F485827

General Info

Members Datasets Scaffolds Average Seq Length
923 377 1846 313

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10004575|Ga0157369_100045757
Length 334
Sequence VVRPRRADGQGVAARDPRPRRLTVRLVFAGTPAAALPSLDAIAASSHELLAVVTRPDAPAGRGRPVDGRDVRRSAVGEWADARGVDVVTPARPADPDFLAWLRNLAPDCCPVVAYGALVPPAALEIPAYGWVNLHFSILPAWRGAAPVQHSILHGDEITGATTFQLKAGLDTGPVYGVVTTEIGRTETAGSLMGRLAAPGAGLLVATLDGIESGELQPKPQPNDGVSLAPKLTVAAARIDWSAPALRVDRLVRACTPAPGAWTTLRGRRVKLGPVDPTDGQLDPGAISVDDQRVIVGTGGGAVALGVVQPEGRGPMDAIAWVRGLRLTADDRFA

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
178 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
179 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
325 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
326 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
327 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
350 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
351 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
352 2582580736 Prauserella sp. Am3 Isolate Unclassified
353 2643221641 Nocardioides sp. Root122 Isolate Unclassified
354 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
355 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
356 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
357 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
358 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
359 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
360 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
361 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
362 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
363 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
364 2891562705 Microbispora tritici MT50 Isolate Unclassified
365 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
366 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
367 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
368 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
369 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
370 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
371 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
372 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
373 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
374 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
375 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
376 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
377 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 0.33
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 5.53
Rhizosphere 89.17
Stem 0
Stem Tuber 0.11
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10004575 3300013105 Bacteria 16260
2 JGI25406J46586_10012586 3300003203 Bacteria 3665
3 JGI25406J46586_10030735 3300003203 Bacteria 2018
4 JGI25406J46586_10040571 3300003203 Bacteria 1649
5 JGI25404J52841_10012198 3300003659 Bacteria 1859
6 Ga0070658_10003299 3300005327 Bacteria 13312
7 Ga0070658_10004108 3300005327 Bacteria 11931
8 Ga0070658_10034494 3300005327 Bacteria 4071
9 Ga0070658_10039254 3300005327 Bacteria 3819
10 Ga0070658_10269779 3300005327 Bacteria 1447
11 Ga0070683_100013327 3300005329 Bacteria 7167
12 Ga0070683_100313617 3300005329 Bacteria 1492
13 Ga0070683_100539160 3300005329 Bacteria 1115
14 Ga0070670_100030363 3300005331 Bacteria 4654
15 Ga0070670_100134151 3300005331 Bacteria 2139
16 Ga0068869_100009523 3300005334 Bacteria 6304
17 Ga0070680_100000593 3300005336 Bacteria 24998
18 Ga0070680_100102749 3300005336 Bacteria 2374
19 Ga0070682_100017404 3300005337 Bacteria 4190
20 Ga0070682_100133291 3300005337 Bacteria 1684
21 Ga0070682_100337873 3300005337 Bacteria 1118
22 Ga0068868_100039320 3300005338 Bacteria 3676
23 Ga0068868_100043967 3300005338 Bacteria 3490
24 Ga0068868_100214097 3300005338 Bacteria 1611
25 Ga0070660_100042286 3300005339 Bacteria 3477
26 Ga0070660_100079237 3300005339 Bacteria 2577
27 Ga0070660_100204072 3300005339 Bacteria 1604
28 Ga0070660_100267755 3300005339 Bacteria 1396
29 Ga0070689_100095783 3300005340 Bacteria 2345
30 Ga0070691_10008216 3300005341 Bacteria 4782
31 Ga0070687_100067389 3300005343 Bacteria 1911
32 Ga0070661_100014991 3300005344 Bacteria 5469
33 Ga0070661_100127559 3300005344 Bacteria 1909
34 Ga0070692_10004963 3300005345 Bacteria 5616
35 Ga0070692_10017484 3300005345 Bacteria 3429
36 Ga0070692_10041894 3300005345 Bacteria 2348
37 Ga0070669_100096606 3300005353 Bacteria 2223
38 Ga0070675_100009094 3300005354 Bacteria 7716
39 Ga0070675_100011908 3300005354 Bacteria 6816
40 Ga0070675_100097439 3300005354 Bacteria 2472
41 Ga0070671_100002713 3300005355 Bacteria 13735
42 Ga0070674_100159943 3300005356 Bacteria 1708
43 Ga0070673_100059250 3300005364 Bacteria 3030
44 Ga0070673_100220685 3300005364 Bacteria 1640
45 Ga0070659_100000619 3300005366 Bacteria 26037
46 Ga0070659_100013213 3300005366 Bacteria 6141
47 Ga0070659_100043276 3300005366 Bacteria 3522
48 Ga0070659_100047992 3300005366 Bacteria 3352
49 Ga0070659_100314281 3300005366 Bacteria 1308
50 Ga0070667_100042929 3300005367 Bacteria 3794
51 Ga0070667_100125971 3300005367 Bacteria 2232
52 Ga0070709_10000601 3300005434 Bacteria 21040
53 Ga0070709_10000823 3300005434 Bacteria 17323
54 Ga0070709_10022304 3300005434 Bacteria 3701
55 Ga0070709_10080130 3300005434 Bacteria 2128
56 Ga0070709_10092702 3300005434 Bacteria 1996
57 Ga0070714_100003489 3300005435 Bacteria 11740
58 Ga0070714_100006469 3300005435 Bacteria 9052
59 Ga0070714_100007188 3300005435 Bacteria 8642
60 Ga0070714_100011424 3300005435 Bacteria 7043
61 Ga0070714_100015841 3300005435 Bacteria 6077
62 Ga0070714_100020459 3300005435 Bacteria 5404
63 Ga0070714_100026755 3300005435 Bacteria 4769
64 Ga0070714_100230000 3300005435 Bacteria 1708
65 Ga0070714_100398904 3300005435 Bacteria 1300
66 Ga0070713_100006897 3300005436 Bacteria 7925
67 Ga0070713_100007037 3300005436 Bacteria 7856
68 Ga0070713_100010692 3300005436 Bacteria 6642
69 Ga0070713_100157112 3300005436 Bacteria 2027
70 Ga0070713_100228835 3300005436 Bacteria 1689
71 Ga0070713_100229650 3300005436 Bacteria 1686
72 Ga0070713_100264599 3300005436 Bacteria 1573
73 Ga0070713_100361707 3300005436 Bacteria 1348
74 Ga0070710_10000704 3300005437 Bacteria 15898
75 Ga0070710_10000868 3300005437 Bacteria 14460
76 Ga0070710_10079055 3300005437 Bacteria 1915
77 Ga0070710_10088687 3300005437 Bacteria 1820
78 Ga0070710_10127642 3300005437 Bacteria 1547
79 Ga0070711_100000369 3300005439 Bacteria 23241
80 Ga0070711_100044661 3300005439 Bacteria 3009
81 Ga0070711_100063587 3300005439 Bacteria 2576
82 Ga0070700_100102919 3300005441 Bacteria 1885
83 Ga0070694_100332996 3300005444 Bacteria 1172
84 Ga0070708_100005821 3300005445 Bacteria 9785
85 Ga0070708_100008154 3300005445 Bacteria 8403
86 Ga0070708_100013187 3300005445 Bacteria 6762
87 Ga0070708_100063538 3300005445 Bacteria 3305
88 Ga0070708_100308674 3300005445 Bacteria 1490
89 Ga0070708_100322184 3300005445 Bacteria 1456
90 Ga0070663_100003535 3300005455 Bacteria 9023
91 Ga0070663_100083348 3300005455 Bacteria 2354
92 Ga0070678_100012017 3300005456 Bacteria 5364
93 Ga0070678_100093441 3300005456 Bacteria 2313
94 Ga0070678_100094047 3300005456 Bacteria 2306
95 Ga0070662_100004777 3300005457 Bacteria 8586
96 Ga0070662_100008194 3300005457 Bacteria 6808
97 Ga0070681_10000504 3300005458 Bacteria 31959
98 Ga0070681_10121291 3300005458 Bacteria 2549
99 Ga0070681_10164278 3300005458 Bacteria 2143
100 Ga0070681_10238052 3300005458 Bacteria 1734
101 Ga0070706_100002492 3300005467 Bacteria 18546
102 Ga0070706_100002558 3300005467 Bacteria 18289
103 Ga0070706_100010627 3300005467 Bacteria 8545
104 Ga0070706_100011680 3300005467 Bacteria 8154
105 Ga0070706_100266893 3300005467 Bacteria 1597
106 Ga0070707_100000199 3300005468 Bacteria 60047
107 Ga0070707_100001248 3300005468 Bacteria 24994
108 Ga0070707_100002510 3300005468 Bacteria 17475
109 Ga0070707_100005322 3300005468 Bacteria 12043
110 Ga0070707_100014634 3300005468 Bacteria 7354
111 Ga0070707_100022729 3300005468 Bacteria 5930
112 Ga0070707_100036751 3300005468 Bacteria 4674
113 Ga0070707_100043283 3300005468 Bacteria 4310
114 Ga0070707_100095229 3300005468 Bacteria 2883
115 Ga0070707_100193532 3300005468 Bacteria 1983
116 Ga0070707_100360997 3300005468 Bacteria 1411
117 Ga0070707_100422977 3300005468 Bacteria 1292
118 Ga0070698_100000223 3300005471 Bacteria 55997
119 Ga0070698_100000264 3300005471 Bacteria 52985
120 Ga0070698_100004936 3300005471 Bacteria 14633
121 Ga0070698_100006575 3300005471 Bacteria 12608
122 Ga0070698_100009166 3300005471 Bacteria 10623
123 Ga0070698_100009346 3300005471 Bacteria 10513
124 Ga0070698_100010677 3300005471 Bacteria 9785
125 Ga0070698_100012045 3300005471 Bacteria 9170
126 Ga0070698_100023491 3300005471 Bacteria 6445
127 Ga0070698_100092840 3300005471 Bacteria 2999
128 Ga0070698_100102135 3300005471 Bacteria 2839
129 Ga0070698_100192365 3300005471 Bacteria 1977
130 Ga0070699_100002999 3300005518 Bacteria 15003
131 Ga0070679_100000687 3300005530 Bacteria 29007
132 Ga0070679_100010892 3300005530 Bacteria 8639
133 Ga0070679_100175965 3300005530 Bacteria 2112
134 Ga0070679_100377721 3300005530 Bacteria 1364
135 Ga0070679_100427095 3300005530 Bacteria 1270
136 Ga0070684_100011120 3300005535 Bacteria 7162
137 Ga0070684_100022936 3300005535 Bacteria 5213
138 Ga0070684_100043616 3300005535 Bacteria 3874
139 Ga0070684_100202129 3300005535 Bacteria 1810
140 Ga0070697_100008868 3300005536 Bacteria 7852
141 Ga0070697_100022138 3300005536 Bacteria 5042
142 Ga0070697_100068293 3300005536 Bacteria 2910
143 Ga0068853_100330452 3300005539 Bacteria 1414
144 Ga0068853_100462529 3300005539 Bacteria 1194
145 Ga0070672_100348122 3300005543 Bacteria 1263
146 Ga0070686_100004188 3300005544 Bacteria 7940
147 Ga0070686_100075456 3300005544 Bacteria 2218
148 Ga0070696_100245626 3300005546 Bacteria 1351
149 Ga0070693_100018462 3300005547 Bacteria 3644
150 Ga0070693_100047880 3300005547 Bacteria 2433
151 Ga0070665_100000703 3300005548 Bacteria 44593
152 Ga0070665_100046395 3300005548 Bacteria 4366
153 Ga0070665_100110970 3300005548 Bacteria 2745
154 Ga0070704_100129273 3300005549 Bacteria 1954
155 Ga0068855_100004375 3300005563 Bacteria 17261
156 Ga0068855_100131380 3300005563 Bacteria 2859
157 Ga0068855_100224872 3300005563 Bacteria 2103
158 Ga0068855_100489469 3300005563 Bacteria 1338
159 Ga0070664_100010112 3300005564 Bacteria 7648
160 Ga0070664_100017926 3300005564 Bacteria 5813
161 Ga0070664_100378875 3300005564 Bacteria 1291
162 Ga0068857_100008891 3300005577 Bacteria 8699
163 Ga0068857_100028443 3300005577 Bacteria 4933
164 Ga0068857_100183040 3300005577 Bacteria 1907
165 Ga0068857_100447223 3300005577 Bacteria 1208
166 Ga0068854_100028810 3300005578 Bacteria 3840
167 Ga0068854_100352128 3300005578 Bacteria 1206
168 Ga0068856_100020564 3300005614 Bacteria 6412
169 Ga0068856_100026030 3300005614 Bacteria 5706
170 Ga0068856_100026955 3300005614 Bacteria 5605
171 Ga0068856_100038800 3300005614 Bacteria 4676
172 Ga0070702_100014503 3300005615 Bacteria 3998
173 Ga0070702_100019326 3300005615 Bacteria 3551
174 Ga0068852_100049930 3300005616 Bacteria 3581
175 Ga0068852_100058858 3300005616 Bacteria 3330
176 Ga0068852_100168032 3300005616 Bacteria 2054
177 Ga0068859_100003310 3300005617 Bacteria 16370
178 Ga0068859_100035566 3300005617 Bacteria 4997
179 Ga0068864_100075629 3300005618 Bacteria 2941
180 Ga0068851_10044295 3300005834 Bacteria 2245
181 Ga0068851_10069154 3300005834 Bacteria 1823
182 Ga0068870_10000071 3300005840 Bacteria 32257
183 Ga0068863_100031033 3300005841 Bacteria 5103
184 Ga0068863_100099316 3300005841 Bacteria 2765
185 Ga0068858_100003961 3300005842 Bacteria 14613
186 Ga0068858_100280556 3300005842 Bacteria 1586
187 Ga0068860_100000696 3300005843 Bacteria 38651
188 Ga0068860_100096313 3300005843 Bacteria 2821
189 Ga0068862_100016202 3300005844 Bacteria 6201
190 Ga0068862_100189667 3300005844 Bacteria 1849
191 Ga0081540_1000616 3300005983 Bacteria 33810
192 Ga0081540_1000782 3300005983 Bacteria 29170
193 Ga0081539_10000806 3300005985 Bacteria 61012
194 Ga0081539_10001125 3300005985 Bacteria 48453
195 Ga0081539_10004135 3300005985 Bacteria 16512
196 Ga0070717_10003541 3300006028 Bacteria 11197
197 Ga0070717_10005526 3300006028 Bacteria 9220
198 Ga0070717_10011746 3300006028 Bacteria 6664
199 Ga0070717_10016987 3300006028 Bacteria 5652
200 Ga0070717_10021169 3300006028 Bacteria 5123
201 Ga0070717_10046302 3300006028 Bacteria 3558
202 Ga0070717_10062304 3300006028 Bacteria 3093
203 Ga0070717_10086256 3300006028 Bacteria 2642
204 Ga0070717_10136020 3300006028 Bacteria 2116
205 Ga0070717_10148949 3300006028 Bacteria 2024
206 Ga0070717_10230942 3300006028 Bacteria 1629
207 Ga0070717_10446964 3300006028 Bacteria 1165
208 Ga0075363_100025191 3300006048 Bacteria 3031
209 Ga0075364_10012201 3300006051 Bacteria 5249
210 Ga0070715_10001553 3300006163 Bacteria 6725
211 Ga0070715_10004219 3300006163 Bacteria 4686
212 Ga0070716_100000523 3300006173 Bacteria 16045
213 Ga0070716_100003243 3300006173 Bacteria 7639
214 Ga0070716_100004648 3300006173 Bacteria 6580
215 Ga0070712_100001355 3300006175 Bacteria 14866
216 Ga0070712_100015091 3300006175 Bacteria 4967
217 Ga0070712_100025700 3300006175 Bacteria 3917
218 Ga0070712_100038541 3300006175 Bacteria 3267
219 Ga0070712_100070379 3300006175 Bacteria 2499
220 Ga0070712_100354046 3300006175 Bacteria 1202
221 Ga0097621_100063494 3300006237 Bacteria 3035
222 Ga0075428_100000548 3300006844 Bacteria 38376
223 Ga0075430_100116789 3300006846 Bacteria 2224
224 Ga0075431_100033598 3300006847 Bacteria 5286
225 Ga0075434_100001779 3300006871 Bacteria 18580
226 Ga0075434_100016475 3300006871 Bacteria 7105
227 Ga0075434_100094262 3300006871 Bacteria 2998
228 Ga0068865_100172894 3300006881 Bacteria 1658
229 Ga0075436_100017369 3300006914 Bacteria 4926
230 Ga0075436_100036169 3300006914 Bacteria 3407
231 Ga0097620_100003310 3300006931 Bacteria 16370
232 Ga0097620_100035566 3300006931 Bacteria 4997
233 Ga0105251_10066396 3300009011 Bacteria 1687
234 Ga0105240_10120810 3300009093 Bacteria 3155
235 Ga0111539_10025523 3300009094 Bacteria 7245
236 Ga0111539_10068637 3300009094 Bacteria 4186
237 Ga0105245_10045369 3300009098 Bacteria 3926
238 Ga0105245_10053882 3300009098 Bacteria 3612
239 Ga0105245_10307724 3300009098 Bacteria 1557
240 Ga0105245_10416883 3300009098 Bacteria 1345
241 Ga0105247_10010944 3300009101 Bacteria 5477
242 Ga0114129_10010771 3300009147 Bacteria 13031
243 Ga0114129_10265376 3300009147 Bacteria 2299
244 Ga0105243_10033376 3300009148 Bacteria 3980
245 Ga0105243_10208195 3300009148 Bacteria 1720
246 Ga0105241_10004726 3300009174 Bacteria 10042
247 Ga0105241_10069818 3300009174 Bacteria 2724
248 Ga0105237_10094009 3300009545 Bacteria 2987
249 Ga0105237_10358051 3300009545 Bacteria 1463
250 Ga0105239_10000854 3300010375 Bacteria 43307
251 Ga0105239_10005467 3300010375 Bacteria 14910
252 Ga0105246_10000321 3300011119 Bacteria 25383
253 Ga0105246_10000478 3300011119 Bacteria 21566
254 Ga0157371_10018942 3300013102 Bacteria 5082
255 Ga0157371_10052250 3300013102 Bacteria 2902
256 Ga0157369_10002905 3300013105 Bacteria 20475
257 Ga0157369_10071305 3300013105 Bacteria 3730
258 Ga0157369_10096500 3300013105 Bacteria 3154
259 Ga0157369_10136882 3300013105 Bacteria 2592
260 Ga0157378_10156863 3300013297 Bacteria 2125
261 Ga0157372_10047147 3300013307 Bacteria 4787
262 Ga0157372_10501827 3300013307 Bacteria 1415
263 Ga0157372_10733692 3300013307 Bacteria 1149
264 Ga0163163_10101443 3300014325 Bacteria 2900
265 Ga0182008_10017849 3300014497 Bacteria 3676
266 Ga0157379_10002714 3300014968 Bacteria 14938
267 Ga0163161_10052759 3300017792 Bacteria 2947
268 Ga0163161_10186601 3300017792 Bacteria 1592
269 Ga0213875_10070533 3300021388 Bacteria 1631
270 Ga0213875_10135734 3300021388 Bacteria 1151
271 Ga0224712_10010846 3300022467 Bacteria 2801
272 Ga0207656_10006329 3300025321 Bacteria 4245
273 Ga0207653_10016065 3300025885 Bacteria 2350
274 Ga0207692_10000277 3300025898 Bacteria 17590
275 Ga0207692_10008894 3300025898 Bacteria 4173
276 Ga0207692_10009191 3300025898 Bacteria 4118
277 Ga0207692_10012523 3300025898 Bacteria 3646
278 Ga0207692_10054041 3300025898 Bacteria 2048
279 Ga0207692_10068078 3300025898 Bacteria 1866
280 Ga0207710_10018127 3300025900 Bacteria 2992
281 Ga0207688_10032483 3300025901 Bacteria 2884
282 Ga0207647_10025031 3300025904 Bacteria 3929
283 Ga0207699_10000261 3300025906 Bacteria 28952
284 Ga0207699_10000458 3300025906 Bacteria 20841
285 Ga0207699_10001066 3300025906 Bacteria 12960
286 Ga0207699_10008590 3300025906 Bacteria 5048
287 Ga0207699_10014254 3300025906 Bacteria 4092
288 Ga0207699_10058475 3300025906 Bacteria 2306
289 Ga0207645_10041514 3300025907 Bacteria 2944
290 Ga0207645_10047739 3300025907 Bacteria 2734
291 Ga0207643_10000102 3300025908 Bacteria 57710
292 Ga0207705_10004990 3300025909 Bacteria 9954
293 Ga0207705_10008596 3300025909 Bacteria 7443
294 Ga0207705_10011904 3300025909 Bacteria 6285
295 Ga0207705_10095745 3300025909 Bacteria 2179
296 Ga0207705_10112150 3300025909 Bacteria 2016
297 Ga0207684_10001230 3300025910 Bacteria 28445
298 Ga0207684_10001761 3300025910 Bacteria 22878
299 Ga0207684_10006481 3300025910 Bacteria 10673
300 Ga0207684_10011655 3300025910 Bacteria 7675
301 Ga0207684_10025133 3300025910 Bacteria 5076
302 Ga0207684_10030279 3300025910 Bacteria 4608
303 Ga0207684_10034910 3300025910 Bacteria 4271
304 Ga0207684_10046895 3300025910 Bacteria 3665
305 Ga0207684_10093466 3300025910 Bacteria 2564
306 Ga0207684_10292315 3300025910 Bacteria 1405
307 Ga0207707_10103022 3300025912 Bacteria 2495
308 Ga0207671_10023017 3300025914 Bacteria 4702
309 Ga0207671_10089523 3300025914 Bacteria 2316
310 Ga0207693_10003084 3300025915 Bacteria 14372
311 Ga0207693_10011453 3300025915 Bacteria 7176
312 Ga0207693_10030153 3300025915 Bacteria 4283
313 Ga0207663_10012382 3300025916 Bacteria 4611
314 Ga0207663_10048339 3300025916 Bacteria 2632
315 Ga0207663_10078370 3300025916 Bacteria 2154
316 Ga0207660_10000439 3300025917 Bacteria 27487
317 Ga0207660_10027222 3300025917 Bacteria 3898
318 Ga0207662_10039096 3300025918 Bacteria 2782
319 Ga0207657_10007215 3300025919 Bacteria 11413
320 Ga0207657_10051901 3300025919 Bacteria 3562
321 Ga0207657_10082552 3300025919 Bacteria 2697
322 Ga0207657_10092164 3300025919 Bacteria 2526
323 Ga0207649_10020755 3300025920 Bacteria 3771
324 Ga0207649_10039068 3300025920 Bacteria 2875
325 Ga0207652_10004366 3300025921 Bacteria 11522
326 Ga0207652_10034783 3300025921 Bacteria 4249
327 Ga0207652_10433206 3300025921 Bacteria 1186
328 Ga0207646_10000278 3300025922 Bacteria 70066
329 Ga0207646_10002243 3300025922 Bacteria 23027
330 Ga0207646_10003994 3300025922 Bacteria 16334
331 Ga0207646_10006877 3300025922 Bacteria 11683
332 Ga0207646_10014374 3300025922 Bacteria 7521
333 Ga0207646_10017448 3300025922 Bacteria 6716
334 Ga0207646_10030307 3300025922 Bacteria 4906
335 Ga0207646_10063984 3300025922 Bacteria 3283
336 Ga0207646_10085097 3300025922 Bacteria 2829
337 Ga0207646_10112132 3300025922 Bacteria 2448
338 Ga0207646_10236330 3300025922 Bacteria 1651
339 Ga0207694_10118167 3300025924 Bacteria 2115
340 Ga0207694_10209450 3300025924 Bacteria 1588
341 Ga0207650_10017555 3300025925 Bacteria 5012
342 Ga0207650_10152697 3300025925 Bacteria 1823
343 Ga0207659_10005909 3300025926 Bacteria 7472
344 Ga0207659_10022350 3300025926 Bacteria 4211
345 Ga0207659_10033050 3300025926 Bacteria 3556
346 Ga0207687_10003225 3300025927 Bacteria 11043
347 Ga0207687_10180829 3300025927 Bacteria 1634
348 Ga0207687_10234237 3300025927 Bacteria 1452
349 Ga0207700_10001366 3300025928 Bacteria 13833
350 Ga0207700_10005658 3300025928 Bacteria 7500
351 Ga0207700_10031442 3300025928 Bacteria 3771
352 Ga0207700_10033364 3300025928 Bacteria 3683
353 Ga0207700_10049461 3300025928 Bacteria 3127
354 Ga0207700_10059009 3300025928 Bacteria 2901
355 Ga0207700_10436518 3300025928 Bacteria 1152
356 Ga0207664_10000311 3300025929 Bacteria 36120
357 Ga0207664_10001412 3300025929 Bacteria 15806
358 Ga0207664_10010644 3300025929 Bacteria 6501
359 Ga0207664_10021242 3300025929 Bacteria 4823
360 Ga0207664_10034531 3300025929 Bacteria 3895
361 Ga0207664_10099819 3300025929 Bacteria 2396
362 Ga0207664_10132319 3300025929 Bacteria 2101
363 Ga0207664_10246873 3300025929 Bacteria 1556
364 Ga0207644_10008498 3300025931 Bacteria 6718
365 Ga0207690_10000575 3300025932 Bacteria 24004
366 Ga0207690_10008450 3300025932 Bacteria 6112
367 Ga0207690_10010483 3300025932 Bacteria 5510
368 Ga0207690_10012749 3300025932 Bacteria 5037
369 Ga0207690_10220403 3300025932 Bacteria 1451
370 Ga0207706_10005138 3300025933 Bacteria 12214
371 Ga0207706_10113444 3300025933 Bacteria 2384
372 Ga0207706_10115805 3300025933 Bacteria 2357
373 Ga0207709_10222945 3300025935 Bacteria 1361
374 Ga0207670_10088801 3300025936 Bacteria 2180
375 Ga0207669_10055884 3300025937 Bacteria 2394
376 Ga0207669_10171311 3300025937 Bacteria 1545
377 Ga0207669_10332441 3300025937 Bacteria 1167
378 Ga0207665_10000215 3300025939 Bacteria 38950
379 Ga0207665_10001013 3300025939 Bacteria 18947
380 Ga0207665_10006016 3300025939 Bacteria 8057
381 Ga0207665_10031498 3300025939 Bacteria 3509
382 Ga0207665_10052907 3300025939 Bacteria 2736
383 Ga0207665_10144864 3300025939 Bacteria 1697
384 Ga0207691_10073314 3300025940 Bacteria 3087
385 Ga0207691_10386837 3300025940 Bacteria 1194
386 Ga0207689_10001185 3300025942 Bacteria 25056
387 Ga0207689_10003272 3300025942 Bacteria 14852
388 Ga0207689_10017236 3300025942 Bacteria 6112
389 Ga0207679_10023587 3300025945 Bacteria 4209
390 Ga0207667_10078681 3300025949 Bacteria 3417
391 Ga0207667_10120689 3300025949 Bacteria 2701
392 Ga0207667_10246848 3300025949 Bacteria 1826
393 Ga0207667_10250328 3300025949 Bacteria 1812
394 Ga0207712_10024714 3300025961 Bacteria 3983
395 Ga0207668_10041699 3300025972 Bacteria 3104
396 Ga0207658_10082125 3300025986 Bacteria 2474
397 Ga0207677_10035307 3300026023 Bacteria 3246
398 Ga0207677_10359700 3300026023 Bacteria 1222
399 Ga0207703_10111725 3300026035 Bacteria 2333
400 Ga0207703_10490568 3300026035 Bacteria 1152
401 Ga0207639_10103119 3300026041 Bacteria 2310
402 Ga0207639_10271699 3300026041 Bacteria 1487
403 Ga0207639_10397059 3300026041 Bacteria 1242
404 Ga0207678_10000141 3300026067 Bacteria 59147
405 Ga0207678_10001012 3300026067 Bacteria 25636
406 Ga0207678_10004168 3300026067 Bacteria 12977
407 Ga0207708_10064175 3300026075 Bacteria 2805
408 Ga0207702_10000567 3300026078 Bacteria 41121
409 Ga0207702_10008130 3300026078 Bacteria 8876
410 Ga0207702_10019266 3300026078 Bacteria 5645
411 Ga0207702_10173858 3300026078 Bacteria 1977
412 Ga0207641_10008900 3300026088 Bacteria 8292
413 Ga0207641_10344090 3300026088 Bacteria 1420
414 Ga0207676_10000814 3300026095 Bacteria 24327
415 Ga0207676_10209841 3300026095 Bacteria 1727
416 Ga0207674_10011467 3300026116 Bacteria 9958
417 Ga0207674_10013397 3300026116 Bacteria 9102
418 Ga0207674_10379284 3300026116 Bacteria 1367
419 Ga0207675_100024703 3300026118 Bacteria 5588
420 Ga0207675_100050757 3300026118 Bacteria 3871
421 Ga0207675_100231589 3300026118 Bacteria 1783
422 Ga0207683_10002042 3300026121 Bacteria 17869
423 Ga0207683_10004876 3300026121 Bacteria 11544
424 Ga0207683_10461389 3300026121 Bacteria 1171
425 Ga0207698_10558700 3300026142 Bacteria 1123
426 Ga0207428_10025122 3300027907 Bacteria 4989
427 Ga0207428_10063708 3300027907 Bacteria 2912
428 Ga0268266_10001679 3300028379 Bacteria 25483
429 Ga0268266_10025102 3300028379 Bacteria 5073
430 Ga0268265_10055749 3300028380 Bacteria 3004
431 Ga0268264_10000697 3300028381 Bacteria 39075
432 Ga0268264_10174239 3300028381 Bacteria 1948
433 Ga0265336_10003994 3300028666 Bacteria 5645
434 Ga0265338_10000827 3300028800 Bacteria 52237
435 Ga0307512_10063373 3300030522 Bacteria 2826
436 Ga0316181_1092416 3300030744 Bacteria 2153
437 Ga0265340_10005442 3300031247 Bacteria 7072
438 Ga0265316_10081161 3300031344 Bacteria 2487
439 Ga0307509_10007679 3300031507 Bacteria 14014
440 Ga0307408_100272122 3300031548 Bacteria 1407
441 Ga0316579_10002232 3300031691 Bacteria 7298
442 Ga0265314_10102111 3300031711 Bacteria 1841
443 Ga0316576_10006220 3300031727 Bacteria 7405
444 Ga0307516_10080920 3300031730 Bacteria 3092
445 Ga0316577_10003582 3300031733 Bacteria 7867
446 Ga0307413_10052968 3300031824 Bacteria 2454
447 Ga0307406_10187612 3300031901 Bacteria 1511
448 Ga0307407_10013842 3300031903 Bacteria 3930
449 Ga0307409_100078999 3300031995 Bacteria 2649
450 Ga0307409_100466785 3300031995 Bacteria 1222
451 Ga0307409_100507075 3300031995 Bacteria 1176
452 Ga0307416_100044055 3300032002 Bacteria 3500
453 Ga0307416_100398650 3300032002 Bacteria 1413
454 Ga0307415_100098439 3300032126 Bacteria 2138
455 Ga0307415_100249021 3300032126 Bacteria 1442
456 Ga0316583_10005810 3300032133 Bacteria 4437
457 Ga0316585_10002697 3300032137 Bacteria 4816
458 Ga0316593_10038422 3300032168 Bacteria 1585
459 Ga0316596_1019194 3300033541 Bacteria 1733
460 Ga0373959_0001379 3300034820 Bacteria 3887
461 Ga0373926_0000767 3300035083 Bacteria 8992
462 Ga0373926_0002281 3300035083 Bacteria 6058
463 Ga0373934_0000006 3300035086 Bacteria 81073
464 Ga0373934_0004342 3300035086 Bacteria 5236
465 Ga0373940_0011732 3300035088 Bacteria 2087
466 Ga0373923_0000602 3300035111 Bacteria 8952
467 Ga0373923_0026721 3300035111 Bacteria 2298
468 Ga0373936_0000341 3300035113 Bacteria 15795
469 Ga0373936_0000792 3300035113 Bacteria 11180
470 Ga0373936_0013649 3300035113 Bacteria 3100
471 Ga0373939_0045621 3300035114 Bacteria 1338
472 Ga0373939_0056658 3300035114 Bacteria 1234
473 Ga0373945_0000439 3300035116 Bacteria 11743
474 Ga0373945_0011554 3300035116 Bacteria 2921
475 Ga0373945_0103708 3300035116 Bacteria 1116
476 Ga0373945_0107300 3300035116 Bacteria 1098
477 Ga0373953_0001325 3300035117 Bacteria 7101
478 Ga0373953_0056521 3300035117 Bacteria 1595
479 Ga0373954_0001834 3300035118 Bacteria 8763
480 Ga0373954_0015932 3300035118 Bacteria 3363
481 Ga0373954_0055882 3300035118 Bacteria 1857
482 Ga0373954_0083001 3300035118 Bacteria 1533
483 Ga0373956_0000498 3300035119 Bacteria 16085
484 Ga0373956_0018288 3300035119 Bacteria 2966
485 Ga0373956_0021856 3300035119 Bacteria 2731
486 Ga0373956_0052667 3300035119 Bacteria 1831
487 Ga0373956_0061188 3300035119 Bacteria 1705
488 Ga0373957_0000878 3300035120 Bacteria 7880
489 Ga0373957_0017010 3300035120 Bacteria 2526
490 Ga0373957_0026004 3300035120 Bacteria 2113
491 Ga0373960_0010514 3300035121 Bacteria 2262
492 Ga0373943_0000222 3300035170 Bacteria 23119
493 Ga0373943_0000620 3300035170 Bacteria 15400
494 Ga0373943_0148186 3300035170 Bacteria 1269
495 Ga0373946_0000211 3300035171 Bacteria 18097
496 Ga0373946_0001783 3300035171 Bacteria 7508
497 Ga0373946_0113191 3300035171 Bacteria 1230
498 Ga0373955_0000034 3300035172 Bacteria 53524
499 Ga0373955_0006038 3300035172 Bacteria 5495
500 Ga0373955_0050207 3300035172 Bacteria 2267
501 Ga0373955_0093454 3300035172 Bacteria 1717
502 Ga0373961_0010664 3300035241 Bacteria 2267
503 Ga0373962_0010648 3300035242 Bacteria 2297
504 Ga0316574_0034991 3300035398 Bacteria 3066
505 Ga0373924_0000343 3300035410 Bacteria 14274
506 Ga0373924_0001065 3300035410 Bacteria 8749
507 Ga0373924_0011134 3300035410 Bacteria 3333
508 Ga0373931_0017595 3300035691 Bacteria 3539
509 Ga0373935_0035088 3300035692 Bacteria 3129
510 Ga0373927_0011206 3300035695 Bacteria 5971
511 Ga0373927_0073976 3300035695 Bacteria 2206
512 Ga0373927_0107451 3300035695 Bacteria 1817
513 Ga0373933_0000161 3300035724 Bacteria 43422
514 Ga0373933_0013141 3300035724 Bacteria 4585
515 Ga0373933_0135572 3300035724 Bacteria 1551
516 Ga0373947_0002674 3300035725 Bacteria 10709
517 Ga0373947_0015037 3300035725 Bacteria 4443
518 Ga0373947_0112790 3300035725 Bacteria 1720
519 Ga0373947_0146243 3300035725 Bacteria 1519
520 Ga0373947_0241559 3300035725 Bacteria 1192
521 Ga0373947_0313063 3300035725 Bacteria 1048
522 Ga0373937_0000126 3300036401 Bacteria 73508
523 Ga0373937_0013317 3300036401 Bacteria 7246
524 Ga0373937_0032272 3300036401 Bacteria 4749
525 Ga0373937_0051034 3300036401 Bacteria 3791
526 Ga0373937_0096539 3300036401 Bacteria 2741
527 Ga0373937_0198533 3300036401 Bacteria 1885
528 Ga0316584_0253986 3300036712 Bacteria 1283
529 Ga0373925_0001213 3300037068 Bacteria 22751
530 Ga0373925_0001242 3300037068 Bacteria 22486
531 Ga0373925_0004745 3300037068 Bacteria 10247
532 Ga0373925_0034034 3300037068 Bacteria 3755
533 Ga0373925_0274614 3300037068 Bacteria 1356
534 Ga0395900_0089872 3300037418 Bacteria 3157
535 Ga0395898_0036630 3300037466 Bacteria 4871
536 Ga0316581_0003414 3300037588 Bacteria 3954
537 Ga0436364_0007757 3300037853 Bacteria 7628
538 Ga0436364_0016285 3300037853 Bacteria 2181
539 Ga0436364_0568803 3300037853 Bacteria 42562
540 Ga0436364_0671111 3300037853 Bacteria 4101
541 Ga0436364_0737335 3300037853 Bacteria 8724
542 Ga0395901_0163097 3300038443 Bacteria 2340
543 Ga0436363_0039138 3300039450 Bacteria 1271
544 Ga0436363_0120235 3300039450 Bacteria 1674
545 Ga0436363_0261863 3300039450 Bacteria 1034
546 Ga0439465_0013225 3300041413 Bacteria 2577
547 Ga0439431_0003805 3300041997 Bacteria 3334
548 Ga0439445_0035838 3300042004 Bacteria 1304
549 Ga0439432_024281 3300042006 Bacteria 1993
550 Ga0466969_0014966 3300044656 Bacteria 4070
551 Ga0466969_0107917 3300044656 Bacteria 1305
552 Ga0466972_0013115 3300044658 Bacteria 4164
553 Ga0466965_0082617 3300044683 Bacteria 1625
554 Ga0466966_0006104 3300044684 Bacteria 7959
555 Ga0466966_0076714 3300044684 Bacteria 2086
556 Ga0466961_0005917 3300044693 Bacteria 7752
557 Ga0466961_0008796 3300044693 Bacteria 6442
558 Ga0466961_0038720 3300044693 Bacteria 3059
559 Ga0466961_0191239 3300044693 Bacteria 1268
560 Ga0466963_0005697 3300044694 Bacteria 7320
561 Ga0466963_0017249 3300044694 Bacteria 4499
562 Ga0466963_0405830 3300044694 Bacteria 961
563 Ga0466964_0014836 3300044706 Bacteria 2965
564 Ga0466964_0019836 3300044706 Bacteria 2587
565 Ga0466971_0004589 3300044719 Bacteria 5968
566 Ga0466971_0070646 3300044719 Bacteria 1585
567 Ga0466970_0046551 3300044765 Bacteria 2310
568 Ga0466957_0002757 3300044842 Bacteria 9511
569 Ga0466957_0051732 3300044842 Bacteria 2500
570 Ga0466957_0065992 3300044842 Bacteria 2230
571 Ga0466957_0131404 3300044842 Bacteria 1604
572 Ga0466957_0339721 3300044842 Bacteria 1017
573 Ga0466960_0027362 3300044901 Bacteria 2600
574 Ga0466960_0171305 3300044901 Bacteria 1172
575 Ga0466960_0184228 3300044901 Bacteria 1133
576 Ga0466959_0000786 3300045049 Bacteria 18627
577 Ga0466959_0006200 3300045049 Bacteria 8262
578 Ga0466959_0011536 3300045049 Bacteria 6352
579 Ga0466959_0050084 3300045049 Bacteria 3068
580 Ga0451576_0523890 3300045051 Bacteria 1245
581 Ga0466958_0005392 3300045836 Bacteria 6875
582 Ga0466958_0022947 3300045836 Bacteria 3659
583 Ga0466967_0001099 3300045976 Bacteria 14974
584 Ga0466967_0008839 3300045976 Bacteria 7426
585 Ga0466967_0009511 3300045976 Bacteria 7217
586 Ga0466967_0022152 3300045976 Bacteria 5177
587 Ga0466967_0022697 3300045976 Bacteria 5127
588 Ga0466967_0052581 3300045976 Bacteria 3576
589 Ga0466967_0055695 3300045976 Bacteria 3484
590 Ga0466967_0060217 3300045976 Bacteria 3363
591 Ga0466967_0060277 3300045976 Bacteria 3362
592 Ga0466967_0119472 3300045976 Bacteria 2433
593 Ga0466967_0185339 3300045976 Bacteria 1965
594 Ga0466967_0462792 3300045976 Bacteria 1241
595 Ga0466967_0475036 3300045976 Bacteria 1224
596 Ga0495592_0000030 3300046454 Bacteria 129103
597 Ga0495592_0064734 3300046454 Bacteria 2678
598 Ga0495592_0183322 3300046454 Bacteria 1424
599 Ga0495592_0283679 3300046454 Bacteria 1082
600 Ga0495603_0001439 3300046455 Bacteria 13837
601 Ga0495603_0008628 3300046455 Bacteria 6159
602 Ga0495629_0015013 3300046459 Bacteria 5566
603 Ga0495641_0027587 3300046461 Bacteria 2759
604 Ga0495641_0164382 3300046461 Bacteria 993
605 Ga0495651_0000221 3300046462 Bacteria 43412
606 Ga0495651_0130027 3300046462 Bacteria 1839
607 Ga0495653_0000895 3300046463 Bacteria 23073
608 Ga0495653_0070199 3300046463 Bacteria 2622
609 Ga0495653_0070298 3300046463 Bacteria 2620
610 Ga0495653_0121150 3300046463 Bacteria 1864
611 Ga0495653_0192005 3300046463 Bacteria 1392
612 Ga0495653_0214135 3300046463 Bacteria 1299
613 Ga0495653_0263493 3300046463 Bacteria 1138
614 Ga0495580_0076865 3300046472 Bacteria 2328
615 Ga0495582_0001232 3300046473 Bacteria 14421
616 Ga0495582_0004428 3300046473 Bacteria 7899
617 Ga0495582_0033988 3300046473 Bacteria 2803
618 Ga0495582_0079635 3300046473 Bacteria 1819
619 Ga0495639_0178368 3300046475 Bacteria 1033
620 Ga0495662_0023146 3300046476 Bacteria 3000
621 Ga0495664_0003692 3300046477 Bacteria 8344
622 Ga0495664_0021701 3300046477 Bacteria 3710
623 Ga0495664_0069459 3300046477 Bacteria 2103
624 Ga0495594_0021752 3300046499 Bacteria 3425
625 Ga0495608_0000191 3300046511 Bacteria 43426
626 Ga0495608_0014956 3300046511 Bacteria 5385
627 Ga0495608_0027786 3300046511 Bacteria 3847
628 Ga0495608_0038704 3300046511 Bacteria 3201
629 Ga0495618_0027405 3300046514 Bacteria 3546
630 Ga0495618_0044993 3300046514 Bacteria 2784
631 Ga0495618_0081741 3300046514 Bacteria 2063
632 Ga0495628_0003830 3300046516 Bacteria 13409
633 Ga0495628_0028621 3300046516 Bacteria 4524
634 Ga0495628_0037076 3300046516 Bacteria 3909
635 Ga0495630_0012349 3300046517 Bacteria 6199
636 Ga0495630_0058749 3300046517 Bacteria 2883
637 Ga0495630_0326228 3300046517 Bacteria 1174
638 Ga0495666_0026971 3300046526 Bacteria 2828
639 Ga0495652_0000921 3300046529 Bacteria 33833
640 Ga0495652_0002640 3300046529 Bacteria 18286
641 Ga0495652_0045493 3300046529 Bacteria 3772
642 Ga0495652_0065676 3300046529 Bacteria 3047
643 Ga0495652_0072617 3300046529 Bacteria 2867
644 Ga0495652_0117785 3300046529 Bacteria 2124
645 Ga0495665_0002334 3300046531 Bacteria 10254
646 Ga0495665_0006345 3300046531 Bacteria 6380
647 Ga0495665_0031595 3300046531 Bacteria 2833
648 Ga0495640_0004093 3300046533 Bacteria 11669
649 Ga0495640_0011149 3300046533 Bacteria 6921
650 Ga0495640_0028834 3300046533 Bacteria 3992
651 Ga0495640_0039340 3300046533 Bacteria 3319
652 Ga0495640_0077148 3300046533 Bacteria 2222
653 Ga0495640_0148290 3300046533 Bacteria 1508
654 Ga0495586_0022515 3300046535 Bacteria 3363
655 Ga0495587_0000210 3300046536 Bacteria 43426
656 Ga0495587_0006716 3300046536 Bacteria 7493
657 Ga0495587_0076147 3300046536 Bacteria 1948
658 Ga0495587_0212384 3300046536 Bacteria 1092
659 Ga0495645_0029854 3300046543 Bacteria 3969
660 Ga0495645_0076714 3300046543 Bacteria 2404
661 Ga0495645_0149563 3300046543 Bacteria 1623
662 Ga0495667_0000040 3300046559 Bacteria 129118
663 Ga0495667_0013375 3300046559 Bacteria 5554
664 Ga0495667_0023765 3300046559 Bacteria 4128
665 Ga0495667_0024113 3300046559 Bacteria 4097
666 Ga0495667_0077349 3300046559 Bacteria 2164
667 Ga0495668_0000477 3300046616 Bacteria 50176
668 Ga0495634_0002549 3300046642 Bacteria 15066
669 Ga0495634_0117901 3300046642 Bacteria 1702
670 Ga0495634_0134824 3300046642 Bacteria 1571
671 Ga0495625_0000969 3300046660 Bacteria 38144
672 Ga0495635_0000373 3300046663 Bacteria 28369
673 Ga0495635_0020270 3300046663 Bacteria 4632
674 Ga0495657_0000029 3300046675 Bacteria 129126
675 Ga0495657_0015497 3300046675 Bacteria 5576
676 Ga0495657_0021602 3300046675 Bacteria 4617
677 Ga0495657_0073654 3300046675 Bacteria 2223
678 Ga0495657_0139273 3300046675 Bacteria 1513
679 Ga0495599_0000238 3300046678 Bacteria 34651
680 Ga0495599_0055554 3300046678 Bacteria 2479
681 Ga0495599_0273062 3300046678 Bacteria 1025
682 Ga0495623_0000652 3300046679 Bacteria 23015
683 Ga0495623_0007901 3300046679 Bacteria 6917
684 Ga0495623_0015753 3300046679 Bacteria 4886
685 Ga0495623_0025198 3300046679 Bacteria 3831
686 Ga0495623_0057266 3300046679 Bacteria 2452
687 Ga0495646_0011399 3300046680 Bacteria 5645
688 Ga0495646_0053325 3300046680 Bacteria 2438
689 Ga0495646_0063798 3300046680 Bacteria 2186
690 Ga0495647_0021182 3300046681 Bacteria 2339
691 Ga0495658_0016530 3300046683 Bacteria 3797
692 Ga0495658_0207408 3300046683 Bacteria 1223
693 Ga0495669_0031349 3300046684 Bacteria 2335
694 Ga0495613_0000459 3300046689 Bacteria 34915
695 Ga0495613_0023536 3300046689 Bacteria 4589
696 Ga0495613_0027878 3300046689 Bacteria 4204
697 Ga0495624_0001477 3300046690 Bacteria 18250
698 Ga0495600_0004117 3300046809 Bacteria 8653
699 Ga0495600_0009623 3300046809 Bacteria 5975
700 Ga0495600_0031175 3300046809 Bacteria 3453
701 Ga0495600_0098321 3300046809 Bacteria 1908
702 Ga0495600_0168879 3300046809 Bacteria 1412
703 Ga0495581_0025729 3300047315 Bacteria 3413
704 Ga0495581_0036856 3300047315 Bacteria 2829
705 Ga0495581_0045917 3300047315 Bacteria 2524
706 Ga0495581_0057462 3300047315 Bacteria 2245
707 Ga0495604_0000034 3300047317 Bacteria 129099
708 Ga0495604_0014642 3300047317 Bacteria 6252
709 Ga0495604_0017920 3300047317 Bacteria 5665
710 Ga0495604_0038984 3300047317 Bacteria 3736
711 Ga0495604_0039115 3300047317 Bacteria 3728
712 Ga0495604_0120531 3300047317 Bacteria 1900
713 Ga0495674_0001403 3300047319 Bacteria 23570
714 Ga0495674_0025013 3300047319 Bacteria 5479
715 Ga0495674_0034492 3300047319 Bacteria 4576
716 Ga0495674_0040925 3300047319 Bacteria 4142
717 Ga0495674_0062227 3300047319 Bacteria 3250
718 Ga0495674_0076231 3300047319 Bacteria 2884
719 Ga0495674_0099382 3300047319 Bacteria 2477
720 Ga0495676_0009541 3300047321 Bacteria 8836
721 Ga0495676_0021763 3300047321 Bacteria 5591
722 Ga0495680_0000522 3300047322 Bacteria 43426
723 Ga0495680_0003936 3300047322 Bacteria 14361
724 Ga0495680_0007711 3300047322 Bacteria 9828
725 Ga0495680_0086007 3300047322 Bacteria 2366
726 Ga0495675_0000613 3300047444 Bacteria 22975
727 Ga0495675_0007809 3300047444 Bacteria 6603
728 Ga0495675_0016573 3300047444 Bacteria 4662
729 Ga0495675_0020863 3300047444 Bacteria 4170
730 Ga0495675_0034408 3300047444 Bacteria 3235
731 Ga0495675_0040915 3300047444 Bacteria 2954
732 Ga0495684_0005175 3300047471 Bacteria 10165
733 Ga0495684_0009248 3300047471 Bacteria 7610
734 Ga0495684_0027794 3300047471 Bacteria 4344
735 Ga0495684_0028463 3300047471 Bacteria 4289
736 Ga0495684_0039046 3300047471 Bacteria 3639
737 Ga0495684_0061338 3300047471 Bacteria 2860
738 Ga0495684_0168379 3300047471 Bacteria 1631
739 Ga0495684_0271147 3300047471 Bacteria 1228
740 Ga0495593_0003766 3300047673 Bacteria 9059
741 Ga0495602_0001101 3300048088 Bacteria 26520
742 Ga0495602_0021704 3300048088 Bacteria 6309
743 Ga0495602_0035342 3300048088 Bacteria 4660
744 Ga0495602_0070136 3300048088 Bacteria 3001
745 Ga0495602_0074482 3300048088 Bacteria 2885
746 Ga0495602_0131380 3300048088 Bacteria 1996
747 Ga0495602_0181918 3300048088 Bacteria 1620
748 Ga0495614_0082639 3300048089 Bacteria 1392
749 Ga0495626_0000234 3300048091 Bacteria 65050
750 Ga0496100_0007843 3300048903 Bacteria 5925
751 Ga0496100_0134770 3300048903 Bacteria 1743
752 Ga0496100_0276155 3300048903 Bacteria 1251
753 Ga0496101_0071517 3300048904 Bacteria 2543
754 Ga0496101_0106525 3300048904 Bacteria 2105
755 Ga0496101_0180368 3300048904 Bacteria 1626
756 Ga0496101_0194058 3300048904 Bacteria 1568
757 Ga0496102_0000287 3300048905 Bacteria 64356
758 Ga0496102_0055310 3300048905 Bacteria 3619
759 Ga0496102_0059022 3300048905 Bacteria 3507
760 Ga0496102_0160102 3300048905 Bacteria 2117
761 Ga0496102_0216761 3300048905 Bacteria 1804
762 Ga0496102_0228058 3300048905 Bacteria 1756
763 Ga0496103_0000192 3300048906 Bacteria 60768
764 Ga0496103_0035769 3300048906 Bacteria 3040
765 Ga0496104_0000398 3300048907 Bacteria 38090
766 Ga0496104_0039051 3300048907 Bacteria 4443
767 Ga0496104_0086163 3300048907 Bacteria 2999
768 Ga0496104_0189020 3300048907 Bacteria 1970
769 Ga0496104_0297069 3300048907 Bacteria 1527
770 Ga0496105_0000812 3300048908 Bacteria 21146
771 Ga0496105_0002315 3300048908 Bacteria 13811
772 Ga0496105_0051856 3300048908 Bacteria 3388
773 Ga0496105_0055672 3300048908 Bacteria 3265
774 Ga0496105_0086402 3300048908 Bacteria 2592
775 Ga0496106_0020477 3300048909 Bacteria 4909
776 Ga0496106_0048856 3300048909 Bacteria 3187
777 Ga0496107_0022461 3300048910 Bacteria 4459
778 Ga0496107_0025540 3300048910 Bacteria 4183
779 Ga0496108_0000149 3300048911 Bacteria 67412
780 Ga0496108_0003584 3300048911 Bacteria 12438
781 Ga0496108_0016367 3300048911 Bacteria 6047
782 Ga0496108_0055394 3300048911 Bacteria 3329
783 Ga0496108_0096311 3300048911 Bacteria 2520
784 Ga0496109_0053506 3300048912 Bacteria 3681
785 Ga0496109_0193967 3300048912 Bacteria 1909
786 Ga0496110_0126346 3300048913 Bacteria 2307
787 Ga0496110_0306621 3300048913 Bacteria 1446
788 Ga0496111_0034773 3300048914 Bacteria 3599
789 Ga0496111_0126997 3300048914 Bacteria 1885
790 Ga0496112_0000555 3300048915 Bacteria 25563
791 Ga0496112_0021103 3300048915 Bacteria 6188
792 Ga0496112_0102259 3300048915 Bacteria 2835
793 Ga0496112_0234943 3300048915 Bacteria 1787
794 Ga0496113_0068910 3300048916 Bacteria 2685
795 Ga0496114_0008673 3300048917 Bacteria 8056
796 Ga0496114_0038878 3300048917 Bacteria 3937
797 Ga0496114_0040956 3300048917 Bacteria 3838
798 Ga0496115_0022579 3300048918 Bacteria 4877
799 Ga0496115_0043647 3300048918 Bacteria 3576
800 Ga0496115_0074109 3300048918 Bacteria 2764
801 Ga0496118_0060297 3300048921 Bacteria 2818
802 Ga0496118_0140963 3300048921 Bacteria 1528
803 Ga0496119_0001269 3300048922 Bacteria 31365
804 Ga0496119_0009683 3300048922 Bacteria 8210
805 Ga0496120_0015501 3300048923 Bacteria 5022
806 Ga0496124_0093858 3300048927 Bacteria 2442
807 Ga0496126_0000588 3300048929 Bacteria 68756
808 Ga0501031_0005137 3300049568 Bacteria 8525
809 Ga0501031_0008163 3300049568 Bacteria 6814
810 Ga0501032_0027113 3300049569 Bacteria 3939
811 Ga0501032_0042338 3300049569 Bacteria 3089
812 Ga0501034_0223514 3300049571 Bacteria 1835
813 Ga0501037_0017841 3300049573 Bacteria 5225
814 Ga0501038_0139134 3300049574 Bacteria 1987
815 Ga0501038_0157997 3300049574 Bacteria 1844
816 Ga0501039_0049633 3300049575 Bacteria 3244
817 Ga0501039_0062539 3300049575 Bacteria 2884
818 Ga0501039_0096052 3300049575 Bacteria 2311
819 Ga0501039_0101363 3300049575 Bacteria 2247
820 Ga0501041_0008683 3300049577 Bacteria 5985
821 Ga0501041_0015605 3300049577 Bacteria 4511
822 Ga0501042_0001539 3300049578 Bacteria 13664
823 Ga0501042_0022820 3300049578 Bacteria 4373
824 Ga0501046_0047691 3300049580 Bacteria 3396
825 Ga0501046_0085945 3300049580 Bacteria 2425
826 Ga0501047_0179621 3300049581 Bacteria 1983
827 Ga0501048_0008158 3300049582 Bacteria 7922
828 Ga0501048_0029392 3300049582 Bacteria 3986
829 Ga0501048_0060518 3300049582 Bacteria 2684
830 Ga0501068_0008501 3300049584 Bacteria 5717
831 Ga0501069_0062877 3300049585 Bacteria 2073
832 Ga0501069_0136050 3300049585 Bacteria 1408
833 Ga0501070_0022083 3300049586 Bacteria 5330
834 Ga0501070_0032113 3300049586 Bacteria 4395
835 Ga0501070_0133940 3300049586 Bacteria 2046
836 Ga0501070_0153231 3300049586 Bacteria 1901
837 Ga0501070_0154307 3300049586 Bacteria 1894
838 Ga0501070_0206798 3300049586 Bacteria 1612
839 Ga0501070_0239869 3300049586 Bacteria 1484
840 Ga0501070_0259357 3300049586 Bacteria 1421
841 Ga0501071_0000355 3300049587 Bacteria 22415
842 Ga0501071_0071847 3300049587 Bacteria 2523
843 Ga0501072_0004287 3300049588 Bacteria 10824
844 Ga0501072_0154626 3300049588 Bacteria 1829
845 Ga0501073_0145209 3300049589 Bacteria 1644
846 Ga0501074_0011695 3300049590 Bacteria 6379
847 Ga0501075_0005534 3300049591 Bacteria 8643
848 Ga0501075_0053165 3300049591 Bacteria 3046
849 Ga0501075_0085053 3300049591 Bacteria 2396
850 Ga0501076_0000758 3300049592 Bacteria 20827
851 Ga0501076_0293871 3300049592 Bacteria 1331
852 Ga0501077_0066828 3300049593 Bacteria 2280
853 Ga0501079_0012673 3300049741 Bacteria 6440
854 Ga0501079_0258831 3300049741 Bacteria 1360
855 Ga0501080_0038584 3300049742 Bacteria 4459
856 Ga0501081_0024995 3300049743 Bacteria 4015
857 Ga0501035_0044305 3300049822 Bacteria 4007
858 Ga0501035_0316848 3300049822 Bacteria 1311
859 Ga0501045_0010113 3300049824 Bacteria 6601
860 Ga0501045_0251447 3300049824 Bacteria 1316
861 nmdc:mga00v17_60413_c1 3300050491 Bacteria 2327
862 nmdc:mga0yw44_61235_c1 3300050492 Bacteria 2308
863 nmdc:mga06z11_95680_c1 3300050494 Bacteria 1621
864 nmdc:mga07m45_3230_c1 3300050496 Bacteria 7826
865 nmdc:mga09592_148791_c1 3300050508 Bacteria 2019
866 nmdc:mga08y16_17213_c1 3300050511 Bacteria 7608
867 nmdc:mga08y16_23121_c1 3300050511 Bacteria 6563
868 nmdc:mga08y16_35177_c1 3300050511 Bacteria 5261
869 nmdc:mga0n895_139714_c1 3300050512 Bacteria 2450
870 nmdc:mga0n895_9940_c1 3300050512 Bacteria 8370
871 nmdc:mga0rr50_182838_c1 3300050513 Bacteria 1715
872 nmdc:mga08x19_29999_c1 3300050514 Bacteria 3414
873 nmdc:mga0a205_44361_c1 3300050515 Bacteria 4286
874 Ga0495601_0052162 3300053077 Bacteria 2582
875 Ga0495601_0059728 3300053077 Bacteria 2418
876 Ga0495601_0135320 3300053077 Bacteria 1606
877 Ga0495612_0002376 3300053078 Bacteria 7758
878 Ga0495612_0034752 3300053078 Bacteria 2042
879 Ga0495595_0156649 3300053084 Bacteria 1122
880 Ga0495619_0001126 3300053085 Bacteria 17567
881 Ga0495619_0003694 3300053085 Bacteria 9865
882 Ga0495619_0071465 3300053085 Bacteria 2322
883 Ga0495619_0081515 3300053085 Bacteria 2179
884 Ga0495619_0158190 3300053085 Bacteria 1564
885 Ga0500643_000352 3300053087 Bacteria 36502
886 Ga0500641_0044978 3300053096 Bacteria 1797
887 Ga0500593_007573 3300053117 Bacteria 4427
888 Ga0501084_0026752 3300054114 Bacteria 4817
889 Ga0501084_0085343 3300054114 Bacteria 2650
890 Ga0466962_0003529 3300061719 Bacteria 7455
891 Ga0466962_0004333 3300061719 Bacteria 6804
892 Ga0466962_0013135 3300061719 Bacteria 3985
893 Ga0466962_0061822 3300061719 Bacteria 1787
894 Ga0466962_0096793 3300061719 Bacteria 1415
895 Ga0530510_0030849 3300061734 Bacteria 3852
896 2515718891 2515154129 Bacteria 5584369
897 2516083103 2515154202 Bacteria 5471270
898 2583151149 2582580736 Bacteria 5325865
899 2644230357 2643221641 Bacteria 4490190
900 2676487927 2675903060 Bacteria 10051191
901 2768645836 2767802112 Bacteria 6465194
902 2855391110 2855386786 Bacteria 4752232
903 2856742829 2856741275 Bacteria 8096094
904 2866556820 2866552031 Bacteria 5824618
905 2873320830 2873314349 Bacteria 8512634
906 2884697544 2884693830 Bacteria 11273186
907 2887486832 2887478801 Bacteria 8972725
908 2891403116 2891395885 Bacteria 9251614
909 2891554565 2891554331 Bacteria 8812224
910 2891564657 2891562705 Bacteria 8039471
911 2895438104 2895427314 Bacteria 13147766
912 2895447661 2895442618 Bacteria 11027144
913 2899372922 2899370129 Bacteria 6781179
914 2984579970 2984576629 Bacteria 4248407
915 2990260751 2990256926 Bacteria 4252839
916 3001891596 3001889506 Bacteria 2975194
917 3003001845 3002998708 Bacteria 11715108
918 8001786840 8001781756 Bacteria 9586736
919 8008486599 8008485437 Bacteria 7198341
920 8025525668 8025524527 Bacteria 7197316
921 8055179772 8055172936 Bacteria 9305943
922 8056065091 8056060235 Bacteria 7259403
923 8057568555 8057568493 Bacteria 7221719
924 Ga0157369_10004575
925 JGI25406J46586_10012586
926 JGI25406J46586_10030735
927 JGI25406J46586_10040571
928 JGI25404J52841_10012198
929 Ga0070658_10003299
930 Ga0070658_10004108
931 Ga0070658_10034494
932 Ga0070658_10039254
933 Ga0070658_10269779
934 Ga0070683_100013327
935 Ga0070683_100313617
936 Ga0070683_100539160
937 Ga0070670_100030363
938 Ga0070670_100134151
939 Ga0068869_100009523
940 Ga0070680_100000593
941 Ga0070680_100102749
942 Ga0070682_100017404
943 Ga0070682_100133291
944 Ga0070682_100337873
945 Ga0068868_100039320
946 Ga0068868_100043967
947 Ga0068868_100214097
948 Ga0070660_100042286
949 Ga0070660_100079237
950 Ga0070660_100204072
951 Ga0070660_100267755
952 Ga0070689_100095783
953 Ga0070691_10008216
954 Ga0070687_100067389
955 Ga0070661_100014991
956 Ga0070661_100127559
957 Ga0070692_10004963
958 Ga0070692_10017484
959 Ga0070692_10041894
960 Ga0070669_100096606
961 Ga0070675_100009094
962 Ga0070675_100011908
963 Ga0070675_100097439
964 Ga0070671_100002713
965 Ga0070674_100159943
966 Ga0070673_100059250
967 Ga0070673_100220685
968 Ga0070659_100000619
969 Ga0070659_100013213
970 Ga0070659_100043276
971 Ga0070659_100047992
972 Ga0070659_100314281
973 Ga0070667_100042929
974 Ga0070667_100125971
975 Ga0070709_10000601
976 Ga0070709_10000823
977 Ga0070709_10022304
978 Ga0070709_10080130
979 Ga0070709_10092702
980 Ga0070714_100003489
981 Ga0070714_100006469
982 Ga0070714_100007188
983 Ga0070714_100011424
984 Ga0070714_100015841
985 Ga0070714_100020459
986 Ga0070714_100026755
987 Ga0070714_100230000
988 Ga0070714_100398904
989 Ga0070713_100006897
990 Ga0070713_100007037
991 Ga0070713_100010692
992 Ga0070713_100157112
993 Ga0070713_100228835
994 Ga0070713_100229650
995 Ga0070713_100264599
996 Ga0070713_100361707
997 Ga0070710_10000704
998 Ga0070710_10000868
999 Ga0070710_10079055
1000 Ga0070710_10088687
1001 Ga0070710_10127642
1002 Ga0070711_100000369
1003 Ga0070711_100044661
1004 Ga0070711_100063587
1005 Ga0070700_100102919
1006 Ga0070694_100332996
1007 Ga0070708_100005821
1008 Ga0070708_100008154
1009 Ga0070708_100013187
1010 Ga0070708_100063538
1011 Ga0070708_100308674
1012 Ga0070708_100322184
1013 Ga0070663_100003535
1014 Ga0070663_100083348
1015 Ga0070678_100012017
1016 Ga0070678_100093441
1017 Ga0070678_100094047
1018 Ga0070662_100004777
1019 Ga0070662_100008194
1020 Ga0070681_10000504
1021 Ga0070681_10121291
1022 Ga0070681_10164278
1023 Ga0070681_10238052
1024 Ga0070706_100002492
1025 Ga0070706_100002558
1026 Ga0070706_100010627
1027 Ga0070706_100011680
1028 Ga0070706_100266893
1029 Ga0070707_100000199
1030 Ga0070707_100001248
1031 Ga0070707_100002510
1032 Ga0070707_100005322
1033 Ga0070707_100014634
1034 Ga0070707_100022729
1035 Ga0070707_100036751
1036 Ga0070707_100043283
1037 Ga0070707_100095229
1038 Ga0070707_100193532
1039 Ga0070707_100360997
1040 Ga0070707_100422977
1041 Ga0070698_100000223
1042 Ga0070698_100000264
1043 Ga0070698_100004936
1044 Ga0070698_100006575
1045 Ga0070698_100009166
1046 Ga0070698_100009346
1047 Ga0070698_100010677
1048 Ga0070698_100012045
1049 Ga0070698_100023491
1050 Ga0070698_100092840
1051 Ga0070698_100102135
1052 Ga0070698_100192365
1053 Ga0070699_100002999
1054 Ga0070679_100000687
1055 Ga0070679_100010892
1056 Ga0070679_100175965
1057 Ga0070679_100377721
1058 Ga0070679_100427095
1059 Ga0070684_100011120
1060 Ga0070684_100022936
1061 Ga0070684_100043616
1062 Ga0070684_100202129
1063 Ga0070697_100008868
1064 Ga0070697_100022138
1065 Ga0070697_100068293
1066 Ga0068853_100330452
1067 Ga0068853_100462529
1068 Ga0070672_100348122
1069 Ga0070686_100004188
1070 Ga0070686_100075456
1071 Ga0070696_100245626
1072 Ga0070693_100018462
1073 Ga0070693_100047880
1074 Ga0070665_100000703
1075 Ga0070665_100046395
1076 Ga0070665_100110970
1077 Ga0070704_100129273
1078 Ga0068855_100004375
1079 Ga0068855_100131380
1080 Ga0068855_100224872
1081 Ga0068855_100489469
1082 Ga0070664_100010112
1083 Ga0070664_100017926
1084 Ga0070664_100378875
1085 Ga0068857_100008891
1086 Ga0068857_100028443
1087 Ga0068857_100183040
1088 Ga0068857_100447223
1089 Ga0068854_100028810
1090 Ga0068854_100352128
1091 Ga0068856_100020564
1092 Ga0068856_100026030
1093 Ga0068856_100026955
1094 Ga0068856_100038800
1095 Ga0070702_100014503
1096 Ga0070702_100019326
1097 Ga0068852_100049930
1098 Ga0068852_100058858
1099 Ga0068852_100168032
1100 Ga0068859_100003310
1101 Ga0068859_100035566
1102 Ga0068864_100075629
1103 Ga0068851_10044295
1104 Ga0068851_10069154
1105 Ga0068870_10000071
1106 Ga0068863_100031033
1107 Ga0068863_100099316
1108 Ga0068858_100003961
1109 Ga0068858_100280556
1110 Ga0068860_100000696
1111 Ga0068860_100096313
1112 Ga0068862_100016202
1113 Ga0068862_100189667
1114 Ga0081540_1000616
1115 Ga0081540_1000782
1116 Ga0081539_10000806
1117 Ga0081539_10001125
1118 Ga0081539_10004135
1119 Ga0070717_10003541
1120 Ga0070717_10005526
1121 Ga0070717_10011746
1122 Ga0070717_10016987
1123 Ga0070717_10021169
1124 Ga0070717_10046302
1125 Ga0070717_10062304
1126 Ga0070717_10086256
1127 Ga0070717_10136020
1128 Ga0070717_10148949
1129 Ga0070717_10230942
1130 Ga0070717_10446964
1131 Ga0075363_100025191
1132 Ga0075364_10012201
1133 Ga0070715_10001553
1134 Ga0070715_10004219
1135 Ga0070716_100000523
1136 Ga0070716_100003243
1137 Ga0070716_100004648
1138 Ga0070712_100001355
1139 Ga0070712_100015091
1140 Ga0070712_100025700
1141 Ga0070712_100038541
1142 Ga0070712_100070379
1143 Ga0070712_100354046
1144 Ga0097621_100063494
1145 Ga0075428_100000548
1146 Ga0075430_100116789
1147 Ga0075431_100033598
1148 Ga0075434_100001779
1149 Ga0075434_100016475
1150 Ga0075434_100094262
1151 Ga0068865_100172894
1152 Ga0075436_100017369
1153 Ga0075436_100036169
1154 Ga0097620_100003310
1155 Ga0097620_100035566
1156 Ga0105251_10066396
1157 Ga0105240_10120810
1158 Ga0111539_10025523
1159 Ga0111539_10068637
1160 Ga0105245_10045369
1161 Ga0105245_10053882
1162 Ga0105245_10307724
1163 Ga0105245_10416883
1164 Ga0105247_10010944
1165 Ga0114129_10010771
1166 Ga0114129_10265376
1167 Ga0105243_10033376
1168 Ga0105243_10208195
1169 Ga0105241_10004726
1170 Ga0105241_10069818
1171 Ga0105237_10094009
1172 Ga0105237_10358051
1173 Ga0105239_10000854
1174 Ga0105239_10005467
1175 Ga0105246_10000321
1176 Ga0105246_10000478
1177 Ga0157371_10018942
1178 Ga0157371_10052250
1179 Ga0157369_10002905
1180 Ga0157369_10071305
1181 Ga0157369_10096500
1182 Ga0157369_10136882
1183 Ga0157378_10156863
1184 Ga0157372_10047147
1185 Ga0157372_10501827
1186 Ga0157372_10733692
1187 Ga0163163_10101443
1188 Ga0182008_10017849
1189 Ga0157379_10002714
1190 Ga0163161_10052759
1191 Ga0163161_10186601
1192 Ga0213875_10070533
1193 Ga0213875_10135734
1194 Ga0224712_10010846
1195 Ga0207656_10006329
1196 Ga0207653_10016065
1197 Ga0207692_10000277
1198 Ga0207692_10008894
1199 Ga0207692_10009191
1200 Ga0207692_10012523
1201 Ga0207692_10054041
1202 Ga0207692_10068078
1203 Ga0207710_10018127
1204 Ga0207688_10032483
1205 Ga0207647_10025031
1206 Ga0207699_10000261
1207 Ga0207699_10000458
1208 Ga0207699_10001066
1209 Ga0207699_10008590
1210 Ga0207699_10014254
1211 Ga0207699_10058475
1212 Ga0207645_10041514
1213 Ga0207645_10047739
1214 Ga0207643_10000102
1215 Ga0207705_10004990
1216 Ga0207705_10008596
1217 Ga0207705_10011904
1218 Ga0207705_10095745
1219 Ga0207705_10112150
1220 Ga0207684_10001230
1221 Ga0207684_10001761
1222 Ga0207684_10006481
1223 Ga0207684_10011655
1224 Ga0207684_10025133
1225 Ga0207684_10030279
1226 Ga0207684_10034910
1227 Ga0207684_10046895
1228 Ga0207684_10093466
1229 Ga0207684_10292315
1230 Ga0207707_10103022
1231 Ga0207671_10023017
1232 Ga0207671_10089523
1233 Ga0207693_10003084
1234 Ga0207693_10011453
1235 Ga0207693_10030153
1236 Ga0207663_10012382
1237 Ga0207663_10048339
1238 Ga0207663_10078370
1239 Ga0207660_10000439
1240 Ga0207660_10027222
1241 Ga0207662_10039096
1242 Ga0207657_10007215
1243 Ga0207657_10051901
1244 Ga0207657_10082552
1245 Ga0207657_10092164
1246 Ga0207649_10020755
1247 Ga0207649_10039068
1248 Ga0207652_10004366
1249 Ga0207652_10034783
1250 Ga0207652_10433206
1251 Ga0207646_10000278
1252 Ga0207646_10002243
1253 Ga0207646_10003994
1254 Ga0207646_10006877
1255 Ga0207646_10014374
1256 Ga0207646_10017448
1257 Ga0207646_10030307
1258 Ga0207646_10063984
1259 Ga0207646_10085097
1260 Ga0207646_10112132
1261 Ga0207646_10236330
1262 Ga0207694_10118167
1263 Ga0207694_10209450
1264 Ga0207650_10017555
1265 Ga0207650_10152697
1266 Ga0207659_10005909
1267 Ga0207659_10022350
1268 Ga0207659_10033050
1269 Ga0207687_10003225
1270 Ga0207687_10180829
1271 Ga0207687_10234237
1272 Ga0207700_10001366
1273 Ga0207700_10005658
1274 Ga0207700_10031442
1275 Ga0207700_10033364
1276 Ga0207700_10049461
1277 Ga0207700_10059009
1278 Ga0207700_10436518
1279 Ga0207664_10000311
1280 Ga0207664_10001412
1281 Ga0207664_10010644
1282 Ga0207664_10021242
1283 Ga0207664_10034531
1284 Ga0207664_10099819
1285 Ga0207664_10132319
1286 Ga0207664_10246873
1287 Ga0207644_10008498
1288 Ga0207690_10000575
1289 Ga0207690_10008450
1290 Ga0207690_10010483
1291 Ga0207690_10012749
1292 Ga0207690_10220403
1293 Ga0207706_10005138
1294 Ga0207706_10113444
1295 Ga0207706_10115805
1296 Ga0207709_10222945
1297 Ga0207670_10088801
1298 Ga0207669_10055884
1299 Ga0207669_10171311
1300 Ga0207669_10332441
1301 Ga0207665_10000215
1302 Ga0207665_10001013
1303 Ga0207665_10006016
1304 Ga0207665_10031498
1305 Ga0207665_10052907
1306 Ga0207665_10144864
1307 Ga0207691_10073314
1308 Ga0207691_10386837
1309 Ga0207689_10001185
1310 Ga0207689_10003272
1311 Ga0207689_10017236
1312 Ga0207679_10023587
1313 Ga0207667_10078681
1314 Ga0207667_10120689
1315 Ga0207667_10246848
1316 Ga0207667_10250328
1317 Ga0207712_10024714
1318 Ga0207668_10041699
1319 Ga0207658_10082125
1320 Ga0207677_10035307
1321 Ga0207677_10359700
1322 Ga0207703_10111725
1323 Ga0207703_10490568
1324 Ga0207639_10103119
1325 Ga0207639_10271699
1326 Ga0207639_10397059
1327 Ga0207678_10000141
1328 Ga0207678_10001012
1329 Ga0207678_10004168
1330 Ga0207708_10064175
1331 Ga0207702_10000567
1332 Ga0207702_10008130
1333 Ga0207702_10019266
1334 Ga0207702_10173858
1335 Ga0207641_10008900
1336 Ga0207641_10344090
1337 Ga0207676_10000814
1338 Ga0207676_10209841
1339 Ga0207674_10011467
1340 Ga0207674_10013397
1341 Ga0207674_10379284
1342 Ga0207675_100024703
1343 Ga0207675_100050757
1344 Ga0207675_100231589
1345 Ga0207683_10002042
1346 Ga0207683_10004876
1347 Ga0207683_10461389
1348 Ga0207698_10558700
1349 Ga0207428_10025122
1350 Ga0207428_10063708
1351 Ga0268266_10001679
1352 Ga0268266_10025102
1353 Ga0268265_10055749
1354 Ga0268264_10000697
1355 Ga0268264_10174239
1356 Ga0265336_10003994
1357 Ga0265338_10000827
1358 Ga0307512_10063373
1359 Ga0316181_1092416
1360 Ga0265340_10005442
1361 Ga0265316_10081161
1362 Ga0307509_10007679
1363 Ga0307408_100272122
1364 Ga0316579_10002232
1365 Ga0265314_10102111
1366 Ga0316576_10006220
1367 Ga0307516_10080920
1368 Ga0316577_10003582
1369 Ga0307413_10052968
1370 Ga0307406_10187612
1371 Ga0307407_10013842
1372 Ga0307409_100078999
1373 Ga0307409_100466785
1374 Ga0307409_100507075
1375 Ga0307416_100044055
1376 Ga0307416_100398650
1377 Ga0307415_100098439
1378 Ga0307415_100249021
1379 Ga0316583_10005810
1380 Ga0316585_10002697
1381 Ga0316593_10038422
1382 Ga0316596_1019194
1383 Ga0373959_0001379
1384 Ga0373926_0000767
1385 Ga0373926_0002281
1386 Ga0373934_0000006
1387 Ga0373934_0004342
1388 Ga0373940_0011732
1389 Ga0373923_0000602
1390 Ga0373923_0026721
1391 Ga0373936_0000341
1392 Ga0373936_0000792
1393 Ga0373936_0013649
1394 Ga0373939_0045621
1395 Ga0373939_0056658
1396 Ga0373945_0000439
1397 Ga0373945_0011554
1398 Ga0373945_0103708
1399 Ga0373945_0107300
1400 Ga0373953_0001325
1401 Ga0373953_0056521
1402 Ga0373954_0001834
1403 Ga0373954_0015932
1404 Ga0373954_0055882
1405 Ga0373954_0083001
1406 Ga0373956_0000498
1407 Ga0373956_0018288
1408 Ga0373956_0021856
1409 Ga0373956_0052667
1410 Ga0373956_0061188
1411 Ga0373957_0000878
1412 Ga0373957_0017010
1413 Ga0373957_0026004
1414 Ga0373960_0010514
1415 Ga0373943_0000222
1416 Ga0373943_0000620
1417 Ga0373943_0148186
1418 Ga0373946_0000211
1419 Ga0373946_0001783
1420 Ga0373946_0113191
1421 Ga0373955_0000034
1422 Ga0373955_0006038
1423 Ga0373955_0050207
1424 Ga0373955_0093454
1425 Ga0373961_0010664
1426 Ga0373962_0010648
1427 Ga0316574_0034991
1428 Ga0373924_0000343
1429 Ga0373924_0001065
1430 Ga0373924_0011134
1431 Ga0373931_0017595
1432 Ga0373935_0035088
1433 Ga0373927_0011206
1434 Ga0373927_0073976
1435 Ga0373927_0107451
1436 Ga0373933_0000161
1437 Ga0373933_0013141
1438 Ga0373933_0135572
1439 Ga0373947_0002674
1440 Ga0373947_0015037
1441 Ga0373947_0112790
1442 Ga0373947_0146243
1443 Ga0373947_0241559
1444 Ga0373947_0313063
1445 Ga0373937_0000126
1446 Ga0373937_0013317
1447 Ga0373937_0032272
1448 Ga0373937_0051034
1449 Ga0373937_0096539
1450 Ga0373937_0198533
1451 Ga0316584_0253986
1452 Ga0373925_0001213
1453 Ga0373925_0001242
1454 Ga0373925_0004745
1455 Ga0373925_0034034
1456 Ga0373925_0274614
1457 Ga0395900_0089872
1458 Ga0395898_0036630
1459 Ga0316581_0003414
1460 Ga0436364_0007757
1461 Ga0436364_0016285
1462 Ga0436364_0568803
1463 Ga0436364_0671111
1464 Ga0436364_0737335
1465 Ga0395901_0163097
1466 Ga0436363_0039138
1467 Ga0436363_0120235
1468 Ga0436363_0261863
1469 Ga0439465_0013225
1470 Ga0439431_0003805
1471 Ga0439445_0035838
1472 Ga0439432_024281
1473 Ga0466969_0014966
1474 Ga0466969_0107917
1475 Ga0466972_0013115
1476 Ga0466965_0082617
1477 Ga0466966_0006104
1478 Ga0466966_0076714
1479 Ga0466961_0005917
1480 Ga0466961_0008796
1481 Ga0466961_0038720
1482 Ga0466961_0191239
1483 Ga0466963_0005697
1484 Ga0466963_0017249
1485 Ga0466963_0405830
1486 Ga0466964_0014836
1487 Ga0466964_0019836
1488 Ga0466971_0004589
1489 Ga0466971_0070646
1490 Ga0466970_0046551
1491 Ga0466957_0002757
1492 Ga0466957_0051732
1493 Ga0466957_0065992
1494 Ga0466957_0131404
1495 Ga0466957_0339721
1496 Ga0466960_0027362
1497 Ga0466960_0171305
1498 Ga0466960_0184228
1499 Ga0466959_0000786
1500 Ga0466959_0006200
1501 Ga0466959_0011536
1502 Ga0466959_0050084
1503 Ga0451576_0523890
1504 Ga0466958_0005392
1505 Ga0466958_0022947
1506 Ga0466967_0001099
1507 Ga0466967_0008839
1508 Ga0466967_0009511
1509 Ga0466967_0022152
1510 Ga0466967_0022697
1511 Ga0466967_0052581
1512 Ga0466967_0055695
1513 Ga0466967_0060217
1514 Ga0466967_0060277
1515 Ga0466967_0119472
1516 Ga0466967_0185339
1517 Ga0466967_0462792
1518 Ga0466967_0475036
1519 Ga0495592_0000030
1520 Ga0495592_0064734
1521 Ga0495592_0183322
1522 Ga0495592_0283679
1523 Ga0495603_0001439
1524 Ga0495603_0008628
1525 Ga0495629_0015013
1526 Ga0495641_0027587
1527 Ga0495641_0164382
1528 Ga0495651_0000221
1529 Ga0495651_0130027
1530 Ga0495653_0000895
1531 Ga0495653_0070199
1532 Ga0495653_0070298
1533 Ga0495653_0121150
1534 Ga0495653_0192005
1535 Ga0495653_0214135
1536 Ga0495653_0263493
1537 Ga0495580_0076865
1538 Ga0495582_0001232
1539 Ga0495582_0004428
1540 Ga0495582_0033988
1541 Ga0495582_0079635
1542 Ga0495639_0178368
1543 Ga0495662_0023146
1544 Ga0495664_0003692
1545 Ga0495664_0021701
1546 Ga0495664_0069459
1547 Ga0495594_0021752
1548 Ga0495608_0000191
1549 Ga0495608_0014956
1550 Ga0495608_0027786
1551 Ga0495608_0038704
1552 Ga0495618_0027405
1553 Ga0495618_0044993
1554 Ga0495618_0081741
1555 Ga0495628_0003830
1556 Ga0495628_0028621
1557 Ga0495628_0037076
1558 Ga0495630_0012349
1559 Ga0495630_0058749
1560 Ga0495630_0326228
1561 Ga0495666_0026971
1562 Ga0495652_0000921
1563 Ga0495652_0002640
1564 Ga0495652_0045493
1565 Ga0495652_0065676
1566 Ga0495652_0072617
1567 Ga0495652_0117785
1568 Ga0495665_0002334
1569 Ga0495665_0006345
1570 Ga0495665_0031595
1571 Ga0495640_0004093
1572 Ga0495640_0011149
1573 Ga0495640_0028834
1574 Ga0495640_0039340
1575 Ga0495640_0077148
1576 Ga0495640_0148290
1577 Ga0495586_0022515
1578 Ga0495587_0000210
1579 Ga0495587_0006716
1580 Ga0495587_0076147
1581 Ga0495587_0212384
1582 Ga0495645_0029854
1583 Ga0495645_0076714
1584 Ga0495645_0149563
1585 Ga0495667_0000040
1586 Ga0495667_0013375
1587 Ga0495667_0023765
1588 Ga0495667_0024113
1589 Ga0495667_0077349
1590 Ga0495668_0000477
1591 Ga0495634_0002549
1592 Ga0495634_0117901
1593 Ga0495634_0134824
1594 Ga0495625_0000969
1595 Ga0495635_0000373
1596 Ga0495635_0020270
1597 Ga0495657_0000029
1598 Ga0495657_0015497
1599 Ga0495657_0021602
1600 Ga0495657_0073654
1601 Ga0495657_0139273
1602 Ga0495599_0000238
1603 Ga0495599_0055554
1604 Ga0495599_0273062
1605 Ga0495623_0000652
1606 Ga0495623_0007901
1607 Ga0495623_0015753
1608 Ga0495623_0025198
1609 Ga0495623_0057266
1610 Ga0495646_0011399
1611 Ga0495646_0053325
1612 Ga0495646_0063798
1613 Ga0495647_0021182
1614 Ga0495658_0016530
1615 Ga0495658_0207408
1616 Ga0495669_0031349
1617 Ga0495613_0000459
1618 Ga0495613_0023536
1619 Ga0495613_0027878
1620 Ga0495624_0001477
1621 Ga0495600_0004117
1622 Ga0495600_0009623
1623 Ga0495600_0031175
1624 Ga0495600_0098321
1625 Ga0495600_0168879
1626 Ga0495581_0025729
1627 Ga0495581_0036856
1628 Ga0495581_0045917
1629 Ga0495581_0057462
1630 Ga0495604_0000034
1631 Ga0495604_0014642
1632 Ga0495604_0017920
1633 Ga0495604_0038984
1634 Ga0495604_0039115
1635 Ga0495604_0120531
1636 Ga0495674_0001403
1637 Ga0495674_0025013
1638 Ga0495674_0034492
1639 Ga0495674_0040925
1640 Ga0495674_0062227
1641 Ga0495674_0076231
1642 Ga0495674_0099382
1643 Ga0495676_0009541
1644 Ga0495676_0021763
1645 Ga0495680_0000522
1646 Ga0495680_0003936
1647 Ga0495680_0007711
1648 Ga0495680_0086007
1649 Ga0495675_0000613
1650 Ga0495675_0007809
1651 Ga0495675_0016573
1652 Ga0495675_0020863
1653 Ga0495675_0034408
1654 Ga0495675_0040915
1655 Ga0495684_0005175
1656 Ga0495684_0009248
1657 Ga0495684_0027794
1658 Ga0495684_0028463
1659 Ga0495684_0039046
1660 Ga0495684_0061338
1661 Ga0495684_0168379
1662 Ga0495684_0271147
1663 Ga0495593_0003766
1664 Ga0495602_0001101
1665 Ga0495602_0021704
1666 Ga0495602_0035342
1667 Ga0495602_0070136
1668 Ga0495602_0074482
1669 Ga0495602_0131380
1670 Ga0495602_0181918
1671 Ga0495614_0082639
1672 Ga0495626_0000234
1673 Ga0496100_0007843
1674 Ga0496100_0134770
1675 Ga0496100_0276155
1676 Ga0496101_0071517
1677 Ga0496101_0106525
1678 Ga0496101_0180368
1679 Ga0496101_0194058
1680 Ga0496102_0000287
1681 Ga0496102_0055310
1682 Ga0496102_0059022
1683 Ga0496102_0160102
1684 Ga0496102_0216761
1685 Ga0496102_0228058
1686 Ga0496103_0000192
1687 Ga0496103_0035769
1688 Ga0496104_0000398
1689 Ga0496104_0039051
1690 Ga0496104_0086163
1691 Ga0496104_0189020
1692 Ga0496104_0297069
1693 Ga0496105_0000812
1694 Ga0496105_0002315
1695 Ga0496105_0051856
1696 Ga0496105_0055672
1697 Ga0496105_0086402
1698 Ga0496106_0020477
1699 Ga0496106_0048856
1700 Ga0496107_0022461
1701 Ga0496107_0025540
1702 Ga0496108_0000149
1703 Ga0496108_0003584
1704 Ga0496108_0016367
1705 Ga0496108_0055394
1706 Ga0496108_0096311
1707 Ga0496109_0053506
1708 Ga0496109_0193967
1709 Ga0496110_0126346
1710 Ga0496110_0306621
1711 Ga0496111_0034773
1712 Ga0496111_0126997
1713 Ga0496112_0000555
1714 Ga0496112_0021103
1715 Ga0496112_0102259
1716 Ga0496112_0234943
1717 Ga0496113_0068910
1718 Ga0496114_0008673
1719 Ga0496114_0038878
1720 Ga0496114_0040956
1721 Ga0496115_0022579
1722 Ga0496115_0043647
1723 Ga0496115_0074109
1724 Ga0496118_0060297
1725 Ga0496118_0140963
1726 Ga0496119_0001269
1727 Ga0496119_0009683
1728 Ga0496120_0015501
1729 Ga0496124_0093858
1730 Ga0496126_0000588
1731 Ga0501031_0005137
1732 Ga0501031_0008163
1733 Ga0501032_0027113
1734 Ga0501032_0042338
1735 Ga0501034_0223514
1736 Ga0501037_0017841
1737 Ga0501038_0139134
1738 Ga0501038_0157997
1739 Ga0501039_0049633
1740 Ga0501039_0062539
1741 Ga0501039_0096052
1742 Ga0501039_0101363
1743 Ga0501041_0008683
1744 Ga0501041_0015605
1745 Ga0501042_0001539
1746 Ga0501042_0022820
1747 Ga0501046_0047691
1748 Ga0501046_0085945
1749 Ga0501047_0179621
1750 Ga0501048_0008158
1751 Ga0501048_0029392
1752 Ga0501048_0060518
1753 Ga0501068_0008501
1754 Ga0501069_0062877
1755 Ga0501069_0136050
1756 Ga0501070_0022083
1757 Ga0501070_0032113
1758 Ga0501070_0133940
1759 Ga0501070_0153231
1760 Ga0501070_0154307
1761 Ga0501070_0206798
1762 Ga0501070_0239869
1763 Ga0501070_0259357
1764 Ga0501071_0000355
1765 Ga0501071_0071847
1766 Ga0501072_0004287
1767 Ga0501072_0154626
1768 Ga0501073_0145209
1769 Ga0501074_0011695
1770 Ga0501075_0005534
1771 Ga0501075_0053165
1772 Ga0501075_0085053
1773 Ga0501076_0000758
1774 Ga0501076_0293871
1775 Ga0501077_0066828
1776 Ga0501079_0012673
1777 Ga0501079_0258831
1778 Ga0501080_0038584
1779 Ga0501081_0024995
1780 Ga0501035_0044305
1781 Ga0501035_0316848
1782 Ga0501045_0010113
1783 Ga0501045_0251447
1784 nmdc:mga00v17_60413_c1
1785 nmdc:mga0yw44_61235_c1
1786 nmdc:mga06z11_95680_c1
1787 nmdc:mga07m45_3230_c1
1788 nmdc:mga09592_148791_c1
1789 nmdc:mga08y16_17213_c1
1790 nmdc:mga08y16_23121_c1
1791 nmdc:mga08y16_35177_c1
1792 nmdc:mga0n895_139714_c1
1793 nmdc:mga0n895_9940_c1
1794 nmdc:mga0rr50_182838_c1
1795 nmdc:mga08x19_29999_c1
1796 nmdc:mga0a205_44361_c1
1797 Ga0495601_0052162
1798 Ga0495601_0059728
1799 Ga0495601_0135320
1800 Ga0495612_0002376
1801 Ga0495612_0034752
1802 Ga0495595_0156649
1803 Ga0495619_0001126
1804 Ga0495619_0003694
1805 Ga0495619_0071465
1806 Ga0495619_0081515
1807 Ga0495619_0158190
1808 Ga0500643_000352
1809 Ga0500641_0044978
1810 Ga0500593_007573
1811 Ga0501084_0026752
1812 Ga0501084_0085343
1813 Ga0466962_0003529
1814 Ga0466962_0004333
1815 Ga0466962_0013135
1816 Ga0466962_0061822
1817 Ga0466962_0096793
1818 Ga0530510_0030849
1819 2515718891
1820 2516083103
1821 2583151149
1822 2644230357
1823 2676487927
1824 2768645836
1825 2855391110
1826 2856742829
1827 2866556820
1828 2873320830
1829 2884697544
1830 2887486832
1831 2891403116
1832 2891554565
1833 2891564657
1834 2895438104
1835 2895447661
1836 2899372922
1837 2984579970
1838 2990260751
1839 3001891596
1840 3003001845
1841 8001786840
1842 8008486599
1843 8025525668
1844 8055179772
1845 8056065091
1846 8057568555

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

231

326

0.94

PF00551

Formyl_trans_N

Formyl transferase

24

208

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9524 1 307
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9464 1 307
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9408 2 308
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.935 2 308
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9305 2 308
ID Description Score Start End Superfamily
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9764 1 306 3.40.50.12230
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9739 2 206 3.40.50.170
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9671 1 306 3.40.50.12230
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.959 2 206 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9382 2 206 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A1H2DD92-F1-model_v4 deleted 0.9895 1 307
AF-A0A538E3I9-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9883 1 175 GO:0004479
GO:0005829
AF-A0A382L434-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9871 26 202 GO:0004479
GO:0005829
AF-A0A1H2DD92-F1-model_v4 deleted 0.9831 1 307
AF-A0A4Q6BVG8-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9828 2 223 GO:0004479
GO:0005829

Map