F485827
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 923 | 377 | 1846 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10004575|Ga0157369_100045757 |
| Length | 334 |
| Sequence | VVRPRRADGQGVAARDPRPRRLTVRLVFAGTPAAALPSLDAIAASSHELLAVVTRPDAPAGRGRPVDGRDVRRSAVGEWADARGVDVVTPARPADPDFLAWLRNLAPDCCPVVAYGALVPPAALEIPAYGWVNLHFSILPAWRGAAPVQHSILHGDEITGATTFQLKAGLDTGPVYGVVTTEIGRTETAGSLMGRLAAPGAGLLVATLDGIESGELQPKPQPNDGVSLAPKLTVAAARIDWSAPALRVDRLVRACTPAPGAWTTLRGRRVKLGPVDPTDGQLDPGAISVDDQRVIVGTGGGAVALGVVQPEGRGPMDAIAWVRGLRLTADDRFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 161 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 178 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 179 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 216 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 301 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 302 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 350 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 351 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 352 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 353 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 354 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 355 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 356 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 357 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 358 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 359 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 360 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 361 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 362 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 363 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 364 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 365 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 366 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 367 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 368 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 369 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 370 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 371 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 372 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 373 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 374 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 375 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 376 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 377 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.64 |
| Metatranscriptomes | 0.33 |
| Isolates | 3.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 0.98 |
| Nodule | 0 |
| Rhizoplane | 5.53 |
| Rhizosphere | 89.17 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10004575 | 3300013105 | Bacteria | 16260 |
| 2 | JGI25406J46586_10012586 | 3300003203 | Bacteria | 3665 |
| 3 | JGI25406J46586_10030735 | 3300003203 | Bacteria | 2018 |
| 4 | JGI25406J46586_10040571 | 3300003203 | Bacteria | 1649 |
| 5 | JGI25404J52841_10012198 | 3300003659 | Bacteria | 1859 |
| 6 | Ga0070658_10003299 | 3300005327 | Bacteria | 13312 |
| 7 | Ga0070658_10004108 | 3300005327 | Bacteria | 11931 |
| 8 | Ga0070658_10034494 | 3300005327 | Bacteria | 4071 |
| 9 | Ga0070658_10039254 | 3300005327 | Bacteria | 3819 |
| 10 | Ga0070658_10269779 | 3300005327 | Bacteria | 1447 |
| 11 | Ga0070683_100013327 | 3300005329 | Bacteria | 7167 |
| 12 | Ga0070683_100313617 | 3300005329 | Bacteria | 1492 |
| 13 | Ga0070683_100539160 | 3300005329 | Bacteria | 1115 |
| 14 | Ga0070670_100030363 | 3300005331 | Bacteria | 4654 |
| 15 | Ga0070670_100134151 | 3300005331 | Bacteria | 2139 |
| 16 | Ga0068869_100009523 | 3300005334 | Bacteria | 6304 |
| 17 | Ga0070680_100000593 | 3300005336 | Bacteria | 24998 |
| 18 | Ga0070680_100102749 | 3300005336 | Bacteria | 2374 |
| 19 | Ga0070682_100017404 | 3300005337 | Bacteria | 4190 |
| 20 | Ga0070682_100133291 | 3300005337 | Bacteria | 1684 |
| 21 | Ga0070682_100337873 | 3300005337 | Bacteria | 1118 |
| 22 | Ga0068868_100039320 | 3300005338 | Bacteria | 3676 |
| 23 | Ga0068868_100043967 | 3300005338 | Bacteria | 3490 |
| 24 | Ga0068868_100214097 | 3300005338 | Bacteria | 1611 |
| 25 | Ga0070660_100042286 | 3300005339 | Bacteria | 3477 |
| 26 | Ga0070660_100079237 | 3300005339 | Bacteria | 2577 |
| 27 | Ga0070660_100204072 | 3300005339 | Bacteria | 1604 |
| 28 | Ga0070660_100267755 | 3300005339 | Bacteria | 1396 |
| 29 | Ga0070689_100095783 | 3300005340 | Bacteria | 2345 |
| 30 | Ga0070691_10008216 | 3300005341 | Bacteria | 4782 |
| 31 | Ga0070687_100067389 | 3300005343 | Bacteria | 1911 |
| 32 | Ga0070661_100014991 | 3300005344 | Bacteria | 5469 |
| 33 | Ga0070661_100127559 | 3300005344 | Bacteria | 1909 |
| 34 | Ga0070692_10004963 | 3300005345 | Bacteria | 5616 |
| 35 | Ga0070692_10017484 | 3300005345 | Bacteria | 3429 |
| 36 | Ga0070692_10041894 | 3300005345 | Bacteria | 2348 |
| 37 | Ga0070669_100096606 | 3300005353 | Bacteria | 2223 |
| 38 | Ga0070675_100009094 | 3300005354 | Bacteria | 7716 |
| 39 | Ga0070675_100011908 | 3300005354 | Bacteria | 6816 |
| 40 | Ga0070675_100097439 | 3300005354 | Bacteria | 2472 |
| 41 | Ga0070671_100002713 | 3300005355 | Bacteria | 13735 |
| 42 | Ga0070674_100159943 | 3300005356 | Bacteria | 1708 |
| 43 | Ga0070673_100059250 | 3300005364 | Bacteria | 3030 |
| 44 | Ga0070673_100220685 | 3300005364 | Bacteria | 1640 |
| 45 | Ga0070659_100000619 | 3300005366 | Bacteria | 26037 |
| 46 | Ga0070659_100013213 | 3300005366 | Bacteria | 6141 |
| 47 | Ga0070659_100043276 | 3300005366 | Bacteria | 3522 |
| 48 | Ga0070659_100047992 | 3300005366 | Bacteria | 3352 |
| 49 | Ga0070659_100314281 | 3300005366 | Bacteria | 1308 |
| 50 | Ga0070667_100042929 | 3300005367 | Bacteria | 3794 |
| 51 | Ga0070667_100125971 | 3300005367 | Bacteria | 2232 |
| 52 | Ga0070709_10000601 | 3300005434 | Bacteria | 21040 |
| 53 | Ga0070709_10000823 | 3300005434 | Bacteria | 17323 |
| 54 | Ga0070709_10022304 | 3300005434 | Bacteria | 3701 |
| 55 | Ga0070709_10080130 | 3300005434 | Bacteria | 2128 |
| 56 | Ga0070709_10092702 | 3300005434 | Bacteria | 1996 |
| 57 | Ga0070714_100003489 | 3300005435 | Bacteria | 11740 |
| 58 | Ga0070714_100006469 | 3300005435 | Bacteria | 9052 |
| 59 | Ga0070714_100007188 | 3300005435 | Bacteria | 8642 |
| 60 | Ga0070714_100011424 | 3300005435 | Bacteria | 7043 |
| 61 | Ga0070714_100015841 | 3300005435 | Bacteria | 6077 |
| 62 | Ga0070714_100020459 | 3300005435 | Bacteria | 5404 |
| 63 | Ga0070714_100026755 | 3300005435 | Bacteria | 4769 |
| 64 | Ga0070714_100230000 | 3300005435 | Bacteria | 1708 |
| 65 | Ga0070714_100398904 | 3300005435 | Bacteria | 1300 |
| 66 | Ga0070713_100006897 | 3300005436 | Bacteria | 7925 |
| 67 | Ga0070713_100007037 | 3300005436 | Bacteria | 7856 |
| 68 | Ga0070713_100010692 | 3300005436 | Bacteria | 6642 |
| 69 | Ga0070713_100157112 | 3300005436 | Bacteria | 2027 |
| 70 | Ga0070713_100228835 | 3300005436 | Bacteria | 1689 |
| 71 | Ga0070713_100229650 | 3300005436 | Bacteria | 1686 |
| 72 | Ga0070713_100264599 | 3300005436 | Bacteria | 1573 |
| 73 | Ga0070713_100361707 | 3300005436 | Bacteria | 1348 |
| 74 | Ga0070710_10000704 | 3300005437 | Bacteria | 15898 |
| 75 | Ga0070710_10000868 | 3300005437 | Bacteria | 14460 |
| 76 | Ga0070710_10079055 | 3300005437 | Bacteria | 1915 |
| 77 | Ga0070710_10088687 | 3300005437 | Bacteria | 1820 |
| 78 | Ga0070710_10127642 | 3300005437 | Bacteria | 1547 |
| 79 | Ga0070711_100000369 | 3300005439 | Bacteria | 23241 |
| 80 | Ga0070711_100044661 | 3300005439 | Bacteria | 3009 |
| 81 | Ga0070711_100063587 | 3300005439 | Bacteria | 2576 |
| 82 | Ga0070700_100102919 | 3300005441 | Bacteria | 1885 |
| 83 | Ga0070694_100332996 | 3300005444 | Bacteria | 1172 |
| 84 | Ga0070708_100005821 | 3300005445 | Bacteria | 9785 |
| 85 | Ga0070708_100008154 | 3300005445 | Bacteria | 8403 |
| 86 | Ga0070708_100013187 | 3300005445 | Bacteria | 6762 |
| 87 | Ga0070708_100063538 | 3300005445 | Bacteria | 3305 |
| 88 | Ga0070708_100308674 | 3300005445 | Bacteria | 1490 |
| 89 | Ga0070708_100322184 | 3300005445 | Bacteria | 1456 |
| 90 | Ga0070663_100003535 | 3300005455 | Bacteria | 9023 |
| 91 | Ga0070663_100083348 | 3300005455 | Bacteria | 2354 |
| 92 | Ga0070678_100012017 | 3300005456 | Bacteria | 5364 |
| 93 | Ga0070678_100093441 | 3300005456 | Bacteria | 2313 |
| 94 | Ga0070678_100094047 | 3300005456 | Bacteria | 2306 |
| 95 | Ga0070662_100004777 | 3300005457 | Bacteria | 8586 |
| 96 | Ga0070662_100008194 | 3300005457 | Bacteria | 6808 |
| 97 | Ga0070681_10000504 | 3300005458 | Bacteria | 31959 |
| 98 | Ga0070681_10121291 | 3300005458 | Bacteria | 2549 |
| 99 | Ga0070681_10164278 | 3300005458 | Bacteria | 2143 |
| 100 | Ga0070681_10238052 | 3300005458 | Bacteria | 1734 |
| 101 | Ga0070706_100002492 | 3300005467 | Bacteria | 18546 |
| 102 | Ga0070706_100002558 | 3300005467 | Bacteria | 18289 |
| 103 | Ga0070706_100010627 | 3300005467 | Bacteria | 8545 |
| 104 | Ga0070706_100011680 | 3300005467 | Bacteria | 8154 |
| 105 | Ga0070706_100266893 | 3300005467 | Bacteria | 1597 |
| 106 | Ga0070707_100000199 | 3300005468 | Bacteria | 60047 |
| 107 | Ga0070707_100001248 | 3300005468 | Bacteria | 24994 |
| 108 | Ga0070707_100002510 | 3300005468 | Bacteria | 17475 |
| 109 | Ga0070707_100005322 | 3300005468 | Bacteria | 12043 |
| 110 | Ga0070707_100014634 | 3300005468 | Bacteria | 7354 |
| 111 | Ga0070707_100022729 | 3300005468 | Bacteria | 5930 |
| 112 | Ga0070707_100036751 | 3300005468 | Bacteria | 4674 |
| 113 | Ga0070707_100043283 | 3300005468 | Bacteria | 4310 |
| 114 | Ga0070707_100095229 | 3300005468 | Bacteria | 2883 |
| 115 | Ga0070707_100193532 | 3300005468 | Bacteria | 1983 |
| 116 | Ga0070707_100360997 | 3300005468 | Bacteria | 1411 |
| 117 | Ga0070707_100422977 | 3300005468 | Bacteria | 1292 |
| 118 | Ga0070698_100000223 | 3300005471 | Bacteria | 55997 |
| 119 | Ga0070698_100000264 | 3300005471 | Bacteria | 52985 |
| 120 | Ga0070698_100004936 | 3300005471 | Bacteria | 14633 |
| 121 | Ga0070698_100006575 | 3300005471 | Bacteria | 12608 |
| 122 | Ga0070698_100009166 | 3300005471 | Bacteria | 10623 |
| 123 | Ga0070698_100009346 | 3300005471 | Bacteria | 10513 |
| 124 | Ga0070698_100010677 | 3300005471 | Bacteria | 9785 |
| 125 | Ga0070698_100012045 | 3300005471 | Bacteria | 9170 |
| 126 | Ga0070698_100023491 | 3300005471 | Bacteria | 6445 |
| 127 | Ga0070698_100092840 | 3300005471 | Bacteria | 2999 |
| 128 | Ga0070698_100102135 | 3300005471 | Bacteria | 2839 |
| 129 | Ga0070698_100192365 | 3300005471 | Bacteria | 1977 |
| 130 | Ga0070699_100002999 | 3300005518 | Bacteria | 15003 |
| 131 | Ga0070679_100000687 | 3300005530 | Bacteria | 29007 |
| 132 | Ga0070679_100010892 | 3300005530 | Bacteria | 8639 |
| 133 | Ga0070679_100175965 | 3300005530 | Bacteria | 2112 |
| 134 | Ga0070679_100377721 | 3300005530 | Bacteria | 1364 |
| 135 | Ga0070679_100427095 | 3300005530 | Bacteria | 1270 |
| 136 | Ga0070684_100011120 | 3300005535 | Bacteria | 7162 |
| 137 | Ga0070684_100022936 | 3300005535 | Bacteria | 5213 |
| 138 | Ga0070684_100043616 | 3300005535 | Bacteria | 3874 |
| 139 | Ga0070684_100202129 | 3300005535 | Bacteria | 1810 |
| 140 | Ga0070697_100008868 | 3300005536 | Bacteria | 7852 |
| 141 | Ga0070697_100022138 | 3300005536 | Bacteria | 5042 |
| 142 | Ga0070697_100068293 | 3300005536 | Bacteria | 2910 |
| 143 | Ga0068853_100330452 | 3300005539 | Bacteria | 1414 |
| 144 | Ga0068853_100462529 | 3300005539 | Bacteria | 1194 |
| 145 | Ga0070672_100348122 | 3300005543 | Bacteria | 1263 |
| 146 | Ga0070686_100004188 | 3300005544 | Bacteria | 7940 |
| 147 | Ga0070686_100075456 | 3300005544 | Bacteria | 2218 |
| 148 | Ga0070696_100245626 | 3300005546 | Bacteria | 1351 |
| 149 | Ga0070693_100018462 | 3300005547 | Bacteria | 3644 |
| 150 | Ga0070693_100047880 | 3300005547 | Bacteria | 2433 |
| 151 | Ga0070665_100000703 | 3300005548 | Bacteria | 44593 |
| 152 | Ga0070665_100046395 | 3300005548 | Bacteria | 4366 |
| 153 | Ga0070665_100110970 | 3300005548 | Bacteria | 2745 |
| 154 | Ga0070704_100129273 | 3300005549 | Bacteria | 1954 |
| 155 | Ga0068855_100004375 | 3300005563 | Bacteria | 17261 |
| 156 | Ga0068855_100131380 | 3300005563 | Bacteria | 2859 |
| 157 | Ga0068855_100224872 | 3300005563 | Bacteria | 2103 |
| 158 | Ga0068855_100489469 | 3300005563 | Bacteria | 1338 |
| 159 | Ga0070664_100010112 | 3300005564 | Bacteria | 7648 |
| 160 | Ga0070664_100017926 | 3300005564 | Bacteria | 5813 |
| 161 | Ga0070664_100378875 | 3300005564 | Bacteria | 1291 |
| 162 | Ga0068857_100008891 | 3300005577 | Bacteria | 8699 |
| 163 | Ga0068857_100028443 | 3300005577 | Bacteria | 4933 |
| 164 | Ga0068857_100183040 | 3300005577 | Bacteria | 1907 |
| 165 | Ga0068857_100447223 | 3300005577 | Bacteria | 1208 |
| 166 | Ga0068854_100028810 | 3300005578 | Bacteria | 3840 |
| 167 | Ga0068854_100352128 | 3300005578 | Bacteria | 1206 |
| 168 | Ga0068856_100020564 | 3300005614 | Bacteria | 6412 |
| 169 | Ga0068856_100026030 | 3300005614 | Bacteria | 5706 |
| 170 | Ga0068856_100026955 | 3300005614 | Bacteria | 5605 |
| 171 | Ga0068856_100038800 | 3300005614 | Bacteria | 4676 |
| 172 | Ga0070702_100014503 | 3300005615 | Bacteria | 3998 |
| 173 | Ga0070702_100019326 | 3300005615 | Bacteria | 3551 |
| 174 | Ga0068852_100049930 | 3300005616 | Bacteria | 3581 |
| 175 | Ga0068852_100058858 | 3300005616 | Bacteria | 3330 |
| 176 | Ga0068852_100168032 | 3300005616 | Bacteria | 2054 |
| 177 | Ga0068859_100003310 | 3300005617 | Bacteria | 16370 |
| 178 | Ga0068859_100035566 | 3300005617 | Bacteria | 4997 |
| 179 | Ga0068864_100075629 | 3300005618 | Bacteria | 2941 |
| 180 | Ga0068851_10044295 | 3300005834 | Bacteria | 2245 |
| 181 | Ga0068851_10069154 | 3300005834 | Bacteria | 1823 |
| 182 | Ga0068870_10000071 | 3300005840 | Bacteria | 32257 |
| 183 | Ga0068863_100031033 | 3300005841 | Bacteria | 5103 |
| 184 | Ga0068863_100099316 | 3300005841 | Bacteria | 2765 |
| 185 | Ga0068858_100003961 | 3300005842 | Bacteria | 14613 |
| 186 | Ga0068858_100280556 | 3300005842 | Bacteria | 1586 |
| 187 | Ga0068860_100000696 | 3300005843 | Bacteria | 38651 |
| 188 | Ga0068860_100096313 | 3300005843 | Bacteria | 2821 |
| 189 | Ga0068862_100016202 | 3300005844 | Bacteria | 6201 |
| 190 | Ga0068862_100189667 | 3300005844 | Bacteria | 1849 |
| 191 | Ga0081540_1000616 | 3300005983 | Bacteria | 33810 |
| 192 | Ga0081540_1000782 | 3300005983 | Bacteria | 29170 |
| 193 | Ga0081539_10000806 | 3300005985 | Bacteria | 61012 |
| 194 | Ga0081539_10001125 | 3300005985 | Bacteria | 48453 |
| 195 | Ga0081539_10004135 | 3300005985 | Bacteria | 16512 |
| 196 | Ga0070717_10003541 | 3300006028 | Bacteria | 11197 |
| 197 | Ga0070717_10005526 | 3300006028 | Bacteria | 9220 |
| 198 | Ga0070717_10011746 | 3300006028 | Bacteria | 6664 |
| 199 | Ga0070717_10016987 | 3300006028 | Bacteria | 5652 |
| 200 | Ga0070717_10021169 | 3300006028 | Bacteria | 5123 |
| 201 | Ga0070717_10046302 | 3300006028 | Bacteria | 3558 |
| 202 | Ga0070717_10062304 | 3300006028 | Bacteria | 3093 |
| 203 | Ga0070717_10086256 | 3300006028 | Bacteria | 2642 |
| 204 | Ga0070717_10136020 | 3300006028 | Bacteria | 2116 |
| 205 | Ga0070717_10148949 | 3300006028 | Bacteria | 2024 |
| 206 | Ga0070717_10230942 | 3300006028 | Bacteria | 1629 |
| 207 | Ga0070717_10446964 | 3300006028 | Bacteria | 1165 |
| 208 | Ga0075363_100025191 | 3300006048 | Bacteria | 3031 |
| 209 | Ga0075364_10012201 | 3300006051 | Bacteria | 5249 |
| 210 | Ga0070715_10001553 | 3300006163 | Bacteria | 6725 |
| 211 | Ga0070715_10004219 | 3300006163 | Bacteria | 4686 |
| 212 | Ga0070716_100000523 | 3300006173 | Bacteria | 16045 |
| 213 | Ga0070716_100003243 | 3300006173 | Bacteria | 7639 |
| 214 | Ga0070716_100004648 | 3300006173 | Bacteria | 6580 |
| 215 | Ga0070712_100001355 | 3300006175 | Bacteria | 14866 |
| 216 | Ga0070712_100015091 | 3300006175 | Bacteria | 4967 |
| 217 | Ga0070712_100025700 | 3300006175 | Bacteria | 3917 |
| 218 | Ga0070712_100038541 | 3300006175 | Bacteria | 3267 |
| 219 | Ga0070712_100070379 | 3300006175 | Bacteria | 2499 |
| 220 | Ga0070712_100354046 | 3300006175 | Bacteria | 1202 |
| 221 | Ga0097621_100063494 | 3300006237 | Bacteria | 3035 |
| 222 | Ga0075428_100000548 | 3300006844 | Bacteria | 38376 |
| 223 | Ga0075430_100116789 | 3300006846 | Bacteria | 2224 |
| 224 | Ga0075431_100033598 | 3300006847 | Bacteria | 5286 |
| 225 | Ga0075434_100001779 | 3300006871 | Bacteria | 18580 |
| 226 | Ga0075434_100016475 | 3300006871 | Bacteria | 7105 |
| 227 | Ga0075434_100094262 | 3300006871 | Bacteria | 2998 |
| 228 | Ga0068865_100172894 | 3300006881 | Bacteria | 1658 |
| 229 | Ga0075436_100017369 | 3300006914 | Bacteria | 4926 |
| 230 | Ga0075436_100036169 | 3300006914 | Bacteria | 3407 |
| 231 | Ga0097620_100003310 | 3300006931 | Bacteria | 16370 |
| 232 | Ga0097620_100035566 | 3300006931 | Bacteria | 4997 |
| 233 | Ga0105251_10066396 | 3300009011 | Bacteria | 1687 |
| 234 | Ga0105240_10120810 | 3300009093 | Bacteria | 3155 |
| 235 | Ga0111539_10025523 | 3300009094 | Bacteria | 7245 |
| 236 | Ga0111539_10068637 | 3300009094 | Bacteria | 4186 |
| 237 | Ga0105245_10045369 | 3300009098 | Bacteria | 3926 |
| 238 | Ga0105245_10053882 | 3300009098 | Bacteria | 3612 |
| 239 | Ga0105245_10307724 | 3300009098 | Bacteria | 1557 |
| 240 | Ga0105245_10416883 | 3300009098 | Bacteria | 1345 |
| 241 | Ga0105247_10010944 | 3300009101 | Bacteria | 5477 |
| 242 | Ga0114129_10010771 | 3300009147 | Bacteria | 13031 |
| 243 | Ga0114129_10265376 | 3300009147 | Bacteria | 2299 |
| 244 | Ga0105243_10033376 | 3300009148 | Bacteria | 3980 |
| 245 | Ga0105243_10208195 | 3300009148 | Bacteria | 1720 |
| 246 | Ga0105241_10004726 | 3300009174 | Bacteria | 10042 |
| 247 | Ga0105241_10069818 | 3300009174 | Bacteria | 2724 |
| 248 | Ga0105237_10094009 | 3300009545 | Bacteria | 2987 |
| 249 | Ga0105237_10358051 | 3300009545 | Bacteria | 1463 |
| 250 | Ga0105239_10000854 | 3300010375 | Bacteria | 43307 |
| 251 | Ga0105239_10005467 | 3300010375 | Bacteria | 14910 |
| 252 | Ga0105246_10000321 | 3300011119 | Bacteria | 25383 |
| 253 | Ga0105246_10000478 | 3300011119 | Bacteria | 21566 |
| 254 | Ga0157371_10018942 | 3300013102 | Bacteria | 5082 |
| 255 | Ga0157371_10052250 | 3300013102 | Bacteria | 2902 |
| 256 | Ga0157369_10002905 | 3300013105 | Bacteria | 20475 |
| 257 | Ga0157369_10071305 | 3300013105 | Bacteria | 3730 |
| 258 | Ga0157369_10096500 | 3300013105 | Bacteria | 3154 |
| 259 | Ga0157369_10136882 | 3300013105 | Bacteria | 2592 |
| 260 | Ga0157378_10156863 | 3300013297 | Bacteria | 2125 |
| 261 | Ga0157372_10047147 | 3300013307 | Bacteria | 4787 |
| 262 | Ga0157372_10501827 | 3300013307 | Bacteria | 1415 |
| 263 | Ga0157372_10733692 | 3300013307 | Bacteria | 1149 |
| 264 | Ga0163163_10101443 | 3300014325 | Bacteria | 2900 |
| 265 | Ga0182008_10017849 | 3300014497 | Bacteria | 3676 |
| 266 | Ga0157379_10002714 | 3300014968 | Bacteria | 14938 |
| 267 | Ga0163161_10052759 | 3300017792 | Bacteria | 2947 |
| 268 | Ga0163161_10186601 | 3300017792 | Bacteria | 1592 |
| 269 | Ga0213875_10070533 | 3300021388 | Bacteria | 1631 |
| 270 | Ga0213875_10135734 | 3300021388 | Bacteria | 1151 |
| 271 | Ga0224712_10010846 | 3300022467 | Bacteria | 2801 |
| 272 | Ga0207656_10006329 | 3300025321 | Bacteria | 4245 |
| 273 | Ga0207653_10016065 | 3300025885 | Bacteria | 2350 |
| 274 | Ga0207692_10000277 | 3300025898 | Bacteria | 17590 |
| 275 | Ga0207692_10008894 | 3300025898 | Bacteria | 4173 |
| 276 | Ga0207692_10009191 | 3300025898 | Bacteria | 4118 |
| 277 | Ga0207692_10012523 | 3300025898 | Bacteria | 3646 |
| 278 | Ga0207692_10054041 | 3300025898 | Bacteria | 2048 |
| 279 | Ga0207692_10068078 | 3300025898 | Bacteria | 1866 |
| 280 | Ga0207710_10018127 | 3300025900 | Bacteria | 2992 |
| 281 | Ga0207688_10032483 | 3300025901 | Bacteria | 2884 |
| 282 | Ga0207647_10025031 | 3300025904 | Bacteria | 3929 |
| 283 | Ga0207699_10000261 | 3300025906 | Bacteria | 28952 |
| 284 | Ga0207699_10000458 | 3300025906 | Bacteria | 20841 |
| 285 | Ga0207699_10001066 | 3300025906 | Bacteria | 12960 |
| 286 | Ga0207699_10008590 | 3300025906 | Bacteria | 5048 |
| 287 | Ga0207699_10014254 | 3300025906 | Bacteria | 4092 |
| 288 | Ga0207699_10058475 | 3300025906 | Bacteria | 2306 |
| 289 | Ga0207645_10041514 | 3300025907 | Bacteria | 2944 |
| 290 | Ga0207645_10047739 | 3300025907 | Bacteria | 2734 |
| 291 | Ga0207643_10000102 | 3300025908 | Bacteria | 57710 |
| 292 | Ga0207705_10004990 | 3300025909 | Bacteria | 9954 |
| 293 | Ga0207705_10008596 | 3300025909 | Bacteria | 7443 |
| 294 | Ga0207705_10011904 | 3300025909 | Bacteria | 6285 |
| 295 | Ga0207705_10095745 | 3300025909 | Bacteria | 2179 |
| 296 | Ga0207705_10112150 | 3300025909 | Bacteria | 2016 |
| 297 | Ga0207684_10001230 | 3300025910 | Bacteria | 28445 |
| 298 | Ga0207684_10001761 | 3300025910 | Bacteria | 22878 |
| 299 | Ga0207684_10006481 | 3300025910 | Bacteria | 10673 |
| 300 | Ga0207684_10011655 | 3300025910 | Bacteria | 7675 |
| 301 | Ga0207684_10025133 | 3300025910 | Bacteria | 5076 |
| 302 | Ga0207684_10030279 | 3300025910 | Bacteria | 4608 |
| 303 | Ga0207684_10034910 | 3300025910 | Bacteria | 4271 |
| 304 | Ga0207684_10046895 | 3300025910 | Bacteria | 3665 |
| 305 | Ga0207684_10093466 | 3300025910 | Bacteria | 2564 |
| 306 | Ga0207684_10292315 | 3300025910 | Bacteria | 1405 |
| 307 | Ga0207707_10103022 | 3300025912 | Bacteria | 2495 |
| 308 | Ga0207671_10023017 | 3300025914 | Bacteria | 4702 |
| 309 | Ga0207671_10089523 | 3300025914 | Bacteria | 2316 |
| 310 | Ga0207693_10003084 | 3300025915 | Bacteria | 14372 |
| 311 | Ga0207693_10011453 | 3300025915 | Bacteria | 7176 |
| 312 | Ga0207693_10030153 | 3300025915 | Bacteria | 4283 |
| 313 | Ga0207663_10012382 | 3300025916 | Bacteria | 4611 |
| 314 | Ga0207663_10048339 | 3300025916 | Bacteria | 2632 |
| 315 | Ga0207663_10078370 | 3300025916 | Bacteria | 2154 |
| 316 | Ga0207660_10000439 | 3300025917 | Bacteria | 27487 |
| 317 | Ga0207660_10027222 | 3300025917 | Bacteria | 3898 |
| 318 | Ga0207662_10039096 | 3300025918 | Bacteria | 2782 |
| 319 | Ga0207657_10007215 | 3300025919 | Bacteria | 11413 |
| 320 | Ga0207657_10051901 | 3300025919 | Bacteria | 3562 |
| 321 | Ga0207657_10082552 | 3300025919 | Bacteria | 2697 |
| 322 | Ga0207657_10092164 | 3300025919 | Bacteria | 2526 |
| 323 | Ga0207649_10020755 | 3300025920 | Bacteria | 3771 |
| 324 | Ga0207649_10039068 | 3300025920 | Bacteria | 2875 |
| 325 | Ga0207652_10004366 | 3300025921 | Bacteria | 11522 |
| 326 | Ga0207652_10034783 | 3300025921 | Bacteria | 4249 |
| 327 | Ga0207652_10433206 | 3300025921 | Bacteria | 1186 |
| 328 | Ga0207646_10000278 | 3300025922 | Bacteria | 70066 |
| 329 | Ga0207646_10002243 | 3300025922 | Bacteria | 23027 |
| 330 | Ga0207646_10003994 | 3300025922 | Bacteria | 16334 |
| 331 | Ga0207646_10006877 | 3300025922 | Bacteria | 11683 |
| 332 | Ga0207646_10014374 | 3300025922 | Bacteria | 7521 |
| 333 | Ga0207646_10017448 | 3300025922 | Bacteria | 6716 |
| 334 | Ga0207646_10030307 | 3300025922 | Bacteria | 4906 |
| 335 | Ga0207646_10063984 | 3300025922 | Bacteria | 3283 |
| 336 | Ga0207646_10085097 | 3300025922 | Bacteria | 2829 |
| 337 | Ga0207646_10112132 | 3300025922 | Bacteria | 2448 |
| 338 | Ga0207646_10236330 | 3300025922 | Bacteria | 1651 |
| 339 | Ga0207694_10118167 | 3300025924 | Bacteria | 2115 |
| 340 | Ga0207694_10209450 | 3300025924 | Bacteria | 1588 |
| 341 | Ga0207650_10017555 | 3300025925 | Bacteria | 5012 |
| 342 | Ga0207650_10152697 | 3300025925 | Bacteria | 1823 |
| 343 | Ga0207659_10005909 | 3300025926 | Bacteria | 7472 |
| 344 | Ga0207659_10022350 | 3300025926 | Bacteria | 4211 |
| 345 | Ga0207659_10033050 | 3300025926 | Bacteria | 3556 |
| 346 | Ga0207687_10003225 | 3300025927 | Bacteria | 11043 |
| 347 | Ga0207687_10180829 | 3300025927 | Bacteria | 1634 |
| 348 | Ga0207687_10234237 | 3300025927 | Bacteria | 1452 |
| 349 | Ga0207700_10001366 | 3300025928 | Bacteria | 13833 |
| 350 | Ga0207700_10005658 | 3300025928 | Bacteria | 7500 |
| 351 | Ga0207700_10031442 | 3300025928 | Bacteria | 3771 |
| 352 | Ga0207700_10033364 | 3300025928 | Bacteria | 3683 |
| 353 | Ga0207700_10049461 | 3300025928 | Bacteria | 3127 |
| 354 | Ga0207700_10059009 | 3300025928 | Bacteria | 2901 |
| 355 | Ga0207700_10436518 | 3300025928 | Bacteria | 1152 |
| 356 | Ga0207664_10000311 | 3300025929 | Bacteria | 36120 |
| 357 | Ga0207664_10001412 | 3300025929 | Bacteria | 15806 |
| 358 | Ga0207664_10010644 | 3300025929 | Bacteria | 6501 |
| 359 | Ga0207664_10021242 | 3300025929 | Bacteria | 4823 |
| 360 | Ga0207664_10034531 | 3300025929 | Bacteria | 3895 |
| 361 | Ga0207664_10099819 | 3300025929 | Bacteria | 2396 |
| 362 | Ga0207664_10132319 | 3300025929 | Bacteria | 2101 |
| 363 | Ga0207664_10246873 | 3300025929 | Bacteria | 1556 |
| 364 | Ga0207644_10008498 | 3300025931 | Bacteria | 6718 |
| 365 | Ga0207690_10000575 | 3300025932 | Bacteria | 24004 |
| 366 | Ga0207690_10008450 | 3300025932 | Bacteria | 6112 |
| 367 | Ga0207690_10010483 | 3300025932 | Bacteria | 5510 |
| 368 | Ga0207690_10012749 | 3300025932 | Bacteria | 5037 |
| 369 | Ga0207690_10220403 | 3300025932 | Bacteria | 1451 |
| 370 | Ga0207706_10005138 | 3300025933 | Bacteria | 12214 |
| 371 | Ga0207706_10113444 | 3300025933 | Bacteria | 2384 |
| 372 | Ga0207706_10115805 | 3300025933 | Bacteria | 2357 |
| 373 | Ga0207709_10222945 | 3300025935 | Bacteria | 1361 |
| 374 | Ga0207670_10088801 | 3300025936 | Bacteria | 2180 |
| 375 | Ga0207669_10055884 | 3300025937 | Bacteria | 2394 |
| 376 | Ga0207669_10171311 | 3300025937 | Bacteria | 1545 |
| 377 | Ga0207669_10332441 | 3300025937 | Bacteria | 1167 |
| 378 | Ga0207665_10000215 | 3300025939 | Bacteria | 38950 |
| 379 | Ga0207665_10001013 | 3300025939 | Bacteria | 18947 |
| 380 | Ga0207665_10006016 | 3300025939 | Bacteria | 8057 |
| 381 | Ga0207665_10031498 | 3300025939 | Bacteria | 3509 |
| 382 | Ga0207665_10052907 | 3300025939 | Bacteria | 2736 |
| 383 | Ga0207665_10144864 | 3300025939 | Bacteria | 1697 |
| 384 | Ga0207691_10073314 | 3300025940 | Bacteria | 3087 |
| 385 | Ga0207691_10386837 | 3300025940 | Bacteria | 1194 |
| 386 | Ga0207689_10001185 | 3300025942 | Bacteria | 25056 |
| 387 | Ga0207689_10003272 | 3300025942 | Bacteria | 14852 |
| 388 | Ga0207689_10017236 | 3300025942 | Bacteria | 6112 |
| 389 | Ga0207679_10023587 | 3300025945 | Bacteria | 4209 |
| 390 | Ga0207667_10078681 | 3300025949 | Bacteria | 3417 |
| 391 | Ga0207667_10120689 | 3300025949 | Bacteria | 2701 |
| 392 | Ga0207667_10246848 | 3300025949 | Bacteria | 1826 |
| 393 | Ga0207667_10250328 | 3300025949 | Bacteria | 1812 |
| 394 | Ga0207712_10024714 | 3300025961 | Bacteria | 3983 |
| 395 | Ga0207668_10041699 | 3300025972 | Bacteria | 3104 |
| 396 | Ga0207658_10082125 | 3300025986 | Bacteria | 2474 |
| 397 | Ga0207677_10035307 | 3300026023 | Bacteria | 3246 |
| 398 | Ga0207677_10359700 | 3300026023 | Bacteria | 1222 |
| 399 | Ga0207703_10111725 | 3300026035 | Bacteria | 2333 |
| 400 | Ga0207703_10490568 | 3300026035 | Bacteria | 1152 |
| 401 | Ga0207639_10103119 | 3300026041 | Bacteria | 2310 |
| 402 | Ga0207639_10271699 | 3300026041 | Bacteria | 1487 |
| 403 | Ga0207639_10397059 | 3300026041 | Bacteria | 1242 |
| 404 | Ga0207678_10000141 | 3300026067 | Bacteria | 59147 |
| 405 | Ga0207678_10001012 | 3300026067 | Bacteria | 25636 |
| 406 | Ga0207678_10004168 | 3300026067 | Bacteria | 12977 |
| 407 | Ga0207708_10064175 | 3300026075 | Bacteria | 2805 |
| 408 | Ga0207702_10000567 | 3300026078 | Bacteria | 41121 |
| 409 | Ga0207702_10008130 | 3300026078 | Bacteria | 8876 |
| 410 | Ga0207702_10019266 | 3300026078 | Bacteria | 5645 |
| 411 | Ga0207702_10173858 | 3300026078 | Bacteria | 1977 |
| 412 | Ga0207641_10008900 | 3300026088 | Bacteria | 8292 |
| 413 | Ga0207641_10344090 | 3300026088 | Bacteria | 1420 |
| 414 | Ga0207676_10000814 | 3300026095 | Bacteria | 24327 |
| 415 | Ga0207676_10209841 | 3300026095 | Bacteria | 1727 |
| 416 | Ga0207674_10011467 | 3300026116 | Bacteria | 9958 |
| 417 | Ga0207674_10013397 | 3300026116 | Bacteria | 9102 |
| 418 | Ga0207674_10379284 | 3300026116 | Bacteria | 1367 |
| 419 | Ga0207675_100024703 | 3300026118 | Bacteria | 5588 |
| 420 | Ga0207675_100050757 | 3300026118 | Bacteria | 3871 |
| 421 | Ga0207675_100231589 | 3300026118 | Bacteria | 1783 |
| 422 | Ga0207683_10002042 | 3300026121 | Bacteria | 17869 |
| 423 | Ga0207683_10004876 | 3300026121 | Bacteria | 11544 |
| 424 | Ga0207683_10461389 | 3300026121 | Bacteria | 1171 |
| 425 | Ga0207698_10558700 | 3300026142 | Bacteria | 1123 |
| 426 | Ga0207428_10025122 | 3300027907 | Bacteria | 4989 |
| 427 | Ga0207428_10063708 | 3300027907 | Bacteria | 2912 |
| 428 | Ga0268266_10001679 | 3300028379 | Bacteria | 25483 |
| 429 | Ga0268266_10025102 | 3300028379 | Bacteria | 5073 |
| 430 | Ga0268265_10055749 | 3300028380 | Bacteria | 3004 |
| 431 | Ga0268264_10000697 | 3300028381 | Bacteria | 39075 |
| 432 | Ga0268264_10174239 | 3300028381 | Bacteria | 1948 |
| 433 | Ga0265336_10003994 | 3300028666 | Bacteria | 5645 |
| 434 | Ga0265338_10000827 | 3300028800 | Bacteria | 52237 |
| 435 | Ga0307512_10063373 | 3300030522 | Bacteria | 2826 |
| 436 | Ga0316181_1092416 | 3300030744 | Bacteria | 2153 |
| 437 | Ga0265340_10005442 | 3300031247 | Bacteria | 7072 |
| 438 | Ga0265316_10081161 | 3300031344 | Bacteria | 2487 |
| 439 | Ga0307509_10007679 | 3300031507 | Bacteria | 14014 |
| 440 | Ga0307408_100272122 | 3300031548 | Bacteria | 1407 |
| 441 | Ga0316579_10002232 | 3300031691 | Bacteria | 7298 |
| 442 | Ga0265314_10102111 | 3300031711 | Bacteria | 1841 |
| 443 | Ga0316576_10006220 | 3300031727 | Bacteria | 7405 |
| 444 | Ga0307516_10080920 | 3300031730 | Bacteria | 3092 |
| 445 | Ga0316577_10003582 | 3300031733 | Bacteria | 7867 |
| 446 | Ga0307413_10052968 | 3300031824 | Bacteria | 2454 |
| 447 | Ga0307406_10187612 | 3300031901 | Bacteria | 1511 |
| 448 | Ga0307407_10013842 | 3300031903 | Bacteria | 3930 |
| 449 | Ga0307409_100078999 | 3300031995 | Bacteria | 2649 |
| 450 | Ga0307409_100466785 | 3300031995 | Bacteria | 1222 |
| 451 | Ga0307409_100507075 | 3300031995 | Bacteria | 1176 |
| 452 | Ga0307416_100044055 | 3300032002 | Bacteria | 3500 |
| 453 | Ga0307416_100398650 | 3300032002 | Bacteria | 1413 |
| 454 | Ga0307415_100098439 | 3300032126 | Bacteria | 2138 |
| 455 | Ga0307415_100249021 | 3300032126 | Bacteria | 1442 |
| 456 | Ga0316583_10005810 | 3300032133 | Bacteria | 4437 |
| 457 | Ga0316585_10002697 | 3300032137 | Bacteria | 4816 |
| 458 | Ga0316593_10038422 | 3300032168 | Bacteria | 1585 |
| 459 | Ga0316596_1019194 | 3300033541 | Bacteria | 1733 |
| 460 | Ga0373959_0001379 | 3300034820 | Bacteria | 3887 |
| 461 | Ga0373926_0000767 | 3300035083 | Bacteria | 8992 |
| 462 | Ga0373926_0002281 | 3300035083 | Bacteria | 6058 |
| 463 | Ga0373934_0000006 | 3300035086 | Bacteria | 81073 |
| 464 | Ga0373934_0004342 | 3300035086 | Bacteria | 5236 |
| 465 | Ga0373940_0011732 | 3300035088 | Bacteria | 2087 |
| 466 | Ga0373923_0000602 | 3300035111 | Bacteria | 8952 |
| 467 | Ga0373923_0026721 | 3300035111 | Bacteria | 2298 |
| 468 | Ga0373936_0000341 | 3300035113 | Bacteria | 15795 |
| 469 | Ga0373936_0000792 | 3300035113 | Bacteria | 11180 |
| 470 | Ga0373936_0013649 | 3300035113 | Bacteria | 3100 |
| 471 | Ga0373939_0045621 | 3300035114 | Bacteria | 1338 |
| 472 | Ga0373939_0056658 | 3300035114 | Bacteria | 1234 |
| 473 | Ga0373945_0000439 | 3300035116 | Bacteria | 11743 |
| 474 | Ga0373945_0011554 | 3300035116 | Bacteria | 2921 |
| 475 | Ga0373945_0103708 | 3300035116 | Bacteria | 1116 |
| 476 | Ga0373945_0107300 | 3300035116 | Bacteria | 1098 |
| 477 | Ga0373953_0001325 | 3300035117 | Bacteria | 7101 |
| 478 | Ga0373953_0056521 | 3300035117 | Bacteria | 1595 |
| 479 | Ga0373954_0001834 | 3300035118 | Bacteria | 8763 |
| 480 | Ga0373954_0015932 | 3300035118 | Bacteria | 3363 |
| 481 | Ga0373954_0055882 | 3300035118 | Bacteria | 1857 |
| 482 | Ga0373954_0083001 | 3300035118 | Bacteria | 1533 |
| 483 | Ga0373956_0000498 | 3300035119 | Bacteria | 16085 |
| 484 | Ga0373956_0018288 | 3300035119 | Bacteria | 2966 |
| 485 | Ga0373956_0021856 | 3300035119 | Bacteria | 2731 |
| 486 | Ga0373956_0052667 | 3300035119 | Bacteria | 1831 |
| 487 | Ga0373956_0061188 | 3300035119 | Bacteria | 1705 |
| 488 | Ga0373957_0000878 | 3300035120 | Bacteria | 7880 |
| 489 | Ga0373957_0017010 | 3300035120 | Bacteria | 2526 |
| 490 | Ga0373957_0026004 | 3300035120 | Bacteria | 2113 |
| 491 | Ga0373960_0010514 | 3300035121 | Bacteria | 2262 |
| 492 | Ga0373943_0000222 | 3300035170 | Bacteria | 23119 |
| 493 | Ga0373943_0000620 | 3300035170 | Bacteria | 15400 |
| 494 | Ga0373943_0148186 | 3300035170 | Bacteria | 1269 |
| 495 | Ga0373946_0000211 | 3300035171 | Bacteria | 18097 |
| 496 | Ga0373946_0001783 | 3300035171 | Bacteria | 7508 |
| 497 | Ga0373946_0113191 | 3300035171 | Bacteria | 1230 |
| 498 | Ga0373955_0000034 | 3300035172 | Bacteria | 53524 |
| 499 | Ga0373955_0006038 | 3300035172 | Bacteria | 5495 |
| 500 | Ga0373955_0050207 | 3300035172 | Bacteria | 2267 |
| 501 | Ga0373955_0093454 | 3300035172 | Bacteria | 1717 |
| 502 | Ga0373961_0010664 | 3300035241 | Bacteria | 2267 |
| 503 | Ga0373962_0010648 | 3300035242 | Bacteria | 2297 |
| 504 | Ga0316574_0034991 | 3300035398 | Bacteria | 3066 |
| 505 | Ga0373924_0000343 | 3300035410 | Bacteria | 14274 |
| 506 | Ga0373924_0001065 | 3300035410 | Bacteria | 8749 |
| 507 | Ga0373924_0011134 | 3300035410 | Bacteria | 3333 |
| 508 | Ga0373931_0017595 | 3300035691 | Bacteria | 3539 |
| 509 | Ga0373935_0035088 | 3300035692 | Bacteria | 3129 |
| 510 | Ga0373927_0011206 | 3300035695 | Bacteria | 5971 |
| 511 | Ga0373927_0073976 | 3300035695 | Bacteria | 2206 |
| 512 | Ga0373927_0107451 | 3300035695 | Bacteria | 1817 |
| 513 | Ga0373933_0000161 | 3300035724 | Bacteria | 43422 |
| 514 | Ga0373933_0013141 | 3300035724 | Bacteria | 4585 |
| 515 | Ga0373933_0135572 | 3300035724 | Bacteria | 1551 |
| 516 | Ga0373947_0002674 | 3300035725 | Bacteria | 10709 |
| 517 | Ga0373947_0015037 | 3300035725 | Bacteria | 4443 |
| 518 | Ga0373947_0112790 | 3300035725 | Bacteria | 1720 |
| 519 | Ga0373947_0146243 | 3300035725 | Bacteria | 1519 |
| 520 | Ga0373947_0241559 | 3300035725 | Bacteria | 1192 |
| 521 | Ga0373947_0313063 | 3300035725 | Bacteria | 1048 |
| 522 | Ga0373937_0000126 | 3300036401 | Bacteria | 73508 |
| 523 | Ga0373937_0013317 | 3300036401 | Bacteria | 7246 |
| 524 | Ga0373937_0032272 | 3300036401 | Bacteria | 4749 |
| 525 | Ga0373937_0051034 | 3300036401 | Bacteria | 3791 |
| 526 | Ga0373937_0096539 | 3300036401 | Bacteria | 2741 |
| 527 | Ga0373937_0198533 | 3300036401 | Bacteria | 1885 |
| 528 | Ga0316584_0253986 | 3300036712 | Bacteria | 1283 |
| 529 | Ga0373925_0001213 | 3300037068 | Bacteria | 22751 |
| 530 | Ga0373925_0001242 | 3300037068 | Bacteria | 22486 |
| 531 | Ga0373925_0004745 | 3300037068 | Bacteria | 10247 |
| 532 | Ga0373925_0034034 | 3300037068 | Bacteria | 3755 |
| 533 | Ga0373925_0274614 | 3300037068 | Bacteria | 1356 |
| 534 | Ga0395900_0089872 | 3300037418 | Bacteria | 3157 |
| 535 | Ga0395898_0036630 | 3300037466 | Bacteria | 4871 |
| 536 | Ga0316581_0003414 | 3300037588 | Bacteria | 3954 |
| 537 | Ga0436364_0007757 | 3300037853 | Bacteria | 7628 |
| 538 | Ga0436364_0016285 | 3300037853 | Bacteria | 2181 |
| 539 | Ga0436364_0568803 | 3300037853 | Bacteria | 42562 |
| 540 | Ga0436364_0671111 | 3300037853 | Bacteria | 4101 |
| 541 | Ga0436364_0737335 | 3300037853 | Bacteria | 8724 |
| 542 | Ga0395901_0163097 | 3300038443 | Bacteria | 2340 |
| 543 | Ga0436363_0039138 | 3300039450 | Bacteria | 1271 |
| 544 | Ga0436363_0120235 | 3300039450 | Bacteria | 1674 |
| 545 | Ga0436363_0261863 | 3300039450 | Bacteria | 1034 |
| 546 | Ga0439465_0013225 | 3300041413 | Bacteria | 2577 |
| 547 | Ga0439431_0003805 | 3300041997 | Bacteria | 3334 |
| 548 | Ga0439445_0035838 | 3300042004 | Bacteria | 1304 |
| 549 | Ga0439432_024281 | 3300042006 | Bacteria | 1993 |
| 550 | Ga0466969_0014966 | 3300044656 | Bacteria | 4070 |
| 551 | Ga0466969_0107917 | 3300044656 | Bacteria | 1305 |
| 552 | Ga0466972_0013115 | 3300044658 | Bacteria | 4164 |
| 553 | Ga0466965_0082617 | 3300044683 | Bacteria | 1625 |
| 554 | Ga0466966_0006104 | 3300044684 | Bacteria | 7959 |
| 555 | Ga0466966_0076714 | 3300044684 | Bacteria | 2086 |
| 556 | Ga0466961_0005917 | 3300044693 | Bacteria | 7752 |
| 557 | Ga0466961_0008796 | 3300044693 | Bacteria | 6442 |
| 558 | Ga0466961_0038720 | 3300044693 | Bacteria | 3059 |
| 559 | Ga0466961_0191239 | 3300044693 | Bacteria | 1268 |
| 560 | Ga0466963_0005697 | 3300044694 | Bacteria | 7320 |
| 561 | Ga0466963_0017249 | 3300044694 | Bacteria | 4499 |
| 562 | Ga0466963_0405830 | 3300044694 | Bacteria | 961 |
| 563 | Ga0466964_0014836 | 3300044706 | Bacteria | 2965 |
| 564 | Ga0466964_0019836 | 3300044706 | Bacteria | 2587 |
| 565 | Ga0466971_0004589 | 3300044719 | Bacteria | 5968 |
| 566 | Ga0466971_0070646 | 3300044719 | Bacteria | 1585 |
| 567 | Ga0466970_0046551 | 3300044765 | Bacteria | 2310 |
| 568 | Ga0466957_0002757 | 3300044842 | Bacteria | 9511 |
| 569 | Ga0466957_0051732 | 3300044842 | Bacteria | 2500 |
| 570 | Ga0466957_0065992 | 3300044842 | Bacteria | 2230 |
| 571 | Ga0466957_0131404 | 3300044842 | Bacteria | 1604 |
| 572 | Ga0466957_0339721 | 3300044842 | Bacteria | 1017 |
| 573 | Ga0466960_0027362 | 3300044901 | Bacteria | 2600 |
| 574 | Ga0466960_0171305 | 3300044901 | Bacteria | 1172 |
| 575 | Ga0466960_0184228 | 3300044901 | Bacteria | 1133 |
| 576 | Ga0466959_0000786 | 3300045049 | Bacteria | 18627 |
| 577 | Ga0466959_0006200 | 3300045049 | Bacteria | 8262 |
| 578 | Ga0466959_0011536 | 3300045049 | Bacteria | 6352 |
| 579 | Ga0466959_0050084 | 3300045049 | Bacteria | 3068 |
| 580 | Ga0451576_0523890 | 3300045051 | Bacteria | 1245 |
| 581 | Ga0466958_0005392 | 3300045836 | Bacteria | 6875 |
| 582 | Ga0466958_0022947 | 3300045836 | Bacteria | 3659 |
| 583 | Ga0466967_0001099 | 3300045976 | Bacteria | 14974 |
| 584 | Ga0466967_0008839 | 3300045976 | Bacteria | 7426 |
| 585 | Ga0466967_0009511 | 3300045976 | Bacteria | 7217 |
| 586 | Ga0466967_0022152 | 3300045976 | Bacteria | 5177 |
| 587 | Ga0466967_0022697 | 3300045976 | Bacteria | 5127 |
| 588 | Ga0466967_0052581 | 3300045976 | Bacteria | 3576 |
| 589 | Ga0466967_0055695 | 3300045976 | Bacteria | 3484 |
| 590 | Ga0466967_0060217 | 3300045976 | Bacteria | 3363 |
| 591 | Ga0466967_0060277 | 3300045976 | Bacteria | 3362 |
| 592 | Ga0466967_0119472 | 3300045976 | Bacteria | 2433 |
| 593 | Ga0466967_0185339 | 3300045976 | Bacteria | 1965 |
| 594 | Ga0466967_0462792 | 3300045976 | Bacteria | 1241 |
| 595 | Ga0466967_0475036 | 3300045976 | Bacteria | 1224 |
| 596 | Ga0495592_0000030 | 3300046454 | Bacteria | 129103 |
| 597 | Ga0495592_0064734 | 3300046454 | Bacteria | 2678 |
| 598 | Ga0495592_0183322 | 3300046454 | Bacteria | 1424 |
| 599 | Ga0495592_0283679 | 3300046454 | Bacteria | 1082 |
| 600 | Ga0495603_0001439 | 3300046455 | Bacteria | 13837 |
| 601 | Ga0495603_0008628 | 3300046455 | Bacteria | 6159 |
| 602 | Ga0495629_0015013 | 3300046459 | Bacteria | 5566 |
| 603 | Ga0495641_0027587 | 3300046461 | Bacteria | 2759 |
| 604 | Ga0495641_0164382 | 3300046461 | Bacteria | 993 |
| 605 | Ga0495651_0000221 | 3300046462 | Bacteria | 43412 |
| 606 | Ga0495651_0130027 | 3300046462 | Bacteria | 1839 |
| 607 | Ga0495653_0000895 | 3300046463 | Bacteria | 23073 |
| 608 | Ga0495653_0070199 | 3300046463 | Bacteria | 2622 |
| 609 | Ga0495653_0070298 | 3300046463 | Bacteria | 2620 |
| 610 | Ga0495653_0121150 | 3300046463 | Bacteria | 1864 |
| 611 | Ga0495653_0192005 | 3300046463 | Bacteria | 1392 |
| 612 | Ga0495653_0214135 | 3300046463 | Bacteria | 1299 |
| 613 | Ga0495653_0263493 | 3300046463 | Bacteria | 1138 |
| 614 | Ga0495580_0076865 | 3300046472 | Bacteria | 2328 |
| 615 | Ga0495582_0001232 | 3300046473 | Bacteria | 14421 |
| 616 | Ga0495582_0004428 | 3300046473 | Bacteria | 7899 |
| 617 | Ga0495582_0033988 | 3300046473 | Bacteria | 2803 |
| 618 | Ga0495582_0079635 | 3300046473 | Bacteria | 1819 |
| 619 | Ga0495639_0178368 | 3300046475 | Bacteria | 1033 |
| 620 | Ga0495662_0023146 | 3300046476 | Bacteria | 3000 |
| 621 | Ga0495664_0003692 | 3300046477 | Bacteria | 8344 |
| 622 | Ga0495664_0021701 | 3300046477 | Bacteria | 3710 |
| 623 | Ga0495664_0069459 | 3300046477 | Bacteria | 2103 |
| 624 | Ga0495594_0021752 | 3300046499 | Bacteria | 3425 |
| 625 | Ga0495608_0000191 | 3300046511 | Bacteria | 43426 |
| 626 | Ga0495608_0014956 | 3300046511 | Bacteria | 5385 |
| 627 | Ga0495608_0027786 | 3300046511 | Bacteria | 3847 |
| 628 | Ga0495608_0038704 | 3300046511 | Bacteria | 3201 |
| 629 | Ga0495618_0027405 | 3300046514 | Bacteria | 3546 |
| 630 | Ga0495618_0044993 | 3300046514 | Bacteria | 2784 |
| 631 | Ga0495618_0081741 | 3300046514 | Bacteria | 2063 |
| 632 | Ga0495628_0003830 | 3300046516 | Bacteria | 13409 |
| 633 | Ga0495628_0028621 | 3300046516 | Bacteria | 4524 |
| 634 | Ga0495628_0037076 | 3300046516 | Bacteria | 3909 |
| 635 | Ga0495630_0012349 | 3300046517 | Bacteria | 6199 |
| 636 | Ga0495630_0058749 | 3300046517 | Bacteria | 2883 |
| 637 | Ga0495630_0326228 | 3300046517 | Bacteria | 1174 |
| 638 | Ga0495666_0026971 | 3300046526 | Bacteria | 2828 |
| 639 | Ga0495652_0000921 | 3300046529 | Bacteria | 33833 |
| 640 | Ga0495652_0002640 | 3300046529 | Bacteria | 18286 |
| 641 | Ga0495652_0045493 | 3300046529 | Bacteria | 3772 |
| 642 | Ga0495652_0065676 | 3300046529 | Bacteria | 3047 |
| 643 | Ga0495652_0072617 | 3300046529 | Bacteria | 2867 |
| 644 | Ga0495652_0117785 | 3300046529 | Bacteria | 2124 |
| 645 | Ga0495665_0002334 | 3300046531 | Bacteria | 10254 |
| 646 | Ga0495665_0006345 | 3300046531 | Bacteria | 6380 |
| 647 | Ga0495665_0031595 | 3300046531 | Bacteria | 2833 |
| 648 | Ga0495640_0004093 | 3300046533 | Bacteria | 11669 |
| 649 | Ga0495640_0011149 | 3300046533 | Bacteria | 6921 |
| 650 | Ga0495640_0028834 | 3300046533 | Bacteria | 3992 |
| 651 | Ga0495640_0039340 | 3300046533 | Bacteria | 3319 |
| 652 | Ga0495640_0077148 | 3300046533 | Bacteria | 2222 |
| 653 | Ga0495640_0148290 | 3300046533 | Bacteria | 1508 |
| 654 | Ga0495586_0022515 | 3300046535 | Bacteria | 3363 |
| 655 | Ga0495587_0000210 | 3300046536 | Bacteria | 43426 |
| 656 | Ga0495587_0006716 | 3300046536 | Bacteria | 7493 |
| 657 | Ga0495587_0076147 | 3300046536 | Bacteria | 1948 |
| 658 | Ga0495587_0212384 | 3300046536 | Bacteria | 1092 |
| 659 | Ga0495645_0029854 | 3300046543 | Bacteria | 3969 |
| 660 | Ga0495645_0076714 | 3300046543 | Bacteria | 2404 |
| 661 | Ga0495645_0149563 | 3300046543 | Bacteria | 1623 |
| 662 | Ga0495667_0000040 | 3300046559 | Bacteria | 129118 |
| 663 | Ga0495667_0013375 | 3300046559 | Bacteria | 5554 |
| 664 | Ga0495667_0023765 | 3300046559 | Bacteria | 4128 |
| 665 | Ga0495667_0024113 | 3300046559 | Bacteria | 4097 |
| 666 | Ga0495667_0077349 | 3300046559 | Bacteria | 2164 |
| 667 | Ga0495668_0000477 | 3300046616 | Bacteria | 50176 |
| 668 | Ga0495634_0002549 | 3300046642 | Bacteria | 15066 |
| 669 | Ga0495634_0117901 | 3300046642 | Bacteria | 1702 |
| 670 | Ga0495634_0134824 | 3300046642 | Bacteria | 1571 |
| 671 | Ga0495625_0000969 | 3300046660 | Bacteria | 38144 |
| 672 | Ga0495635_0000373 | 3300046663 | Bacteria | 28369 |
| 673 | Ga0495635_0020270 | 3300046663 | Bacteria | 4632 |
| 674 | Ga0495657_0000029 | 3300046675 | Bacteria | 129126 |
| 675 | Ga0495657_0015497 | 3300046675 | Bacteria | 5576 |
| 676 | Ga0495657_0021602 | 3300046675 | Bacteria | 4617 |
| 677 | Ga0495657_0073654 | 3300046675 | Bacteria | 2223 |
| 678 | Ga0495657_0139273 | 3300046675 | Bacteria | 1513 |
| 679 | Ga0495599_0000238 | 3300046678 | Bacteria | 34651 |
| 680 | Ga0495599_0055554 | 3300046678 | Bacteria | 2479 |
| 681 | Ga0495599_0273062 | 3300046678 | Bacteria | 1025 |
| 682 | Ga0495623_0000652 | 3300046679 | Bacteria | 23015 |
| 683 | Ga0495623_0007901 | 3300046679 | Bacteria | 6917 |
| 684 | Ga0495623_0015753 | 3300046679 | Bacteria | 4886 |
| 685 | Ga0495623_0025198 | 3300046679 | Bacteria | 3831 |
| 686 | Ga0495623_0057266 | 3300046679 | Bacteria | 2452 |
| 687 | Ga0495646_0011399 | 3300046680 | Bacteria | 5645 |
| 688 | Ga0495646_0053325 | 3300046680 | Bacteria | 2438 |
| 689 | Ga0495646_0063798 | 3300046680 | Bacteria | 2186 |
| 690 | Ga0495647_0021182 | 3300046681 | Bacteria | 2339 |
| 691 | Ga0495658_0016530 | 3300046683 | Bacteria | 3797 |
| 692 | Ga0495658_0207408 | 3300046683 | Bacteria | 1223 |
| 693 | Ga0495669_0031349 | 3300046684 | Bacteria | 2335 |
| 694 | Ga0495613_0000459 | 3300046689 | Bacteria | 34915 |
| 695 | Ga0495613_0023536 | 3300046689 | Bacteria | 4589 |
| 696 | Ga0495613_0027878 | 3300046689 | Bacteria | 4204 |
| 697 | Ga0495624_0001477 | 3300046690 | Bacteria | 18250 |
| 698 | Ga0495600_0004117 | 3300046809 | Bacteria | 8653 |
| 699 | Ga0495600_0009623 | 3300046809 | Bacteria | 5975 |
| 700 | Ga0495600_0031175 | 3300046809 | Bacteria | 3453 |
| 701 | Ga0495600_0098321 | 3300046809 | Bacteria | 1908 |
| 702 | Ga0495600_0168879 | 3300046809 | Bacteria | 1412 |
| 703 | Ga0495581_0025729 | 3300047315 | Bacteria | 3413 |
| 704 | Ga0495581_0036856 | 3300047315 | Bacteria | 2829 |
| 705 | Ga0495581_0045917 | 3300047315 | Bacteria | 2524 |
| 706 | Ga0495581_0057462 | 3300047315 | Bacteria | 2245 |
| 707 | Ga0495604_0000034 | 3300047317 | Bacteria | 129099 |
| 708 | Ga0495604_0014642 | 3300047317 | Bacteria | 6252 |
| 709 | Ga0495604_0017920 | 3300047317 | Bacteria | 5665 |
| 710 | Ga0495604_0038984 | 3300047317 | Bacteria | 3736 |
| 711 | Ga0495604_0039115 | 3300047317 | Bacteria | 3728 |
| 712 | Ga0495604_0120531 | 3300047317 | Bacteria | 1900 |
| 713 | Ga0495674_0001403 | 3300047319 | Bacteria | 23570 |
| 714 | Ga0495674_0025013 | 3300047319 | Bacteria | 5479 |
| 715 | Ga0495674_0034492 | 3300047319 | Bacteria | 4576 |
| 716 | Ga0495674_0040925 | 3300047319 | Bacteria | 4142 |
| 717 | Ga0495674_0062227 | 3300047319 | Bacteria | 3250 |
| 718 | Ga0495674_0076231 | 3300047319 | Bacteria | 2884 |
| 719 | Ga0495674_0099382 | 3300047319 | Bacteria | 2477 |
| 720 | Ga0495676_0009541 | 3300047321 | Bacteria | 8836 |
| 721 | Ga0495676_0021763 | 3300047321 | Bacteria | 5591 |
| 722 | Ga0495680_0000522 | 3300047322 | Bacteria | 43426 |
| 723 | Ga0495680_0003936 | 3300047322 | Bacteria | 14361 |
| 724 | Ga0495680_0007711 | 3300047322 | Bacteria | 9828 |
| 725 | Ga0495680_0086007 | 3300047322 | Bacteria | 2366 |
| 726 | Ga0495675_0000613 | 3300047444 | Bacteria | 22975 |
| 727 | Ga0495675_0007809 | 3300047444 | Bacteria | 6603 |
| 728 | Ga0495675_0016573 | 3300047444 | Bacteria | 4662 |
| 729 | Ga0495675_0020863 | 3300047444 | Bacteria | 4170 |
| 730 | Ga0495675_0034408 | 3300047444 | Bacteria | 3235 |
| 731 | Ga0495675_0040915 | 3300047444 | Bacteria | 2954 |
| 732 | Ga0495684_0005175 | 3300047471 | Bacteria | 10165 |
| 733 | Ga0495684_0009248 | 3300047471 | Bacteria | 7610 |
| 734 | Ga0495684_0027794 | 3300047471 | Bacteria | 4344 |
| 735 | Ga0495684_0028463 | 3300047471 | Bacteria | 4289 |
| 736 | Ga0495684_0039046 | 3300047471 | Bacteria | 3639 |
| 737 | Ga0495684_0061338 | 3300047471 | Bacteria | 2860 |
| 738 | Ga0495684_0168379 | 3300047471 | Bacteria | 1631 |
| 739 | Ga0495684_0271147 | 3300047471 | Bacteria | 1228 |
| 740 | Ga0495593_0003766 | 3300047673 | Bacteria | 9059 |
| 741 | Ga0495602_0001101 | 3300048088 | Bacteria | 26520 |
| 742 | Ga0495602_0021704 | 3300048088 | Bacteria | 6309 |
| 743 | Ga0495602_0035342 | 3300048088 | Bacteria | 4660 |
| 744 | Ga0495602_0070136 | 3300048088 | Bacteria | 3001 |
| 745 | Ga0495602_0074482 | 3300048088 | Bacteria | 2885 |
| 746 | Ga0495602_0131380 | 3300048088 | Bacteria | 1996 |
| 747 | Ga0495602_0181918 | 3300048088 | Bacteria | 1620 |
| 748 | Ga0495614_0082639 | 3300048089 | Bacteria | 1392 |
| 749 | Ga0495626_0000234 | 3300048091 | Bacteria | 65050 |
| 750 | Ga0496100_0007843 | 3300048903 | Bacteria | 5925 |
| 751 | Ga0496100_0134770 | 3300048903 | Bacteria | 1743 |
| 752 | Ga0496100_0276155 | 3300048903 | Bacteria | 1251 |
| 753 | Ga0496101_0071517 | 3300048904 | Bacteria | 2543 |
| 754 | Ga0496101_0106525 | 3300048904 | Bacteria | 2105 |
| 755 | Ga0496101_0180368 | 3300048904 | Bacteria | 1626 |
| 756 | Ga0496101_0194058 | 3300048904 | Bacteria | 1568 |
| 757 | Ga0496102_0000287 | 3300048905 | Bacteria | 64356 |
| 758 | Ga0496102_0055310 | 3300048905 | Bacteria | 3619 |
| 759 | Ga0496102_0059022 | 3300048905 | Bacteria | 3507 |
| 760 | Ga0496102_0160102 | 3300048905 | Bacteria | 2117 |
| 761 | Ga0496102_0216761 | 3300048905 | Bacteria | 1804 |
| 762 | Ga0496102_0228058 | 3300048905 | Bacteria | 1756 |
| 763 | Ga0496103_0000192 | 3300048906 | Bacteria | 60768 |
| 764 | Ga0496103_0035769 | 3300048906 | Bacteria | 3040 |
| 765 | Ga0496104_0000398 | 3300048907 | Bacteria | 38090 |
| 766 | Ga0496104_0039051 | 3300048907 | Bacteria | 4443 |
| 767 | Ga0496104_0086163 | 3300048907 | Bacteria | 2999 |
| 768 | Ga0496104_0189020 | 3300048907 | Bacteria | 1970 |
| 769 | Ga0496104_0297069 | 3300048907 | Bacteria | 1527 |
| 770 | Ga0496105_0000812 | 3300048908 | Bacteria | 21146 |
| 771 | Ga0496105_0002315 | 3300048908 | Bacteria | 13811 |
| 772 | Ga0496105_0051856 | 3300048908 | Bacteria | 3388 |
| 773 | Ga0496105_0055672 | 3300048908 | Bacteria | 3265 |
| 774 | Ga0496105_0086402 | 3300048908 | Bacteria | 2592 |
| 775 | Ga0496106_0020477 | 3300048909 | Bacteria | 4909 |
| 776 | Ga0496106_0048856 | 3300048909 | Bacteria | 3187 |
| 777 | Ga0496107_0022461 | 3300048910 | Bacteria | 4459 |
| 778 | Ga0496107_0025540 | 3300048910 | Bacteria | 4183 |
| 779 | Ga0496108_0000149 | 3300048911 | Bacteria | 67412 |
| 780 | Ga0496108_0003584 | 3300048911 | Bacteria | 12438 |
| 781 | Ga0496108_0016367 | 3300048911 | Bacteria | 6047 |
| 782 | Ga0496108_0055394 | 3300048911 | Bacteria | 3329 |
| 783 | Ga0496108_0096311 | 3300048911 | Bacteria | 2520 |
| 784 | Ga0496109_0053506 | 3300048912 | Bacteria | 3681 |
| 785 | Ga0496109_0193967 | 3300048912 | Bacteria | 1909 |
| 786 | Ga0496110_0126346 | 3300048913 | Bacteria | 2307 |
| 787 | Ga0496110_0306621 | 3300048913 | Bacteria | 1446 |
| 788 | Ga0496111_0034773 | 3300048914 | Bacteria | 3599 |
| 789 | Ga0496111_0126997 | 3300048914 | Bacteria | 1885 |
| 790 | Ga0496112_0000555 | 3300048915 | Bacteria | 25563 |
| 791 | Ga0496112_0021103 | 3300048915 | Bacteria | 6188 |
| 792 | Ga0496112_0102259 | 3300048915 | Bacteria | 2835 |
| 793 | Ga0496112_0234943 | 3300048915 | Bacteria | 1787 |
| 794 | Ga0496113_0068910 | 3300048916 | Bacteria | 2685 |
| 795 | Ga0496114_0008673 | 3300048917 | Bacteria | 8056 |
| 796 | Ga0496114_0038878 | 3300048917 | Bacteria | 3937 |
| 797 | Ga0496114_0040956 | 3300048917 | Bacteria | 3838 |
| 798 | Ga0496115_0022579 | 3300048918 | Bacteria | 4877 |
| 799 | Ga0496115_0043647 | 3300048918 | Bacteria | 3576 |
| 800 | Ga0496115_0074109 | 3300048918 | Bacteria | 2764 |
| 801 | Ga0496118_0060297 | 3300048921 | Bacteria | 2818 |
| 802 | Ga0496118_0140963 | 3300048921 | Bacteria | 1528 |
| 803 | Ga0496119_0001269 | 3300048922 | Bacteria | 31365 |
| 804 | Ga0496119_0009683 | 3300048922 | Bacteria | 8210 |
| 805 | Ga0496120_0015501 | 3300048923 | Bacteria | 5022 |
| 806 | Ga0496124_0093858 | 3300048927 | Bacteria | 2442 |
| 807 | Ga0496126_0000588 | 3300048929 | Bacteria | 68756 |
| 808 | Ga0501031_0005137 | 3300049568 | Bacteria | 8525 |
| 809 | Ga0501031_0008163 | 3300049568 | Bacteria | 6814 |
| 810 | Ga0501032_0027113 | 3300049569 | Bacteria | 3939 |
| 811 | Ga0501032_0042338 | 3300049569 | Bacteria | 3089 |
| 812 | Ga0501034_0223514 | 3300049571 | Bacteria | 1835 |
| 813 | Ga0501037_0017841 | 3300049573 | Bacteria | 5225 |
| 814 | Ga0501038_0139134 | 3300049574 | Bacteria | 1987 |
| 815 | Ga0501038_0157997 | 3300049574 | Bacteria | 1844 |
| 816 | Ga0501039_0049633 | 3300049575 | Bacteria | 3244 |
| 817 | Ga0501039_0062539 | 3300049575 | Bacteria | 2884 |
| 818 | Ga0501039_0096052 | 3300049575 | Bacteria | 2311 |
| 819 | Ga0501039_0101363 | 3300049575 | Bacteria | 2247 |
| 820 | Ga0501041_0008683 | 3300049577 | Bacteria | 5985 |
| 821 | Ga0501041_0015605 | 3300049577 | Bacteria | 4511 |
| 822 | Ga0501042_0001539 | 3300049578 | Bacteria | 13664 |
| 823 | Ga0501042_0022820 | 3300049578 | Bacteria | 4373 |
| 824 | Ga0501046_0047691 | 3300049580 | Bacteria | 3396 |
| 825 | Ga0501046_0085945 | 3300049580 | Bacteria | 2425 |
| 826 | Ga0501047_0179621 | 3300049581 | Bacteria | 1983 |
| 827 | Ga0501048_0008158 | 3300049582 | Bacteria | 7922 |
| 828 | Ga0501048_0029392 | 3300049582 | Bacteria | 3986 |
| 829 | Ga0501048_0060518 | 3300049582 | Bacteria | 2684 |
| 830 | Ga0501068_0008501 | 3300049584 | Bacteria | 5717 |
| 831 | Ga0501069_0062877 | 3300049585 | Bacteria | 2073 |
| 832 | Ga0501069_0136050 | 3300049585 | Bacteria | 1408 |
| 833 | Ga0501070_0022083 | 3300049586 | Bacteria | 5330 |
| 834 | Ga0501070_0032113 | 3300049586 | Bacteria | 4395 |
| 835 | Ga0501070_0133940 | 3300049586 | Bacteria | 2046 |
| 836 | Ga0501070_0153231 | 3300049586 | Bacteria | 1901 |
| 837 | Ga0501070_0154307 | 3300049586 | Bacteria | 1894 |
| 838 | Ga0501070_0206798 | 3300049586 | Bacteria | 1612 |
| 839 | Ga0501070_0239869 | 3300049586 | Bacteria | 1484 |
| 840 | Ga0501070_0259357 | 3300049586 | Bacteria | 1421 |
| 841 | Ga0501071_0000355 | 3300049587 | Bacteria | 22415 |
| 842 | Ga0501071_0071847 | 3300049587 | Bacteria | 2523 |
| 843 | Ga0501072_0004287 | 3300049588 | Bacteria | 10824 |
| 844 | Ga0501072_0154626 | 3300049588 | Bacteria | 1829 |
| 845 | Ga0501073_0145209 | 3300049589 | Bacteria | 1644 |
| 846 | Ga0501074_0011695 | 3300049590 | Bacteria | 6379 |
| 847 | Ga0501075_0005534 | 3300049591 | Bacteria | 8643 |
| 848 | Ga0501075_0053165 | 3300049591 | Bacteria | 3046 |
| 849 | Ga0501075_0085053 | 3300049591 | Bacteria | 2396 |
| 850 | Ga0501076_0000758 | 3300049592 | Bacteria | 20827 |
| 851 | Ga0501076_0293871 | 3300049592 | Bacteria | 1331 |
| 852 | Ga0501077_0066828 | 3300049593 | Bacteria | 2280 |
| 853 | Ga0501079_0012673 | 3300049741 | Bacteria | 6440 |
| 854 | Ga0501079_0258831 | 3300049741 | Bacteria | 1360 |
| 855 | Ga0501080_0038584 | 3300049742 | Bacteria | 4459 |
| 856 | Ga0501081_0024995 | 3300049743 | Bacteria | 4015 |
| 857 | Ga0501035_0044305 | 3300049822 | Bacteria | 4007 |
| 858 | Ga0501035_0316848 | 3300049822 | Bacteria | 1311 |
| 859 | Ga0501045_0010113 | 3300049824 | Bacteria | 6601 |
| 860 | Ga0501045_0251447 | 3300049824 | Bacteria | 1316 |
| 861 | nmdc:mga00v17_60413_c1 | 3300050491 | Bacteria | 2327 |
| 862 | nmdc:mga0yw44_61235_c1 | 3300050492 | Bacteria | 2308 |
| 863 | nmdc:mga06z11_95680_c1 | 3300050494 | Bacteria | 1621 |
| 864 | nmdc:mga07m45_3230_c1 | 3300050496 | Bacteria | 7826 |
| 865 | nmdc:mga09592_148791_c1 | 3300050508 | Bacteria | 2019 |
| 866 | nmdc:mga08y16_17213_c1 | 3300050511 | Bacteria | 7608 |
| 867 | nmdc:mga08y16_23121_c1 | 3300050511 | Bacteria | 6563 |
| 868 | nmdc:mga08y16_35177_c1 | 3300050511 | Bacteria | 5261 |
| 869 | nmdc:mga0n895_139714_c1 | 3300050512 | Bacteria | 2450 |
| 870 | nmdc:mga0n895_9940_c1 | 3300050512 | Bacteria | 8370 |
| 871 | nmdc:mga0rr50_182838_c1 | 3300050513 | Bacteria | 1715 |
| 872 | nmdc:mga08x19_29999_c1 | 3300050514 | Bacteria | 3414 |
| 873 | nmdc:mga0a205_44361_c1 | 3300050515 | Bacteria | 4286 |
| 874 | Ga0495601_0052162 | 3300053077 | Bacteria | 2582 |
| 875 | Ga0495601_0059728 | 3300053077 | Bacteria | 2418 |
| 876 | Ga0495601_0135320 | 3300053077 | Bacteria | 1606 |
| 877 | Ga0495612_0002376 | 3300053078 | Bacteria | 7758 |
| 878 | Ga0495612_0034752 | 3300053078 | Bacteria | 2042 |
| 879 | Ga0495595_0156649 | 3300053084 | Bacteria | 1122 |
| 880 | Ga0495619_0001126 | 3300053085 | Bacteria | 17567 |
| 881 | Ga0495619_0003694 | 3300053085 | Bacteria | 9865 |
| 882 | Ga0495619_0071465 | 3300053085 | Bacteria | 2322 |
| 883 | Ga0495619_0081515 | 3300053085 | Bacteria | 2179 |
| 884 | Ga0495619_0158190 | 3300053085 | Bacteria | 1564 |
| 885 | Ga0500643_000352 | 3300053087 | Bacteria | 36502 |
| 886 | Ga0500641_0044978 | 3300053096 | Bacteria | 1797 |
| 887 | Ga0500593_007573 | 3300053117 | Bacteria | 4427 |
| 888 | Ga0501084_0026752 | 3300054114 | Bacteria | 4817 |
| 889 | Ga0501084_0085343 | 3300054114 | Bacteria | 2650 |
| 890 | Ga0466962_0003529 | 3300061719 | Bacteria | 7455 |
| 891 | Ga0466962_0004333 | 3300061719 | Bacteria | 6804 |
| 892 | Ga0466962_0013135 | 3300061719 | Bacteria | 3985 |
| 893 | Ga0466962_0061822 | 3300061719 | Bacteria | 1787 |
| 894 | Ga0466962_0096793 | 3300061719 | Bacteria | 1415 |
| 895 | Ga0530510_0030849 | 3300061734 | Bacteria | 3852 |
| 896 | 2515718891 | 2515154129 | Bacteria | 5584369 |
| 897 | 2516083103 | 2515154202 | Bacteria | 5471270 |
| 898 | 2583151149 | 2582580736 | Bacteria | 5325865 |
| 899 | 2644230357 | 2643221641 | Bacteria | 4490190 |
| 900 | 2676487927 | 2675903060 | Bacteria | 10051191 |
| 901 | 2768645836 | 2767802112 | Bacteria | 6465194 |
| 902 | 2855391110 | 2855386786 | Bacteria | 4752232 |
| 903 | 2856742829 | 2856741275 | Bacteria | 8096094 |
| 904 | 2866556820 | 2866552031 | Bacteria | 5824618 |
| 905 | 2873320830 | 2873314349 | Bacteria | 8512634 |
| 906 | 2884697544 | 2884693830 | Bacteria | 11273186 |
| 907 | 2887486832 | 2887478801 | Bacteria | 8972725 |
| 908 | 2891403116 | 2891395885 | Bacteria | 9251614 |
| 909 | 2891554565 | 2891554331 | Bacteria | 8812224 |
| 910 | 2891564657 | 2891562705 | Bacteria | 8039471 |
| 911 | 2895438104 | 2895427314 | Bacteria | 13147766 |
| 912 | 2895447661 | 2895442618 | Bacteria | 11027144 |
| 913 | 2899372922 | 2899370129 | Bacteria | 6781179 |
| 914 | 2984579970 | 2984576629 | Bacteria | 4248407 |
| 915 | 2990260751 | 2990256926 | Bacteria | 4252839 |
| 916 | 3001891596 | 3001889506 | Bacteria | 2975194 |
| 917 | 3003001845 | 3002998708 | Bacteria | 11715108 |
| 918 | 8001786840 | 8001781756 | Bacteria | 9586736 |
| 919 | 8008486599 | 8008485437 | Bacteria | 7198341 |
| 920 | 8025525668 | 8025524527 | Bacteria | 7197316 |
| 921 | 8055179772 | 8055172936 | Bacteria | 9305943 |
| 922 | 8056065091 | 8056060235 | Bacteria | 7259403 |
| 923 | 8057568555 | 8057568493 | Bacteria | 7221719 |
| 924 | Ga0157369_10004575 | |||
| 925 | JGI25406J46586_10012586 | |||
| 926 | JGI25406J46586_10030735 | |||
| 927 | JGI25406J46586_10040571 | |||
| 928 | JGI25404J52841_10012198 | |||
| 929 | Ga0070658_10003299 | |||
| 930 | Ga0070658_10004108 | |||
| 931 | Ga0070658_10034494 | |||
| 932 | Ga0070658_10039254 | |||
| 933 | Ga0070658_10269779 | |||
| 934 | Ga0070683_100013327 | |||
| 935 | Ga0070683_100313617 | |||
| 936 | Ga0070683_100539160 | |||
| 937 | Ga0070670_100030363 | |||
| 938 | Ga0070670_100134151 | |||
| 939 | Ga0068869_100009523 | |||
| 940 | Ga0070680_100000593 | |||
| 941 | Ga0070680_100102749 | |||
| 942 | Ga0070682_100017404 | |||
| 943 | Ga0070682_100133291 | |||
| 944 | Ga0070682_100337873 | |||
| 945 | Ga0068868_100039320 | |||
| 946 | Ga0068868_100043967 | |||
| 947 | Ga0068868_100214097 | |||
| 948 | Ga0070660_100042286 | |||
| 949 | Ga0070660_100079237 | |||
| 950 | Ga0070660_100204072 | |||
| 951 | Ga0070660_100267755 | |||
| 952 | Ga0070689_100095783 | |||
| 953 | Ga0070691_10008216 | |||
| 954 | Ga0070687_100067389 | |||
| 955 | Ga0070661_100014991 | |||
| 956 | Ga0070661_100127559 | |||
| 957 | Ga0070692_10004963 | |||
| 958 | Ga0070692_10017484 | |||
| 959 | Ga0070692_10041894 | |||
| 960 | Ga0070669_100096606 | |||
| 961 | Ga0070675_100009094 | |||
| 962 | Ga0070675_100011908 | |||
| 963 | Ga0070675_100097439 | |||
| 964 | Ga0070671_100002713 | |||
| 965 | Ga0070674_100159943 | |||
| 966 | Ga0070673_100059250 | |||
| 967 | Ga0070673_100220685 | |||
| 968 | Ga0070659_100000619 | |||
| 969 | Ga0070659_100013213 | |||
| 970 | Ga0070659_100043276 | |||
| 971 | Ga0070659_100047992 | |||
| 972 | Ga0070659_100314281 | |||
| 973 | Ga0070667_100042929 | |||
| 974 | Ga0070667_100125971 | |||
| 975 | Ga0070709_10000601 | |||
| 976 | Ga0070709_10000823 | |||
| 977 | Ga0070709_10022304 | |||
| 978 | Ga0070709_10080130 | |||
| 979 | Ga0070709_10092702 | |||
| 980 | Ga0070714_100003489 | |||
| 981 | Ga0070714_100006469 | |||
| 982 | Ga0070714_100007188 | |||
| 983 | Ga0070714_100011424 | |||
| 984 | Ga0070714_100015841 | |||
| 985 | Ga0070714_100020459 | |||
| 986 | Ga0070714_100026755 | |||
| 987 | Ga0070714_100230000 | |||
| 988 | Ga0070714_100398904 | |||
| 989 | Ga0070713_100006897 | |||
| 990 | Ga0070713_100007037 | |||
| 991 | Ga0070713_100010692 | |||
| 992 | Ga0070713_100157112 | |||
| 993 | Ga0070713_100228835 | |||
| 994 | Ga0070713_100229650 | |||
| 995 | Ga0070713_100264599 | |||
| 996 | Ga0070713_100361707 | |||
| 997 | Ga0070710_10000704 | |||
| 998 | Ga0070710_10000868 | |||
| 999 | Ga0070710_10079055 | |||
| 1000 | Ga0070710_10088687 | |||
| 1001 | Ga0070710_10127642 | |||
| 1002 | Ga0070711_100000369 | |||
| 1003 | Ga0070711_100044661 | |||
| 1004 | Ga0070711_100063587 | |||
| 1005 | Ga0070700_100102919 | |||
| 1006 | Ga0070694_100332996 | |||
| 1007 | Ga0070708_100005821 | |||
| 1008 | Ga0070708_100008154 | |||
| 1009 | Ga0070708_100013187 | |||
| 1010 | Ga0070708_100063538 | |||
| 1011 | Ga0070708_100308674 | |||
| 1012 | Ga0070708_100322184 | |||
| 1013 | Ga0070663_100003535 | |||
| 1014 | Ga0070663_100083348 | |||
| 1015 | Ga0070678_100012017 | |||
| 1016 | Ga0070678_100093441 | |||
| 1017 | Ga0070678_100094047 | |||
| 1018 | Ga0070662_100004777 | |||
| 1019 | Ga0070662_100008194 | |||
| 1020 | Ga0070681_10000504 | |||
| 1021 | Ga0070681_10121291 | |||
| 1022 | Ga0070681_10164278 | |||
| 1023 | Ga0070681_10238052 | |||
| 1024 | Ga0070706_100002492 | |||
| 1025 | Ga0070706_100002558 | |||
| 1026 | Ga0070706_100010627 | |||
| 1027 | Ga0070706_100011680 | |||
| 1028 | Ga0070706_100266893 | |||
| 1029 | Ga0070707_100000199 | |||
| 1030 | Ga0070707_100001248 | |||
| 1031 | Ga0070707_100002510 | |||
| 1032 | Ga0070707_100005322 | |||
| 1033 | Ga0070707_100014634 | |||
| 1034 | Ga0070707_100022729 | |||
| 1035 | Ga0070707_100036751 | |||
| 1036 | Ga0070707_100043283 | |||
| 1037 | Ga0070707_100095229 | |||
| 1038 | Ga0070707_100193532 | |||
| 1039 | Ga0070707_100360997 | |||
| 1040 | Ga0070707_100422977 | |||
| 1041 | Ga0070698_100000223 | |||
| 1042 | Ga0070698_100000264 | |||
| 1043 | Ga0070698_100004936 | |||
| 1044 | Ga0070698_100006575 | |||
| 1045 | Ga0070698_100009166 | |||
| 1046 | Ga0070698_100009346 | |||
| 1047 | Ga0070698_100010677 | |||
| 1048 | Ga0070698_100012045 | |||
| 1049 | Ga0070698_100023491 | |||
| 1050 | Ga0070698_100092840 | |||
| 1051 | Ga0070698_100102135 | |||
| 1052 | Ga0070698_100192365 | |||
| 1053 | Ga0070699_100002999 | |||
| 1054 | Ga0070679_100000687 | |||
| 1055 | Ga0070679_100010892 | |||
| 1056 | Ga0070679_100175965 | |||
| 1057 | Ga0070679_100377721 | |||
| 1058 | Ga0070679_100427095 | |||
| 1059 | Ga0070684_100011120 | |||
| 1060 | Ga0070684_100022936 | |||
| 1061 | Ga0070684_100043616 | |||
| 1062 | Ga0070684_100202129 | |||
| 1063 | Ga0070697_100008868 | |||
| 1064 | Ga0070697_100022138 | |||
| 1065 | Ga0070697_100068293 | |||
| 1066 | Ga0068853_100330452 | |||
| 1067 | Ga0068853_100462529 | |||
| 1068 | Ga0070672_100348122 | |||
| 1069 | Ga0070686_100004188 | |||
| 1070 | Ga0070686_100075456 | |||
| 1071 | Ga0070696_100245626 | |||
| 1072 | Ga0070693_100018462 | |||
| 1073 | Ga0070693_100047880 | |||
| 1074 | Ga0070665_100000703 | |||
| 1075 | Ga0070665_100046395 | |||
| 1076 | Ga0070665_100110970 | |||
| 1077 | Ga0070704_100129273 | |||
| 1078 | Ga0068855_100004375 | |||
| 1079 | Ga0068855_100131380 | |||
| 1080 | Ga0068855_100224872 | |||
| 1081 | Ga0068855_100489469 | |||
| 1082 | Ga0070664_100010112 | |||
| 1083 | Ga0070664_100017926 | |||
| 1084 | Ga0070664_100378875 | |||
| 1085 | Ga0068857_100008891 | |||
| 1086 | Ga0068857_100028443 | |||
| 1087 | Ga0068857_100183040 | |||
| 1088 | Ga0068857_100447223 | |||
| 1089 | Ga0068854_100028810 | |||
| 1090 | Ga0068854_100352128 | |||
| 1091 | Ga0068856_100020564 | |||
| 1092 | Ga0068856_100026030 | |||
| 1093 | Ga0068856_100026955 | |||
| 1094 | Ga0068856_100038800 | |||
| 1095 | Ga0070702_100014503 | |||
| 1096 | Ga0070702_100019326 | |||
| 1097 | Ga0068852_100049930 | |||
| 1098 | Ga0068852_100058858 | |||
| 1099 | Ga0068852_100168032 | |||
| 1100 | Ga0068859_100003310 | |||
| 1101 | Ga0068859_100035566 | |||
| 1102 | Ga0068864_100075629 | |||
| 1103 | Ga0068851_10044295 | |||
| 1104 | Ga0068851_10069154 | |||
| 1105 | Ga0068870_10000071 | |||
| 1106 | Ga0068863_100031033 | |||
| 1107 | Ga0068863_100099316 | |||
| 1108 | Ga0068858_100003961 | |||
| 1109 | Ga0068858_100280556 | |||
| 1110 | Ga0068860_100000696 | |||
| 1111 | Ga0068860_100096313 | |||
| 1112 | Ga0068862_100016202 | |||
| 1113 | Ga0068862_100189667 | |||
| 1114 | Ga0081540_1000616 | |||
| 1115 | Ga0081540_1000782 | |||
| 1116 | Ga0081539_10000806 | |||
| 1117 | Ga0081539_10001125 | |||
| 1118 | Ga0081539_10004135 | |||
| 1119 | Ga0070717_10003541 | |||
| 1120 | Ga0070717_10005526 | |||
| 1121 | Ga0070717_10011746 | |||
| 1122 | Ga0070717_10016987 | |||
| 1123 | Ga0070717_10021169 | |||
| 1124 | Ga0070717_10046302 | |||
| 1125 | Ga0070717_10062304 | |||
| 1126 | Ga0070717_10086256 | |||
| 1127 | Ga0070717_10136020 | |||
| 1128 | Ga0070717_10148949 | |||
| 1129 | Ga0070717_10230942 | |||
| 1130 | Ga0070717_10446964 | |||
| 1131 | Ga0075363_100025191 | |||
| 1132 | Ga0075364_10012201 | |||
| 1133 | Ga0070715_10001553 | |||
| 1134 | Ga0070715_10004219 | |||
| 1135 | Ga0070716_100000523 | |||
| 1136 | Ga0070716_100003243 | |||
| 1137 | Ga0070716_100004648 | |||
| 1138 | Ga0070712_100001355 | |||
| 1139 | Ga0070712_100015091 | |||
| 1140 | Ga0070712_100025700 | |||
| 1141 | Ga0070712_100038541 | |||
| 1142 | Ga0070712_100070379 | |||
| 1143 | Ga0070712_100354046 | |||
| 1144 | Ga0097621_100063494 | |||
| 1145 | Ga0075428_100000548 | |||
| 1146 | Ga0075430_100116789 | |||
| 1147 | Ga0075431_100033598 | |||
| 1148 | Ga0075434_100001779 | |||
| 1149 | Ga0075434_100016475 | |||
| 1150 | Ga0075434_100094262 | |||
| 1151 | Ga0068865_100172894 | |||
| 1152 | Ga0075436_100017369 | |||
| 1153 | Ga0075436_100036169 | |||
| 1154 | Ga0097620_100003310 | |||
| 1155 | Ga0097620_100035566 | |||
| 1156 | Ga0105251_10066396 | |||
| 1157 | Ga0105240_10120810 | |||
| 1158 | Ga0111539_10025523 | |||
| 1159 | Ga0111539_10068637 | |||
| 1160 | Ga0105245_10045369 | |||
| 1161 | Ga0105245_10053882 | |||
| 1162 | Ga0105245_10307724 | |||
| 1163 | Ga0105245_10416883 | |||
| 1164 | Ga0105247_10010944 | |||
| 1165 | Ga0114129_10010771 | |||
| 1166 | Ga0114129_10265376 | |||
| 1167 | Ga0105243_10033376 | |||
| 1168 | Ga0105243_10208195 | |||
| 1169 | Ga0105241_10004726 | |||
| 1170 | Ga0105241_10069818 | |||
| 1171 | Ga0105237_10094009 | |||
| 1172 | Ga0105237_10358051 | |||
| 1173 | Ga0105239_10000854 | |||
| 1174 | Ga0105239_10005467 | |||
| 1175 | Ga0105246_10000321 | |||
| 1176 | Ga0105246_10000478 | |||
| 1177 | Ga0157371_10018942 | |||
| 1178 | Ga0157371_10052250 | |||
| 1179 | Ga0157369_10002905 | |||
| 1180 | Ga0157369_10071305 | |||
| 1181 | Ga0157369_10096500 | |||
| 1182 | Ga0157369_10136882 | |||
| 1183 | Ga0157378_10156863 | |||
| 1184 | Ga0157372_10047147 | |||
| 1185 | Ga0157372_10501827 | |||
| 1186 | Ga0157372_10733692 | |||
| 1187 | Ga0163163_10101443 | |||
| 1188 | Ga0182008_10017849 | |||
| 1189 | Ga0157379_10002714 | |||
| 1190 | Ga0163161_10052759 | |||
| 1191 | Ga0163161_10186601 | |||
| 1192 | Ga0213875_10070533 | |||
| 1193 | Ga0213875_10135734 | |||
| 1194 | Ga0224712_10010846 | |||
| 1195 | Ga0207656_10006329 | |||
| 1196 | Ga0207653_10016065 | |||
| 1197 | Ga0207692_10000277 | |||
| 1198 | Ga0207692_10008894 | |||
| 1199 | Ga0207692_10009191 | |||
| 1200 | Ga0207692_10012523 | |||
| 1201 | Ga0207692_10054041 | |||
| 1202 | Ga0207692_10068078 | |||
| 1203 | Ga0207710_10018127 | |||
| 1204 | Ga0207688_10032483 | |||
| 1205 | Ga0207647_10025031 | |||
| 1206 | Ga0207699_10000261 | |||
| 1207 | Ga0207699_10000458 | |||
| 1208 | Ga0207699_10001066 | |||
| 1209 | Ga0207699_10008590 | |||
| 1210 | Ga0207699_10014254 | |||
| 1211 | Ga0207699_10058475 | |||
| 1212 | Ga0207645_10041514 | |||
| 1213 | Ga0207645_10047739 | |||
| 1214 | Ga0207643_10000102 | |||
| 1215 | Ga0207705_10004990 | |||
| 1216 | Ga0207705_10008596 | |||
| 1217 | Ga0207705_10011904 | |||
| 1218 | Ga0207705_10095745 | |||
| 1219 | Ga0207705_10112150 | |||
| 1220 | Ga0207684_10001230 | |||
| 1221 | Ga0207684_10001761 | |||
| 1222 | Ga0207684_10006481 | |||
| 1223 | Ga0207684_10011655 | |||
| 1224 | Ga0207684_10025133 | |||
| 1225 | Ga0207684_10030279 | |||
| 1226 | Ga0207684_10034910 | |||
| 1227 | Ga0207684_10046895 | |||
| 1228 | Ga0207684_10093466 | |||
| 1229 | Ga0207684_10292315 | |||
| 1230 | Ga0207707_10103022 | |||
| 1231 | Ga0207671_10023017 | |||
| 1232 | Ga0207671_10089523 | |||
| 1233 | Ga0207693_10003084 | |||
| 1234 | Ga0207693_10011453 | |||
| 1235 | Ga0207693_10030153 | |||
| 1236 | Ga0207663_10012382 | |||
| 1237 | Ga0207663_10048339 | |||
| 1238 | Ga0207663_10078370 | |||
| 1239 | Ga0207660_10000439 | |||
| 1240 | Ga0207660_10027222 | |||
| 1241 | Ga0207662_10039096 | |||
| 1242 | Ga0207657_10007215 | |||
| 1243 | Ga0207657_10051901 | |||
| 1244 | Ga0207657_10082552 | |||
| 1245 | Ga0207657_10092164 | |||
| 1246 | Ga0207649_10020755 | |||
| 1247 | Ga0207649_10039068 | |||
| 1248 | Ga0207652_10004366 | |||
| 1249 | Ga0207652_10034783 | |||
| 1250 | Ga0207652_10433206 | |||
| 1251 | Ga0207646_10000278 | |||
| 1252 | Ga0207646_10002243 | |||
| 1253 | Ga0207646_10003994 | |||
| 1254 | Ga0207646_10006877 | |||
| 1255 | Ga0207646_10014374 | |||
| 1256 | Ga0207646_10017448 | |||
| 1257 | Ga0207646_10030307 | |||
| 1258 | Ga0207646_10063984 | |||
| 1259 | Ga0207646_10085097 | |||
| 1260 | Ga0207646_10112132 | |||
| 1261 | Ga0207646_10236330 | |||
| 1262 | Ga0207694_10118167 | |||
| 1263 | Ga0207694_10209450 | |||
| 1264 | Ga0207650_10017555 | |||
| 1265 | Ga0207650_10152697 | |||
| 1266 | Ga0207659_10005909 | |||
| 1267 | Ga0207659_10022350 | |||
| 1268 | Ga0207659_10033050 | |||
| 1269 | Ga0207687_10003225 | |||
| 1270 | Ga0207687_10180829 | |||
| 1271 | Ga0207687_10234237 | |||
| 1272 | Ga0207700_10001366 | |||
| 1273 | Ga0207700_10005658 | |||
| 1274 | Ga0207700_10031442 | |||
| 1275 | Ga0207700_10033364 | |||
| 1276 | Ga0207700_10049461 | |||
| 1277 | Ga0207700_10059009 | |||
| 1278 | Ga0207700_10436518 | |||
| 1279 | Ga0207664_10000311 | |||
| 1280 | Ga0207664_10001412 | |||
| 1281 | Ga0207664_10010644 | |||
| 1282 | Ga0207664_10021242 | |||
| 1283 | Ga0207664_10034531 | |||
| 1284 | Ga0207664_10099819 | |||
| 1285 | Ga0207664_10132319 | |||
| 1286 | Ga0207664_10246873 | |||
| 1287 | Ga0207644_10008498 | |||
| 1288 | Ga0207690_10000575 | |||
| 1289 | Ga0207690_10008450 | |||
| 1290 | Ga0207690_10010483 | |||
| 1291 | Ga0207690_10012749 | |||
| 1292 | Ga0207690_10220403 | |||
| 1293 | Ga0207706_10005138 | |||
| 1294 | Ga0207706_10113444 | |||
| 1295 | Ga0207706_10115805 | |||
| 1296 | Ga0207709_10222945 | |||
| 1297 | Ga0207670_10088801 | |||
| 1298 | Ga0207669_10055884 | |||
| 1299 | Ga0207669_10171311 | |||
| 1300 | Ga0207669_10332441 | |||
| 1301 | Ga0207665_10000215 | |||
| 1302 | Ga0207665_10001013 | |||
| 1303 | Ga0207665_10006016 | |||
| 1304 | Ga0207665_10031498 | |||
| 1305 | Ga0207665_10052907 | |||
| 1306 | Ga0207665_10144864 | |||
| 1307 | Ga0207691_10073314 | |||
| 1308 | Ga0207691_10386837 | |||
| 1309 | Ga0207689_10001185 | |||
| 1310 | Ga0207689_10003272 | |||
| 1311 | Ga0207689_10017236 | |||
| 1312 | Ga0207679_10023587 | |||
| 1313 | Ga0207667_10078681 | |||
| 1314 | Ga0207667_10120689 | |||
| 1315 | Ga0207667_10246848 | |||
| 1316 | Ga0207667_10250328 | |||
| 1317 | Ga0207712_10024714 | |||
| 1318 | Ga0207668_10041699 | |||
| 1319 | Ga0207658_10082125 | |||
| 1320 | Ga0207677_10035307 | |||
| 1321 | Ga0207677_10359700 | |||
| 1322 | Ga0207703_10111725 | |||
| 1323 | Ga0207703_10490568 | |||
| 1324 | Ga0207639_10103119 | |||
| 1325 | Ga0207639_10271699 | |||
| 1326 | Ga0207639_10397059 | |||
| 1327 | Ga0207678_10000141 | |||
| 1328 | Ga0207678_10001012 | |||
| 1329 | Ga0207678_10004168 | |||
| 1330 | Ga0207708_10064175 | |||
| 1331 | Ga0207702_10000567 | |||
| 1332 | Ga0207702_10008130 | |||
| 1333 | Ga0207702_10019266 | |||
| 1334 | Ga0207702_10173858 | |||
| 1335 | Ga0207641_10008900 | |||
| 1336 | Ga0207641_10344090 | |||
| 1337 | Ga0207676_10000814 | |||
| 1338 | Ga0207676_10209841 | |||
| 1339 | Ga0207674_10011467 | |||
| 1340 | Ga0207674_10013397 | |||
| 1341 | Ga0207674_10379284 | |||
| 1342 | Ga0207675_100024703 | |||
| 1343 | Ga0207675_100050757 | |||
| 1344 | Ga0207675_100231589 | |||
| 1345 | Ga0207683_10002042 | |||
| 1346 | Ga0207683_10004876 | |||
| 1347 | Ga0207683_10461389 | |||
| 1348 | Ga0207698_10558700 | |||
| 1349 | Ga0207428_10025122 | |||
| 1350 | Ga0207428_10063708 | |||
| 1351 | Ga0268266_10001679 | |||
| 1352 | Ga0268266_10025102 | |||
| 1353 | Ga0268265_10055749 | |||
| 1354 | Ga0268264_10000697 | |||
| 1355 | Ga0268264_10174239 | |||
| 1356 | Ga0265336_10003994 | |||
| 1357 | Ga0265338_10000827 | |||
| 1358 | Ga0307512_10063373 | |||
| 1359 | Ga0316181_1092416 | |||
| 1360 | Ga0265340_10005442 | |||
| 1361 | Ga0265316_10081161 | |||
| 1362 | Ga0307509_10007679 | |||
| 1363 | Ga0307408_100272122 | |||
| 1364 | Ga0316579_10002232 | |||
| 1365 | Ga0265314_10102111 | |||
| 1366 | Ga0316576_10006220 | |||
| 1367 | Ga0307516_10080920 | |||
| 1368 | Ga0316577_10003582 | |||
| 1369 | Ga0307413_10052968 | |||
| 1370 | Ga0307406_10187612 | |||
| 1371 | Ga0307407_10013842 | |||
| 1372 | Ga0307409_100078999 | |||
| 1373 | Ga0307409_100466785 | |||
| 1374 | Ga0307409_100507075 | |||
| 1375 | Ga0307416_100044055 | |||
| 1376 | Ga0307416_100398650 | |||
| 1377 | Ga0307415_100098439 | |||
| 1378 | Ga0307415_100249021 | |||
| 1379 | Ga0316583_10005810 | |||
| 1380 | Ga0316585_10002697 | |||
| 1381 | Ga0316593_10038422 | |||
| 1382 | Ga0316596_1019194 | |||
| 1383 | Ga0373959_0001379 | |||
| 1384 | Ga0373926_0000767 | |||
| 1385 | Ga0373926_0002281 | |||
| 1386 | Ga0373934_0000006 | |||
| 1387 | Ga0373934_0004342 | |||
| 1388 | Ga0373940_0011732 | |||
| 1389 | Ga0373923_0000602 | |||
| 1390 | Ga0373923_0026721 | |||
| 1391 | Ga0373936_0000341 | |||
| 1392 | Ga0373936_0000792 | |||
| 1393 | Ga0373936_0013649 | |||
| 1394 | Ga0373939_0045621 | |||
| 1395 | Ga0373939_0056658 | |||
| 1396 | Ga0373945_0000439 | |||
| 1397 | Ga0373945_0011554 | |||
| 1398 | Ga0373945_0103708 | |||
| 1399 | Ga0373945_0107300 | |||
| 1400 | Ga0373953_0001325 | |||
| 1401 | Ga0373953_0056521 | |||
| 1402 | Ga0373954_0001834 | |||
| 1403 | Ga0373954_0015932 | |||
| 1404 | Ga0373954_0055882 | |||
| 1405 | Ga0373954_0083001 | |||
| 1406 | Ga0373956_0000498 | |||
| 1407 | Ga0373956_0018288 | |||
| 1408 | Ga0373956_0021856 | |||
| 1409 | Ga0373956_0052667 | |||
| 1410 | Ga0373956_0061188 | |||
| 1411 | Ga0373957_0000878 | |||
| 1412 | Ga0373957_0017010 | |||
| 1413 | Ga0373957_0026004 | |||
| 1414 | Ga0373960_0010514 | |||
| 1415 | Ga0373943_0000222 | |||
| 1416 | Ga0373943_0000620 | |||
| 1417 | Ga0373943_0148186 | |||
| 1418 | Ga0373946_0000211 | |||
| 1419 | Ga0373946_0001783 | |||
| 1420 | Ga0373946_0113191 | |||
| 1421 | Ga0373955_0000034 | |||
| 1422 | Ga0373955_0006038 | |||
| 1423 | Ga0373955_0050207 | |||
| 1424 | Ga0373955_0093454 | |||
| 1425 | Ga0373961_0010664 | |||
| 1426 | Ga0373962_0010648 | |||
| 1427 | Ga0316574_0034991 | |||
| 1428 | Ga0373924_0000343 | |||
| 1429 | Ga0373924_0001065 | |||
| 1430 | Ga0373924_0011134 | |||
| 1431 | Ga0373931_0017595 | |||
| 1432 | Ga0373935_0035088 | |||
| 1433 | Ga0373927_0011206 | |||
| 1434 | Ga0373927_0073976 | |||
| 1435 | Ga0373927_0107451 | |||
| 1436 | Ga0373933_0000161 | |||
| 1437 | Ga0373933_0013141 | |||
| 1438 | Ga0373933_0135572 | |||
| 1439 | Ga0373947_0002674 | |||
| 1440 | Ga0373947_0015037 | |||
| 1441 | Ga0373947_0112790 | |||
| 1442 | Ga0373947_0146243 | |||
| 1443 | Ga0373947_0241559 | |||
| 1444 | Ga0373947_0313063 | |||
| 1445 | Ga0373937_0000126 | |||
| 1446 | Ga0373937_0013317 | |||
| 1447 | Ga0373937_0032272 | |||
| 1448 | Ga0373937_0051034 | |||
| 1449 | Ga0373937_0096539 | |||
| 1450 | Ga0373937_0198533 | |||
| 1451 | Ga0316584_0253986 | |||
| 1452 | Ga0373925_0001213 | |||
| 1453 | Ga0373925_0001242 | |||
| 1454 | Ga0373925_0004745 | |||
| 1455 | Ga0373925_0034034 | |||
| 1456 | Ga0373925_0274614 | |||
| 1457 | Ga0395900_0089872 | |||
| 1458 | Ga0395898_0036630 | |||
| 1459 | Ga0316581_0003414 | |||
| 1460 | Ga0436364_0007757 | |||
| 1461 | Ga0436364_0016285 | |||
| 1462 | Ga0436364_0568803 | |||
| 1463 | Ga0436364_0671111 | |||
| 1464 | Ga0436364_0737335 | |||
| 1465 | Ga0395901_0163097 | |||
| 1466 | Ga0436363_0039138 | |||
| 1467 | Ga0436363_0120235 | |||
| 1468 | Ga0436363_0261863 | |||
| 1469 | Ga0439465_0013225 | |||
| 1470 | Ga0439431_0003805 | |||
| 1471 | Ga0439445_0035838 | |||
| 1472 | Ga0439432_024281 | |||
| 1473 | Ga0466969_0014966 | |||
| 1474 | Ga0466969_0107917 | |||
| 1475 | Ga0466972_0013115 | |||
| 1476 | Ga0466965_0082617 | |||
| 1477 | Ga0466966_0006104 | |||
| 1478 | Ga0466966_0076714 | |||
| 1479 | Ga0466961_0005917 | |||
| 1480 | Ga0466961_0008796 | |||
| 1481 | Ga0466961_0038720 | |||
| 1482 | Ga0466961_0191239 | |||
| 1483 | Ga0466963_0005697 | |||
| 1484 | Ga0466963_0017249 | |||
| 1485 | Ga0466963_0405830 | |||
| 1486 | Ga0466964_0014836 | |||
| 1487 | Ga0466964_0019836 | |||
| 1488 | Ga0466971_0004589 | |||
| 1489 | Ga0466971_0070646 | |||
| 1490 | Ga0466970_0046551 | |||
| 1491 | Ga0466957_0002757 | |||
| 1492 | Ga0466957_0051732 | |||
| 1493 | Ga0466957_0065992 | |||
| 1494 | Ga0466957_0131404 | |||
| 1495 | Ga0466957_0339721 | |||
| 1496 | Ga0466960_0027362 | |||
| 1497 | Ga0466960_0171305 | |||
| 1498 | Ga0466960_0184228 | |||
| 1499 | Ga0466959_0000786 | |||
| 1500 | Ga0466959_0006200 | |||
| 1501 | Ga0466959_0011536 | |||
| 1502 | Ga0466959_0050084 | |||
| 1503 | Ga0451576_0523890 | |||
| 1504 | Ga0466958_0005392 | |||
| 1505 | Ga0466958_0022947 | |||
| 1506 | Ga0466967_0001099 | |||
| 1507 | Ga0466967_0008839 | |||
| 1508 | Ga0466967_0009511 | |||
| 1509 | Ga0466967_0022152 | |||
| 1510 | Ga0466967_0022697 | |||
| 1511 | Ga0466967_0052581 | |||
| 1512 | Ga0466967_0055695 | |||
| 1513 | Ga0466967_0060217 | |||
| 1514 | Ga0466967_0060277 | |||
| 1515 | Ga0466967_0119472 | |||
| 1516 | Ga0466967_0185339 | |||
| 1517 | Ga0466967_0462792 | |||
| 1518 | Ga0466967_0475036 | |||
| 1519 | Ga0495592_0000030 | |||
| 1520 | Ga0495592_0064734 | |||
| 1521 | Ga0495592_0183322 | |||
| 1522 | Ga0495592_0283679 | |||
| 1523 | Ga0495603_0001439 | |||
| 1524 | Ga0495603_0008628 | |||
| 1525 | Ga0495629_0015013 | |||
| 1526 | Ga0495641_0027587 | |||
| 1527 | Ga0495641_0164382 | |||
| 1528 | Ga0495651_0000221 | |||
| 1529 | Ga0495651_0130027 | |||
| 1530 | Ga0495653_0000895 | |||
| 1531 | Ga0495653_0070199 | |||
| 1532 | Ga0495653_0070298 | |||
| 1533 | Ga0495653_0121150 | |||
| 1534 | Ga0495653_0192005 | |||
| 1535 | Ga0495653_0214135 | |||
| 1536 | Ga0495653_0263493 | |||
| 1537 | Ga0495580_0076865 | |||
| 1538 | Ga0495582_0001232 | |||
| 1539 | Ga0495582_0004428 | |||
| 1540 | Ga0495582_0033988 | |||
| 1541 | Ga0495582_0079635 | |||
| 1542 | Ga0495639_0178368 | |||
| 1543 | Ga0495662_0023146 | |||
| 1544 | Ga0495664_0003692 | |||
| 1545 | Ga0495664_0021701 | |||
| 1546 | Ga0495664_0069459 | |||
| 1547 | Ga0495594_0021752 | |||
| 1548 | Ga0495608_0000191 | |||
| 1549 | Ga0495608_0014956 | |||
| 1550 | Ga0495608_0027786 | |||
| 1551 | Ga0495608_0038704 | |||
| 1552 | Ga0495618_0027405 | |||
| 1553 | Ga0495618_0044993 | |||
| 1554 | Ga0495618_0081741 | |||
| 1555 | Ga0495628_0003830 | |||
| 1556 | Ga0495628_0028621 | |||
| 1557 | Ga0495628_0037076 | |||
| 1558 | Ga0495630_0012349 | |||
| 1559 | Ga0495630_0058749 | |||
| 1560 | Ga0495630_0326228 | |||
| 1561 | Ga0495666_0026971 | |||
| 1562 | Ga0495652_0000921 | |||
| 1563 | Ga0495652_0002640 | |||
| 1564 | Ga0495652_0045493 | |||
| 1565 | Ga0495652_0065676 | |||
| 1566 | Ga0495652_0072617 | |||
| 1567 | Ga0495652_0117785 | |||
| 1568 | Ga0495665_0002334 | |||
| 1569 | Ga0495665_0006345 | |||
| 1570 | Ga0495665_0031595 | |||
| 1571 | Ga0495640_0004093 | |||
| 1572 | Ga0495640_0011149 | |||
| 1573 | Ga0495640_0028834 | |||
| 1574 | Ga0495640_0039340 | |||
| 1575 | Ga0495640_0077148 | |||
| 1576 | Ga0495640_0148290 | |||
| 1577 | Ga0495586_0022515 | |||
| 1578 | Ga0495587_0000210 | |||
| 1579 | Ga0495587_0006716 | |||
| 1580 | Ga0495587_0076147 | |||
| 1581 | Ga0495587_0212384 | |||
| 1582 | Ga0495645_0029854 | |||
| 1583 | Ga0495645_0076714 | |||
| 1584 | Ga0495645_0149563 | |||
| 1585 | Ga0495667_0000040 | |||
| 1586 | Ga0495667_0013375 | |||
| 1587 | Ga0495667_0023765 | |||
| 1588 | Ga0495667_0024113 | |||
| 1589 | Ga0495667_0077349 | |||
| 1590 | Ga0495668_0000477 | |||
| 1591 | Ga0495634_0002549 | |||
| 1592 | Ga0495634_0117901 | |||
| 1593 | Ga0495634_0134824 | |||
| 1594 | Ga0495625_0000969 | |||
| 1595 | Ga0495635_0000373 | |||
| 1596 | Ga0495635_0020270 | |||
| 1597 | Ga0495657_0000029 | |||
| 1598 | Ga0495657_0015497 | |||
| 1599 | Ga0495657_0021602 | |||
| 1600 | Ga0495657_0073654 | |||
| 1601 | Ga0495657_0139273 | |||
| 1602 | Ga0495599_0000238 | |||
| 1603 | Ga0495599_0055554 | |||
| 1604 | Ga0495599_0273062 | |||
| 1605 | Ga0495623_0000652 | |||
| 1606 | Ga0495623_0007901 | |||
| 1607 | Ga0495623_0015753 | |||
| 1608 | Ga0495623_0025198 | |||
| 1609 | Ga0495623_0057266 | |||
| 1610 | Ga0495646_0011399 | |||
| 1611 | Ga0495646_0053325 | |||
| 1612 | Ga0495646_0063798 | |||
| 1613 | Ga0495647_0021182 | |||
| 1614 | Ga0495658_0016530 | |||
| 1615 | Ga0495658_0207408 | |||
| 1616 | Ga0495669_0031349 | |||
| 1617 | Ga0495613_0000459 | |||
| 1618 | Ga0495613_0023536 | |||
| 1619 | Ga0495613_0027878 | |||
| 1620 | Ga0495624_0001477 | |||
| 1621 | Ga0495600_0004117 | |||
| 1622 | Ga0495600_0009623 | |||
| 1623 | Ga0495600_0031175 | |||
| 1624 | Ga0495600_0098321 | |||
| 1625 | Ga0495600_0168879 | |||
| 1626 | Ga0495581_0025729 | |||
| 1627 | Ga0495581_0036856 | |||
| 1628 | Ga0495581_0045917 | |||
| 1629 | Ga0495581_0057462 | |||
| 1630 | Ga0495604_0000034 | |||
| 1631 | Ga0495604_0014642 | |||
| 1632 | Ga0495604_0017920 | |||
| 1633 | Ga0495604_0038984 | |||
| 1634 | Ga0495604_0039115 | |||
| 1635 | Ga0495604_0120531 | |||
| 1636 | Ga0495674_0001403 | |||
| 1637 | Ga0495674_0025013 | |||
| 1638 | Ga0495674_0034492 | |||
| 1639 | Ga0495674_0040925 | |||
| 1640 | Ga0495674_0062227 | |||
| 1641 | Ga0495674_0076231 | |||
| 1642 | Ga0495674_0099382 | |||
| 1643 | Ga0495676_0009541 | |||
| 1644 | Ga0495676_0021763 | |||
| 1645 | Ga0495680_0000522 | |||
| 1646 | Ga0495680_0003936 | |||
| 1647 | Ga0495680_0007711 | |||
| 1648 | Ga0495680_0086007 | |||
| 1649 | Ga0495675_0000613 | |||
| 1650 | Ga0495675_0007809 | |||
| 1651 | Ga0495675_0016573 | |||
| 1652 | Ga0495675_0020863 | |||
| 1653 | Ga0495675_0034408 | |||
| 1654 | Ga0495675_0040915 | |||
| 1655 | Ga0495684_0005175 | |||
| 1656 | Ga0495684_0009248 | |||
| 1657 | Ga0495684_0027794 | |||
| 1658 | Ga0495684_0028463 | |||
| 1659 | Ga0495684_0039046 | |||
| 1660 | Ga0495684_0061338 | |||
| 1661 | Ga0495684_0168379 | |||
| 1662 | Ga0495684_0271147 | |||
| 1663 | Ga0495593_0003766 | |||
| 1664 | Ga0495602_0001101 | |||
| 1665 | Ga0495602_0021704 | |||
| 1666 | Ga0495602_0035342 | |||
| 1667 | Ga0495602_0070136 | |||
| 1668 | Ga0495602_0074482 | |||
| 1669 | Ga0495602_0131380 | |||
| 1670 | Ga0495602_0181918 | |||
| 1671 | Ga0495614_0082639 | |||
| 1672 | Ga0495626_0000234 | |||
| 1673 | Ga0496100_0007843 | |||
| 1674 | Ga0496100_0134770 | |||
| 1675 | Ga0496100_0276155 | |||
| 1676 | Ga0496101_0071517 | |||
| 1677 | Ga0496101_0106525 | |||
| 1678 | Ga0496101_0180368 | |||
| 1679 | Ga0496101_0194058 | |||
| 1680 | Ga0496102_0000287 | |||
| 1681 | Ga0496102_0055310 | |||
| 1682 | Ga0496102_0059022 | |||
| 1683 | Ga0496102_0160102 | |||
| 1684 | Ga0496102_0216761 | |||
| 1685 | Ga0496102_0228058 | |||
| 1686 | Ga0496103_0000192 | |||
| 1687 | Ga0496103_0035769 | |||
| 1688 | Ga0496104_0000398 | |||
| 1689 | Ga0496104_0039051 | |||
| 1690 | Ga0496104_0086163 | |||
| 1691 | Ga0496104_0189020 | |||
| 1692 | Ga0496104_0297069 | |||
| 1693 | Ga0496105_0000812 | |||
| 1694 | Ga0496105_0002315 | |||
| 1695 | Ga0496105_0051856 | |||
| 1696 | Ga0496105_0055672 | |||
| 1697 | Ga0496105_0086402 | |||
| 1698 | Ga0496106_0020477 | |||
| 1699 | Ga0496106_0048856 | |||
| 1700 | Ga0496107_0022461 | |||
| 1701 | Ga0496107_0025540 | |||
| 1702 | Ga0496108_0000149 | |||
| 1703 | Ga0496108_0003584 | |||
| 1704 | Ga0496108_0016367 | |||
| 1705 | Ga0496108_0055394 | |||
| 1706 | Ga0496108_0096311 | |||
| 1707 | Ga0496109_0053506 | |||
| 1708 | Ga0496109_0193967 | |||
| 1709 | Ga0496110_0126346 | |||
| 1710 | Ga0496110_0306621 | |||
| 1711 | Ga0496111_0034773 | |||
| 1712 | Ga0496111_0126997 | |||
| 1713 | Ga0496112_0000555 | |||
| 1714 | Ga0496112_0021103 | |||
| 1715 | Ga0496112_0102259 | |||
| 1716 | Ga0496112_0234943 | |||
| 1717 | Ga0496113_0068910 | |||
| 1718 | Ga0496114_0008673 | |||
| 1719 | Ga0496114_0038878 | |||
| 1720 | Ga0496114_0040956 | |||
| 1721 | Ga0496115_0022579 | |||
| 1722 | Ga0496115_0043647 | |||
| 1723 | Ga0496115_0074109 | |||
| 1724 | Ga0496118_0060297 | |||
| 1725 | Ga0496118_0140963 | |||
| 1726 | Ga0496119_0001269 | |||
| 1727 | Ga0496119_0009683 | |||
| 1728 | Ga0496120_0015501 | |||
| 1729 | Ga0496124_0093858 | |||
| 1730 | Ga0496126_0000588 | |||
| 1731 | Ga0501031_0005137 | |||
| 1732 | Ga0501031_0008163 | |||
| 1733 | Ga0501032_0027113 | |||
| 1734 | Ga0501032_0042338 | |||
| 1735 | Ga0501034_0223514 | |||
| 1736 | Ga0501037_0017841 | |||
| 1737 | Ga0501038_0139134 | |||
| 1738 | Ga0501038_0157997 | |||
| 1739 | Ga0501039_0049633 | |||
| 1740 | Ga0501039_0062539 | |||
| 1741 | Ga0501039_0096052 | |||
| 1742 | Ga0501039_0101363 | |||
| 1743 | Ga0501041_0008683 | |||
| 1744 | Ga0501041_0015605 | |||
| 1745 | Ga0501042_0001539 | |||
| 1746 | Ga0501042_0022820 | |||
| 1747 | Ga0501046_0047691 | |||
| 1748 | Ga0501046_0085945 | |||
| 1749 | Ga0501047_0179621 | |||
| 1750 | Ga0501048_0008158 | |||
| 1751 | Ga0501048_0029392 | |||
| 1752 | Ga0501048_0060518 | |||
| 1753 | Ga0501068_0008501 | |||
| 1754 | Ga0501069_0062877 | |||
| 1755 | Ga0501069_0136050 | |||
| 1756 | Ga0501070_0022083 | |||
| 1757 | Ga0501070_0032113 | |||
| 1758 | Ga0501070_0133940 | |||
| 1759 | Ga0501070_0153231 | |||
| 1760 | Ga0501070_0154307 | |||
| 1761 | Ga0501070_0206798 | |||
| 1762 | Ga0501070_0239869 | |||
| 1763 | Ga0501070_0259357 | |||
| 1764 | Ga0501071_0000355 | |||
| 1765 | Ga0501071_0071847 | |||
| 1766 | Ga0501072_0004287 | |||
| 1767 | Ga0501072_0154626 | |||
| 1768 | Ga0501073_0145209 | |||
| 1769 | Ga0501074_0011695 | |||
| 1770 | Ga0501075_0005534 | |||
| 1771 | Ga0501075_0053165 | |||
| 1772 | Ga0501075_0085053 | |||
| 1773 | Ga0501076_0000758 | |||
| 1774 | Ga0501076_0293871 | |||
| 1775 | Ga0501077_0066828 | |||
| 1776 | Ga0501079_0012673 | |||
| 1777 | Ga0501079_0258831 | |||
| 1778 | Ga0501080_0038584 | |||
| 1779 | Ga0501081_0024995 | |||
| 1780 | Ga0501035_0044305 | |||
| 1781 | Ga0501035_0316848 | |||
| 1782 | Ga0501045_0010113 | |||
| 1783 | Ga0501045_0251447 | |||
| 1784 | nmdc:mga00v17_60413_c1 | |||
| 1785 | nmdc:mga0yw44_61235_c1 | |||
| 1786 | nmdc:mga06z11_95680_c1 | |||
| 1787 | nmdc:mga07m45_3230_c1 | |||
| 1788 | nmdc:mga09592_148791_c1 | |||
| 1789 | nmdc:mga08y16_17213_c1 | |||
| 1790 | nmdc:mga08y16_23121_c1 | |||
| 1791 | nmdc:mga08y16_35177_c1 | |||
| 1792 | nmdc:mga0n895_139714_c1 | |||
| 1793 | nmdc:mga0n895_9940_c1 | |||
| 1794 | nmdc:mga0rr50_182838_c1 | |||
| 1795 | nmdc:mga08x19_29999_c1 | |||
| 1796 | nmdc:mga0a205_44361_c1 | |||
| 1797 | Ga0495601_0052162 | |||
| 1798 | Ga0495601_0059728 | |||
| 1799 | Ga0495601_0135320 | |||
| 1800 | Ga0495612_0002376 | |||
| 1801 | Ga0495612_0034752 | |||
| 1802 | Ga0495595_0156649 | |||
| 1803 | Ga0495619_0001126 | |||
| 1804 | Ga0495619_0003694 | |||
| 1805 | Ga0495619_0071465 | |||
| 1806 | Ga0495619_0081515 | |||
| 1807 | Ga0495619_0158190 | |||
| 1808 | Ga0500643_000352 | |||
| 1809 | Ga0500641_0044978 | |||
| 1810 | Ga0500593_007573 | |||
| 1811 | Ga0501084_0026752 | |||
| 1812 | Ga0501084_0085343 | |||
| 1813 | Ga0466962_0003529 | |||
| 1814 | Ga0466962_0004333 | |||
| 1815 | Ga0466962_0013135 | |||
| 1816 | Ga0466962_0061822 | |||
| 1817 | Ga0466962_0096793 | |||
| 1818 | Ga0530510_0030849 | |||
| 1819 | 2515718891 | |||
| 1820 | 2516083103 | |||
| 1821 | 2583151149 | |||
| 1822 | 2644230357 | |||
| 1823 | 2676487927 | |||
| 1824 | 2768645836 | |||
| 1825 | 2855391110 | |||
| 1826 | 2856742829 | |||
| 1827 | 2866556820 | |||
| 1828 | 2873320830 | |||
| 1829 | 2884697544 | |||
| 1830 | 2887486832 | |||
| 1831 | 2891403116 | |||
| 1832 | 2891554565 | |||
| 1833 | 2891564657 | |||
| 1834 | 2895438104 | |||
| 1835 | 2895447661 | |||
| 1836 | 2899372922 | |||
| 1837 | 2984579970 | |||
| 1838 | 2990260751 | |||
| 1839 | 3001891596 | |||
| 1840 | 3003001845 | |||
| 1841 | 8001786840 | |||
| 1842 | 8008486599 | |||
| 1843 | 8025525668 | |||
| 1844 | 8055179772 | |||
| 1845 | 8056065091 | |||
| 1846 | 8057568555 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iqf-assembly2.cif.gz_B | crystal structure of methyionyl-trna formyltransferase from bacillus anthracis | 0.9524 | 1 | 307 |
| 4iqf-assembly2.cif.gz_B | crystal structure of methyionyl-trna formyltransferase from bacillus anthracis | 0.9464 | 1 | 307 |
| 2fmt-assembly2.cif.gz_B | methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet | 0.9408 | 2 | 308 |
| 2fmt-assembly2.cif.gz_B | methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet | 0.935 | 2 | 308 |
| 5uai-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa | 0.9305 | 2 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WND3_1_310_3.40.50.12230 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9764 | 1 | 306 | 3.40.50.12230 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9739 | 2 | 206 | 3.40.50.170 |
| af_P9WND3_1_310_3.40.50.12230 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9671 | 1 | 306 | 3.40.50.12230 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.959 | 2 | 206 | 3.40.50.170 |
| af_B4FRN6_28_246_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9382 | 2 | 206 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H2DD92-F1-model_v4 | deleted | 0.9895 | 1 | 307 |
|
| AF-A0A538E3I9-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9883 | 1 | 175 |
GO:0004479
GO:0005829 |
| AF-A0A382L434-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9871 | 26 | 202 |
GO:0004479
GO:0005829 |
| AF-A0A1H2DD92-F1-model_v4 | deleted | 0.9831 | 1 | 307 |
|
| AF-A0A4Q6BVG8-F1-model_v4 | methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9828 | 2 | 223 |
GO:0004479
GO:0005829 |