960 | Bacteria | 664 |
| 311 | Ga0207651_12004624 | 3300025960 | Bacteria | 520 |
| 312 | Ga0207668_12080532 | 3300025972 | Bacteria | 511 |
| 313 | Ga0207640_10086461 | 3300025981 | Bacteria | 2159 |
| 314 | Ga0207677_10167202 | 3300026023 | Bacteria | 1715 |
| 315 | Ga0207677_11143427 | 3300026023 | Bacteria | 711 |
| 316 | Ga0207703_10523956 | 3300026035 | Bacteria | 1115 |
| 317 | Ga0207703_11671488 | 3300026035 | Bacteria | 612 |
| 318 | Ga0207708_10643677 | 3300026075 | Unclassified | 902 |
| 319 | Ga0207702_10785682 | 3300026078 | Bacteria | 941 |
| 320 | Ga0207702_10995894 | 3300026078 | Bacteria | 831 |
| 321 | Ga0207641_10111621 | 3300026088 | Bacteria | 2425 |
| 322 | Ga0207641_10811404 | 3300026088 | Bacteria | 926 |
| 323 | Ga0207648_10656375 | 3300026089 | Bacteria | 970 |
| 324 | Ga0207648_11075891 | 3300026089 | Bacteria | 754 |
| 325 | Ga0207676_10683765 | 3300026095 | Bacteria | 993 |
| 326 | Ga0207675_100359663 | 3300026118 | Bacteria | 1428 |
| 327 | Ga0207683_10157773 | 3300026121 | Bacteria | 2050 |
| 328 | Ga0207698_10659500 | 3300026142 | Bacteria | 1037 |
| 329 | Ga0209971_1078601 | 3300027682 | Bacteria | 803 |
| 330 | Ga0207428_10155228 | 3300027907 | Bacteria | 1741 |
| 331 | Ga0207428_10495778 | 3300027907 | Unclassified | 887 |
| 332 | Ga0268266_11338137 | 3300028379 | Bacteria | 692 |
| 333 | Ga0268265_11456006 | 3300028380 | Bacteria | 688 |
| 334 | Ga0265326_10029810 | 3300028558 | Bacteria | 1555 |
| 335 | Ga0265334_10030810 | 3300028573 | Bacteria | 2145 |
| 336 | Ga0265336_10004451 | 3300028666 | Bacteria | 5293 |
| 337 | Ga0265338_10011714 | 3300028800 | Bacteria | 10095 |
| 338 | Ga0265338_10026816 | 3300028800 | Bacteria | 5798 |
| 339 | Ga0265338_10255224 | 3300028800 | Bacteria | 1291 |
| 340 | Ga0265324_10076549 | 3300029957 | Bacteria | 1138 |
| 341 | Ga0265327_10173533 | 3300031251 | Bacteria | 989 |
| 342 | Ga0265316_10615726 | 3300031344 | Unclassified | 769 |
| 343 | Ga0307408_100133893 | 3300031548 | Bacteria | 1937 |
| 344 | Ga0265313_10015960 | 3300031595 | Bacteria | 4343 |
| 345 | Ga0307413_10717980 | 3300031824 | Bacteria | 832 |
| 346 | Ga0307413_10906961 | 3300031824 | Bacteria | 749 |
| 347 | Ga0307413_11193891 | 3300031824 | Bacteria | 661 |
| 348 | Ga0307413_11749456 | 3300031824 | Bacteria | 555 |
| 349 | Ga0307410_11664537 | 3300031852 | Bacteria | 565 |
| 350 | Ga0307407_10575396 | 3300031903 | Bacteria | 836 |
| 351 | Ga0307407_11461607 | 3300031903 | Bacteria | 540 |
| 352 | Ga0307409_100120949 | 3300031995 | Bacteria | 2217 |
| 353 | Ga0307409_100484609 | 3300031995 | Bacteria | 1201 |
| 354 | Ga0307409_100702210 | 3300031995 | Bacteria | 1011 |
| 355 | Ga0307409_100831742 | 3300031995 | Bacteria | 933 |
| 356 | Ga0307409_100948464 | 3300031995 | Bacteria | 876 |
| 357 | Ga0307416_100935322 | 3300032002 | Unclassified | 968 |
| 358 | Ga0307416_101501839 | 3300032002 | Bacteria | 779 |
| 359 | Ga0307416_101744079 | 3300032002 | Bacteria | 727 |
| 360 | Ga0307416_101745106 | 3300032002 | Bacteria | 727 |
| 361 | Ga0307416_103895203 | 3300032002 | Bacteria | 500 |
| 362 | Ga0307411_10694364 | 3300032005 | Bacteria | 886 |
| 363 | Ga0307411_11771550 | 3300032005 | Unclassified | 573 |
| 364 | Ga0307415_102130496 | 3300032126 | Bacteria | 548 |
| 365 | Ga0316593_10150305 | 3300032168 | Bacteria | 847 |
| 366 | Ga0316593_10268019 | 3300032168 | Bacteria | 642 |
| 367 | Ga0373938_0221535 | 3300034957 | Bacteria | 531 |
| 368 | Ga0373926_0424381 | 3300035083 | Bacteria | 526 |
| 369 | Ga0373934_0354053 | 3300035086 | Bacteria | 611 |
| 370 | Ga0373940_0234628 | 3300035088 | Bacteria | 614 |
| 371 | Ga0373944_0005337 | 3300035089 | Bacteria | 3381 |
| 372 | Ga0373949_0152676 | 3300035090 | Bacteria | 669 |
| 373 | Ga0373949_0286875 | 3300035090 | Unclassified | 519 |
| 374 | Ga0373951_0089622 | 3300035091 | Bacteria | 806 |
| 375 | Ga0373923_0208491 | 3300035111 | Bacteria | 905 |
| 376 | Ga0373939_0010566 | 3300035114 | Bacteria | 2312 |
| 377 | Ga0373939_0028882 | 3300035114 | Bacteria | 1582 |
| 378 | Ga0373941_0201910 | 3300035115 | Bacteria | 756 |
| 379 | Ga0373941_0441597 | 3300035115 | Bacteria | 545 |
| 380 | Ga0373945_0003284 | 3300035116 | Bacteria | 5073 |
| 381 | Ga0373953_0308466 | 3300035117 | Bacteria | 691 |
| 382 | Ga0373956_0192401 | 3300035119 | Unclassified | 966 |
| 383 | Ga0373960_0032084 | 3300035121 | Bacteria | 1474 |
| 384 | Ga0373960_0299965 | 3300035121 | Bacteria | 597 |
| 385 | Ga0373943_0015576 | 3300035170 | Bacteria | 3456 |
| 386 | Ga0373946_0037702 | 3300035171 | Bacteria | 1966 |
| 387 | Ga0373955_0229495 | 3300035172 | Bacteria | 1110 |
| 388 | Ga0373942_0149928 | 3300035207 | Bacteria | 748 |
| 389 | Ga0373962_0072283 | 3300035242 | Bacteria | 1033 |
| 390 | Ga0373962_0271955 | 3300035242 | Unclassified | 594 |
| 391 | Ga0373924_0040697 | 3300035410 | Bacteria | 1903 |
| 392 | Ga0373924_0363867 | 3300035410 | Unclassified | 645 |
| 393 | Ga0373931_0046837 | 3300035691 | Bacteria | 2287 |
| 394 | Ga0373931_1165938 | 3300035691 | Bacteria | 526 |
| 395 | Ga0373935_0008543 | 3300035692 | Bacteria | 6131 |
| 396 | Ga0373933_0814604 | 3300035724 | Unclassified | 614 |
| 397 | Ga0373933_0852239 | 3300035724 | Bacteria | 600 |
| 398 | Ga0373947_0063830 | 3300035725 | Bacteria | 2244 |
| 399 | Ga0373937_0018152 | 3300036401 | Bacteria | 6276 |
| 400 | Ga0373937_0090109 | 3300036401 | Bacteria | 2840 |
| 401 | Ga0373937_0365295 | 3300036401 | Bacteria | 1368 |
| 402 | Ga0373925_0106104 | 3300037068 | Bacteria | 2165 |
| 403 | Ga0373925_0971730 | 3300037068 | Bacteria | 700 |
| 404 | Ga0395899_0009988 | 3300037312 | Bacteria | 7280 |
| 405 | Ga0395899_0893938 | 3300037312 | Bacteria | 542 |
| 406 | Ga0395900_0020924 | 3300037418 | Bacteria | 6685 |
| 407 | Ga0395900_0444637 | 3300037418 | Bacteria | 1253 |
| 408 | Ga0395898_0105139 | 3300037466 | Bacteria | 2707 |
| 409 | Ga0395898_0291577 | 3300037466 | Bacteria | 1556 |
| 410 | Ga0395898_0400369 | 3300037466 | Bacteria | 1309 |
| 411 | Ga0395898_0634226 | 3300037466 | Bacteria | 1011 |
| 412 | Ga0395905_0128781 | 3300037471 | Bacteria | 2380 |
| 413 | Ga0395905_1378417 | 3300037471 | Bacteria | 609 |
| 414 | Ga0395901_0060212 | 3300038443 | Bacteria | 3950 |
| 415 | Ga0395901_0390962 | 3300038443 | Bacteria | 1430 |
| 416 | Ga0395901_1542327 | 3300038443 | Bacteria | 619 |
| 417 | Ga0436365_1683679 | 3300039437 | Bacteria | 829 |
| 418 | Ga0436363_1379579 | 3300039450 | Bacteria | 1398 |
| 419 | Ga0436363_1452544 | 3300039450 | Bacteria | 759 |
| 420 | Ga0439436_0078138 | 3300041404 | Bacteria | 922 |
| 421 | Ga0439438_022461 | 3300041405 | Bacteria | 1749 |
| 422 | Ga0439453_0169369 | 3300041408 | Unclassified | 527 |
| 423 | Ga0439461_0012464 | 3300041410 | Bacteria | 1592 |
| 424 | Ga0439461_0117805 | 3300041410 | Bacteria | 661 |
| 425 | Ga0439466_0132485 | 3300041411 | Bacteria | 767 |
| 426 | Ga0451789_0212464 | 3300041443 | Bacteria | 674 |
| 427 | Ga0439431_0041721 | 3300041997 | Bacteria | 1171 |
| 428 | Ga0439445_0077202 | 3300042004 | Bacteria | 928 |
| 429 | Ga0439454_087254 | 3300042011 | Bacteria | 573 |
| 430 | Ga0439456_020324 | 3300042013 | Bacteria | 1401 |
| 431 | Ga0439462_0044105 | 3300042015 | Bacteria | 1193 |
| 432 | Ga0450923_077999 | 3300042125 | Bacteria | 742 |
| 433 | Ga0450890_037123 | 3300042127 | Unclassified | 711 |
| 434 | Ga0450891_016117 | 3300042129 | Unclassified | 712 |
| 435 | Ga0450905_017378 | 3300042142 | Bacteria | 1043 |
| 436 | Ga0450910_072723 | 3300042147 | Bacteria | 593 |
| 437 | Ga0450910_087656 | 3300042147 | Bacteria | 549 |
| 438 | Ga0439446_0005728 | 3300042156 | Bacteria | 3208 |
| 439 | Ga0450909_045503 | 3300042185 | Bacteria | 680 |
| 440 | Ga0439435_0260372 | 3300042436 | Unclassified | 586 |
| 441 | Ga0439459_0040837 | 3300042438 | Bacteria | 985 |
| 442 | Ga0451577_1027297 | 3300042876 | Bacteria | 740 |
| 443 | Ga0466969_0026994 | 3300044656 | Bacteria | 2942 |
| 444 | Ga0466969_0031342 | 3300044656 | Bacteria | 2706 |
| 445 | Ga0466972_0014839 | 3300044658 | Bacteria | 3899 |
| 446 | Ga0466965_0010775 | 3300044683 | Bacteria | 4277 |
| 447 | Ga0466965_0105435 | 3300044683 | Bacteria | 1445 |
| 448 | Ga0466965_0608364 | 3300044683 | Bacteria | 621 |
| 449 | Ga0466966_0092816 | 3300044684 | Bacteria | 1872 |
| 450 | Ga0466966_0132892 | 3300044684 | Bacteria | 1523 |
| 451 | Ga0466961_0020602 | 3300044693 | Bacteria | 4244 |
| 452 | Ga0466961_0048982 | 3300044693 | Bacteria | 2701 |
| 453 | Ga0466961_0056553 | 3300044693 | Bacteria | 2500 |
| 454 | Ga0466961_0127674 | 3300044693 | Bacteria | 1594 |
| 455 | Ga0466961_0186151 | 3300044693 | Bacteria | 1288 |
| 456 | Ga0466961_0187581 | 3300044693 | Bacteria | 1282 |
| 457 | Ga0466961_0804411 | 3300044693 | Bacteria | 561 |
| 458 | Ga0466963_0000118 | 3300044694 | Bacteria | 29387 |
| 459 | Ga0466963_0002499 | 3300044694 | Bacteria | 10291 |
| 460 | Ga0466963_0003979 | 3300044694 | Bacteria | 8544 |
| 461 | Ga0466963_0004071 | 3300044694 | Bacteria | 8456 |
| 462 | Ga0466963_0005177 | 3300044694 | Bacteria | 7613 |
| 463 | Ga0466963_0012606 | 3300044694 | Bacteria | 5178 |
| 464 | Ga0466963_0016631 | 3300044694 | Bacteria | 4576 |
| 465 | Ga0466963_0023771 | 3300044694 | Bacteria | 3896 |
| 466 | Ga0466963_0030926 | 3300044694 | Bacteria | 3457 |
| 467 | Ga0466963_0040505 | 3300044694 | Bacteria | 3053 |
| 468 | Ga0466963_0089158 | 3300044694 | Bacteria | 2098 |
| 469 | Ga0466963_0299156 | 3300044694 | Bacteria | 1131 |
| 470 | Ga0466963_0348102 | 3300044694 | Bacteria | 1043 |
| 471 | Ga0466964_0004607 | 3300044706 | Bacteria | 5097 |
| 472 | Ga0466964_0060975 | 3300044706 | Bacteria | 1570 |
| 473 | Ga0466964_0093894 | 3300044706 | Bacteria | 1310 |
| 474 | Ga0466964_0102831 | 3300044706 | Bacteria | 1262 |
| 475 | Ga0466964_0103121 | 3300044706 | Bacteria | 1260 |
| 476 | Ga0466964_0165291 | 3300044706 | Bacteria | 1037 |
| 477 | Ga0466964_0270068 | 3300044706 | Bacteria | 846 |
| 478 | Ga0466964_0875143 | 3300044706 | Bacteria | 512 |
| 479 | Ga0453684_0891964 | 3300044712 | Bacteria | 953 |
| 480 | Ga0466971_0000713 | 3300044719 | Bacteria | 13307 |
| 481 | Ga0466971_0008839 | 3300044719 | Bacteria | 4398 |
| 482 | Ga0466971_0032000 | 3300044719 | Bacteria | 2356 |
| 483 | Ga0466971_0036573 | 3300044719 | Bacteria | 2202 |
| 484 | Ga0466971_0048051 | 3300044719 | Bacteria | 1918 |
| 485 | Ga0466968_0000530 | 3300044735 | Bacteria | 12949 |
| 486 | Ga0466968_0003236 | 3300044735 | Bacteria | 6005 |
| 487 | Ga0466968_0029539 | 3300044735 | Bacteria | 2267 |
| 488 | Ga0466968_0081497 | 3300044735 | Bacteria | 1422 |
| 489 | Ga0466970_0096285 | 3300044765 | Bacteria | 1609 |
| 490 | Ga0466970_0338633 | 3300044765 | Bacteria | 852 |
| 491 | Ga0466957_0004414 | 3300044842 | Bacteria | 7831 |
| 492 | Ga0466957_0012200 | 3300044842 | Bacteria | 4973 |
| 493 | Ga0466957_0050698 | 3300044842 | Bacteria | 2525 |
| 494 | Ga0466957_0097236 | 3300044842 | Bacteria | 1851 |
| 495 | Ga0466957_0106005 | 3300044842 | Bacteria | 1777 |
| 496 | Ga0466957_0133717 | 3300044842 | Bacteria | 1592 |
| 497 | Ga0466957_0201769 | 3300044842 | Bacteria | 1306 |
| 498 | Ga0466957_0226169 | 3300044842 | Bacteria | 1237 |
| 499 | Ga0466957_0233322 | 3300044842 | Bacteria | 1219 |
| 500 | Ga0466960_0010158 | 3300044901 | Bacteria | 3904 |
| 501 | Ga0466960_0012809 | 3300044901 | Bacteria | 3549 |
| 502 | Ga0466960_0112428 | 3300044901 | Bacteria | 1417 |
| 503 | Ga0466959_0012465 | 3300045049 | Bacteria | 6143 |
| 504 | Ga0466959_0026888 | 3300045049 | Bacteria | 4267 |
| 505 | Ga0466959_0038032 | 3300045049 | Bacteria | 3556 |
| 506 | Ga0466959_0101050 | 3300045049 | Bacteria | 2064 |
| 507 | Ga0466959_0304035 | 3300045049 | Bacteria | 1092 |
| 508 | Ga0466958_0000495 | 3300045836 | Bacteria | 16502 |
| 509 | Ga0466958_0002659 | 3300045836 | Bacteria | 9035 |
| 510 | Ga0466958_0008925 | 3300045836 | Bacteria | 5570 |
| 511 | Ga0466958_0016750 | 3300045836 | Bacteria | 4225 |
| 512 | Ga0466958_0016911 | 3300045836 | Bacteria | 4208 |
| 513 | Ga0466958_0038580 | 3300045836 | Bacteria | 2866 |
| 514 | Ga0466958_0108168 | 3300045836 | Bacteria | 1734 |
| 515 | Ga0466958_0443338 | 3300045836 | Bacteria | 840 |
| 516 | Ga0466958_0732575 | 3300045836 | Bacteria | 644 |
| 517 | Ga0466967_0005677 | 3300045976 | Bacteria | 8696 |
| 518 | Ga0466967_0009665 | 3300045976 | Bacteria | 7174 |
| 519 | Ga0466967_0021933 | 3300045976 | Bacteria | 5198 |
| 520 | Ga0466967_0026507 | 3300045976 | Bacteria | 4802 |
| 521 | Ga0466967_0029955 | 3300045976 | Bacteria | 4561 |
| 522 | Ga0466967_0039231 | 3300045976 | Bacteria | 4069 |
| 523 | Ga0466967_0063816 | 3300045976 | Bacteria | 3274 |
| 524 | Ga0466967_0165771 | 3300045976 | Bacteria | 2076 |
| 525 | Ga0466967_0194467 | 3300045976 | Bacteria | 1918 |
| 526 | Ga0466967_0247906 | 3300045976 | Bacteria | 1700 |
| 527 | Ga0466967_0291290 | 3300045976 | Bacteria | 1568 |
| 528 | Ga0466967_0388260 | 3300045976 | Bacteria | 1356 |
| 529 | Ga0466967_1313196 | 3300045976 | Bacteria | 720 |
| 530 | Ga0466967_2056931 | 3300045976 | Bacteria | 567 |
| 531 | Ga0466967_2538193 | 3300045976 | Bacteria | 507 |
| 532 | Ga0495627_125876 | 3300046453 | Bacteria | 722 |
| 533 | Ga0495592_0000125 | 3300046454 | Bacteria | 68045 |
| 534 | Ga0495592_0005522 | 3300046454 | Bacteria | 9351 |
| 535 | Ga0495592_0134964 | 3300046454 | Bacteria | 1722 |
| 536 | Ga0495592_0507505 | 3300046454 | Bacteria | 747 |
| 537 | Ga0495603_0015063 | 3300046455 | Bacteria | 4675 |
| 538 | Ga0495603_0876958 | 3300046455 | Unclassified | 510 |
| 539 | Ga0495591_154336 | 3300046458 | Bacteria | 551 |
| 540 | Ga0495629_0348451 | 3300046459 | Bacteria | 1010 |
| 541 | Ga0495629_1092382 | 3300046459 | Unclassified | 516 |
| 542 | Ga0495641_0002166 | 3300046461 | Bacteria | 15735 |
| 543 | Ga0495641_0019667 | 3300046461 | Bacteria | 3447 |
| 544 | Ga0495641_0063276 | 3300046461 | Bacteria | 1668 |
| 545 | Ga0495641_0198761 | 3300046461 | Bacteria | 898 |
| 546 | Ga0495641_0277427 | 3300046461 | Bacteria | 754 |
| 547 | Ga0495651_0000011 | 3300046462 | Bacteria | 147193 |
| 548 | Ga0495651_0053221 | 3300046462 | Bacteria | 3117 |
| 549 | Ga0495651_0053601 | 3300046462 | Bacteria | 3104 |
| 550 | Ga0495653_0005067 | 3300046463 | Bacteria | 10691 |
| 551 | Ga0495653_0007515 | 3300046463 | Bacteria | 8913 |
| 552 | Ga0495653_0109332 | 3300046463 | Bacteria | 1989 |
| 553 | Ga0495653_0228669 | 3300046463 | Bacteria | 1246 |
| 554 | Ga0495653_0292154 | 3300046463 | Bacteria | 1066 |
| 555 | Ga0495580_0026301 | 3300046472 | Bacteria | 4244 |
| 556 | Ga0495582_0049302 | 3300046473 | Bacteria | 2318 |
| 557 | Ga0495582_0066542 | 3300046473 | Bacteria | 1991 |
| 558 | Ga0495582_0173848 | 3300046473 | Bacteria | 1226 |
| 559 | Ga0495582_0346567 | 3300046473 | Bacteria | 855 |
| 560 | Ga0495582_0414982 | 3300046473 | Bacteria | 776 |
| 561 | Ga0495605_0229012 | 3300046474 | Bacteria | 801 |
| 562 | Ga0495605_0369641 | 3300046474 | Bacteria | 599 |
| 563 | Ga0495639_0002434 | 3300046475 | Bacteria | 8127 |
| 564 | Ga0495662_0040226 | 3300046476 | Bacteria | 2257 |
| 565 | Ga0495662_0294875 | 3300046476 | Bacteria | 798 |
| 566 | Ga0495664_0066647 | 3300046477 | Bacteria | 2147 |
| 567 | Ga0495664_0570473 | 3300046477 | Bacteria | 673 |
| 568 | Ga0495664_0798566 | 3300046477 | Bacteria | 555 |
| 569 | Ga0495584_0153293 | 3300046491 | Bacteria | 1171 |
| 570 | Ga0495584_0199027 | 3300046491 | Bacteria | 1018 |
| 571 | Ga0495584_0463026 | 3300046491 | Bacteria | 645 |
| 572 | Ga0495584_0493230 | 3300046491 | Bacteria | 624 |
| 573 | Ga0495585_0261347 | 3300046492 | Bacteria | 861 |
| 574 | Ga0495594_0195783 | 3300046499 | Bacteria | 1152 |
| 575 | Ga0495607_0008218 | 3300046501 | Bacteria | 7142 |
| 576 | Ga0495607_0402215 | 3300046501 | Unclassified | 623 |
| 577 | Ga0495608_0031190 | 3300046511 | Bacteria | 3605 |
| 578 | Ga0495608_0067051 | 3300046511 | Bacteria | 2348 |
| 579 | Ga0495608_0116995 | 3300046511 | Bacteria | 1710 |
| 580 | Ga0495608_0143686 | 3300046511 | Bacteria | 1522 |
| 581 | Ga0495608_0301873 | 3300046511 | Bacteria | 991 |
| 582 | Ga0495608_0403909 | 3300046511 | Bacteria | 835 |
| 583 | Ga0495608_0562881 | 3300046511 | Bacteria | 686 |
| 584 | Ga0495608_0802511 | 3300046511 | Bacteria | 555 |
| 585 | Ga0495618_0007063 | 3300046514 | Bacteria | 6792 |
| 586 | Ga0495618_0083273 | 3300046514 | Bacteria | 2043 |
| 587 | Ga0495618_0425776 | 3300046514 | Bacteria | 809 |
| 588 | Ga0495618_0919265 | 3300046514 | Bacteria | 504 |
| 589 | Ga0495628_0000040 | 3300046516 | Bacteria | 104506 |
| 590 | Ga0495628_0164627 | 3300046516 | Bacteria | 1684 |
| 591 | Ga0495628_0680174 | 3300046516 | Bacteria | 728 |
| 592 | Ga0495628_0943723 | 3300046516 | Bacteria | 596 |
| 593 | Ga0495630_0024760 | 3300046517 | Bacteria | 4436 |
| 594 | Ga0495630_0215508 | 3300046517 | Bacteria | 1465 |
| 595 | Ga0495631_0150953 | 3300046518 | Bacteria | 997 |
| 596 | Ga0495631_0177932 | 3300046518 | Bacteria | 912 |
| 597 | Ga0495637_0170544 | 3300046520 | Bacteria | 812 |
| 598 | Ga0495644_0001368 | 3300046523 | Bacteria | 9959 |
| 599 | Ga0495663_0092716 | 3300046525 | Bacteria | 986 |
| 600 | Ga0495663_0361747 | 3300046525 | Archaea | 530 |
| 601 | Ga0495666_0004106 | 3300046526 | Bacteria | 7353 |
| 602 | Ga0495652_0000299 | 3300046529 | Bacteria | 58948 |
| 603 | Ga0495652_0011344 | 3300046529 | Bacteria | 8058 |
| 604 | Ga0495652_0025357 | 3300046529 | Bacteria | 5246 |
| 605 | Ga0495652_0089135 | 3300046529 | Bacteria | 2526 |
| 606 | Ga0495665_0010827 | 3300046531 | Bacteria | 4934 |
| 607 | Ga0495640_0025758 | 3300046533 | Bacteria | 4260 |
| 608 | Ga0495640_0222963 | 3300046533 | Bacteria | 1188 |
| 609 | Ga0495640_0954950 | 3300046533 | Bacteria | 506 |
| 610 | Ga0495586_0075959 | 3300046535 | Bacteria | 1840 |
| 611 | Ga0495586_0106582 | 3300046535 | Bacteria | 1558 |
| 612 | Ga0495586_0160344 | 3300046535 | Bacteria | 1268 |
| 613 | Ga0495586_0259856 | 3300046535 | Bacteria | 991 |
| 614 | Ga0495587_0000212 | 3300046536 | Bacteria | 43340 |
| 615 | Ga0495587_0007700 | 3300046536 | Bacteria | 6969 |
| 616 | Ga0495587_0245118 | 3300046536 | Bacteria | 1008 |
| 617 | Ga0495598_0290964 | 3300046537 | Bacteria | 616 |
| 618 | Ga0495609_0093411 | 3300046538 | Bacteria | 1307 |
| 619 | Ga0495645_0000035 | 3300046543 | Bacteria | 102305 |
| 620 | Ga0495645_0160431 | 3300046543 | Bacteria | 1555 |
| 621 | Ga0495645_0248753 | 3300046543 | Bacteria | 1182 |
| 622 | Ga0495645_0300131 | 3300046543 | Bacteria | 1049 |
| 623 | Ga0495645_0652807 | 3300046543 | Bacteria | 642 |
| 624 | Ga0495633_0311268 | 3300046558 | Unclassified | 715 |
| 625 | Ga0495667_0071245 | 3300046559 | Bacteria | 2267 |
| 626 | Ga0495667_0258736 | 3300046559 | Bacteria | 1107 |
| 627 | Ga0495667_0275518 | 3300046559 | Unclassified | 1068 |
| 628 | Ga0495667_0918867 | 3300046559 | Bacteria | 536 |
| 629 | Ga0495656_0002084 | 3300046615 | Bacteria | 6601 |
| 630 | Ga0495656_0266797 | 3300046615 | Bacteria | 869 |
| 631 | Ga0495656_0823090 | 3300046615 | Unclassified | 502 |
| 632 | Ga0495634_0008657 | 3300046642 | Bacteria | 7550 |
| 633 | Ga0495634_0089487 | 3300046642 | Bacteria | 2001 |
| 634 | Ga0495634_0134086 | 3300046642 | Bacteria | 1576 |
| 635 | Ga0495611_0006116 | 3300046648 | Bacteria | 5135 |
| 636 | Ga0495635_0016143 | 3300046663 | Bacteria | 5214 |
| 637 | Ga0495635_0157134 | 3300046663 | Bacteria | 1547 |
| 638 | Ga0495635_0640030 | 3300046663 | Bacteria | 692 |
| 639 | Ga0495659_0002432 | 3300046664 | Bacteria | 6010 |
| 640 | Ga0495657_0018821 | 3300046675 | Bacteria | 4991 |
| 641 | Ga0495657_0080116 | 3300046675 | Bacteria | 2114 |
| 642 | Ga0495657_0503046 | 3300046675 | Bacteria | 706 |
| 643 | Ga0495657_0749995 | 3300046675 | Bacteria | 559 |
| 644 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 645 | Ga0495599_0370391 | 3300046678 | Bacteria | 856 |
| 646 | Ga0495599_0439454 | 3300046678 | Bacteria | 773 |
| 647 | Ga0495623_0002770 | 3300046679 | Bacteria | 11583 |
| 648 | Ga0495623_0099293 | 3300046679 | Bacteria | 1775 |
| 649 | Ga0495646_0004330 | 3300046680 | Bacteria | 8944 |
| 650 | Ga0495646_0036960 | 3300046680 | Bacteria | 3023 |
| 651 | Ga0495646_0185068 | 3300046680 | Bacteria | 1141 |
| 652 | Ga0495646_0356241 | 3300046680 | Bacteria | 766 |
| 653 | Ga0495647_0013798 | 3300046681 | Bacteria | 2806 |
| 654 | Ga0495647_0024108 | 3300046681 | Bacteria | 2213 |
| 655 | Ga0495647_0079293 | 3300046681 | Bacteria | 1329 |
| 656 | Ga0495658_0058045 | 3300046683 | Bacteria | 2212 |
| 657 | Ga0495658_0189684 | 3300046683 | Bacteria | 1277 |
| 658 | Ga0495658_0194873 | 3300046683 | Unclassified | 1261 |
| 659 | Ga0495658_0268558 | 3300046683 | Bacteria | 1075 |
| 660 | Ga0495658_0960498 | 3300046683 | Bacteria | 546 |
| 661 | Ga0495613_0072321 | 3300046689 | Bacteria | 2513 |
| 662 | Ga0495613_0077722 | 3300046689 | Bacteria | 2414 |
| 663 | Ga0495613_0130762 | 3300046689 | Bacteria | 1798 |
| 664 | Ga0495613_0719236 | 3300046689 | Bacteria | 656 |
| 665 | Ga0495613_0810412 | 3300046689 | Bacteria | 610 |
| 666 | Ga0495624_0018533 | 3300046690 | Bacteria | 4655 |
| 667 | Ga0495624_0397280 | 3300046690 | Bacteria | 828 |
| 668 | Ga0495670_0111130 | 3300046691 | Bacteria | 1418 |
| 669 | Ga0495670_0408487 | 3300046691 | Bacteria | 734 |
| 670 | Ga0495649_0669616 | 3300046694 | Bacteria | 510 |
| 671 | Ga0495589_0211995 | 3300046794 | Bacteria | 912 |
| 672 | Ga0495600_0045430 | 3300046809 | Bacteria | 2866 |
| 673 | Ga0495600_0092060 | 3300046809 | Bacteria | 1977 |
| 674 | Ga0495600_0957845 | 3300046809 | Bacteria | 502 |
| 675 | Ga0495581_0003407 | 3300047315 | Bacteria | 9134 |
| 676 | Ga0495604_0000847 | 3300047317 | Bacteria | 25539 |
| 677 | Ga0495604_0768930 | 3300047317 | Bacteria | 608 |
| 678 | Ga0495636_0047163 | 3300047318 | Bacteria | 1799 |
| 679 | Ga0495636_0331618 | 3300047318 | Bacteria | 716 |
| 680 | Ga0495674_0061607 | 3300047319 | Bacteria | 3269 |
| 681 | Ga0495674_0091709 | 3300047319 | Bacteria | 2594 |
| 682 | Ga0495674_1043620 | 3300047319 | Bacteria | 625 |
| 683 | Ga0495674_1224110 | 3300047319 | Bacteria | 566 |
| 684 | Ga0495676_0039058 | 3300047321 | Bacteria | 3935 |
| 685 | Ga0495676_0202175 | 3300047321 | Bacteria | 1380 |
| 686 | Ga0495676_0519851 | 3300047321 | Bacteria | 780 |
| 687 | Ga0495680_0022970 | 3300047322 | Bacteria | 5191 |
| 688 | Ga0495680_0070522 | 3300047322 | Bacteria | 2664 |
| 689 | Ga0495680_0118073 | 3300047322 | Bacteria | 1960 |
| 690 | Ga0495680_0672712 | 3300047322 | Bacteria | 686 |
| 691 | Ga0495687_246340 | 3300047443 | Bacteria | 536 |
| 692 | Ga0495675_0000137 | 3300047444 | Bacteria | 50947 |
| 693 | Ga0495675_0547176 | 3300047444 | Bacteria | 660 |
| 694 | Ga0495677_0059240 | 3300047445 | Bacteria | 1418 |
| 695 | Ga0495677_0110870 | 3300047445 | Bacteria | 1043 |
| 696 | Ga0495681_0214812 | 3300047470 | Bacteria | 774 |
| 697 | Ga0495684_0012535 | 3300047471 | Bacteria | 6534 |
| 698 | Ga0495684_0103183 | 3300047471 | Bacteria | 2155 |
| 699 | Ga0495684_0103727 | 3300047471 | Bacteria | 2149 |
| 700 | Ga0495684_0244517 | 3300047471 | Bacteria | 1307 |
| 701 | Ga0495684_0349069 | 3300047471 | Bacteria | 1051 |
| 702 | Ga0495593_0008432 | 3300047673 | Bacteria | 5994 |
| 703 | Ga0495602_0000733 | 3300048088 | Bacteria | 30967 |
| 704 | Ga0495602_0235592 | 3300048088 | Bacteria | 1372 |
| 705 | Ga0495602_0273539 | 3300048088 | Bacteria | 1247 |
| 706 | Ga0495602_1067430 | 3300048088 | Bacteria | 530 |
| 707 | Ga0495614_0004562 | 3300048089 | Bacteria | 6243 |
| 708 | Ga0496100_0004812 | 3300048903 | Bacteria | 7210 |
| 709 | Ga0496100_0148947 | 3300048903 | Bacteria | 1667 |
| 710 | Ga0496100_0230211 | 3300048903 | Bacteria | 1363 |
| 711 | Ga0496100_1084410 | 3300048903 | Bacteria | 631 |
| 712 | Ga0496101_0159475 | 3300048904 | Bacteria | 1729 |
| 713 | Ga0496101_0171204 | 3300048904 | Bacteria | 1669 |
| 714 | Ga0496101_0599646 | 3300048904 | Bacteria | 871 |
| 715 | Ga0496101_0648279 | 3300048904 | Unclassified | 834 |
| 716 | Ga0496101_1280793 | 3300048904 | Bacteria | 573 |
| 717 | Ga0496102_0001719 | 3300048905 | Bacteria | 19153 |
| 718 | Ga0496102_0080567 | 3300048905 | Bacteria | 2999 |
| 719 | Ga0496102_0126509 | 3300048905 | Bacteria | 2389 |
| 720 | Ga0496102_0283621 | 3300048905 | Bacteria | 1561 |
| 721 | Ga0496103_0080194 | 3300048906 | Bacteria | 2052 |
| 722 | Ga0496103_0148716 | 3300048906 | Bacteria | 1500 |
| 723 | Ga0496103_0271787 | 3300048906 | Bacteria | 1090 |
| 724 | Ga0496103_0370795 | 3300048906 | Bacteria | 920 |
| 725 | Ga0496103_0450129 | 3300048906 | Bacteria | 826 |
| 726 | Ga0496104_0023791 | 3300048907 | Bacteria | 5633 |
| 727 | Ga0496104_0095175 | 3300048907 | Bacteria | 2849 |
| 728 | Ga0496104_0151405 | 3300048907 | Bacteria | 2226 |
| 729 | Ga0496104_0466344 | 3300048907 | Bacteria | 1174 |
| 730 | Ga0496104_0879008 | 3300048907 | Bacteria | 801 |
| 731 | Ga0496104_0926232 | 3300048907 | Bacteria | 776 |
| 732 | Ga0496104_1152905 | 3300048907 | Bacteria | 678 |
| 733 | Ga0496105_0219865 | 3300048908 | Bacteria | 1546 |
| 734 | Ga0496105_0320689 | 3300048908 | Bacteria | 1242 |
| 735 | Ga0496106_0029860 | 3300048909 | Bacteria | 4063 |
| 736 | Ga0496106_0065555 | 3300048909 | Bacteria | 2765 |
| 737 | Ga0496106_0320136 | 3300048909 | Bacteria | 1245 |
| 738 | Ga0496106_0372097 | 3300048909 | Bacteria | 1148 |
| 739 | Ga0496106_0813229 | 3300048909 | Bacteria | 741 |
| 740 | Ga0496106_0937594 | 3300048909 | Bacteria | 682 |
| 741 | Ga0496107_0003518 | 3300048910 | Bacteria | 10486 |
| 742 | Ga0496107_0080303 | 3300048910 | Bacteria | 2378 |
| 743 | Ga0496107_0494864 | 3300048910 | Bacteria | 907 |
| 744 | Ga0496107_0541779 | 3300048910 | Bacteria | 862 |
| 745 | Ga0496107_0850685 | 3300048910 | Unclassified | 666 |
| 746 | Ga0496108_0003564 | 3300048911 | Bacteria | 12475 |
| 747 | Ga0496108_0077630 | 3300048911 | Bacteria | 2809 |
| 748 | Ga0496108_0786651 | 3300048911 | Bacteria | 821 |
| 749 | Ga0496108_1289988 | 3300048911 | Bacteria | 614 |
| 750 | Ga0496109_0031188 | 3300048912 | Bacteria | 4781 |
| 751 | Ga0496109_0089590 | 3300048912 | Bacteria | 2844 |
| 752 | Ga0496109_0125045 | 3300048912 | Bacteria | 2397 |
| 753 | Ga0496109_0138280 | 3300048912 | Bacteria | 2277 |
| 754 | Ga0496109_0401832 | 3300048912 | Bacteria | 1294 |
| 755 | Ga0496109_0789332 | 3300048912 | Bacteria | 888 |
| 756 | Ga0496109_1220479 | 3300048912 | Bacteria | 688 |
| 757 | Ga0496109_1780814 | 3300048912 | Bacteria | 549 |
| 758 | Ga0496110_0052783 | 3300048913 | Bacteria | 3572 |
| 759 | Ga0496110_0130099 | 3300048913 | Bacteria | 2272 |
| 760 | Ga0496110_0258038 | 3300048913 | Bacteria | 1586 |
| 761 | Ga0496111_0005894 | 3300048914 | Bacteria | 7902 |
| 762 | Ga0496111_0027142 | 3300048914 | Bacteria | 4048 |
| 763 | Ga0496111_0083665 | 3300048914 | Bacteria | 2332 |
| 764 | Ga0496111_0091086 | 3300048914 | Bacteria | 2234 |
| 765 | Ga0496111_0229057 | 3300048914 | Bacteria | 1380 |
| 766 | Ga0496111_0817705 | 3300048914 | Bacteria | 674 |
| 767 | Ga0496112_0005957 | 3300048915 | Bacteria | 10635 |
| 768 | Ga0496112_0163212 | 3300048915 | Bacteria | 2194 |
| 769 | Ga0496112_0310217 | 3300048915 | Bacteria | 1523 |
| 770 | Ga0496112_0386318 | 3300048915 | Bacteria | 1340 |
| 771 | Ga0496112_0396007 | 3300048915 | Bacteria | 1321 |
| 772 | Ga0496112_0443895 | 3300048915 | Bacteria | 1235 |
| 773 | Ga0496113_0086292 | 3300048916 | Bacteria | 2411 |
| 774 | Ga0496113_0198838 | 3300048916 | Bacteria | 1593 |
| 775 | Ga0496113_1053132 | 3300048916 | Bacteria | 639 |
| 776 | Ga0496113_1221452 | 3300048916 | Bacteria | 586 |
| 777 | Ga0496113_1451091 | 3300048916 | Bacteria | 530 |
| 778 | Ga0496114_0011420 | 3300048917 | Bacteria | 7097 |
| 779 | Ga0496114_0244124 | 3300048917 | Bacteria | 1579 |
| 780 | Ga0496114_0328723 | 3300048917 | Bacteria | 1351 |
| 781 | Ga0496114_0547627 | 3300048917 | Bacteria | 1022 |
| 782 | Ga0496115_0003592 | 3300048918 | Bacteria | 11145 |
| 783 | Ga0496115_0474854 | 3300048918 | Bacteria | 1007 |
| 784 | Ga0496115_0746191 | 3300048918 | Bacteria | 766 |
| 785 | Ga0496115_1014588 | 3300048918 | Bacteria | 633 |
| 786 | Ga0501299_072641 | 3300049522 | Bacteria | 750 |
| 787 | Ga0501031_0001067 | 3300049568 | Bacteria | 16637 |
| 788 | Ga0501031_0376422 | 3300049568 | Bacteria | 919 |
| 789 | Ga0501033_0049052 | 3300049570 | Bacteria | 3135 |
| 790 | Ga0501036_0088574 | 3300049572 | Bacteria | 2616 |
| 791 | Ga0501036_0780104 | 3300049572 | Bacteria | 788 |
| 792 | Ga0501036_1080826 | 3300049572 | Bacteria | 656 |
| 793 | Ga0501037_0207896 | 3300049573 | Bacteria | 1381 |
| 794 | Ga0501038_0016739 | 3300049574 | Bacteria | 6641 |
| 795 | Ga0501038_0585211 | 3300049574 | Bacteria | 846 |
| 796 | Ga0501039_0019894 | 3300049575 | Bacteria | 5145 |
| 797 | Ga0501040_0011907 | 3300049576 | Bacteria | 5690 |
| 798 | Ga0501040_0135597 | 3300049576 | Bacteria | 1733 |
| 799 | Ga0501040_0259456 | 3300049576 | Bacteria | 1240 |
| 800 | Ga0501040_0527902 | 3300049576 | Bacteria | 851 |
| 801 | Ga0501040_0792006 | 3300049576 | Bacteria | 686 |
| 802 | Ga0501040_0846995 | 3300049576 | Bacteria | 662 |
| 803 | Ga0501041_0013469 | 3300049577 | Bacteria | 4848 |
| 804 | Ga0501041_0166991 | 3300049577 | Bacteria | 1377 |
| 805 | Ga0501041_0405148 | 3300049577 | Bacteria | 864 |
| 806 | Ga0501042_0021290 | 3300049578 | Bacteria | 4516 |
| 807 | Ga0501042_0077759 | 3300049578 | Bacteria | 2376 |
| 808 | Ga0501042_0606751 | 3300049578 | Bacteria | 796 |
| 809 | Ga0501043_0017822 | 3300049579 | Bacteria | 5567 |
| 810 | Ga0501043_0445460 | 3300049579 | Bacteria | 974 |
| 811 | Ga0501047_1153841 | 3300049581 | Bacteria | 588 |
| 812 | Ga0501047_1171040 | 3300049581 | Bacteria | 582 |
| 813 | Ga0501048_0003924 | 3300049582 | Bacteria | 11299 |
| 814 | Ga0501048_0455262 | 3300049582 | Bacteria | 917 |
| 815 | Ga0501048_0477212 | 3300049582 | Bacteria | 894 |
| 816 | Ga0501067_0067585 | 3300049583 | Bacteria | 1979 |
| 817 | Ga0501067_0113289 | 3300049583 | Unclassified | 1508 |
| 818 | Ga0501067_0349865 | 3300049583 | Unclassified | 824 |
| 819 | Ga0501067_0897735 | 3300049583 | Bacteria | 500 |
| 820 | Ga0501068_0105560 | 3300049584 | Bacteria | 1748 |
| 821 | Ga0501069_0074742 | 3300049585 | Bacteria | 1902 |
| 822 | Ga0501070_0030372 | 3300049586 | Bacteria | 4528 |
| 823 | Ga0501070_1223207 | 3300049586 | Bacteria | 576 |
| 824 | Ga0501071_0029040 | 3300049587 | Bacteria | 3900 |
| 825 | Ga0501071_0949584 | 3300049587 | Bacteria | 664 |
| 826 | Ga0501072_0008312 | 3300049588 | Bacteria | 7883 |
| 827 | Ga0501072_0374638 | 3300049588 | Bacteria | 1130 |
| 828 | Ga0501072_1527058 | 3300049588 | Bacteria | 515 |
| 829 | Ga0501072_1550132 | 3300049588 | Bacteria | 511 |
| 830 | Ga0501073_0152043 | 3300049589 | Bacteria | 1604 |
| 831 | Ga0501074_0006779 | 3300049590 | Bacteria | 8267 |
| 832 | Ga0501074_0942084 | 3300049590 | Bacteria | 607 |
| 833 | Ga0501074_1075677 | 3300049590 | Bacteria | 565 |
| 834 | Ga0501075_0334210 | 3300049591 | Bacteria | 1154 |
| 835 | Ga0501075_0411238 | 3300049591 | Bacteria | 1031 |
| 836 | Ga0501075_0480364 | 3300049591 | Bacteria | 948 |
| 837 | Ga0501075_1383773 | 3300049591 | Bacteria | 533 |
| 838 | Ga0501075_1384112 | 3300049591 | Unclassified | 533 |
| 839 | Ga0501076_0013821 | 3300049592 | Bacteria | 6059 |
| 840 | Ga0501076_0145007 | 3300049592 | Bacteria | 1930 |
| 841 | Ga0501077_0007451 | 3300049593 | Bacteria | 6750 |
| 842 | Ga0501077_0008854 | 3300049593 | Bacteria | 6245 |
| 843 | Ga0501077_0073551 | 3300049593 | Bacteria | 2165 |
| 844 | Ga0501077_0403495 | 3300049593 | Unclassified | 874 |
| 845 | Ga0501079_0005553 | 3300049741 | Bacteria | 9405 |
| 846 | Ga0501079_0144867 | 3300049741 | Bacteria | 1851 |
| 847 | Ga0501079_1132473 | 3300049741 | Bacteria | 616 |
| 848 | Ga0501080_0069088 | 3300049742 | Bacteria | 3285 |
| 849 | Ga0501080_0818719 | 3300049742 | Bacteria | 816 |
| 850 | Ga0501081_0022634 | 3300049743 | Bacteria | 4206 |
| 851 | Ga0501081_0023948 | 3300049743 | Bacteria | 4096 |
| 852 | Ga0501081_0827342 | 3300049743 | Bacteria | 697 |
| 853 | Ga0501081_0875377 | 3300049743 | Unclassified | 677 |
| 854 | Ga0501083_0197294 | 3300049744 | Bacteria | 1313 |
| 855 | Ga0501035_0099401 | 3300049822 | Bacteria | 2554 |
| 856 | Ga0501035_1073312 | 3300049822 | Unclassified | 630 |
| 857 | Ga0501044_0447798 | 3300049823 | Bacteria | 1198 |
| 858 | Ga0501045_0007617 | 3300049824 | Bacteria | 7525 |
| 859 | Ga0501045_0487089 | 3300049824 | Bacteria | 916 |
| 860 | Ga0501045_0640857 | 3300049824 | Bacteria | 786 |
| 861 | Ga0501045_0740308 | 3300049824 | Unclassified | 725 |
| 862 | Ga0501045_0807452 | 3300049824 | Bacteria | 691 |
| 863 | Ga0501045_0970651 | 3300049824 | Bacteria | 623 |
| 864 | nmdc:mga05p37_1364991_c1 | 3300050507 | Bacteria | 717 |
| 865 | nmdc:mga05p37_1463306_c1 | 3300050507 | Bacteria | 683 |
| 866 | nmdc:mga05p37_1807082_c1 | 3300050507 | Bacteria | 589 |
| 867 | nmdc:mga05p37_41768_c1 | 3300050507 | Bacteria | 5631 |
| 868 | nmdc:mga05p37_58255_c1 | 3300050507 | Bacteria | 3725 |
| 869 | nmdc:mga05p37_994354_c1 | 3300050507 | Bacteria | 892 |
| 870 | nmdc:mga09592_290734_c1 | 3300050508 | Bacteria | 1417 |
| 871 | nmdc:mga0qj67_663541_c1 | 3300050509 | Bacteria | 831 |
| 872 | nmdc:mga06r32_306332_c1 | 3300050510 | Bacteria | 1574 |
| 873 | nmdc:mga08y16_187104_c1 | 3300050511 | Bacteria | 2148 |
| 874 | nmdc:mga08y16_809306_c1 | 3300050511 | Bacteria | 929 |
| 875 | nmdc:mga0n895_331074_c1 | 3300050512 | Bacteria | 1543 |
| 876 | nmdc:mga0n895_513995_c1 | 3300050512 | Bacteria | 1206 |
| 877 | nmdc:mga0n895_516161_c1 | 3300050512 | Bacteria | 1203 |
| 878 | nmdc:mga0n895_581640_c1 | 3300050512 | Bacteria | 1123 |
| 879 | nmdc:mga0rr50_1642956_c1 | 3300050513 | Unclassified | 542 |
| 880 | nmdc:mga0rr50_662144_c1 | 3300050513 | Bacteria | 891 |
| 881 | nmdc:mga08x19_1079139_c1 | 3300050514 | Bacteria | 570 |
| 882 | nmdc:mga08x19_279209_c1 | 3300050514 | Bacteria | 1157 |
| 883 | nmdc:mga08x19_44535_c1 | 3300050514 | Bacteria | 2833 |
| 884 | nmdc:mga0a205_298849_c1 | 3300050515 | Bacteria | 1483 |
| 885 | nmdc:mga0a205_461435_c1 | 3300050515 | Bacteria | 1130 |
| 886 | nmdc:mga0a205_937546_c1 | 3300050515 | Bacteria | 712 |
| 887 | Ga0495601_0002178 | 3300053077 | Bacteria | 11028 |
| 888 | Ga0495601_0004792 | 3300053077 | Bacteria | 7843 |
| 889 | Ga0495601_0011903 | 3300053077 | Bacteria | 5214 |
| 890 | Ga0495601_0171877 | 3300053077 | Bacteria | 1416 |
| 891 | Ga0495601_0495633 | 3300053077 | Bacteria | 788 |
| 892 | Ga0495601_1036890 | 3300053077 | Bacteria | 515 |
| 893 | Ga0495612_0023169 | 3300053078 | Bacteria | 2490 |
| 894 | Ga0495612_0141548 | 3300053078 | Bacteria | 1043 |
| 895 | Ga0495612_0199973 | 3300053078 | Bacteria | 881 |
| 896 | Ga0495655_0109583 | 3300053083 | Bacteria | 828 |
| 897 | Ga0495595_0116044 | 3300053084 | Bacteria | 1301 |
| 898 | Ga0495619_0018551 | 3300053085 | Bacteria | 4414 |
| 899 | Ga0495619_0177702 | 3300053085 | Bacteria | 1472 |
| 900 | Ga0495619_0270515 | 3300053085 | Bacteria | 1177 |
| 901 | Ga0495619_0304755 | 3300053085 | Bacteria | 1103 |
| 902 | Ga0495619_0588705 | 3300053085 | Bacteria | 761 |
| 903 | Ga0500566_0029077 | 3300053094 | Bacteria | 3229 |
| 904 | Ga0501084_0237553 | 3300054114 | Bacteria | 1538 |
| 905 | Ga0501084_0276622 | 3300054114 | Bacteria | 1417 |
| 906 | Ga0501084_0904838 | 3300054114 | Bacteria | 742 |
| 907 | Ga0501084_1068688 | 3300054114 | Bacteria | 678 |
| 908 | Ga0590075_057663 | 3300059424 | Bacteria | 1000 |
| 909 | Ga0590077_032479 | 3300059426 | Bacteria | 1144 |
| 910 | Ga0501082_0030156 | 3300060353 | Bacteria | 4674 |
| 911 | Ga0501082_0292369 | 3300060353 | Bacteria | 1418 |
| 912 | Ga0501082_0703213 | 3300060353 | Bacteria | 885 |
| 913 | Ga0501082_1069839 | 3300060353 | Bacteria | 705 |
| 914 | Ga0501082_1171893 | 3300060353 | Bacteria | 672 |
| 915 | Ga0466962_0003630 | 3300061719 | Bacteria | 7359 |
| 916 | Ga0466962_0006235 | 3300061719 | Bacteria | 5727 |
| 917 | Ga0466962_0007473 | 3300061719 | Bacteria | 5244 |
| 918 | Ga0466962_0019218 | 3300061719 | Bacteria | 3281 |
| 919 | Ga0466962_0076362 | 3300061719 | Bacteria | 1601 |
| 920 | Ga0466962_0081564 | 3300061719 | Bacteria | 1547 |
| 921 | Ga0466962_0458445 | 3300061719 | Bacteria | 642 |
| 922 | Ga0530510_0036177 | 3300061734 | Bacteria | 3558 |
| 923 | Ga0530510_0205028 | 3300061734 | Bacteria | 1465 |
| 924 | Ga0530510_0489425 | 3300061734 | Bacteria | 932 |
| 925 | Ga0530510_0555156 | 3300061734 | Bacteria | 872 |
| 926 | Ga0530510_1042104 | 3300061734 | Bacteria | 626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006028 | Ga0070717_10487220 | Ga0070717_104872202 | 66 |
| 2 | 3300046454 | Ga0495592_0005522 | Ga0495592_0005522_1568_1801 | 66 |
| 3 | 3300046462 | Ga0495651_0053221 | Ga0495651_0053221_1543_1776 | 66 |
| 4 | 3300046463 | Ga0495653_0007515 | Ga0495653_0007515_7907_8140 | 66 |
| 5 | 3300046511 | Ga0495608_0143686 | Ga0495608_0143686_72_305 | 66 |
| 6 | 3300046511 | Ga0495608_0802511 | Ga0495608_0802511_127_360 | 66 |
| 7 | 3300046529 | Ga0495652_0011344 | Ga0495652_0011344_6981_7214 | 66 |
| 8 | 3300046533 | Ga0495640_0954950 | Ga0495640_0954950_259_492 | 66 |
| 9 | 3300046536 | Ga0495587_0007700 | Ga0495587_0007700_76_309 | 66 |
| 10 | 3300046543 | Ga0495645_0300131 | Ga0495645_0300131_740_973 | 66 |
| 11 | 3300046543 | Ga0495645_0652807 | Ga0495645_0652807_267_500 | 66 |
| 12 | 3300046559 | Ga0495667_0918867 | Ga0495667_0918867_47_280 | 66 |
| 13 | 3300046663 | Ga0495635_0016143 | Ga0495635_0016143_149_382 | 66 |
| 14 | 3300046675 | Ga0495657_0080116 | Ga0495657_0080116_1743_1976 | 66 |
| 15 | 3300046675 | Ga0495657_0503046 | Ga0495657_0503046_152_385 | 66 |
| 16 | 3300046678 | Ga0495599_0439454 | Ga0495599_0439454_501_734 | 66 |
| 17 | 3300046679 | Ga0495623_0099293 | Ga0495623_0099293_1478_1711 | 66 |
| 18 | 3300046680 | Ga0495646_0185068 | Ga0495646_0185068_633_866 | 66 |
| 19 | 3300046809 | Ga0495600_0092060 | Ga0495600_0092060_730_963 | 66 |
| 20 | 3300047319 | Ga0495674_0061607 | Ga0495674_0061607_2972_3205 | 66 |
| 21 | 3300047322 | Ga0495680_0070522 | Ga0495680_0070522_1600_1833 | 66 |
| 22 | 3300047444 | Ga0495675_0547176 | Ga0495675_0547176_352_585 | 66 |
| 23 | 3300047471 | Ga0495684_0103727 | Ga0495684_0103727_163_396 | 66 |
| 24 | 3300048088 | Ga0495602_0273539 | Ga0495602_0273539_950_1183 | 66 |
| 25 | 3300053077 | Ga0495601_0004792 | Ga0495601_0004792_973_1206 | 66 |
| 26 | 3300053078 | Ga0495612_0023169 | Ga0495612_0023169_26_259 | 66 |
| 27 | 3300009098 | Ga0105245_10250487 | Ga0105245_102504873 | 73 |
| 28 | 3300005331 | Ga0070670_100397215 | Ga0070670_1003972153 | 76 |
| 29 | 3300005337 | Ga0070682_100651027 | Ga0070682_1006510272 | 76 |
| 30 | 3300005338 | Ga0068868_100750976 | Ga0068868_1007509763 | 76 |
| 31 | 3300005340 | Ga0070689_100110905 | Ga0070689_1001109052 | 76 |
| 32 | 3300005340 | Ga0070689_102049872 | Ga0070689_1020498722 | 76 |
| 33 | 3300005345 | Ga0070692_10083591 | Ga0070692_100835913 | 76 |
| 34 | 3300005347 | Ga0070668_100361639 | Ga0070668_1003616391 | 76 |
| 35 | 3300005354 | Ga0070675_100051021 | Ga0070675_1000510213 | 76 |
| 36 | 3300005354 | Ga0070675_101896470 | Ga0070675_1018964701 | 76 |
| 37 | 3300005356 | Ga0070674_101421182 | Ga0070674_1014211821 | 76 |
| 38 | 3300005364 | Ga0070673_100550992 | Ga0070673_1005509922 | 76 |
| 39 | 3300005364 | Ga0070673_102261066 | Ga0070673_1022610662 | 76 |
| 40 | 3300005365 | Ga0070688_101598757 | Ga0070688_1015987572 | 76 |
| 41 | 3300005438 | Ga0070701_11418078 | Ga0070701_114180782 | 76 |
| 42 | 3300005441 | Ga0070700_100921485 | Ga0070700_1009214851 | 76 |
| 43 | 3300005441 | Ga0070700_101089409 | Ga0070700_1010894092 | 76 |
| 44 | 3300005455 | Ga0070663_100640945 | Ga0070663_1006409453 | 76 |
| 45 | 3300005456 | Ga0070678_100075237 | Ga0070678_1000752372 | 76 |
| 46 | 3300005457 | Ga0070662_101591548 | Ga0070662_1015915482 | 76 |
| 47 | 3300005458 | Ga0070681_10364277 | Ga0070681_103642773 | 76 |
| 48 | 3300005458 | Ga0070681_11816076 | Ga0070681_118160762 | 76 |
| 49 | 3300005459 | Ga0068867_100514805 | Ga0068867_1005148053 | 76 |
| 50 | 3300005459 | Ga0068867_101192521 | Ga0068867_1011925211 | 76 |
| 51 | 3300005467 | Ga0070706_100317981 | Ga0070706_1003179813 | 76 |
| 52 | 3300005471 | Ga0070698_100092057 | Ga0070698_1000920574 | 76 |
| 53 | 3300005518 | Ga0070699_100126495 | Ga0070699_1001264953 | 76 |
| 54 | 3300005518 | Ga0070699_100584748 | Ga0070699_1005847483 | 76 |
| 55 | 3300005535 | Ga0070684_100302945 | Ga0070684_1003029452 | 76 |
| 56 | 3300005535 | Ga0070684_100444116 | Ga0070684_1004441163 | 76 |
| 57 | 3300005535 | Ga0070684_101480506 | Ga0070684_1014805062 | 76 |
| 58 | 3300005543 | Ga0070672_100157353 | Ga0070672_1001573533 | 76 |
| 59 | 3300005543 | Ga0070672_101145764 | Ga0070672_1011457642 | 76 |
| 60 | 3300005543 | Ga0070672_101261144 | Ga0070672_1012611442 | 76 |
| 61 | 3300005544 | Ga0070686_100041395 | Ga0070686_1000413952 | 76 |
| 62 | 3300005545 | Ga0070695_101135042 | Ga0070695_1011350422 | 76 |
| 63 | 3300005546 | Ga0070696_100527814 | Ga0070696_1005278141 | 76 |
| 64 | 3300005547 | Ga0070693_100112440 | Ga0070693_1001124401 | 76 |
| 65 | 3300005549 | Ga0070704_100356772 | Ga0070704_1003567721 | 76 |
| 66 | 3300005563 | Ga0068855_101108618 | Ga0068855_1011086182 | 76 |
| 67 | 3300005563 | Ga0068855_101924310 | Ga0068855_1019243102 | 76 |
| 68 | 3300005564 | Ga0070664_101939627 | Ga0070664_1019396272 | 76 |
| 69 | 3300005578 | Ga0068854_100017506 | Ga0068854_1000175067 | 76 |
| 70 | 3300005615 | Ga0070702_100028049 | Ga0070702_1000280493 | 76 |
| 71 | 3300005718 | Ga0068866_11293779 | Ga0068866_112937792 | 76 |
| 72 | 3300005840 | Ga0068870_10165339 | Ga0068870_101653392 | 76 |
| 73 | 3300005841 | Ga0068863_102093770 | Ga0068863_1020937702 | 76 |
| 74 | 3300005842 | Ga0068858_101256939 | Ga0068858_1012569392 | 76 |
| 75 | 3300005843 | Ga0068860_101297249 | Ga0068860_1012972492 | 76 |
| 76 | 3300005844 | Ga0068862_102642739 | Ga0068862_1026427392 | 76 |
| 77 | 3300005937 | Ga0081455_10014606 | Ga0081455_100146066 | 76 |
| 78 | 3300005937 | Ga0081455_10028287 | Ga0081455_100282877 | 76 |
| 79 | 3300006178 | Ga0075367_11078854 | Ga0075367_110788542 | 76 |
| 80 | 3300006237 | Ga0097621_101856085 | Ga0097621_1018560852 | 76 |
| 81 | 3300006844 | Ga0075428_101986613 | Ga0075428_1019866132 | 76 |
| 82 | 3300006846 | Ga0075430_100870158 | Ga0075430_1008701582 | 76 |
| 83 | 3300006847 | Ga0075431_100067662 | Ga0075431_1000676623 | 76 |
| 84 | 3300006847 | Ga0075431_101667871 | Ga0075431_1016678712 | 76 |
| 85 | 3300006852 | Ga0075433_10309150 | Ga0075433_103091502 | 76 |
| 86 | 3300006871 | Ga0075434_100077763 | Ga0075434_1000777635 | 76 |
| 87 | 3300006880 | Ga0075429_100110768 | Ga0075429_1001107683 | 76 |
| 88 | 3300006881 | Ga0068865_100414591 | Ga0068865_1004145913 | 76 |
| 89 | 3300006914 | Ga0075436_100042448 | Ga0075436_1000424484 | 76 |
| 90 | 3300006914 | Ga0075436_100197233 | Ga0075436_1001972332 | 76 |
| 91 | 3300009093 | Ga0105240_10786652 | Ga0105240_107866521 | 76 |
| 92 | 3300009094 | Ga0111539_10568978 | Ga0111539_105689783 | 76 |
| 93 | 3300009094 | Ga0111539_11871176 | Ga0111539_118711762 | 76 |
| 94 | 3300009094 | Ga0111539_11882715 | Ga0111539_118827152 | 76 |
| 95 | 3300009098 | Ga0105245_10023710 | Ga0105245_100237106 | 76 |
| 96 | 3300009098 | Ga0105245_10363355 | Ga0105245_103633552 | 76 |
| 97 | 3300009101 | Ga0105247_10211950 | Ga0105247_102119501 | 76 |
| 98 | 3300009101 | Ga0105247_10750519 | Ga0105247_107505192 | 76 |
| 99 | 3300009147 | Ga0114129_10074808 | Ga0114129_100748084 | 76 |
| 100 | 3300009147 | Ga0114129_10109054 | Ga0114129_101090542 | 76 |
| 101 | 3300009147 | Ga0114129_10738990 | Ga0114129_107389903 | 76 |
| 102 | 3300009147 | Ga0114129_12142471 | Ga0114129_121424712 | 76 |
| 103 | 3300009148 | Ga0105243_10135016 | Ga0105243_101350162 | 76 |
| 104 | 3300009148 | Ga0105243_11154668 | Ga0105243_111546682 | 76 |
| 105 | 3300009148 | Ga0105243_11166797 | Ga0105243_111667972 | 76 |
| 106 | 3300009174 | Ga0105241_12320141 | Ga0105241_123201412 | 76 |
| 107 | 3300009177 | Ga0105248_12707521 | Ga0105248_127075212 | 76 |
| 108 | 3300009177 | Ga0105248_12928016 | Ga0105248_129280161 | 76 |
| 109 | 3300009553 | Ga0105249_12059326 | Ga0105249_120593262 | 76 |
| 110 | 3300009987 | Ga0105030_104081 | Ga0105030_1040813 | 76 |
| 111 | 3300010375 | Ga0105239_10084330 | Ga0105239_100843306 | 76 |
| 112 | 3300010375 | Ga0105239_12429694 | Ga0105239_124296942 | 76 |
| 113 | 3300013102 | Ga0157371_11073687 | Ga0157371_110736872 | 76 |
| 114 | 3300013296 | Ga0157374_11781422 | Ga0157374_117814222 | 76 |
| 115 | 3300013297 | Ga0157378_10452806 | Ga0157378_104528061 | 76 |
| 116 | 3300013306 | Ga0163162_10805839 | Ga0163162_108058393 | 76 |
| 117 | 3300013308 | Ga0157375_10260119 | Ga0157375_102601194 | 76 |
| 118 | 3300013308 | Ga0157375_11116036 | Ga0157375_111160363 | 76 |
| 119 | 3300013308 | Ga0157375_11598201 | Ga0157375_115982012 | 76 |
| 120 | 3300014325 | Ga0163163_10461987 | Ga0163163_104619873 | 76 |
| 121 | 3300014326 | Ga0157380_10122016 | Ga0157380_101220163 | 76 |
| 122 | 3300014745 | Ga0157377_10216151 | Ga0157377_102161512 | 76 |
| 123 | 3300014745 | Ga0157377_10641935 | Ga0157377_106419352 | 76 |
| 124 | 3300025901 | Ga0207688_10133801 | Ga0207688_101338012 | 76 |
| 125 | 3300025901 | Ga0207688_10321841 | Ga0207688_103218411 | 76 |
| 126 | 3300025908 | Ga0207643_10163444 | Ga0207643_101634443 | 76 |
| 127 | 3300025912 | Ga0207707_10340746 | Ga0207707_103407463 | 76 |
| 128 | 3300025912 | Ga0207707_11436219 | Ga0207707_114362191 | 76 |
| 129 | 3300025917 | Ga0207660_10231942 | Ga0207660_102319422 | 76 |
| 130 | 3300025919 | Ga0207657_10227776 | Ga0207657_102277762 | 76 |
| 131 | 3300025921 | Ga0207652_10654765 | Ga0207652_106547652 | 76 |
| 132 | 3300025923 | Ga0207681_10848716 | Ga0207681_108487162 | 76 |
| 133 | 3300025926 | Ga0207659_10225399 | Ga0207659_102253993 | 76 |
| 134 | 3300025927 | Ga0207687_10183354 | Ga0207687_101833543 | 76 |
| 135 | 3300025931 | Ga0207644_10467735 | Ga0207644_104677352 | 76 |
| 136 | 3300025933 | Ga0207706_10421842 | Ga0207706_104218423 | 76 |
| 137 | 3300025933 | Ga0207706_10510444 | Ga0207706_105104443 | 76 |
| 138 | 3300025935 | Ga0207709_10042657 | Ga0207709_100426574 | 76 |
| 139 | 3300025936 | Ga0207670_11019127 | Ga0207670_110191272 | 76 |
| 140 | 3300025938 | Ga0207704_10387689 | Ga0207704_103876891 | 76 |
| 141 | 3300025938 | Ga0207704_10693426 | Ga0207704_106934262 | 76 |
| 142 | 3300025938 | Ga0207704_11254096 | Ga0207704_112540962 | 76 |
| 143 | 3300025939 | Ga0207665_10412244 | Ga0207665_104122442 | 76 |
| 144 | 3300025940 | Ga0207691_10073098 | Ga0207691_100730983 | 76 |
| 145 | 3300025940 | Ga0207691_11011857 | Ga0207691_110118573 | 76 |
| 146 | 3300025942 | Ga0207689_10125116 | Ga0207689_101251163 | 76 |
| 147 | 3300025944 | Ga0207661_11301007 | Ga0207661_113010072 | 76 |
| 148 | 3300025945 | Ga0207679_10140474 | Ga0207679_101404743 | 76 |
| 149 | 3300025960 | Ga0207651_11262318 | Ga0207651_112623181 | 76 |
| 150 | 3300025960 | Ga0207651_12004624 | Ga0207651_120046242 | 76 |
| 151 | 3300025972 | Ga0207668_12080532 | Ga0207668_120805322 | 76 |
| 152 | 3300025981 | Ga0207640_10086461 | Ga0207640_100864612 | 76 |
| 153 | 3300026023 | Ga0207677_11143427 | Ga0207677_111434272 | 76 |
| 154 | 3300026035 | Ga0207703_11671488 | Ga0207703_116714883 | 76 |
| 155 | 3300026075 | Ga0207708_10643677 | Ga0207708_106436772 | 76 |
| 156 | 3300026078 | Ga0207702_10995894 | Ga0207702_109958943 | 76 |
| 157 | 3300026088 | Ga0207641_10811404 | Ga0207641_108114042 | 76 |
| 158 | 3300026089 | Ga0207648_10656375 | Ga0207648_106563752 | 76 |
| 159 | 3300026089 | Ga0207648_11075891 | Ga0207648_110758911 | 76 |
| 160 | 3300026095 | Ga0207676_10683765 | Ga0207676_106837653 | 76 |
| 161 | 3300026118 | Ga0207675_100359663 | Ga0207675_1003596632 | 76 |
| 162 | 3300026121 | Ga0207683_10157773 | Ga0207683_101577733 | 76 |
| 163 | 3300027682 | Ga0209971_1078601 | Ga0209971_10786011 | 76 |
| 164 | 3300027907 | Ga0207428_10495778 | Ga0207428_104957782 | 76 |
| 165 | 3300028379 | Ga0268266_11338137 | Ga0268266_113381372 | 76 |
| 166 | 3300028380 | Ga0268265_11456006 | Ga0268265_114560062 | 76 |
| 167 | 3300031548 | Ga0307408_100133893 | Ga0307408_1001338933 | 76 |
| 168 | 3300031824 | Ga0307413_10717980 | Ga0307413_107179802 | 76 |
| 169 | 3300031824 | Ga0307413_10906961 | Ga0307413_109069612 | 76 |
| 170 | 3300031824 | Ga0307413_11193891 | Ga0307413_111938911 | 76 |
| 171 | 3300031824 | Ga0307413_11749456 | Ga0307413_117494562 | 76 |
| 172 | 3300031852 | Ga0307410_11664537 | Ga0307410_116645371 | 76 |
| 173 | 3300031903 | Ga0307407_10575396 | Ga0307407_105753963 | 76 |
| 174 | 3300031903 | Ga0307407_11461607 | Ga0307407_114616072 | 76 |
| 175 | 3300031995 | Ga0307409_100120949 | Ga0307409_1001209493 | 76 |
| 176 | 3300031995 | Ga0307409_100484609 | Ga0307409_1004846093 | 76 |
| 177 | 3300031995 | Ga0307409_100702210 | Ga0307409_1007022103 | 76 |
| 178 | 3300031995 | Ga0307409_100831742 | Ga0307409_1008317423 | 76 |
| 179 | 3300031995 | Ga0307409_100948464 | Ga0307409_1009484642 | 76 |
| 180 | 3300032002 | Ga0307416_100935322 | Ga0307416_1009353223 | 76 |
| 181 | 3300032002 | Ga0307416_101501839 | Ga0307416_1015018393 | 76 |
| 182 | 3300032002 | Ga0307416_101744079 | Ga0307416_1017440792 | 76 |
| 183 | 3300032002 | Ga0307416_101745106 | Ga0307416_1017451062 | 76 |
| 184 | 3300032002 | Ga0307416_103895203 | Ga0307416_1038952031 | 76 |
| 185 | 3300032005 | Ga0307411_10694364 | Ga0307411_106943642 | 76 |
| 186 | 3300032005 | Ga0307411_11771550 | Ga0307411_117715502 | 76 |
| 187 | 3300032126 | Ga0307415_102130496 | Ga0307415_1021304961 | 76 |
| 188 | 3300032168 | Ga0316593_10150305 | Ga0316593_101503051 | 76 |
| 189 | 3300032168 | Ga0316593_10268019 | Ga0316593_102680192 | 76 |
| 190 | 3300035410 | Ga0373924_0040697 | Ga0373924_0040697_177_407 | 76 |
| 191 | 3300035724 | Ga0373933_0852239 | Ga0373933_0852239_240_488 | 76 |
| 192 | 3300037312 | Ga0395899_0009988 | Ga0395899_0009988_4704_4934 | 76 |
| 193 | 3300037418 | Ga0395900_0020924 | Ga0395900_0020924_616_846 | 76 |
| 194 | 3300037466 | Ga0395898_0291577 | Ga0395898_0291577_711_941 | 76 |
| 195 | 3300037466 | Ga0395898_0634226 | Ga0395898_0634226_530_760 | 76 |
| 196 | 3300037471 | Ga0395905_0128781 | Ga0395905_0128781_1997_2227 | 76 |
| 197 | 3300037471 | Ga0395905_1378417 | Ga0395905_1378417_358_588 | 76 |
| 198 | 3300038443 | Ga0395901_0060212 | Ga0395901_0060212_793_1023 | 76 |
| 199 | 3300038443 | Ga0395901_1542327 | Ga0395901_1542327_98_328 | 76 |
| 200 | 3300041404 | Ga0439436_0078138 | Ga0439436_0078138_598_828 | 76 |
| 201 | 3300041405 | Ga0439438_022461 | Ga0439438_022461_1014_1244 | 76 |
| 202 | 3300041408 | Ga0439453_0169369 | Ga0439453_0169369_52_282 | 76 |
| 203 | 3300041410 | Ga0439461_0012464 | Ga0439461_0012464_1105_1335 | 76 |
| 204 | 3300041410 | Ga0439461_0117805 | Ga0439461_0117805_72_302 | 76 |
| 205 | 3300041411 | Ga0439466_0132485 | Ga0439466_0132485_388_618 | 76 |
| 206 | 3300041443 | Ga0451789_0212464 | Ga0451789_0212464_141_380 | 76 |
| 207 | 3300041997 | Ga0439431_0041721 | Ga0439431_0041721_647_877 | 76 |
| 208 | 3300042004 | Ga0439445_0077202 | Ga0439445_0077202_226_456 | 76 |
| 209 | 3300042011 | Ga0439454_087254 | Ga0439454_087254_184_414 | 76 |
| 210 | 3300042013 | Ga0439456_020324 | Ga0439456_020324_767_997 | 76 |
| 211 | 3300042015 | Ga0439462_0044105 | Ga0439462_0044105_419_649 | 76 |
| 212 | 3300042125 | Ga0450923_077999 | Ga0450923_077999_318_548 | 76 |
| 213 | 3300042127 | Ga0450890_037123 | Ga0450890_037123_64_294 | 76 |
| 214 | 3300042129 | Ga0450891_016117 | Ga0450891_016117_138_368 | 76 |
| 215 | 3300042142 | Ga0450905_017378 | Ga0450905_017378_643_873 | 76 |
| 216 | 3300042147 | Ga0450910_072723 | Ga0450910_072723_246_476 | 76 |
| 217 | 3300042147 | Ga0450910_087656 | Ga0450910_087656_124_354 | 76 |
| 218 | 3300042156 | Ga0439446_0005728 | Ga0439446_0005728_2662_2892 | 76 |
| 219 | 3300042185 | Ga0450909_045503 | Ga0450909_045503_416_646 | 76 |
| 220 | 3300042436 | Ga0439435_0260372 | Ga0439435_0260372_197_427 | 76 |
| 221 | 3300042438 | Ga0439459_0040837 | Ga0439459_0040837_371_601 | 76 |
| 222 | 3300046458 | Ga0495591_154336 | Ga0495591_154336_238_468 | 76 |
| 223 | 3300046459 | Ga0495629_1092382 | Ga0495629_1092382_74_322 | 76 |
| 224 | 3300046474 | Ga0495605_0229012 | Ga0495605_0229012_54_284 | 76 |
| 225 | 3300046491 | Ga0495584_0153293 | Ga0495584_0153293_67_297 | 76 |
| 226 | 3300046491 | Ga0495584_0463026 | Ga0495584_0463026_217_447 | 76 |
| 227 | 3300046491 | Ga0495584_0493230 | Ga0495584_0493230_164_394 | 76 |
| 228 | 3300046492 | Ga0495585_0261347 | Ga0495585_0261347_348_578 | 76 |
| 229 | 3300046501 | Ga0495607_0402215 | Ga0495607_0402215_380_610 | 76 |
| 230 | 3300046518 | Ga0495631_0177932 | Ga0495631_0177932_363_593 | 76 |
| 231 | 3300046520 | Ga0495637_0170544 | Ga0495637_0170544_63_293 | 76 |
| 232 | 3300046525 | Ga0495663_0092716 | Ga0495663_0092716_580_810 | 76 |
| 233 | 3300046525 | Ga0495663_0361747 | Ga0495663_0361747_207_437 | 76 |
| 234 | 3300046537 | Ga0495598_0290964 | Ga0495598_0290964_238_468 | 76 |
| 235 | 3300046558 | Ga0495633_0311268 | Ga0495633_0311268_367_597 | 76 |
| 236 | 3300046615 | Ga0495656_0266797 | Ga0495656_0266797_573_803 | 76 |
| 237 | 3300046615 | Ga0495656_0823090 | Ga0495656_0823090_115_348 | 76 |
| 238 | 3300046642 | Ga0495634_0089487 | Ga0495634_0089487_521_766 | 76 |
| 239 | 3300046681 | Ga0495647_0013798 | Ga0495647_0013798_992_1237 | 76 |
| 240 | 3300046689 | Ga0495613_0719236 | Ga0495613_0719236_77_322 | 76 |
| 241 | 3300046691 | Ga0495670_0408487 | Ga0495670_0408487_430_675 | 76 |
| 242 | 3300046694 | Ga0495649_0669616 | Ga0495649_0669616_164_394 | 76 |
| 243 | 3300046794 | Ga0495589_0211995 | Ga0495589_0211995_607_837 | 76 |
| 244 | 3300047318 | Ga0495636_0331618 | Ga0495636_0331618_10_240 | 76 |
| 245 | 3300047321 | Ga0495676_0519851 | Ga0495676_0519851_11_250 | 76 |
| 246 | 3300047445 | Ga0495677_0059240 | Ga0495677_0059240_760_990 | 76 |
| 247 | 3300047470 | Ga0495681_0214812 | Ga0495681_0214812_214_444 | 76 |
| 248 | 3300048903 | Ga0496100_0230211 | Ga0496100_0230211_423_662 | 76 |
| 249 | 3300048904 | Ga0496101_0171204 | Ga0496101_0171204_504_743 | 76 |
| 250 | 3300048904 | Ga0496101_1280793 | Ga0496101_1280793_203_442 | 76 |
| 251 | 3300048905 | Ga0496102_0126509 | Ga0496102_0126509_1114_1353 | 76 |
| 252 | 3300048906 | Ga0496103_0370795 | Ga0496103_0370795_595_834 | 76 |
| 253 | 3300048906 | Ga0496103_0450129 | Ga0496103_0450129_382_621 | 76 |
| 254 | 3300048907 | Ga0496104_0095175 | Ga0496104_0095175_1659_1904 | 76 |
| 255 | 3300048907 | Ga0496104_0466344 | Ga0496104_0466344_320_559 | 76 |
| 256 | 3300048907 | Ga0496104_0879008 | Ga0496104_0879008_549_788 | 76 |
| 257 | 3300048907 | Ga0496104_1152905 | Ga0496104_1152905_10_249 | 76 |
| 258 | 3300048908 | Ga0496105_0320689 | Ga0496105_0320689_461_700 | 76 |
| 259 | 3300048909 | Ga0496106_0065555 | Ga0496106_0065555_1722_1961 | 76 |
| 260 | 3300048909 | Ga0496106_0320136 | Ga0496106_0320136_133_363 | 76 |
| 261 | 3300048909 | Ga0496106_0372097 | Ga0496106_0372097_562_801 | 76 |
| 262 | 3300048909 | Ga0496106_0937594 | Ga0496106_0937594_32_262 | 76 |
| 263 | 3300048910 | Ga0496107_0080303 | Ga0496107_0080303_270_509 | 76 |
| 264 | 3300048910 | Ga0496107_0494864 | Ga0496107_0494864_332_562 | 76 |
| 265 | 3300048910 | Ga0496107_0541779 | Ga0496107_0541779_443_679 | 76 |
| 266 | 3300048911 | Ga0496108_0077630 | Ga0496108_0077630_94_333 | 76 |
| 267 | 3300048911 | Ga0496108_1289988 | Ga0496108_1289988_333_569 | 76 |
| 268 | 3300048912 | Ga0496109_0125045 | Ga0496109_0125045_1616_1855 | 76 |
| 269 | 3300048912 | Ga0496109_0138280 | Ga0496109_0138280_1145_1384 | 76 |
| 270 | 3300048913 | Ga0496110_0130099 | Ga0496110_0130099_1865_2104 | 76 |
| 271 | 3300048913 | Ga0496110_0258038 | Ga0496110_0258038_471_710 | 76 |
| 272 | 3300048914 | Ga0496111_0005894 | Ga0496111_0005894_6578_6817 | 76 |
| 273 | 3300048914 | Ga0496111_0229057 | Ga0496111_0229057_327_566 | 76 |
| 274 | 3300048914 | Ga0496111_0817705 | Ga0496111_0817705_300_545 | 76 |
| 275 | 3300048915 | Ga0496112_0310217 | Ga0496112_0310217_206_445 | 76 |
| 276 | 3300048915 | Ga0496112_0386318 | Ga0496112_0386318_697_936 | 76 |
| 277 | 3300048915 | Ga0496112_0443895 | Ga0496112_0443895_58_297 | 76 |
| 278 | 3300048916 | Ga0496113_0198838 | Ga0496113_0198838_1301_1546 | 76 |
| 279 | 3300048916 | Ga0496113_1221452 | Ga0496113_1221452_187_426 | 76 |
| 280 | 3300048917 | Ga0496114_0328723 | Ga0496114_0328723_869_1108 | 76 |
| 281 | 3300048918 | Ga0496115_0746191 | Ga0496115_0746191_491_730 | 76 |
| 282 | 3300049522 | Ga0501299_072641 | Ga0501299_072641_438_668 | 76 |
| 283 | 3300049568 | Ga0501031_0001067 | Ga0501031_0001067_1635_1865 | 76 |
| 284 | 3300049568 | Ga0501031_0376422 | Ga0501031_0376422_43_273 | 76 |
| 285 | 3300049570 | Ga0501033_0049052 | Ga0501033_0049052_198_428 | 76 |
| 286 | 3300049572 | Ga0501036_0088574 | Ga0501036_0088574_633_863 | 76 |
| 287 | 3300049572 | Ga0501036_0780104 | Ga0501036_0780104_187_417 | 76 |
| 288 | 3300049572 | Ga0501036_1080826 | Ga0501036_1080826_19_249 | 76 |
| 289 | 3300049573 | Ga0501037_0207896 | Ga0501037_0207896_404_634 | 76 |
| 290 | 3300049574 | Ga0501038_0016739 | Ga0501038_0016739_2550_2780 | 76 |
| 291 | 3300049574 | Ga0501038_0585211 | Ga0501038_0585211_73_303 | 76 |
| 292 | 3300049575 | Ga0501039_0019894 | Ga0501039_0019894_2385_2615 | 76 |
| 293 | 3300049576 | Ga0501040_0011907 | Ga0501040_0011907_4701_4931 | 76 |
| 294 | 3300049576 | Ga0501040_0135597 | Ga0501040_0135597_886_1116 | 76 |
| 295 | 3300049576 | Ga0501040_0259456 | Ga0501040_0259456_159_389 | 76 |
| 296 | 3300049576 | Ga0501040_0527902 | Ga0501040_0527902_408_641 | 76 |
| 297 | 3300049576 | Ga0501040_0792006 | Ga0501040_0792006_130_381 | 76 |
| 298 | 3300049576 | Ga0501040_0846995 | Ga0501040_0846995_291_521 | 76 |
| 299 | 3300049577 | Ga0501041_0013469 | Ga0501041_0013469_755_985 | 76 |
| 300 | 3300049577 | Ga0501041_0166991 | Ga0501041_0166991_78_308 | 76 |
| 301 | 3300049577 | Ga0501041_0405148 | Ga0501041_0405148_398_628 | 76 |
| 302 | 3300049578 | Ga0501042_0021290 | Ga0501042_0021290_2644_2874 | 76 |
| 303 | 3300049578 | Ga0501042_0077759 | Ga0501042_0077759_1704_1937 | 76 |
| 304 | 3300049578 | Ga0501042_0606751 | Ga0501042_0606751_79_309 | 76 |
| 305 | 3300049579 | Ga0501043_0017822 | Ga0501043_0017822_371_601 | 76 |
| 306 | 3300049579 | Ga0501043_0445460 | Ga0501043_0445460_162_392 | 76 |
| 307 | 3300049581 | Ga0501047_1153841 | Ga0501047_1153841_323_556 | 76 |
| 308 | 3300049581 | Ga0501047_1171040 | Ga0501047_1171040_340_570 | 76 |
| 309 | 3300049582 | Ga0501048_0003924 | Ga0501048_0003924_5883_6113 | 76 |
| 310 | 3300049582 | Ga0501048_0455262 | Ga0501048_0455262_443_673 | 76 |
| 311 | 3300049582 | Ga0501048_0477212 | Ga0501048_0477212_332_565 | 76 |
| 312 | 3300049583 | Ga0501067_0897735 | Ga0501067_0897735_145_381 | 76 |
| 313 | 3300049584 | Ga0501068_0105560 | Ga0501068_0105560_370_600 | 76 |
| 314 | 3300049586 | Ga0501070_0030372 | Ga0501070_0030372_2770_3000 | 76 |
| 315 | 3300049586 | Ga0501070_1223207 | Ga0501070_1223207_183_413 | 76 |
| 316 | 3300049587 | Ga0501071_0029040 | Ga0501071_0029040_2750_2980 | 76 |
| 317 | 3300049587 | Ga0501071_0949584 | Ga0501071_0949584_275_505 | 76 |
| 318 | 3300049588 | Ga0501072_0008312 | Ga0501072_0008312_2794_3024 | 76 |
| 319 | 3300049588 | Ga0501072_0374638 | Ga0501072_0374638_374_604 | 76 |
| 320 | 3300049588 | Ga0501072_1527058 | Ga0501072_1527058_85_315 | 76 |
| 321 | 3300049588 | Ga0501072_1550132 | Ga0501072_1550132_267_500 | 76 |
| 322 | 3300049589 | Ga0501073_0152043 | Ga0501073_0152043_757_987 | 76 |
| 323 | 3300049590 | Ga0501074_0006779 | Ga0501074_0006779_2939_3169 | 76 |
| 324 | 3300049590 | Ga0501074_0942084 | Ga0501074_0942084_31_264 | 76 |
| 325 | 3300049590 | Ga0501074_1075677 | Ga0501074_1075677_103_333 | 76 |
| 326 | 3300049591 | Ga0501075_0334210 | Ga0501075_0334210_444_674 | 76 |
| 327 | 3300049591 | Ga0501075_0411238 | Ga0501075_0411238_423_656 | 76 |
| 328 | 3300049591 | Ga0501075_0480364 | Ga0501075_0480364_15_245 | 76 |
| 329 | 3300049591 | Ga0501075_1383773 | Ga0501075_1383773_282_512 | 76 |
| 330 | 3300049591 | Ga0501075_1384112 | Ga0501075_1384112_195_425 | 76 |
| 331 | 3300049592 | Ga0501076_0013821 | Ga0501076_0013821_4573_4803 | 76 |
| 332 | 3300049592 | Ga0501076_0145007 | Ga0501076_0145007_1516_1749 | 76 |
| 333 | 3300049593 | Ga0501077_0007451 | Ga0501077_0007451_5089_5322 | 76 |
| 334 | 3300049593 | Ga0501077_0008854 | Ga0501077_0008854_3882_4112 | 76 |
| 335 | 3300049593 | Ga0501077_0073551 | Ga0501077_0073551_1739_1969 | 76 |
| 336 | 3300049593 | Ga0501077_0403495 | Ga0501077_0403495_601_831 | 76 |
| 337 | 3300049741 | Ga0501079_0005553 | Ga0501079_0005553_839_1069 | 76 |
| 338 | 3300049741 | Ga0501079_0144867 | Ga0501079_0144867_316_546 | 76 |
| 339 | 3300049741 | Ga0501079_1132473 | Ga0501079_1132473_50_283 | 76 |
| 340 | 3300049742 | Ga0501080_0069088 | Ga0501080_0069088_2152_2382 | 76 |
| 341 | 3300049742 | Ga0501080_0818719 | Ga0501080_0818719_521_751 | 76 |
| 342 | 3300049743 | Ga0501081_0022634 | Ga0501081_0022634_3657_3887 | 76 |
| 343 | 3300049743 | Ga0501081_0023948 | Ga0501081_0023948_330_563 | 76 |
| 344 | 3300049743 | Ga0501081_0827342 | Ga0501081_0827342_155_385 | 76 |
| 345 | 3300049743 | Ga0501081_0875377 | Ga0501081_0875377_346_576 | 76 |
| 346 | 3300049744 | Ga0501083_0197294 | Ga0501083_0197294_195_425 | 76 |
| 347 | 3300049822 | Ga0501035_0099401 | Ga0501035_0099401_50_280 | 76 |
| 348 | 3300049822 | Ga0501035_1073312 | Ga0501035_1073312_377_607 | 76 |
| 349 | 3300049823 | Ga0501044_0447798 | Ga0501044_0447798_556_786 | 76 |
| 350 | 3300049824 | Ga0501045_0007617 | Ga0501045_0007617_1528_1758 | 76 |
| 351 | 3300049824 | Ga0501045_0487089 | Ga0501045_0487089_328_561 | 76 |
| 352 | 3300049824 | Ga0501045_0640857 | Ga0501045_0640857_295_525 | 76 |
| 353 | 3300049824 | Ga0501045_0740308 | Ga0501045_0740308_447_677 | 76 |
| 354 | 3300049824 | Ga0501045_0807452 | Ga0501045_0807452_69_299 | 76 |
| 355 | 3300049824 | Ga0501045_0970651 | Ga0501045_0970651_183_413 | 76 |
| 356 | 3300050507 | nmdc:mga05p37_1364991_c1 | nmdc:mga05p37_1364991_c1_162_392 | 76 |
| 357 | 3300050507 | nmdc:mga05p37_1463306_c1 | nmdc:mga05p37_1463306_c1_92_328 | 76 |
| 358 | 3300050507 | nmdc:mga05p37_1807082_c1 | nmdc:mga05p37_1807082_c1_192_422 | 76 |
| 359 | 3300050507 | nmdc:mga05p37_41768_c1 | nmdc:mga05p37_41768_c1_2429_2665 | 76 |
| 360 | 3300050507 | nmdc:mga05p37_58255_c1 | nmdc:mga05p37_58255_c1_2183_2419 | 76 |
| 361 | 3300050507 | nmdc:mga05p37_994354_c1 | nmdc:mga05p37_994354_c1_249_479 | 76 |
| 362 | 3300050508 | nmdc:mga09592_290734_c1 | nmdc:mga09592_290734_c1_269_499 | 76 |
| 363 | 3300050509 | nmdc:mga0qj67_663541_c1 | nmdc:mga0qj67_663541_c1_272_505 | 76 |
| 364 | 3300050510 | nmdc:mga06r32_306332_c1 | nmdc:mga06r32_306332_c1_369_599 | 76 |
| 365 | 3300050511 | nmdc:mga08y16_809306_c1 | nmdc:mga08y16_809306_c1_534_773 | 76 |
| 366 | 3300050512 | nmdc:mga0n895_331074_c1 | nmdc:mga0n895_331074_c1_996_1232 | 76 |
| 367 | 3300050512 | nmdc:mga0n895_516161_c1 | nmdc:mga0n895_516161_c1_200_436 | 76 |
| 368 | 3300050512 | nmdc:mga0n895_581640_c1 | nmdc:mga0n895_581640_c1_618_848 | 76 |
| 369 | 3300050513 | nmdc:mga0rr50_1642956_c1 | nmdc:mga0rr50_1642956_c1_171_401 | 76 |
| 370 | 3300050514 | nmdc:mga08x19_279209_c1 | nmdc:mga08x19_279209_c1_135_371 | 76 |
| 371 | 3300050514 | nmdc:mga08x19_44535_c1 | nmdc:mga08x19_44535_c1_241_471 | 76 |
| 372 | 3300050515 | nmdc:mga0a205_298849_c1 | nmdc:mga0a205_298849_c1_396_626 | 76 |
| 373 | 3300050515 | nmdc:mga0a205_461435_c1 | nmdc:mga0a205_461435_c1_648_884 | 76 |
| 374 | 3300050515 | nmdc:mga0a205_937546_c1 | nmdc:mga0a205_937546_c1_275_514 | 76 |
| 375 | 3300054114 | Ga0501084_0237553 | Ga0501084_0237553_1025_1255 | 76 |
| 376 | 3300054114 | Ga0501084_0276622 | Ga0501084_0276622_761_991 | 76 |
| 377 | 3300054114 | Ga0501084_0904838 | Ga0501084_0904838_403_633 | 76 |
| 378 | 3300054114 | Ga0501084_1068688 | Ga0501084_1068688_418_648 | 76 |
| 379 | 3300059424 | Ga0590075_057663 | Ga0590075_057663_384_614 | 76 |
| 380 | 3300059426 | Ga0590077_032479 | Ga0590077_032479_165_395 | 76 |
| 381 | 3300060353 | Ga0501082_0030156 | Ga0501082_0030156_1181_1411 | 76 |
| 382 | 3300060353 | Ga0501082_0292369 | Ga0501082_0292369_967_1200 | 76 |
| 383 | 3300060353 | Ga0501082_0703213 | Ga0501082_0703213_162_392 | 76 |
| 384 | 3300060353 | Ga0501082_1069839 | Ga0501082_1069839_267_497 | 76 |
| 385 | 3300060353 | Ga0501082_1171893 | Ga0501082_1171893_252_482 | 76 |
| 386 | 3300061734 | Ga0530510_0036177 | Ga0530510_0036177_1901_2131 | 76 |
| 387 | 3300061734 | Ga0530510_0205028 | Ga0530510_0205028_435_665 | 76 |
| 388 | 3300061734 | Ga0530510_0489425 | Ga0530510_0489425_376_609 | 76 |
| 389 | 3300061734 | Ga0530510_0555156 | Ga0530510_0555156_524_754 | 76 |
| 390 | 3300061734 | Ga0530510_1042104 | Ga0530510_1042104_237_467 | 76 |
| 391 | 3300005327 | Ga0070658_10093479 | Ga0070658_100934791 | 77 |
| 392 | 3300005329 | Ga0070683_100033346 | Ga0070683_1000333466 | 77 |
| 393 | 3300005329 | Ga0070683_101104419 | Ga0070683_1011044191 | 77 |
| 394 | 3300005336 | Ga0070680_100177035 | Ga0070680_1001770352 | 77 |
| 395 | 3300005337 | Ga0070682_100082642 | Ga0070682_1000826424 | 77 |
| 396 | 3300005338 | Ga0068868_100311859 | Ga0068868_1003118593 | 77 |
| 397 | 3300005338 | Ga0068868_100611557 | Ga0068868_1006115573 | 77 |
| 398 | 3300005339 | Ga0070660_100055136 | Ga0070660_1000551365 | 77 |
| 399 | 3300005344 | Ga0070661_100073947 | Ga0070661_1000739472 | 77 |
| 400 | 3300005344 | Ga0070661_101253887 | Ga0070661_1012538871 | 77 |
| 401 | 3300005355 | Ga0070671_100136876 | Ga0070671_1001368764 | 77 |
| 402 | 3300005355 | Ga0070671_100432260 | Ga0070671_1004322601 | 77 |
| 403 | 3300005355 | Ga0070671_100608511 | Ga0070671_1006085112 | 77 |
| 404 | 3300005355 | Ga0070671_101706839 | Ga0070671_1017068391 | 77 |
| 405 | 3300005364 | Ga0070673_100890297 | Ga0070673_1008902972 | 77 |
| 406 | 3300005365 | Ga0070688_100702775 | Ga0070688_1007027752 | 77 |
| 407 | 3300005366 | Ga0070659_100024570 | Ga0070659_1000245703 | 77 |
| 408 | 3300005366 | Ga0070659_101609997 | Ga0070659_1016099971 | 77 |
| 409 | 3300005434 | Ga0070709_10024136 | Ga0070709_100241362 | 77 |
| 410 | 3300005434 | Ga0070709_10218658 | Ga0070709_102186583 | 77 |
| 411 | 3300005434 | Ga0070709_10345926 | Ga0070709_103459262 | 77 |
| 412 | 3300005435 | Ga0070714_100004990 | Ga0070714_1000049904 | 77 |
| 413 | 3300005435 | Ga0070714_100006640 | Ga0070714_1000066403 | 77 |
| 414 | 3300005435 | Ga0070714_100013910 | Ga0070714_1000139109 | 77 |
| 415 | 3300005435 | Ga0070714_100077181 | Ga0070714_1000771811 | 77 |
| 416 | 3300005435 | Ga0070714_100351981 | Ga0070714_1003519813 | 77 |
| 417 | 3300005435 | Ga0070714_101014830 | Ga0070714_1010148302 | 77 |
| 418 | 3300005435 | Ga0070714_101614554 | Ga0070714_1016145542 | 77 |
| 419 | 3300005436 | Ga0070713_100013273 | Ga0070713_1000132732 | 77 |
| 420 | 3300005436 | Ga0070713_100196285 | Ga0070713_1001962853 | 77 |
| 421 | 3300005436 | Ga0070713_100204352 | Ga0070713_1002043524 | 77 |
| 422 | 3300005436 | Ga0070713_101430251 | Ga0070713_1014302512 | 77 |
| 423 | 3300005437 | Ga0070710_10013773 | Ga0070710_100137732 | 77 |
| 424 | 3300005437 | Ga0070710_10549242 | Ga0070710_105492422 | 77 |
| 425 | 3300005439 | Ga0070711_100030354 | Ga0070711_1000303542 | 77 |
| 426 | 3300005439 | Ga0070711_101053360 | Ga0070711_1010533602 | 77 |
| 427 | 3300005439 | Ga0070711_101110461 | Ga0070711_1011104612 | 77 |
| 428 | 3300005440 | Ga0070705_100125339 | Ga0070705_1001253392 | 77 |
| 429 | 3300005444 | Ga0070694_100127068 | Ga0070694_1001270682 | 77 |
| 430 | 3300005458 | Ga0070681_10017999 | Ga0070681_1001799912 | 77 |
| 431 | 3300005458 | Ga0070681_10055435 | Ga0070681_100554352 | 77 |
| 432 | 3300005458 | Ga0070681_10070898 | Ga0070681_100708984 | 77 |
| 433 | 3300005458 | Ga0070681_11682271 | Ga0070681_116822711 | 77 |
| 434 | 3300005468 | Ga0070707_100307125 | Ga0070707_1003071253 | 77 |
| 435 | 3300005468 | Ga0070707_101756317 | Ga0070707_1017563172 | 77 |
| 436 | 3300005468 | Ga0070707_101944543 | Ga0070707_1019445432 | 77 |
| 437 | 3300005530 | Ga0070679_100112791 | Ga0070679_1001127912 | 77 |
| 438 | 3300005530 | Ga0070679_101411923 | Ga0070679_1014119232 | 77 |
| 439 | 3300005535 | Ga0070684_100218082 | Ga0070684_1002180822 | 77 |
| 440 | 3300005535 | Ga0070684_100799726 | Ga0070684_1007997262 | 77 |
| 441 | 3300005544 | Ga0070686_100104651 | Ga0070686_1001046513 | 77 |
| 442 | 3300005545 | Ga0070695_100000334 | Ga0070695_10000033421 | 77 |
| 443 | 3300005545 | Ga0070695_100273716 | Ga0070695_1002737163 | 77 |
| 444 | 3300005546 | Ga0070696_100384479 | Ga0070696_1003844791 | 77 |
| 445 | 3300005547 | Ga0070693_100483097 | Ga0070693_1004830972 | 77 |
| 446 | 3300005549 | Ga0070704_102188619 | Ga0070704_1021886192 | 77 |
| 447 | 3300005563 | Ga0068855_100099403 | Ga0068855_1000994034 | 77 |
| 448 | 3300005563 | Ga0068855_100837570 | Ga0068855_1008375702 | 77 |
| 449 | 3300005564 | Ga0070664_100155596 | Ga0070664_1001555962 | 77 |
| 450 | 3300005564 | Ga0070664_100484890 | Ga0070664_1004848903 | 77 |
| 451 | 3300005614 | Ga0068856_100257473 | Ga0068856_1002574733 | 77 |
| 452 | 3300005614 | Ga0068856_100277510 | Ga0068856_1002775103 | 77 |
| 453 | 3300005614 | Ga0068856_101187269 | Ga0068856_1011872692 | 77 |
| 454 | 3300005615 | Ga0070702_101394514 | Ga0070702_1013945141 | 77 |
| 455 | 3300005616 | Ga0068852_101508291 | Ga0068852_1015082912 | 77 |
| 456 | 3300005618 | Ga0068864_101532715 | Ga0068864_1015327152 | 77 |
| 457 | 3300005841 | Ga0068863_100204364 | Ga0068863_1002043643 | 77 |
| 458 | 3300005842 | Ga0068858_100899222 | Ga0068858_1008992222 | 77 |
| 459 | 3300005843 | Ga0068860_101193666 | Ga0068860_1011936662 | 77 |
| 460 | 3300006028 | Ga0070717_10009831 | Ga0070717_100098316 | 77 |
| 461 | 3300006028 | Ga0070717_10031287 | Ga0070717_100312872 | 77 |
| 462 | 3300006028 | Ga0070717_10113541 | Ga0070717_101135413 | 77 |
| 463 | 3300006028 | Ga0070717_11465630 | Ga0070717_114656302 | 77 |
| 464 | 3300006058 | Ga0075432_10138145 | Ga0075432_101381452 | 77 |
| 465 | 3300006163 | Ga0070715_10000828 | Ga0070715_1000082810 | 77 |
| 466 | 3300006173 | Ga0070716_100041038 | Ga0070716_1000410385 | 77 |
| 467 | 3300006173 | Ga0070716_100106023 | Ga0070716_1001060233 | 77 |
| 468 | 3300006173 | Ga0070716_100439840 | Ga0070716_1004398402 | 77 |
| 469 | 3300006173 | Ga0070716_101316327 | Ga0070716_1013163272 | 77 |
| 470 | 3300006175 | Ga0070712_100107991 | Ga0070712_1001079912 | 77 |
| 471 | 3300006175 | Ga0070712_100357163 | Ga0070712_1003571632 | 77 |
| 472 | 3300006175 | Ga0070712_100461305 | Ga0070712_1004613052 | 77 |
| 473 | 3300006237 | Ga0097621_100983539 | Ga0097621_1009835392 | 77 |
| 474 | 3300006871 | Ga0075434_100127633 | Ga0075434_1001276334 | 77 |
| 475 | 3300006914 | Ga0075436_101365960 | Ga0075436_1013659602 | 77 |
| 476 | 3300007076 | Ga0075435_101375441 | Ga0075435_1013754412 | 77 |
| 477 | 3300009093 | Ga0105240_10061979 | Ga0105240_100619793 | 77 |
| 478 | 3300009093 | Ga0105240_10751949 | Ga0105240_107519491 | 77 |
| 479 | 3300009093 | Ga0105240_11654157 | Ga0105240_116541572 | 77 |
| 480 | 3300009094 | Ga0111539_10670627 | Ga0111539_106706273 | 77 |
| 481 | 3300009098 | Ga0105245_10210097 | Ga0105245_102100972 | 77 |
| 482 | 3300009098 | Ga0105245_12859988 | Ga0105245_128599882 | 77 |
| 483 | 3300009101 | Ga0105247_10056896 | Ga0105247_100568962 | 77 |
| 484 | 3300009174 | Ga0105241_11064575 | Ga0105241_110645752 | 77 |
| 485 | 3300009174 | Ga0105241_11100195 | Ga0105241_111001952 | 77 |
| 486 | 3300009176 | Ga0105242_10114044 | Ga0105242_101140443 | 77 |
| 487 | 3300009176 | Ga0105242_13241787 | Ga0105242_132417872 | 77 |
| 488 | 3300009177 | Ga0105248_10112254 | Ga0105248_101122543 | 77 |
| 489 | 3300009177 | Ga0105248_10253316 | Ga0105248_102533163 | 77 |
| 490 | 3300009545 | Ga0105237_10026151 | Ga0105237_100261513 | 77 |
| 491 | 3300009545 | Ga0105237_11711700 | Ga0105237_117117002 | 77 |
| 492 | 3300009545 | Ga0105237_11793333 | Ga0105237_117933332 | 77 |
| 493 | 3300009551 | Ga0105238_10118859 | Ga0105238_101188593 | 77 |
| 494 | 3300009551 | Ga0105238_11081270 | Ga0105238_110812702 | 77 |
| 495 | 3300009551 | Ga0105238_11431623 | Ga0105238_114316232 | 77 |
| 496 | 3300010159 | Ga0099796_10225322 | Ga0099796_102253223 | 77 |
| 497 | 3300010375 | Ga0105239_11407827 | Ga0105239_114078271 | 77 |
| 498 | 3300010375 | Ga0105239_12094119 | Ga0105239_120941192 | 77 |
| 499 | 3300013104 | Ga0157370_10413434 | Ga0157370_104134342 | 77 |
| 500 | 3300013105 | Ga0157369_10491542 | Ga0157369_104915423 | 77 |
| 501 | 3300013105 | Ga0157369_11138565 | Ga0157369_111385652 | 77 |
| 502 | 3300013105 | Ga0157369_11216291 | Ga0157369_112162912 | 77 |
| 503 | 3300013296 | Ga0157374_10265789 | Ga0157374_102657893 | 77 |
| 504 | 3300013306 | Ga0163162_10418059 | Ga0163162_104180592 | 77 |
| 505 | 3300013307 | Ga0157372_10018430 | Ga0157372_1001843011 | 77 |
| 506 | 3300013307 | Ga0157372_10111220 | Ga0157372_101112203 | 77 |
| 507 | 3300013307 | Ga0157372_10156827 | Ga0157372_101568273 | 77 |
| 508 | 3300013308 | Ga0157375_11086508 | Ga0157375_110865082 | 77 |
| 509 | 3300014745 | Ga0157377_10122710 | Ga0157377_101227103 | 77 |
| 510 | 3300014968 | Ga0157379_10208612 | Ga0157379_102086122 | 77 |
| 511 | 3300014968 | Ga0157379_10850184 | Ga0157379_108501842 | 77 |
| 512 | 3300014969 | Ga0157376_10016558 | Ga0157376_100165584 | 77 |
| 513 | 3300014969 | Ga0157376_12886825 | Ga0157376_128868252 | 77 |
| 514 | 3300015261 | Ga0182006_1109769 | Ga0182006_11097692 | 77 |
| 515 | 3300020069 | Ga0197907_10181217 | Ga0197907_101812172 | 77 |
| 516 | 3300020069 | Ga0197907_10665942 | Ga0197907_106659422 | 77 |
| 517 | 3300020069 | Ga0197907_10905758 | Ga0197907_109057582 | 77 |
| 518 | 3300020070 | Ga0206356_10040951 | Ga0206356_100409512 | 77 |
| 519 | 3300020070 | Ga0206356_10662684 | Ga0206356_106626844 | 77 |
| 520 | 3300020070 | Ga0206356_11528012 | Ga0206356_115280121 | 77 |
| 521 | 3300020078 | Ga0206352_11055702 | Ga0206352_110557022 | 77 |
| 522 | 3300020081 | Ga0206354_11301243 | Ga0206354_113012432 | 77 |
| 523 | 3300021377 | Ga0213874_10416647 | Ga0213874_104166471 | 77 |
| 524 | 3300022467 | Ga0224712_10226339 | Ga0224712_102263392 | 77 |
| 525 | 3300022467 | Ga0224712_10506495 | Ga0224712_105064952 | 77 |
| 526 | 3300025898 | Ga0207692_10058612 | Ga0207692_100586124 | 77 |
| 527 | 3300025898 | Ga0207692_10334188 | Ga0207692_103341883 | 77 |
| 528 | 3300025898 | Ga0207692_10971994 | Ga0207692_109719942 | 77 |
| 529 | 3300025905 | Ga0207685_10117897 | Ga0207685_101178972 | 77 |
| 530 | 3300025906 | Ga0207699_10007116 | Ga0207699_100071164 | 77 |
| 531 | 3300025906 | Ga0207699_10060384 | Ga0207699_100603841 | 77 |
| 532 | 3300025906 | Ga0207699_10308978 | Ga0207699_103089782 | 77 |
| 533 | 3300025909 | Ga0207705_10195466 | Ga0207705_101954663 | 77 |
| 534 | 3300025911 | Ga0207654_10862261 | Ga0207654_108622611 | 77 |
| 535 | 3300025912 | Ga0207707_10157753 | Ga0207707_101577533 | 77 |
| 536 | 3300025912 | Ga0207707_10752645 | Ga0207707_107526453 | 77 |
| 537 | 3300025913 | Ga0207695_10011313 | Ga0207695_100113139 | 77 |
| 538 | 3300025914 | Ga0207671_10107109 | Ga0207671_101071093 | 77 |
| 539 | 3300025915 | Ga0207693_10001626 | Ga0207693_1000162626 | 77 |
| 540 | 3300025915 | Ga0207693_10017266 | Ga0207693_100172662 | 77 |
| 541 | 3300025915 | Ga0207693_10150761 | Ga0207693_101507612 | 77 |
| 542 | 3300025915 | Ga0207693_10347086 | Ga0207693_103470863 | 77 |
| 543 | 3300025916 | Ga0207663_10025086 | Ga0207663_100250865 | 77 |
| 544 | 3300025916 | Ga0207663_10037958 | Ga0207663_100379582 | 77 |
| 545 | 3300025917 | Ga0207660_10365929 | Ga0207660_103659293 | 77 |
| 546 | 3300025919 | Ga0207657_10001172 | Ga0207657_100011729 | 77 |
| 547 | 3300025921 | Ga0207652_10232970 | Ga0207652_102329702 | 77 |
| 548 | 3300025921 | Ga0207652_11102369 | Ga0207652_111023692 | 77 |
| 549 | 3300025922 | Ga0207646_10613578 | Ga0207646_106135781 | 77 |
| 550 | 3300025924 | Ga0207694_10128507 | Ga0207694_101285073 | 77 |
| 551 | 3300025927 | Ga0207687_10106620 | Ga0207687_101066202 | 77 |
| 552 | 3300025927 | Ga0207687_10108056 | Ga0207687_101080562 | 77 |
| 553 | 3300025927 | Ga0207687_10469270 | Ga0207687_104692701 | 77 |
| 554 | 3300025927 | Ga0207687_11062839 | Ga0207687_110628392 | 77 |
| 555 | 3300025928 | Ga0207700_10018023 | Ga0207700_100180236 | 77 |
| 556 | 3300025928 | Ga0207700_10130618 | Ga0207700_101306183 | 77 |
| 557 | 3300025928 | Ga0207700_10134606 | Ga0207700_101346063 | 77 |
| 558 | 3300025929 | Ga0207664_10005865 | Ga0207664_100058656 | 77 |
| 559 | 3300025929 | Ga0207664_10016617 | Ga0207664_100166174 | 77 |
| 560 | 3300025929 | Ga0207664_10055511 | Ga0207664_100555111 | 77 |
| 561 | 3300025929 | Ga0207664_10069815 | Ga0207664_100698153 | 77 |
| 562 | 3300025929 | Ga0207664_10144708 | Ga0207664_101447084 | 77 |
| 563 | 3300025929 | Ga0207664_10620506 | Ga0207664_106205062 | 77 |
| 564 | 3300025931 | Ga0207644_10241308 | Ga0207644_102413084 | 77 |
| 565 | 3300025931 | Ga0207644_10269856 | Ga0207644_102698562 | 77 |
| 566 | 3300025934 | Ga0207686_10048920 | Ga0207686_100489204 | 77 |
| 567 | 3300025939 | Ga0207665_10024562 | Ga0207665_100245627 | 77 |
| 568 | 3300025939 | Ga0207665_10297216 | Ga0207665_102972163 | 77 |
| 569 | 3300025939 | Ga0207665_10499459 | Ga0207665_104994592 | 77 |
| 570 | 3300025939 | Ga0207665_11234612 | Ga0207665_112346122 | 77 |
| 571 | 3300025941 | Ga0207711_10307793 | Ga0207711_103077933 | 77 |
| 572 | 3300025944 | Ga0207661_10010984 | Ga0207661_100109844 | 77 |
| 573 | 3300025945 | Ga0207679_10094600 | Ga0207679_100946003 | 77 |
| 574 | 3300025949 | Ga0207667_10155798 | Ga0207667_101557983 | 77 |
| 575 | 3300025949 | Ga0207667_10403816 | Ga0207667_104038162 | 77 |
| 576 | 3300025960 | Ga0207651_10898085 | Ga0207651_108980852 | 77 |
| 577 | 3300026023 | Ga0207677_10167202 | Ga0207677_101672023 | 77 |
| 578 | 3300026035 | Ga0207703_10523956 | Ga0207703_105239562 | 77 |
| 579 | 3300026078 | Ga0207702_10785682 | Ga0207702_107856822 | 77 |
| 580 | 3300026088 | Ga0207641_10111621 | Ga0207641_101116213 | 77 |
| 581 | 3300026142 | Ga0207698_10659500 | Ga0207698_106595002 | 77 |
| 582 | 3300027907 | Ga0207428_10155228 | Ga0207428_101552282 | 77 |
| 583 | 3300028558 | Ga0265326_10029810 | Ga0265326_100298103 | 77 |
| 584 | 3300028573 | Ga0265334_10030810 | Ga0265334_100308104 | 77 |
| 585 | 3300028666 | Ga0265336_10004451 | Ga0265336_100044513 | 77 |
| 586 | 3300028800 | Ga0265338_10011714 | Ga0265338_100117149 | 77 |
| 587 | 3300028800 | Ga0265338_10026816 | Ga0265338_100268162 | 77 |
| 588 | 3300028800 | Ga0265338_10255224 | Ga0265338_102552242 | 77 |
| 589 | 3300029957 | Ga0265324_10076549 | Ga0265324_100765493 | 77 |
| 590 | 3300031251 | Ga0265327_10173533 | Ga0265327_101735332 | 77 |
| 591 | 3300031344 | Ga0265316_10615726 | Ga0265316_106157263 | 77 |
| 592 | 3300031595 | Ga0265313_10015960 | Ga0265313_100159604 | 77 |
| 593 | 3300034957 | Ga0373938_0221535 | Ga0373938_0221535_93_326 | 77 |
| 594 | 3300035083 | Ga0373926_0424381 | Ga0373926_0424381_236_469 | 77 |
| 595 | 3300035086 | Ga0373934_0354053 | Ga0373934_0354053_234_467 | 77 |
| 596 | 3300035088 | Ga0373940_0234628 | Ga0373940_0234628_232_465 | 77 |
| 597 | 3300035089 | Ga0373944_0005337 | Ga0373944_0005337_1902_2135 | 77 |
| 598 | 3300035090 | Ga0373949_0152676 | Ga0373949_0152676_400_633 | 77 |
| 599 | 3300035090 | Ga0373949_0286875 | Ga0373949_0286875_50_283 | 77 |
| 600 | 3300035091 | Ga0373951_0089622 | Ga0373951_0089622_18_251 | 77 |
| 601 | 3300035111 | Ga0373923_0208491 | Ga0373923_0208491_449_682 | 77 |
| 602 | 3300035114 | Ga0373939_0010566 | Ga0373939_0010566_1504_1737 | 77 |
| 603 | 3300035114 | Ga0373939_0028882 | Ga0373939_0028882_561_794 | 77 |
| 604 | 3300035115 | Ga0373941_0201910 | Ga0373941_0201910_474_707 | 77 |
| 605 | 3300035115 | Ga0373941_0441597 | Ga0373941_0441597_15_248 | 77 |
| 606 | 3300035116 | Ga0373945_0003284 | Ga0373945_0003284_4524_4757 | 77 |
| 607 | 3300035117 | Ga0373953_0308466 | Ga0373953_0308466_365_598 | 77 |
| 608 | 3300035119 | Ga0373956_0192401 | Ga0373956_0192401_185_418 | 77 |
| 609 | 3300035121 | Ga0373960_0032084 | Ga0373960_0032084_156_389 | 77 |
| 610 | 3300035121 | Ga0373960_0299965 | Ga0373960_0299965_50_283 | 77 |
| 611 | 3300035170 | Ga0373943_0015576 | Ga0373943_0015576_2816_3049 | 77 |
| 612 | 3300035171 | Ga0373946_0037702 | Ga0373946_0037702_239_472 | 77 |
| 613 | 3300035172 | Ga0373955_0229495 | Ga0373955_0229495_823_1056 | 77 |
| 614 | 3300035207 | Ga0373942_0149928 | Ga0373942_0149928_105_338 | 77 |
| 615 | 3300035242 | Ga0373962_0072283 | Ga0373962_0072283_549_782 | 77 |
| 616 | 3300035242 | Ga0373962_0271955 | Ga0373962_0271955_135_368 | 77 |
| 617 | 3300035410 | Ga0373924_0363867 | Ga0373924_0363867_282_515 | 77 |
| 618 | 3300035691 | Ga0373931_0046837 | Ga0373931_0046837_1991_2224 | 77 |
| 619 | 3300035691 | Ga0373931_1165938 | Ga0373931_1165938_55_288 | 77 |
| 620 | 3300035692 | Ga0373935_0008543 | Ga0373935_0008543_1585_1818 | 77 |
| 621 | 3300035724 | Ga0373933_0814604 | Ga0373933_0814604_130_363 | 77 |
| 622 | 3300035725 | Ga0373947_0063830 | Ga0373947_0063830_1310_1543 | 77 |
| 623 | 3300036401 | Ga0373937_0018152 | Ga0373937_0018152_53_286 | 77 |
| 624 | 3300036401 | Ga0373937_0090109 | Ga0373937_0090109_612_845 | 77 |
| 625 | 3300036401 | Ga0373937_0365295 | Ga0373937_0365295_1056_1289 | 77 |
| 626 | 3300037068 | Ga0373925_0106104 | Ga0373925_0106104_909_1142 | 77 |
| 627 | 3300037068 | Ga0373925_0971730 | Ga0373925_0971730_202_435 | 77 |
| 628 | 3300037312 | Ga0395899_0893938 | Ga0395899_0893938_291_524 | 77 |
| 629 | 3300037418 | Ga0395900_0444637 | Ga0395900_0444637_908_1141 | 77 |
| 630 | 3300037466 | Ga0395898_0105139 | Ga0395898_0105139_1272_1505 | 77 |
| 631 | 3300037466 | Ga0395898_0400369 | Ga0395898_0400369_70_303 | 77 |
| 632 | 3300038443 | Ga0395901_0390962 | Ga0395901_0390962_352_585 | 77 |
| 633 | 3300039437 | Ga0436365_1683679 | Ga0436365_1683679_260_493 | 77 |
| 634 | 3300039450 | Ga0436363_1379579 | Ga0436363_1379579_157_390 | 77 |
| 635 | 3300039450 | Ga0436363_1452544 | Ga0436363_1452544_32_265 | 77 |
| 636 | 3300042876 | Ga0451577_1027297 | Ga0451577_1027297_56_289 | 77 |
| 637 | 3300044656 | Ga0466969_0026994 | Ga0466969_0026994_1154_1387 | 77 |
| 638 | 3300044656 | Ga0466969_0031342 | Ga0466969_0031342_1592_1825 | 77 |
| 639 | 3300044658 | Ga0466972_0014839 | Ga0466972_0014839_870_1103 | 77 |
| 640 | 3300044683 | Ga0466965_0010775 | Ga0466965_0010775_3740_3973 | 77 |
| 641 | 3300044683 | Ga0466965_0105435 | Ga0466965_0105435_113_346 | 77 |
| 642 | 3300044683 | Ga0466965_0608364 | Ga0466965_0608364_308_541 | 77 |
| 643 | 3300044684 | Ga0466966_0092816 | Ga0466966_0092816_976_1209 | 77 |
| 644 | 3300044684 | Ga0466966_0132892 | Ga0466966_0132892_660_893 | 77 |
| 645 | 3300044693 | Ga0466961_0020602 | Ga0466961_0020602_2976_3209 | 77 |
| 646 | 3300044693 | Ga0466961_0048982 | Ga0466961_0048982_927_1160 | 77 |
| 647 | 3300044693 | Ga0466961_0056553 | Ga0466961_0056553_838_1071 | 77 |
| 648 | 3300044693 | Ga0466961_0127674 | Ga0466961_0127674_720_953 | 77 |
| 649 | 3300044693 | Ga0466961_0186151 | Ga0466961_0186151_214_447 | 77 |
| 650 | 3300044693 | Ga0466961_0187581 | Ga0466961_0187581_657_890 | 77 |
| 651 | 3300044693 | Ga0466961_0804411 | Ga0466961_0804411_68_301 | 77 |
| 652 | 3300044694 | Ga0466963_0000118 | Ga0466963_0000118_23488_23721 | 77 |
| 653 | 3300044694 | Ga0466963_0002499 | Ga0466963_0002499_371_604 | 77 |
| 654 | 3300044694 | Ga0466963_0003979 | Ga0466963_0003979_8051_8284 | 77 |
| 655 | 3300044694 | Ga0466963_0004071 | Ga0466963_0004071_3775_4008 | 77 |
| 656 | 3300044694 | Ga0466963_0005177 | Ga0466963_0005177_865_1098 | 77 |
| 657 | 3300044694 | Ga0466963_0012606 | Ga0466963_0012606_3365_3598 | 77 |
| 658 | 3300044694 | Ga0466963_0016631 | Ga0466963_0016631_2852_3085 | 77 |
| 659 | 3300044694 | Ga0466963_0023771 | Ga0466963_0023771_731_964 | 77 |
| 660 | 3300044694 | Ga0466963_0030926 | Ga0466963_0030926_1820_2053 | 77 |
| 661 | 3300044694 | Ga0466963_0040505 | Ga0466963_0040505_1947_2180 | 77 |
| 662 | 3300044694 | Ga0466963_0089158 | Ga0466963_0089158_805_1038 | 77 |
| 663 | 3300044694 | Ga0466963_0299156 | Ga0466963_0299156_224_457 | 77 |
| 664 | 3300044694 | Ga0466963_0348102 | Ga0466963_0348102_170_403 | 77 |
| 665 | 3300044706 | Ga0466964_0004607 | Ga0466964_0004607_2563_2796 | 77 |
| 666 | 3300044706 | Ga0466964_0060975 | Ga0466964_0060975_254_493 | 77 |
| 667 | 3300044706 | Ga0466964_0093894 | Ga0466964_0093894_279_512 | 77 |
| 668 | 3300044706 | Ga0466964_0102831 | Ga0466964_0102831_786_1019 | 77 |
| 669 | 3300044706 | Ga0466964_0103121 | Ga0466964_0103121_786_1019 | 77 |
| 670 | 3300044706 | Ga0466964_0165291 | Ga0466964_0165291_48_281 | 77 |
| 671 | 3300044706 | Ga0466964_0270068 | Ga0466964_0270068_435_668 | 77 |
| 672 | 3300044706 | Ga0466964_0875143 | Ga0466964_0875143_196_429 | 77 |
| 673 | 3300044712 | Ga0453684_0891964 | Ga0453684_0891964_453_686 | 77 |
| 674 | 3300044719 | Ga0466971_0000713 | Ga0466971_0000713_4196_4429 | 77 |
| 675 | 3300044719 | Ga0466971_0008839 | Ga0466971_0008839_3514_3747 | 77 |
| 676 | 3300044719 | Ga0466971_0032000 | Ga0466971_0032000_209_442 | 77 |
| 677 | 3300044719 | Ga0466971_0036573 | Ga0466971_0036573_402_635 | 77 |
| 678 | 3300044719 | Ga0466971_0048051 | Ga0466971_0048051_625_858 | 77 |
| 679 | 3300044735 | Ga0466968_0000530 | Ga0466968_0000530_8510_8743 | 77 |
| 680 | 3300044735 | Ga0466968_0003236 | Ga0466968_0003236_2282_2515 | 77 |
| 681 | 3300044735 | Ga0466968_0029539 | Ga0466968_0029539_721_954 | 77 |
| 682 | 3300044735 | Ga0466968_0081497 | Ga0466968_0081497_490_723 | 77 |
| 683 | 3300044765 | Ga0466970_0096285 | Ga0466970_0096285_243_476 | 77 |
| 684 | 3300044765 | Ga0466970_0338633 | Ga0466970_0338633_208_441 | 77 |
| 685 | 3300044842 | Ga0466957_0004414 | Ga0466957_0004414_6582_6815 | 77 |
| 686 | 3300044842 | Ga0466957_0012200 | Ga0466957_0012200_92_325 | 77 |
| 687 | 3300044842 | Ga0466957_0050698 | Ga0466957_0050698_1006_1239 | 77 |
| 688 | 3300044842 | Ga0466957_0097236 | Ga0466957_0097236_612_845 | 77 |
| 689 | 3300044842 | Ga0466957_0106005 | Ga0466957_0106005_761_994 | 77 |
| 690 | 3300044842 | Ga0466957_0133717 | Ga0466957_0133717_1117_1350 | 77 |
| 691 | 3300044842 | Ga0466957_0201769 | Ga0466957_0201769_710_943 | 77 |
| 692 | 3300044842 | Ga0466957_0226169 | Ga0466957_0226169_90_323 | 77 |
| 693 | 3300044842 | Ga0466957_0233322 | Ga0466957_0233322_715_948 | 77 |
| 694 | 3300044901 | Ga0466960_0010158 | Ga0466960_0010158_3213_3446 | 77 |
| 695 | 3300044901 | Ga0466960_0012809 | Ga0466960_0012809_922_1155 | 77 |
| 696 | 3300044901 | Ga0466960_0112428 | Ga0466960_0112428_255_488 | 77 |
| 697 | 3300045049 | Ga0466959_0012465 | Ga0466959_0012465_4694_4927 | 77 |
| 698 | 3300045049 | Ga0466959_0026888 | Ga0466959_0026888_409_642 | 77 |
| 699 | 3300045049 | Ga0466959_0038032 | Ga0466959_0038032_2496_2729 | 77 |
| 700 | 3300045049 | Ga0466959_0101050 | Ga0466959_0101050_1175_1408 | 77 |
| 701 | 3300045049 | Ga0466959_0304035 | Ga0466959_0304035_387_620 | 77 |
| 702 | 3300045836 | Ga0466958_0000495 | Ga0466958_0000495_3026_3259 | 77 |
| 703 | 3300045836 | Ga0466958_0002659 | Ga0466958_0002659_5307_5540 | 77 |
| 704 | 3300045836 | Ga0466958_0008925 | Ga0466958_0008925_2022_2255 | 77 |
| 705 | 3300045836 | Ga0466958_0016750 | Ga0466958_0016750_1007_1240 | 77 |
| 706 | 3300045836 | Ga0466958_0016911 | Ga0466958_0016911_194_427 | 77 |
| 707 | 3300045836 | Ga0466958_0038580 | Ga0466958_0038580_675_908 | 77 |
| 708 | 3300045836 | Ga0466958_0108168 | Ga0466958_0108168_675_908 | 77 |
| 709 | 3300045836 | Ga0466958_0443338 | Ga0466958_0443338_114_347 | 77 |
| 710 | 3300045836 | Ga0466958_0732575 | Ga0466958_0732575_157_390 | 77 |
| 711 | 3300045976 | Ga0466967_0005677 | Ga0466967_0005677_5584_5817 | 77 |
| 712 | 3300045976 | Ga0466967_0009665 | Ga0466967_0009665_3775_4008 | 77 |
| 713 | 3300045976 | Ga0466967_0021933 | Ga0466967_0021933_4578_4811 | 77 |
| 714 | 3300045976 | Ga0466967_0026507 | Ga0466967_0026507_72_305 | 77 |
| 715 | 3300045976 | Ga0466967_0029955 | Ga0466967_0029955_774_1007 | 77 |
| 716 | 3300045976 | Ga0466967_0039231 | Ga0466967_0039231_2212_2445 | 77 |
| 717 | 3300045976 | Ga0466967_0063816 | Ga0466967_0063816_822_1055 | 77 |
| 718 | 3300045976 | Ga0466967_0165771 | Ga0466967_0165771_1072_1305 | 77 |
| 719 | 3300045976 | Ga0466967_0194467 | Ga0466967_0194467_1474_1707 | 77 |
| 720 | 3300045976 | Ga0466967_0247906 | Ga0466967_0247906_1226_1459 | 77 |
| 721 | 3300045976 | Ga0466967_0291290 | Ga0466967_0291290_786_1019 | 77 |
| 722 | 3300045976 | Ga0466967_0388260 | Ga0466967_0388260_400_633 | 77 |
| 723 | 3300045976 | Ga0466967_1313196 | Ga0466967_1313196_65_298 | 77 |
| 724 | 3300045976 | Ga0466967_2056931 | Ga0466967_2056931_171_404 | 77 |
| 725 | 3300045976 | Ga0466967_2538193 | Ga0466967_2538193_242_475 | 77 |
| 726 | 3300046453 | Ga0495627_125876 | Ga0495627_125876_215_448 | 77 |
| 727 | 3300046454 | Ga0495592_0000125 | Ga0495592_0000125_34265_34498 | 77 |
| 728 | 3300046454 | Ga0495592_0134964 | Ga0495592_0134964_1015_1248 | 77 |
| 729 | 3300046454 | Ga0495592_0507505 | Ga0495592_0507505_438_671 | 77 |
| 730 | 3300046455 | Ga0495603_0015063 | Ga0495603_0015063_513_746 | 77 |
| 731 | 3300046455 | Ga0495603_0876958 | Ga0495603_0876958_111_344 | 77 |
| 732 | 3300046459 | Ga0495629_0348451 | Ga0495629_0348451_702_935 | 77 |
| 733 | 3300046461 | Ga0495641_0002166 | Ga0495641_0002166_14445_14678 | 77 |
| 734 | 3300046461 | Ga0495641_0019667 | Ga0495641_0019667_779_1012 | 77 |
| 735 | 3300046461 | Ga0495641_0063276 | Ga0495641_0063276_731_964 | 77 |
| 736 | 3300046461 | Ga0495641_0198761 | Ga0495641_0198761_194_427 | 77 |
| 737 | 3300046461 | Ga0495641_0277427 | Ga0495641_0277427_346_579 | 77 |
| 738 | 3300046462 | Ga0495651_0000011 | Ga0495651_0000011_15460_15693 | 77 |
| 739 | 3300046462 | Ga0495651_0053601 | Ga0495651_0053601_38_271 | 77 |
| 740 | 3300046463 | Ga0495653_0005067 | Ga0495653_0005067_195_428 | 77 |
| 741 | 3300046463 | Ga0495653_0109332 | Ga0495653_0109332_1722_1955 | 77 |
| 742 | 3300046463 | Ga0495653_0228669 | Ga0495653_0228669_841_1074 | 77 |
| 743 | 3300046463 | Ga0495653_0292154 | Ga0495653_0292154_539_772 | 77 |
| 744 | 3300046472 | Ga0495580_0026301 | Ga0495580_0026301_215_448 | 77 |
| 745 | 3300046473 | Ga0495582_0049302 | Ga0495582_0049302_626_859 | 77 |
| 746 | 3300046473 | Ga0495582_0066542 | Ga0495582_0066542_1566_1799 | 77 |
| 747 | 3300046473 | Ga0495582_0173848 | Ga0495582_0173848_38_271 | 77 |
| 748 | 3300046473 | Ga0495582_0346567 | Ga0495582_0346567_513_746 | 77 |
| 749 | 3300046473 | Ga0495582_0414982 | Ga0495582_0414982_319_552 | 77 |
| 750 | 3300046474 | Ga0495605_0369641 | Ga0495605_0369641_194_427 | 77 |
| 751 | 3300046475 | Ga0495639_0002434 | Ga0495639_0002434_1196_1429 | 77 |
| 752 | 3300046476 | Ga0495662_0040226 | Ga0495662_0040226_128_361 | 77 |
| 753 | 3300046476 | Ga0495662_0294875 | Ga0495662_0294875_459_692 | 77 |
| 754 | 3300046477 | Ga0495664_0066647 | Ga0495664_0066647_1897_2130 | 77 |
| 755 | 3300046477 | Ga0495664_0570473 | Ga0495664_0570473_370_603 | 77 |
| 756 | 3300046477 | Ga0495664_0798566 | Ga0495664_0798566_12_245 | 77 |
| 757 | 3300046491 | Ga0495584_0199027 | Ga0495584_0199027_471_704 | 77 |
| 758 | 3300046499 | Ga0495594_0195783 | Ga0495594_0195783_240_473 | 77 |
| 759 | 3300046501 | Ga0495607_0008218 | Ga0495607_0008218_5637_5870 | 77 |
| 760 | 3300046511 | Ga0495608_0031190 | Ga0495608_0031190_2903_3136 | 77 |
| 761 | 3300046511 | Ga0495608_0067051 | Ga0495608_0067051_1268_1501 | 77 |
| 762 | 3300046511 | Ga0495608_0116995 | Ga0495608_0116995_1369_1602 | 77 |
| 763 | 3300046511 | Ga0495608_0301873 | Ga0495608_0301873_711_944 | 77 |
| 764 | 3300046511 | Ga0495608_0403909 | Ga0495608_0403909_385_618 | 77 |
| 765 | 3300046511 | Ga0495608_0562881 | Ga0495608_0562881_21_254 | 77 |
| 766 | 3300046514 | Ga0495618_0007063 | Ga0495618_0007063_1801_2034 | 77 |
| 767 | 3300046514 | Ga0495618_0083273 | Ga0495618_0083273_1032_1265 | 77 |
| 768 | 3300046514 | Ga0495618_0425776 | Ga0495618_0425776_300_533 | 77 |
| 769 | 3300046514 | Ga0495618_0919265 | Ga0495618_0919265_129_362 | 77 |
| 770 | 3300046516 | Ga0495628_0000040 | Ga0495628_0000040_3800_4033 | 77 |
| 771 | 3300046516 | Ga0495628_0164627 | Ga0495628_0164627_564_797 | 77 |
| 772 | 3300046516 | Ga0495628_0680174 | Ga0495628_0680174_112_345 | 77 |
| 773 | 3300046516 | Ga0495628_0943723 | Ga0495628_0943723_198_431 | 77 |
| 774 | 3300046517 | Ga0495630_0024760 | Ga0495630_0024760_225_458 | 77 |
| 775 | 3300046517 | Ga0495630_0215508 | Ga0495630_0215508_1008_1241 | 77 |
| 776 | 3300046518 | Ga0495631_0150953 | Ga0495631_0150953_576_809 | 77 |
| 777 | 3300046523 | Ga0495644_0001368 | Ga0495644_0001368_1529_1762 | 77 |
| 778 | 3300046526 | Ga0495666_0004106 | Ga0495666_0004106_1662_1895 | 77 |
| 779 | 3300046529 | Ga0495652_0000299 | Ga0495652_0000299_8087_8320 | 77 |
| 780 | 3300046529 | Ga0495652_0025357 | Ga0495652_0025357_4760_4993 | 77 |
| 781 | 3300046529 | Ga0495652_0089135 | Ga0495652_0089135_1195_1428 | 77 |
| 782 | 3300046531 | Ga0495665_0010827 | Ga0495665_0010827_4409_4642 | 77 |
| 783 | 3300046533 | Ga0495640_0025758 | Ga0495640_0025758_2132_2365 | 77 |
| 784 | 3300046533 | Ga0495640_0222963 | Ga0495640_0222963_702_935 | 77 |
| 785 | 3300046535 | Ga0495586_0075959 | Ga0495586_0075959_1008_1241 | 77 |
| 786 | 3300046535 | Ga0495586_0106582 | Ga0495586_0106582_370_603 | 77 |
| 787 | 3300046535 | Ga0495586_0160344 | Ga0495586_0160344_31_264 | 77 |
| 788 | 3300046535 | Ga0495586_0259856 | Ga0495586_0259856_167_400 | 77 |
| 789 | 3300046536 | Ga0495587_0000212 | Ga0495587_0000212_11688_11921 | 77 |
| 790 | 3300046536 | Ga0495587_0245118 | Ga0495587_0245118_659_892 | 77 |
| 791 | 3300046538 | Ga0495609_0093411 | Ga0495609_0093411_1055_1288 | 77 |
| 792 | 3300046543 | Ga0495645_0000035 | Ga0495645_0000035_34205_34438 | 77 |
| 793 | 3300046543 | Ga0495645_0160431 | Ga0495645_0160431_1116_1349 | 77 |
| 794 | 3300046543 | Ga0495645_0248753 | Ga0495645_0248753_576_809 | 77 |
| 795 | 3300046559 | Ga0495667_0071245 | Ga0495667_0071245_741_974 | 77 |
| 796 | 3300046559 | Ga0495667_0258736 | Ga0495667_0258736_345_578 | 77 |
| 797 | 3300046559 | Ga0495667_0275518 | Ga0495667_0275518_718_951 | 77 |
| 798 | 3300046615 | Ga0495656_0002084 | Ga0495656_0002084_5256_5489 | 77 |
| 799 | 3300046642 | Ga0495634_0008657 | Ga0495634_0008657_6441_6674 | 77 |
| 800 | 3300046642 | Ga0495634_0134086 | Ga0495634_0134086_1160_1393 | 77 |
| 801 | 3300046648 | Ga0495611_0006116 | Ga0495611_0006116_3137_3370 | 77 |
| 802 | 3300046663 | Ga0495635_0157134 | Ga0495635_0157134_359_592 | 77 |
| 803 | 3300046663 | Ga0495635_0640030 | Ga0495635_0640030_235_468 | 77 |
| 804 | 3300046664 | Ga0495659_0002432 | Ga0495659_0002432_2459_2692 | 77 |
| 805 | 3300046675 | Ga0495657_0018821 | Ga0495657_0018821_1416_1649 | 77 |
| 806 | 3300046675 | Ga0495657_0749995 | Ga0495657_0749995_291_524 | 77 |
| 807 | 3300046678 | Ga0495599_0000009 | Ga0495599_0000009_45385_45618 | 77 |
| 808 | 3300046678 | Ga0495599_0370391 | Ga0495599_0370391_258_491 | 77 |
| 809 | 3300046679 | Ga0495623_0002770 | Ga0495623_0002770_3928_4161 | 77 |
| 810 | 3300046680 | Ga0495646_0004330 | Ga0495646_0004330_7786_8019 | 77 |
| 811 | 3300046680 | Ga0495646_0036960 | Ga0495646_0036960_1763_1996 | 77 |
| 812 | 3300046680 | Ga0495646_0356241 | Ga0495646_0356241_80_313 | 77 |
| 813 | 3300046681 | Ga0495647_0024108 | Ga0495647_0024108_212_445 | 77 |
| 814 | 3300046681 | Ga0495647_0079293 | Ga0495647_0079293_507_740 | 77 |
| 815 | 3300046683 | Ga0495658_0058045 | Ga0495658_0058045_956_1189 | 77 |
| 816 | 3300046683 | Ga0495658_0189684 | Ga0495658_0189684_18_251 | 77 |
| 817 | 3300046683 | Ga0495658_0194873 | Ga0495658_0194873_883_1116 | 77 |
| 818 | 3300046683 | Ga0495658_0268558 | Ga0495658_0268558_123_356 | 77 |
| 819 | 3300046683 | Ga0495658_0960498 | Ga0495658_0960498_59_292 | 77 |
| 820 | 3300046689 | Ga0495613_0072321 | Ga0495613_0072321_1687_1920 | 77 |
| 821 | 3300046689 | Ga0495613_0077722 | Ga0495613_0077722_2158_2391 | 77 |
| 822 | 3300046689 | Ga0495613_0130762 | Ga0495613_0130762_142_375 | 77 |
| 823 | 3300046689 | Ga0495613_0810412 | Ga0495613_0810412_302_535 | 77 |
| 824 | 3300046690 | Ga0495624_0018533 | Ga0495624_0018533_2521_2754 | 77 |
| 825 | 3300046690 | Ga0495624_0397280 | Ga0495624_0397280_145_378 | 77 |
| 826 | 3300046691 | Ga0495670_0111130 | Ga0495670_0111130_665_898 | 77 |
| 827 | 3300046809 | Ga0495600_0045430 | Ga0495600_0045430_1369_1602 | 77 |
| 828 | 3300046809 | Ga0495600_0957845 | Ga0495600_0957845_91_324 | 77 |
| 829 | 3300047315 | Ga0495581_0003407 | Ga0495581_0003407_614_847 | 77 |
| 830 | 3300047317 | Ga0495604_0000847 | Ga0495604_0000847_2038_2271 | 77 |
| 831 | 3300047317 | Ga0495604_0768930 | Ga0495604_0768930_334_567 | 77 |
| 832 | 3300047318 | Ga0495636_0047163 | Ga0495636_0047163_1358_1591 | 77 |
| 833 | 3300047319 | Ga0495674_0091709 | Ga0495674_0091709_2056_2289 | 77 |
| 834 | 3300047319 | Ga0495674_1043620 | Ga0495674_1043620_358_591 | 77 |
| 835 | 3300047319 | Ga0495674_1224110 | Ga0495674_1224110_23_256 | 77 |
| 836 | 3300047321 | Ga0495676_0039058 | Ga0495676_0039058_2393_2626 | 77 |
| 837 | 3300047321 | Ga0495676_0202175 | Ga0495676_0202175_659_892 | 77 |
| 838 | 3300047322 | Ga0495680_0022970 | Ga0495680_0022970_1674_1907 | 77 |
| 839 | 3300047322 | Ga0495680_0118073 | Ga0495680_0118073_34_267 | 77 |
| 840 | 3300047322 | Ga0495680_0672712 | Ga0495680_0672712_109_342 | 77 |
| 841 | 3300047443 | Ga0495687_246340 | Ga0495687_246340_184_417 | 77 |
| 842 | 3300047444 | Ga0495675_0000137 | Ga0495675_0000137_30257_30490 | 77 |
| 843 | 3300047445 | Ga0495677_0110870 | Ga0495677_0110870_778_1011 | 77 |
| 844 | 3300047471 | Ga0495684_0012535 | Ga0495684_0012535_1016_1249 | 77 |
| 845 | 3300047471 | Ga0495684_0103183 | Ga0495684_0103183_907_1140 | 77 |
| 846 | 3300047471 | Ga0495684_0244517 | Ga0495684_0244517_19_252 | 77 |
| 847 | 3300047471 | Ga0495684_0349069 | Ga0495684_0349069_507_740 | 77 |
| 848 | 3300047673 | Ga0495593_0008432 | Ga0495593_0008432_1024_1257 | 77 |
| 849 | 3300048088 | Ga0495602_0000733 | Ga0495602_0000733_11688_11921 | 77 |
| 850 | 3300048088 | Ga0495602_0235592 | Ga0495602_0235592_719_952 | 77 |
| 851 | 3300048088 | Ga0495602_1067430 | Ga0495602_1067430_232_465 | 77 |
| 852 | 3300048089 | Ga0495614_0004562 | Ga0495614_0004562_1348_1581 | 77 |
| 853 | 3300048903 | Ga0496100_0004812 | Ga0496100_0004812_2990_3223 | 77 |
| 854 | 3300048903 | Ga0496100_0148947 | Ga0496100_0148947_1105_1338 | 77 |
| 855 | 3300048903 | Ga0496100_1084410 | Ga0496100_1084410_250_483 | 77 |
| 856 | 3300048904 | Ga0496101_0159475 | Ga0496101_0159475_944_1177 | 77 |
| 857 | 3300048904 | Ga0496101_0599646 | Ga0496101_0599646_295_528 | 77 |
| 858 | 3300048904 | Ga0496101_0648279 | Ga0496101_0648279_439_672 | 77 |
| 859 | 3300048905 | Ga0496102_0001719 | Ga0496102_0001719_6750_6983 | 77 |
| 860 | 3300048905 | Ga0496102_0080567 | Ga0496102_0080567_2182_2415 | 77 |
| 861 | 3300048905 | Ga0496102_0283621 | Ga0496102_0283621_51_284 | 77 |
| 862 | 3300048906 | Ga0496103_0080194 | Ga0496103_0080194_1647_1880 | 77 |
| 863 | 3300048906 | Ga0496103_0148716 | Ga0496103_0148716_116_349 | 77 |
| 864 | 3300048906 | Ga0496103_0271787 | Ga0496103_0271787_621_854 | 77 |
| 865 | 3300048907 | Ga0496104_0023791 | Ga0496104_0023791_2106_2339 | 77 |
| 866 | 3300048907 | Ga0496104_0151405 | Ga0496104_0151405_1327_1560 | 77 |
| 867 | 3300048907 | Ga0496104_0926232 | Ga0496104_0926232_175_408 | 77 |
| 868 | 3300048908 | Ga0496105_0219865 | Ga0496105_0219865_647_880 | 77 |
| 869 | 3300048909 | Ga0496106_0029860 | Ga0496106_0029860_2944_3177 | 77 |
| 870 | 3300048909 | Ga0496106_0813229 | Ga0496106_0813229_352_585 | 77 |
| 871 | 3300048910 | Ga0496107_0003518 | Ga0496107_0003518_6216_6449 | 77 |
| 872 | 3300048910 | Ga0496107_0850685 | Ga0496107_0850685_159_392 | 77 |
| 873 | 3300048911 | Ga0496108_0003564 | Ga0496108_0003564_2086_2319 | 77 |
| 874 | 3300048911 | Ga0496108_0786651 | Ga0496108_0786651_85_318 | 77 |
| 875 | 3300048912 | Ga0496109_0031188 | Ga0496109_0031188_1455_1688 | 77 |
| 876 | 3300048912 | Ga0496109_0089590 | Ga0496109_0089590_340_573 | 77 |
| 877 | 3300048912 | Ga0496109_0401832 | Ga0496109_0401832_160_393 | 77 |
| 878 | 3300048912 | Ga0496109_0789332 | Ga0496109_0789332_241_474 | 77 |
| 879 | 3300048912 | Ga0496109_1220479 | Ga0496109_1220479_244_477 | 77 |
| 880 | 3300048912 | Ga0496109_1780814 | Ga0496109_1780814_283_516 | 77 |
| 881 | 3300048913 | Ga0496110_0052783 | Ga0496110_0052783_1196_1429 | 77 |
| 882 | 3300048914 | Ga0496111_0027142 | Ga0496111_0027142_3239_3472 | 77 |
| 883 | 3300048914 | Ga0496111_0083665 | Ga0496111_0083665_1885_2118 | 77 |
| 884 | 3300048914 | Ga0496111_0091086 | Ga0496111_0091086_1439_1672 | 77 |
| 885 | 3300048915 | Ga0496112_0005957 | Ga0496112_0005957_9444_9677 | 77 |
| 886 | 3300048915 | Ga0496112_0163212 | Ga0496112_0163212_1632_1865 | 77 |
| 887 | 3300048915 | Ga0496112_0396007 | Ga0496112_0396007_953_1186 | 77 |
| 888 | 3300048916 | Ga0496113_0086292 | Ga0496113_0086292_1092_1325 | 77 |
| 889 | 3300048916 | Ga0496113_1053132 | Ga0496113_1053132_268_501 | 77 |
| 890 | 3300048916 | Ga0496113_1451091 | Ga0496113_1451091_197_430 | 77 |
| 891 | 3300048917 | Ga0496114_0011420 | Ga0496114_0011420_887_1120 | 77 |
| 892 | 3300048917 | Ga0496114_0244124 | Ga0496114_0244124_1104_1337 | 77 |
| 893 | 3300048917 | Ga0496114_0547627 | Ga0496114_0547627_463_696 | 77 |
| 894 | 3300048918 | Ga0496115_0003592 | Ga0496115_0003592_4163_4396 | 77 |
| 895 | 3300048918 | Ga0496115_0474854 | Ga0496115_0474854_620_853 | 77 |
| 896 | 3300048918 | Ga0496115_1014588 | Ga0496115_1014588_203_436 | 77 |
| 897 | 3300049583 | Ga0501067_0067585 | Ga0501067_0067585_1056_1289 | 77 |
| 898 | 3300049583 | Ga0501067_0113289 | Ga0501067_0113289_160_393 | 77 |
| 899 | 3300049583 | Ga0501067_0349865 | Ga0501067_0349865_72_305 | 77 |
| 900 | 3300049585 | Ga0501069_0074742 | Ga0501069_0074742_812_1045 | 77 |
| 901 | 3300050511 | nmdc:mga08y16_187104_c1 | nmdc:mga08y16_187104_c1_743_976 | 77 |
| 902 | 3300050512 | nmdc:mga0n895_513995_c1 | nmdc:mga0n895_513995_c1_447_680 | 77 |
| 903 | 3300050513 | nmdc:mga0rr50_662144_c1 | nmdc:mga0rr50_662144_c1_221_454 | 77 |
| 904 | 3300050514 | nmdc:mga08x19_1079139_c1 | nmdc:mga08x19_1079139_c1_242_475 | 77 |
| 905 | 3300053077 | Ga0495601_0002178 | Ga0495601_0002178_1998_2231 | 77 |
| 906 | 3300053077 | Ga0495601_0011903 | Ga0495601_0011903_4257_4490 | 77 |
| 907 | 3300053077 | Ga0495601_0171877 | Ga0495601_0171877_193_426 | 77 |
| 908 | 3300053077 | Ga0495601_0495633 | Ga0495601_0495633_254_487 | 77 |
| 909 | 3300053077 | Ga0495601_1036890 | Ga0495601_1036890_172_405 | 77 |
| 910 | 3300053078 | Ga0495612_0141548 | Ga0495612_0141548_382_615 | 77 |
| 911 | 3300053078 | Ga0495612_0199973 | Ga0495612_0199973_563_796 | 77 |
| 912 | 3300053083 | Ga0495655_0109583 | Ga0495655_0109583_416_649 | 77 |
| 913 | 3300053084 | Ga0495595_0116044 | Ga0495595_0116044_324_557 | 77 |
| 914 | 3300053085 | Ga0495619_0018551 | Ga0495619_0018551_2600_2833 | 77 |
| 915 | 3300053085 | Ga0495619_0177702 | Ga0495619_0177702_443_676 | 77 |
| 916 | 3300053085 | Ga0495619_0270515 | Ga0495619_0270515_846_1079 | 77 |
| 917 | 3300053085 | Ga0495619_0304755 | Ga0495619_0304755_808_1041 | 77 |
| 918 | 3300053085 | Ga0495619_0588705 | Ga0495619_0588705_305_538 | 77 |
| 919 | 3300053094 | Ga0500566_0029077 | Ga0500566_0029077_2113_2346 | 77 |
| 920 | 3300061719 | Ga0466962_0003630 | Ga0466962_0003630_3621_3854 | 77 |
| 921 | 3300061719 | Ga0466962_0006235 | Ga0466962_0006235_3985_4218 | 77 |
| 922 | 3300061719 | Ga0466962_0007473 | Ga0466962_0007473_4635_4868 | 77 |
| 923 | 3300061719 | Ga0466962_0019218 | Ga0466962_0019218_379_612 | 77 |
| 924 | 3300061719 | Ga0466962_0076362 | Ga0466962_0076362_286_519 | 77 |
| 925 | 3300061719 | Ga0466962_0081564 | Ga0466962_0081564_868_1101 | 77 |
| 926 | 3300061719 | Ga0466962_0458445 | Ga0466962_0458445_191_424 | 77 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8crx-assembly1.cif.gz_G | cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound | 0.7706 | 3 | 77 |
| 4jno-assembly1.cif.gz_A | crystal structure of plasmodium falciparum erythrocyte binding antigen 140 (pfeba-140/baebl) region ii in complex with sialyllactose | 0.7526 | 19 | 35 |
| 1g5i-assembly1.cif.gz_B | crystal structure of the accessory subunit of murine mitochondrial polymerase gamma | 0.7314 | 3 | 35 |
| 5c53-assembly1.cif.gz_B | probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma | 0.7267 | 6 | 35 |
| 3ikl-assembly1.cif.gz_A | crystal structure of pol gb delta-i4. | 0.7249 | 2 | 29 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFM7_9_77_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9197 | 6 | 77 | 3.30.300.20 |
| af_P9WFM7_9_77_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8947 | 6 | 77 | 3.30.300.20 |
| 2cy1A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.762 | 1 | 76 | 3.30.300.20 |
| 2cy1A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7436 | 1 | 76 | 3.30.300.20 |
| af_Q2G2S7_1_244_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7419 | 19 | 41 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7ZK63-F1-model_v4 | RNA-binding protein KhpA (KH-domain protein A) | 0.9868 | 9 | 77 |
GO:0003723
GO:0005737 GO:0008360 GO:0009252 GO:0071555 |
| AF-A0A1W9RIV1-F1-model_v4 | RNA-binding protein KhpA (KH-domain protein A) | 0.9867 | 2 | 77 |
GO:0003723
GO:0005737 GO:0008360 GO:0009252 GO:0071555 |
| AF-A0A538MA88-F1-model_v4 | RNA-binding protein KhpA (KH-domain protein A) | 0.9834 | 2 | 77 |
GO:0003723
GO:0005737 |
| AF-A0A7W0ZGY8-F1-model_v4 | KH domain-containing protein | 0.9814 | 12 | 77 |
GO:0003723
GO:0005737 |
| AF-A0A7Y3L329-F1-model_v4 | RNA-binding protein KhpA (KH-domain protein A) | 0.9744 | 1 | 76 |
GO:0003723
GO:0005737 GO:0008360 GO:0009252 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar