F485801

General Info

Members Datasets Scaffolds Average Seq Length
922 299 1844 140

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10088360|Ga0265328_100883602
Length 157
Sequence MIYLTRRATFSASHYYWNDAWTAEKNEQVFGRCSRRAGHGHNYTLEVTVAGEPDPVTGFVVDLKWLKDAIEREVLDAWDHRHLNLEAPEFTEGKLIPTTENLAIAAWKRLEPAVTAAGGARLSRVRIYETPEIFAEYRGPHVRRGGFVSGVDDEGGL

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
299 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.74
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 2.17
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 20.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10088360 3300031239 Unclassified 1144
2 rootH1_10160945 3300003316 Bacteria 2393
3 rootH2_10026678 3300003320 Unclassified 2694
4 rootH2_10165665 3300003320 Unclassified 2365
5 rootH2_10260805 3300003320 Unclassified 1380
6 rootL2_10200354 3300003322 Bacteria 4503
7 Ga0058862_12011688 3300004803 Bacteria 656
8 Ga0065714_10006998 3300005288 Bacteria 3043
9 Ga0065704_10036673 3300005289 Unclassified 843
10 Ga0065712_10217890 3300005290 Unclassified 1051
11 Ga0065707_10937773 3300005295 Bacteria 556
12 Ga0070658_10023555 3300005327 Bacteria 4940
13 Ga0070658_10032764 3300005327 Bacteria 4178
14 Ga0070658_10080374 3300005327 Bacteria 2678
15 Ga0070658_10084667 3300005327 Bacteria 2607
16 Ga0070658_10203144 3300005327 Bacteria 1672
17 Ga0070683_100001556 3300005329 Bacteria 17746
18 Ga0070683_100023527 3300005329 Bacteria 5510
19 Ga0070683_100081436 3300005329 Bacteria 3031
20 Ga0070683_100119774 3300005329 Unclassified 2486
21 Ga0070683_100132018 3300005329 Bacteria 2364
22 Ga0070683_100185303 3300005329 Bacteria 1976
23 Ga0070683_100211522 3300005329 Bacteria 1842
24 Ga0070683_100322832 3300005329 Bacteria 1469
25 Ga0070690_100529017 3300005330 Bacteria 886
26 Ga0068869_100017699 3300005334 Bacteria 4838
27 Ga0068869_100213801 3300005334 Bacteria 1526
28 Ga0068869_101467597 3300005334 Bacteria 605
29 Ga0070666_10028737 3300005335 Bacteria 3651
30 Ga0070666_10359297 3300005335 Bacteria 1043
31 Ga0070680_100042940 3300005336 Bacteria 3670
32 Ga0070680_100197399 3300005336 Bacteria 1696
33 Ga0070680_100287859 3300005336 Bacteria 1392
34 Ga0070680_100329878 3300005336 Unclassified 1296
35 Ga0070680_100350120 3300005336 Bacteria 1256
36 Ga0070680_100945723 3300005336 Bacteria 744
37 Ga0068868_100004476 3300005338 Bacteria 9800
38 Ga0068868_100015337 3300005338 Bacteria 5665
39 Ga0068868_100022297 3300005338 Bacteria 4776
40 Ga0068868_100346578 3300005338 Bacteria 1271
41 Ga0068868_100476518 3300005338 Bacteria 1089
42 Ga0068868_100740633 3300005338 Unclassified 882
43 Ga0070660_100006768 3300005339 Bacteria 7956
44 Ga0070660_100054107 3300005339 Bacteria 3098
45 Ga0070660_100101301 3300005339 Unclassified 2282
46 Ga0070689_100490055 3300005340 Unclassified 1051
47 Ga0070691_10039203 3300005341 Unclassified 2238
48 Ga0070691_10368595 3300005341 Bacteria 802
49 Ga0070691_10860431 3300005341 Bacteria 556
50 Ga0070661_100003065 3300005344 Bacteria 11492
51 Ga0070661_100004616 3300005344 Bacteria 9480
52 Ga0070661_100107987 3300005344 Bacteria 2076
53 Ga0070661_100194418 3300005344 Bacteria 1548
54 Ga0070661_100951947 3300005344 Bacteria 711
55 Ga0070668_100061780 3300005347 Bacteria 2903
56 Ga0070669_100469884 3300005353 Bacteria 1039
57 Ga0070669_100787855 3300005353 Unclassified 807
58 Ga0070675_100186492 3300005354 Bacteria 1795
59 Ga0070675_100188659 3300005354 Bacteria 1785
60 Ga0070671_100025737 3300005355 Bacteria 4831
61 Ga0070671_100027068 3300005355 Bacteria 4717
62 Ga0070671_100131020 3300005355 Bacteria 2112
63 Ga0070671_100775859 3300005355 Bacteria 834
64 Ga0070673_100023375 3300005364 Bacteria 4516
65 Ga0070673_100362368 3300005364 Bacteria 1289
66 Ga0070659_100200491 3300005366 Bacteria 1642
67 Ga0070659_101006636 3300005366 Bacteria 732
68 Ga0070667_100006815 3300005367 Bacteria 9489
69 Ga0070667_100049090 3300005367 Bacteria 3554
70 Ga0070667_102316328 3300005367 Bacteria 506
71 Ga0070709_10069913 3300005434 Bacteria 2262
72 Ga0070709_10385238 3300005434 Unclassified 1043
73 Ga0070709_11178743 3300005434 Bacteria 615
74 Ga0070714_100014205 3300005435 Bacteria 6394
75 Ga0070714_100690404 3300005435 Bacteria 984
76 Ga0070713_100010367 3300005436 Bacteria 6733
77 Ga0070713_100315805 3300005436 Unclassified 1442
78 Ga0070713_100740150 3300005436 Unclassified 940
79 Ga0070710_10172280 3300005437 Unclassified 1349
80 Ga0070710_10845429 3300005437 Unclassified 657
81 Ga0070711_100102773 3300005439 Unclassified 2082
82 Ga0070711_100285151 3300005439 Bacteria 1308
83 Ga0070711_101050785 3300005439 Unclassified 700
84 Ga0070705_100458253 3300005440 Bacteria 958
85 Ga0070663_100031150 3300005455 Bacteria 3663
86 Ga0070663_100290365 3300005455 Bacteria 1306
87 Ga0070663_100627248 3300005455 Bacteria 907
88 Ga0070663_100745487 3300005455 Bacteria 836
89 Ga0070663_100820753 3300005455 Bacteria 798
90 Ga0070678_100003237 3300005456 Bacteria 9044
91 Ga0070662_100082083 3300005457 Bacteria 2403
92 Ga0070681_10003755 3300005458 Bacteria 14254
93 Ga0070681_10004476 3300005458 Bacteria 13323
94 Ga0070681_10470233 3300005458 Bacteria 1170
95 Ga0070681_10755568 3300005458 Bacteria 889
96 Ga0070698_100000535 3300005471 Bacteria 40564
97 Ga0070699_100080454 3300005518 Bacteria 2840
98 Ga0070699_100853161 3300005518 Unclassified 834
99 Ga0070679_100020623 3300005530 Bacteria 6427
100 Ga0070679_100112249 3300005530 Bacteria 2712
101 Ga0070679_100341361 3300005530 Bacteria 1446
102 Ga0070679_100357345 3300005530 Bacteria 1408
103 Ga0070679_100385382 3300005530 Bacteria 1348
104 Ga0070679_100394852 3300005530 Unclassified 1329
105 Ga0070684_100002861 3300005535 Bacteria 12829
106 Ga0070684_100005055 3300005535 Bacteria 10070
107 Ga0070684_100021807 3300005535 Bacteria 5335
108 Ga0070684_100050758 3300005535 Bacteria 3604
109 Ga0070684_100630286 3300005535 Bacteria 997
110 Ga0070684_100745168 3300005535 Unclassified 914
111 Ga0070684_101176267 3300005535 Unclassified 721
112 Ga0070684_101289172 3300005535 Bacteria 687
113 Ga0068853_100004104 3300005539 Bacteria 11220
114 Ga0068853_100043023 3300005539 Bacteria 3864
115 Ga0068853_100044174 3300005539 Bacteria 3814
116 Ga0068853_100047503 3300005539 Bacteria 3683
117 Ga0068853_100084324 3300005539 Bacteria 2784
118 Ga0068853_100186843 3300005539 Bacteria 1881
119 Ga0070672_100119666 3300005543 Unclassified 2154
120 Ga0070665_100024742 3300005548 Bacteria 6049
121 Ga0070665_100049315 3300005548 Bacteria 4225
122 Ga0070665_100082946 3300005548 Bacteria 3211
123 Ga0070665_100171818 3300005548 Bacteria 2168
124 Ga0070665_100195887 3300005548 Bacteria 2021
125 Ga0070665_100350010 3300005548 Bacteria 1483
126 Ga0070665_100869712 3300005548 Bacteria 914
127 Ga0070665_101608419 3300005548 Bacteria 658
128 Ga0070704_100020808 3300005549 Bacteria 4239
129 Ga0068855_100000819 3300005563 Bacteria 38473
130 Ga0068855_100004206 3300005563 Bacteria 17569
131 Ga0068855_100012254 3300005563 Bacteria 10363
132 Ga0068855_100014110 3300005563 Bacteria 9629
133 Ga0068855_100014511 3300005563 Bacteria 9488
134 Ga0068855_100026325 3300005563 Bacteria 6958
135 Ga0068855_100057916 3300005563 Bacteria 4541
136 Ga0068855_100072112 3300005563 Bacteria 4015
137 Ga0068855_100081457 3300005563 Bacteria 3751
138 Ga0068855_100152156 3300005563 Bacteria 2630
139 Ga0068855_100185794 3300005563 Unclassified 2347
140 Ga0068855_100501351 3300005563 Bacteria 1319
141 Ga0068855_100532933 3300005563 Bacteria 1273
142 Ga0068855_100543429 3300005563 Bacteria 1258
143 Ga0068855_100655331 3300005563 Bacteria 1127
144 Ga0068855_100859036 3300005563 Unclassified 961
145 Ga0068855_101147539 3300005563 Bacteria 810
146 Ga0068855_101413872 3300005563 Bacteria 717
147 Ga0068855_101814569 3300005563 Bacteria 619
148 Ga0068855_102067886 3300005563 Unclassified 574
149 Ga0068855_102144557 3300005563 Bacteria 562
150 Ga0070664_100136329 3300005564 Unclassified 2159
151 Ga0070664_100253364 3300005564 Bacteria 1583
152 Ga0070664_101063845 3300005564 Unclassified 761
153 Ga0068857_100001991 3300005577 Bacteria 16557
154 Ga0068857_100083477 3300005577 Bacteria 2854
155 Ga0068857_100235583 3300005577 Bacteria 1675
156 Ga0068857_100335207 3300005577 Bacteria 1399
157 Ga0068857_100564421 3300005577 Bacteria 1073
158 Ga0068854_100058150 3300005578 Unclassified 2790
159 Ga0068854_100368625 3300005578 Unclassified 1180
160 Ga0068854_101203020 3300005578 Bacteria 679
161 Ga0068856_100001782 3300005614 Bacteria 22500
162 Ga0068856_100008091 3300005614 Bacteria 10266
163 Ga0068856_100011451 3300005614 Bacteria 8606
164 Ga0068856_100015606 3300005614 Bacteria 7344
165 Ga0068856_100060352 3300005614 Bacteria 3746
166 Ga0068856_100091653 3300005614 Bacteria 3023
167 Ga0068856_100316967 3300005614 Bacteria 1577
168 Ga0068856_100382337 3300005614 Bacteria 1427
169 Ga0068856_100960335 3300005614 Bacteria 873
170 Ga0068856_101692099 3300005614 Unclassified 645
171 Ga0068852_100003017 3300005616 Bacteria 11711
172 Ga0068852_100003172 3300005616 Bacteria 11474
173 Ga0068852_100003318 3300005616 Bacteria 11236
174 Ga0068852_100008628 3300005616 Bacteria 7527
175 Ga0068852_100111185 3300005616 Bacteria 2491
176 Ga0068852_100243251 3300005616 Unclassified 1721
177 Ga0068852_100260003 3300005616 Bacteria 1666
178 Ga0068852_100387959 3300005616 Bacteria 1371
179 Ga0068852_100515525 3300005616 Bacteria 1192
180 Ga0068852_100558806 3300005616 Unclassified 1145
181 Ga0068852_100584811 3300005616 Bacteria 1120
182 Ga0068852_100899394 3300005616 Bacteria 902
183 Ga0068859_100083756 3300005617 Bacteria 3233
184 Ga0068859_100102578 3300005617 Bacteria 2918
185 Ga0068859_100860959 3300005617 Bacteria 992
186 Ga0068859_100866161 3300005617 Bacteria 989
187 Ga0068859_102353838 3300005617 Unclassified 587
188 Ga0068864_100001011 3300005618 Bacteria 23500
189 Ga0068851_10016720 3300005834 Bacteria 3515
190 Ga0068851_10070517 3300005834 Bacteria 1807
191 Ga0068851_10077545 3300005834 Bacteria 1730
192 Ga0068851_10092843 3300005834 Bacteria 1591
193 Ga0068851_10190298 3300005834 Unclassified 1140
194 Ga0068851_10314664 3300005834 Unclassified 903
195 Ga0068870_10567091 3300005840 Bacteria 767
196 Ga0068863_100001678 3300005841 Bacteria 21916
197 Ga0068863_100007398 3300005841 Bacteria 10747
198 Ga0068863_101106728 3300005841 Bacteria 797
199 Ga0068858_100003486 3300005842 Bacteria 15597
200 Ga0068858_100203322 3300005842 Bacteria 1873
201 Ga0068858_100284937 3300005842 Bacteria 1573
202 Ga0068858_100476504 3300005842 Bacteria 1204
203 Ga0068858_100682275 3300005842 Unclassified 999
204 Ga0068860_100007224 3300005843 Bacteria 11106
205 Ga0068860_100023371 3300005843 Bacteria 5974
206 Ga0068860_100854229 3300005843 Bacteria 925
207 Ga0068862_100244391 3300005844 Bacteria 1633
208 Ga0068862_100883479 3300005844 Unclassified 878
209 Ga0070717_10016965 3300006028 Bacteria 5656
210 Ga0070717_10216768 3300006028 Bacteria 1681
211 Ga0070717_11214219 3300006028 Unclassified 686
212 Ga0070717_11379792 3300006028 Bacteria 640
213 Ga0070712_100082293 3300006175 Unclassified 2335
214 Ga0097621_100003579 3300006237 Bacteria 10736
215 Ga0097621_100039628 3300006237 Bacteria 3785
216 Ga0097621_101410398 3300006237 Bacteria 660
217 Ga0068871_100003833 3300006358 Bacteria 10365
218 Ga0068871_100020118 3300006358 Bacteria 5107
219 Ga0068871_100028898 3300006358 Bacteria 4351
220 Ga0068871_101305172 3300006358 Bacteria 683
221 Ga0068871_101396223 3300006358 Unclassified 660
222 Ga0075428_100272270 3300006844 Unclassified 1822
223 Ga0075430_100032755 3300006846 Bacteria 4410
224 Ga0075429_100009842 3300006880 Bacteria 8288
225 Ga0075429_100488698 3300006880 Bacteria 1079
226 Ga0075429_101549622 3300006880 Unclassified 576
227 Ga0068865_100054112 3300006881 Bacteria 2787
228 Ga0068865_101181530 3300006881 Bacteria 677
229 Ga0075436_100032986 3300006914 Bacteria 3568
230 Ga0097620_100083764 3300006931 Bacteria 3233
231 Ga0097620_100102569 3300006931 Bacteria 2918
232 Ga0097620_100861045 3300006931 Bacteria 992
233 Ga0097620_100866296 3300006931 Bacteria 989
234 Ga0097620_102354255 3300006931 Unclassified 587
235 Ga0105240_10000531 3300009093 Bacteria 70393
236 Ga0105240_10003431 3300009093 Bacteria 24635
237 Ga0105240_10009850 3300009093 Bacteria 13489
238 Ga0105240_10015189 3300009093 Bacteria 10478
239 Ga0105240_10015938 3300009093 Bacteria 10194
240 Ga0105240_10034845 3300009093 Bacteria 6490
241 Ga0105240_10042759 3300009093 Bacteria 5771
242 Ga0105240_10054107 3300009093 Bacteria 5031
243 Ga0105240_10084928 3300009093 Bacteria 3880
244 Ga0105240_10092926 3300009093 Unclassified 3683
245 Ga0105240_10232022 3300009093 Bacteria 2144
246 Ga0105240_10311733 3300009093 Bacteria 1797
247 Ga0105240_10394695 3300009093 Unclassified 1560
248 Ga0105240_10394867 3300009093 Bacteria 1559
249 Ga0105240_10470736 3300009093 Unclassified 1402
250 Ga0105240_10802720 3300009093 Bacteria 1019
251 Ga0105240_10868925 3300009093 Bacteria 972
252 Ga0105240_11241263 3300009093 Bacteria 788
253 Ga0111539_10012544 3300009094 Bacteria 10619
254 Ga0111539_10039250 3300009094 Bacteria 5708
255 Ga0111539_11272971 3300009094 Unclassified 854
256 Ga0105245_10006340 3300009098 Bacteria 10409
257 Ga0105245_10032253 3300009098 Unclassified 4638
258 Ga0105245_10045717 3300009098 Bacteria 3910
259 Ga0105245_10073426 3300009098 Bacteria 3111
260 Ga0105245_10152482 3300009098 Bacteria 2186
261 Ga0105245_10480985 3300009098 Bacteria 1255
262 Ga0105247_10016685 3300009101 Bacteria 4404
263 Ga0105247_10094104 3300009101 Bacteria 1906
264 Ga0105247_10168380 3300009101 Unclassified 1455
265 Ga0114129_10168959 3300009147 Unclassified 2982
266 Ga0114129_10616725 3300009147 Bacteria 1404
267 Ga0105243_10009867 3300009148 Bacteria 7263
268 Ga0105243_10782929 3300009148 Bacteria 938
269 Ga0105241_10000199 3300009174 Bacteria 44908
270 Ga0105241_10001305 3300009174 Bacteria 18974
271 Ga0105241_10002734 3300009174 Bacteria 13219
272 Ga0105241_10013210 3300009174 Bacteria 6053
273 Ga0105241_10018485 3300009174 Bacteria 5127
274 Ga0105241_10093630 3300009174 Bacteria 2375
275 Ga0105241_10172273 3300009174 Bacteria 1789
276 Ga0105241_10402184 3300009174 Bacteria 1201
277 Ga0105241_10437407 3300009174 Bacteria 1154
278 Ga0105241_10542257 3300009174 Bacteria 1043
279 Ga0105241_10814294 3300009174 Unclassified 861
280 Ga0105242_11204845 3300009176 Unclassified 777
281 Ga0105248_10000004 3300009177 Bacteria 695244
282 Ga0105248_10000255 3300009177 Bacteria 62145
283 Ga0105248_10093925 3300009177 Bacteria 3378
284 Ga0105248_10205747 3300009177 Bacteria 2218
285 Ga0105248_10400748 3300009177 Bacteria 1545
286 Ga0105248_10616549 3300009177 Bacteria 1224
287 Ga0105248_11092470 3300009177 Bacteria 901
288 Ga0105237_10003805 3300009545 Bacteria 17734
289 Ga0105237_10019484 3300009545 Bacteria 7007
290 Ga0105237_10050367 3300009545 Bacteria 4184
291 Ga0105237_10230918 3300009545 Bacteria 1851
292 Ga0105237_10247869 3300009545 Bacteria 1783
293 Ga0105237_10265446 3300009545 Bacteria 1720
294 Ga0105237_10321428 3300009545 Unclassified 1551
295 Ga0105237_10345581 3300009545 Unclassified 1492
296 Ga0105237_11543340 3300009545 Bacteria 671
297 Ga0105238_10000262 3300009551 Bacteria 58846
298 Ga0105238_10000292 3300009551 Bacteria 55692
299 Ga0105238_10001340 3300009551 Bacteria 24728
300 Ga0105238_10007813 3300009551 Bacteria 10696
301 Ga0105238_10032054 3300009551 Bacteria 5348
302 Ga0105238_10052982 3300009551 Bacteria 4078
303 Ga0105238_10078667 3300009551 Bacteria 3288
304 Ga0105238_10081743 3300009551 Bacteria 3220
305 Ga0105238_10227607 3300009551 Unclassified 1841
306 Ga0105238_10232640 3300009551 Bacteria 1819
307 Ga0105238_10239389 3300009551 Bacteria 1792
308 Ga0105238_10413015 3300009551 Bacteria 1343
309 Ga0105238_10684020 3300009551 Bacteria 1037
310 Ga0105238_10743348 3300009551 Bacteria 994
311 Ga0105238_12184579 3300009551 Unclassified 588
312 Ga0105249_10035872 3300009553 Bacteria 4497
313 Ga0105249_10064494 3300009553 Bacteria 3368
314 Ga0105249_12137559 3300009553 Bacteria 633
315 Ga0105239_10001873 3300010375 Bacteria 27535
316 Ga0105239_10004032 3300010375 Bacteria 17766
317 Ga0105239_10007426 3300010375 Bacteria 12574
318 Ga0105239_10054842 3300010375 Bacteria 4373
319 Ga0105239_10096949 3300010375 Bacteria 3258
320 Ga0105239_10307055 3300010375 Bacteria 1787
321 Ga0105239_10316960 3300010375 Bacteria 1758
322 Ga0105239_10337112 3300010375 Bacteria 1701
323 Ga0105239_10770631 3300010375 Unclassified 1101
324 Ga0105239_13561122 3300010375 Unclassified 506
325 Ga0105246_10006772 3300011119 Bacteria 7006
326 Ga0105246_10467531 3300011119 Bacteria 1064
327 Ga0105246_10884187 3300011119 Unclassified 800
328 Ga0157373_10000734 3300013100 Bacteria 25474
329 Ga0157373_10053519 3300013100 Bacteria 2870
330 Ga0157373_10459506 3300013100 Bacteria 917
331 Ga0157373_10577668 3300013100 Bacteria 817
332 Ga0157373_11562317 3300013100 Unclassified 505
333 Ga0157371_10029907 3300013102 Bacteria 3933
334 Ga0157371_10279736 3300013102 Unclassified 1205
335 Ga0157370_10000107 3300013104 Bacteria 95413
336 Ga0157370_10010187 3300013104 Bacteria 9927
337 Ga0157370_10011099 3300013104 Bacteria 9444
338 Ga0157370_10021637 3300013104 Bacteria 6407
339 Ga0157370_10028338 3300013104 Bacteria 5511
340 Ga0157370_10052263 3300013104 Bacteria 3901
341 Ga0157370_10061945 3300013104 Bacteria 3550
342 Ga0157370_10101058 3300013104 Bacteria 2701
343 Ga0157370_10192159 3300013104 Unclassified 1895
344 Ga0157370_10192399 3300013104 Unclassified 1894
345 Ga0157370_10361919 3300013104 Bacteria 1337
346 Ga0157370_10498118 3300013104 Unclassified 1119
347 Ga0157370_10549010 3300013104 Bacteria 1059
348 Ga0157370_10838706 3300013104 Bacteria 836
349 Ga0157370_11795871 3300013104 Bacteria 550
350 Ga0157369_10000275 3300013105 Bacteria 69270
351 Ga0157369_10002075 3300013105 Bacteria 24207
352 Ga0157369_10003741 3300013105 Bacteria 18074
353 Ga0157369_10014204 3300013105 Bacteria 8996
354 Ga0157369_10017062 3300013105 Bacteria 8157
355 Ga0157369_10017846 3300013105 Bacteria 7966
356 Ga0157369_10021414 3300013105 Bacteria 7232
357 Ga0157369_10042732 3300013105 Bacteria 4944
358 Ga0157369_10079311 3300013105 Bacteria 3517
359 Ga0157369_10089774 3300013105 Bacteria 3281
360 Ga0157369_10092522 3300013105 Bacteria 3227
361 Ga0157369_10097179 3300013105 Bacteria 3142
362 Ga0157369_10099468 3300013105 Bacteria 3101
363 Ga0157369_10112954 3300013105 Bacteria 2886
364 Ga0157369_10138740 3300013105 Bacteria 2573
365 Ga0157369_10274304 3300013105 Bacteria 1757
366 Ga0157369_10339131 3300013105 Bacteria 1561
367 Ga0157369_10519471 3300013105 Bacteria 1232
368 Ga0157369_11827151 3300013105 Unclassified 617
369 Ga0157374_10009059 3300013296 Bacteria 8529
370 Ga0157374_10009888 3300013296 Bacteria 8185
371 Ga0157374_10025221 3300013296 Bacteria 5334
372 Ga0157374_10043879 3300013296 Bacteria 4131
373 Ga0157374_10076869 3300013296 Bacteria 3157
374 Ga0157374_10216396 3300013296 Unclassified 1879
375 Ga0157374_10220706 3300013296 Bacteria 1860
376 Ga0157374_10828369 3300013296 Bacteria 942
377 Ga0157374_10847509 3300013296 Unclassified 931
378 Ga0157374_10884859 3300013296 Bacteria 910
379 Ga0157374_10958257 3300013296 Bacteria 874
380 Ga0157374_11251476 3300013296 Unclassified 764
381 Ga0157374_11725672 3300013296 Bacteria 651
382 Ga0157378_10017511 3300013297 Bacteria 6289
383 Ga0157378_10029194 3300013297 Bacteria 4868
384 Ga0157378_10037831 3300013297 Bacteria 4276
385 Ga0157378_10078165 3300013297 Bacteria 2984
386 Ga0157378_10090679 3300013297 Bacteria 2778
387 Ga0157378_10110831 3300013297 Unclassified 2516
388 Ga0163162_10050845 3300013306 Unclassified 4157
389 Ga0163162_10442181 3300013306 Bacteria 1432
390 Ga0163162_10474961 3300013306 Bacteria 1382
391 Ga0163162_10974753 3300013306 Bacteria 958
392 Ga0157372_10000127 3300013307 Bacteria 82699
393 Ga0157372_10001526 3300013307 Bacteria 25177
394 Ga0157372_10004316 3300013307 Bacteria 15198
395 Ga0157372_10011047 3300013307 Bacteria 9608
396 Ga0157372_10016987 3300013307 Bacteria 7812
397 Ga0157372_10020604 3300013307 Bacteria 7116
398 Ga0157372_10023808 3300013307 Bacteria 6643
399 Ga0157372_10024442 3300013307 Bacteria 6562
400 Ga0157372_10030644 3300013307 Bacteria 5885
401 Ga0157372_10044759 3300013307 Bacteria 4905
402 Ga0157372_10047346 3300013307 Bacteria 4778
403 Ga0157372_10056981 3300013307 Bacteria 4367
404 Ga0157372_10076793 3300013307 Unclassified 3772
405 Ga0157372_10096852 3300013307 Unclassified 3363
406 Ga0157372_10099093 3300013307 Bacteria 3324
407 Ga0157372_10112432 3300013307 Bacteria 3120
408 Ga0157372_10179432 3300013307 Bacteria 2451
409 Ga0157372_10191598 3300013307 Bacteria 2368
410 Ga0157372_10212721 3300013307 Bacteria 2241
411 Ga0157372_10252014 3300013307 Unclassified 2049
412 Ga0157372_10307228 3300013307 Unclassified 1845
413 Ga0157372_10459844 3300013307 Bacteria 1483
414 Ga0157372_10566334 3300013307 Bacteria 1324
415 Ga0157375_10011935 3300013308 Bacteria 7687
416 Ga0157375_10015926 3300013308 Bacteria 6742
417 Ga0157375_10032288 3300013308 Bacteria 4964
418 Ga0157375_10257217 3300013308 Unclassified 1907
419 Ga0157375_11208298 3300013308 Bacteria 887
420 Ga0163163_10016141 3300014325 Bacteria 6929
421 Ga0163163_10065040 3300014325 Bacteria 3619
422 Ga0163163_10122743 3300014325 Bacteria 2632
423 Ga0157380_10173810 3300014326 Unclassified 1885
424 Ga0182008_10229877 3300014497 Bacteria 951
425 Ga0157377_10089227 3300014745 Bacteria 1817
426 Ga0157379_10005183 3300014968 Bacteria 11193
427 Ga0157379_10018173 3300014968 Bacteria 6195
428 Ga0157379_10074904 3300014968 Bacteria 3030
429 Ga0157379_10140759 3300014968 Bacteria 2175
430 Ga0157379_11310565 3300014968 Bacteria 699
431 Ga0157376_10001195 3300014969 Bacteria 17141
432 Ga0157376_10021210 3300014969 Bacteria 5044
433 Ga0157376_10104173 3300014969 Bacteria 2486
434 Ga0157376_10159694 3300014969 Unclassified 2042
435 Ga0157376_10192979 3300014969 Bacteria 1869
436 Ga0157376_10265556 3300014969 Bacteria 1610
437 Ga0157376_11914256 3300014969 Unclassified 630
438 Ga0163161_10035791 3300017792 Bacteria 3555
439 Ga0197907_11423606 3300020069 Bacteria 1838
440 Ga0206356_11265128 3300020070 Bacteria 1042
441 Ga0206351_10892278 3300020077 Bacteria 748
442 Ga0206352_10576970 3300020078 Unclassified 1036
443 Ga0206352_11317142 3300020078 Bacteria 672
444 Ga0206354_10491568 3300020081 Unclassified 633
445 Ga0206354_10556744 3300020081 Bacteria 1509
446 Ga0206353_11896668 3300020082 Bacteria 808
447 Ga0154015_1346029 3300020610 Bacteria 1302
448 Ga0154015_1571093 3300020610 Bacteria 740
449 Ga0213872_10025707 3300021361 Bacteria 2706
450 Ga0213872_10048157 3300021361 Bacteria 1937
451 Ga0213872_10106642 3300021361 Bacteria 1246
452 Ga0213872_10115337 3300021361 Bacteria 1190
453 Ga0213874_10349338 3300021377 Bacteria 566
454 Ga0213871_10021294 3300021441 Bacteria 1614
455 Ga0213871_10039638 3300021441 Unclassified 1261
456 Ga0207697_10026675 3300025315 Bacteria 2362
457 Ga0207656_10029705 3300025321 Bacteria 2253
458 Ga0207656_10039750 3300025321 Bacteria 1991
459 Ga0207656_10057652 3300025321 Bacteria 1695
460 Ga0207656_10091433 3300025321 Bacteria 1382
461 Ga0207656_10159065 3300025321 Bacteria 1074
462 Ga0207656_10334267 3300025321 Bacteria 754
463 Ga0207692_10663357 3300025898 Unclassified 675
464 Ga0207710_10008632 3300025900 Bacteria 4296
465 Ga0207710_10165353 3300025900 Unclassified 1079
466 Ga0207710_10406345 3300025900 Unclassified 699
467 Ga0207688_10034034 3300025901 Bacteria 2820
468 Ga0207688_10318402 3300025901 Unclassified 954
469 Ga0207647_10007335 3300025904 Bacteria 7974
470 Ga0207647_10046122 3300025904 Bacteria 2716
471 Ga0207647_10096372 3300025904 Bacteria 1761
472 Ga0207685_10077323 3300025905 Unclassified 1367
473 Ga0207699_11006898 3300025906 Unclassified 616
474 Ga0207645_10005882 3300025907 Bacteria 8836
475 Ga0207705_10035919 3300025909 Bacteria 3547
476 Ga0207705_10051275 3300025909 Bacteria 2970
477 Ga0207705_10052224 3300025909 Bacteria 2942
478 Ga0207705_10077691 3300025909 Bacteria 2415
479 Ga0207705_10593242 3300025909 Bacteria 861
480 Ga0207705_11227478 3300025909 Bacteria 574
481 Ga0207705_11333878 3300025909 Bacteria 547
482 Ga0207654_10000013 3300025911 Bacteria 241873
483 Ga0207654_10000219 3300025911 Bacteria 35241
484 Ga0207654_10006439 3300025911 Bacteria 5911
485 Ga0207654_10027124 3300025911 Unclassified 3111
486 Ga0207654_10111395 3300025911 Bacteria 1704
487 Ga0207654_10123076 3300025911 Bacteria 1632
488 Ga0207654_10130565 3300025911 Unclassified 1590
489 Ga0207654_10496501 3300025911 Unclassified 861
490 Ga0207654_10534572 3300025911 Bacteria 831
491 Ga0207707_10007146 3300025912 Bacteria 9722
492 Ga0207707_10030886 3300025912 Bacteria 4686
493 Ga0207707_10070052 3300025912 Unclassified 3056
494 Ga0207707_10846436 3300025912 Bacteria 759
495 Ga0207707_11055558 3300025912 Bacteria 664
496 Ga0207695_10000233 3300025913 Bacteria 147498
497 Ga0207695_10000258 3300025913 Bacteria 134197
498 Ga0207695_10000398 3300025913 Bacteria 97114
499 Ga0207695_10000501 3300025913 Bacteria 83342
500 Ga0207695_10005107 3300025913 Bacteria 17581
501 Ga0207695_10009332 3300025913 Bacteria 12141
502 Ga0207695_10069784 3300025913 Bacteria 3595
503 Ga0207695_10089803 3300025913 Bacteria 3089
504 Ga0207695_10095375 3300025913 Bacteria 2979
505 Ga0207695_10125935 3300025913 Bacteria 2524
506 Ga0207695_10137036 3300025913 Bacteria 2400
507 Ga0207695_10260032 3300025913 Bacteria 1634
508 Ga0207695_10326451 3300025913 Bacteria 1424
509 Ga0207695_10518431 3300025913 Bacteria 1074
510 Ga0207695_10747188 3300025913 Unclassified 858
511 Ga0207671_10000022 3300025914 Bacteria 277803
512 Ga0207671_10001087 3300025914 Bacteria 32869
513 Ga0207671_10054501 3300025914 Bacteria 2963
514 Ga0207671_10123056 3300025914 Unclassified 1984
515 Ga0207671_10351187 3300025914 Bacteria 1169
516 Ga0207693_10496298 3300025915 Unclassified 953
517 Ga0207663_10064936 3300025916 Bacteria 2331
518 Ga0207663_10084866 3300025916 Unclassified 2084
519 Ga0207663_10644198 3300025916 Bacteria 836
520 Ga0207660_10049572 3300025917 Bacteria 2978
521 Ga0207660_10087558 3300025917 Bacteria 2301
522 Ga0207660_10107284 3300025917 Bacteria 2095
523 Ga0207660_10446806 3300025917 Unclassified 1045
524 Ga0207660_10462142 3300025917 Unclassified 1027
525 Ga0207660_10719764 3300025917 Bacteria 814
526 Ga0207660_10724152 3300025917 Bacteria 812
527 Ga0207660_11061230 3300025917 Unclassified 660
528 Ga0207657_10107475 3300025919 Bacteria 2308
529 Ga0207657_10108566 3300025919 Bacteria 2294
530 Ga0207657_10226742 3300025919 Bacteria 1495
531 Ga0207649_10014261 3300025920 Bacteria 4447
532 Ga0207649_10349614 3300025920 Bacteria 1094
533 Ga0207649_10357049 3300025920 Bacteria 1083
534 Ga0207652_10172244 3300025921 Bacteria 1943
535 Ga0207652_10434536 3300025921 Bacteria 1184
536 Ga0207652_10497440 3300025921 Bacteria 1098
537 Ga0207652_10811748 3300025921 Bacteria 830
538 Ga0207652_11033143 3300025921 Unclassified 721
539 Ga0207681_10505328 3300025923 Bacteria 990
540 Ga0207681_11139914 3300025923 Unclassified 655
541 Ga0207694_10000009 3300025924 Bacteria 460687
542 Ga0207694_10000682 3300025924 Bacteria 30458
543 Ga0207694_10001146 3300025924 Bacteria 23003
544 Ga0207694_10042704 3300025924 Bacteria 3498
545 Ga0207694_10078940 3300025924 Bacteria 2581
546 Ga0207694_10273007 3300025924 Bacteria 1387
547 Ga0207694_10378282 3300025924 Bacteria 1175
548 Ga0207694_10497979 3300025924 Unclassified 1020
549 Ga0207694_10572608 3300025924 Unclassified 949
550 Ga0207694_10723890 3300025924 Bacteria 839
551 Ga0207694_10831456 3300025924 Bacteria 780
552 Ga0207659_10110682 3300025926 Bacteria 2087
553 Ga0207659_10437636 3300025926 Bacteria 1099
554 Ga0207687_10063915 3300025927 Bacteria 2607
555 Ga0207687_10112375 3300025927 Bacteria 2024
556 Ga0207687_10171439 3300025927 Bacteria 1674
557 Ga0207687_10390703 3300025927 Bacteria 1142
558 Ga0207687_10521880 3300025927 Bacteria 994
559 Ga0207687_10856468 3300025927 Unclassified 777
560 Ga0207700_10002175 3300025928 Bacteria 11231
561 Ga0207700_10984627 3300025928 Unclassified 755
562 Ga0207664_10318671 3300025929 Unclassified 1371
563 Ga0207644_10069804 3300025931 Unclassified 2566
564 Ga0207644_10240824 3300025931 Bacteria 1440
565 Ga0207644_10303894 3300025931 Unclassified 1286
566 Ga0207690_10228223 3300025932 Bacteria 1428
567 Ga0207690_10536159 3300025932 Bacteria 950
568 Ga0207706_10013501 3300025933 Bacteria 7423
569 Ga0207686_10074609 3300025934 Unclassified 2192
570 Ga0207709_10021388 3300025935 Bacteria 3661
571 Ga0207670_10460519 3300025936 Unclassified 1027
572 Ga0207704_10278017 3300025938 Unclassified 1271
573 Ga0207704_10286135 3300025938 Bacteria 1255
574 Ga0207691_10010218 3300025940 Bacteria 9004
575 Ga0207711_10000008 3300025941 Bacteria 597686
576 Ga0207711_10000010 3300025941 Bacteria 557970
577 Ga0207711_10016171 3300025941 Bacteria 6194
578 Ga0207711_10053830 3300025941 Bacteria 3452
579 Ga0207711_10184420 3300025941 Bacteria 1899
580 Ga0207711_10445447 3300025941 Unclassified 1205
581 Ga0207689_10000543 3300025942 Bacteria 35857
582 Ga0207689_10028697 3300025942 Bacteria 4654
583 Ga0207661_10002791 3300025944 Bacteria 12045
584 Ga0207661_10017763 3300025944 Bacteria 5271
585 Ga0207661_10074641 3300025944 Bacteria 2780
586 Ga0207661_10111456 3300025944 Unclassified 2315
587 Ga0207661_10132114 3300025944 Bacteria 2140
588 Ga0207661_10149798 3300025944 Bacteria 2016
589 Ga0207661_10164465 3300025944 Bacteria 1927
590 Ga0207679_10050554 3300025945 Bacteria 3039
591 Ga0207667_10000930 3300025949 Bacteria 37351
592 Ga0207667_10001644 3300025949 Bacteria 28165
593 Ga0207667_10007052 3300025949 Bacteria 13580
594 Ga0207667_10007746 3300025949 Bacteria 12837
595 Ga0207667_10011149 3300025949 Bacteria 10463
596 Ga0207667_10034028 3300025949 Bacteria 5474
597 Ga0207667_10034303 3300025949 Bacteria 5450
598 Ga0207667_10062025 3300025949 Bacteria 3910
599 Ga0207667_10090955 3300025949 Bacteria 3153
600 Ga0207667_10299733 3300025949 Bacteria 1642
601 Ga0207667_10485896 3300025949 Bacteria 1253
602 Ga0207667_10677006 3300025949 Bacteria 1035
603 Ga0207667_11014428 3300025949 Bacteria 817
604 Ga0207667_11099345 3300025949 Bacteria 778
605 Ga0207651_10055776 3300025960 Bacteria 2716
606 Ga0207712_10018867 3300025961 Bacteria 4497
607 Ga0207712_10078847 3300025961 Bacteria 2391
608 Ga0207640_10042322 3300025981 Unclassified 2904
609 Ga0207640_11528230 3300025981 Bacteria 600
610 Ga0207640_12032103 3300025981 Unclassified 521
611 Ga0207658_10048455 3300025986 Unclassified 3115
612 Ga0207658_10328029 3300025986 Bacteria 1327
613 Ga0207677_10002256 3300026023 Bacteria 10115
614 Ga0207677_10026651 3300026023 Bacteria 3629
615 Ga0207677_10137836 3300026023 Bacteria 1863
616 Ga0207677_10694240 3300026023 Bacteria 902
617 Ga0207703_11794843 3300026035 Bacteria 589
618 Ga0207639_10002669 3300026041 Bacteria 11977
619 Ga0207639_10067330 3300026041 Bacteria 2786
620 Ga0207639_10068103 3300026041 Bacteria 2772
621 Ga0207639_10126360 3300026041 Bacteria 2110
622 Ga0207639_10175555 3300026041 Unclassified 1819
623 Ga0207639_10927215 3300026041 Bacteria 814
624 Ga0207678_10001021 3300026067 Bacteria 25521
625 Ga0207678_10029470 3300026067 Bacteria 4790
626 Ga0207678_10168013 3300026067 Bacteria 1873
627 Ga0207678_10198662 3300026067 Unclassified 1714
628 Ga0207678_10407698 3300026067 Bacteria 1177
629 Ga0207708_10142552 3300026075 Bacteria 1881
630 Ga0207708_10867766 3300026075 Bacteria 780
631 Ga0207702_10008532 3300026078 Bacteria 8638
632 Ga0207702_10026962 3300026078 Bacteria 4770
633 Ga0207702_10032700 3300026078 Bacteria 4340
634 Ga0207702_10137200 3300026078 Bacteria 2208
635 Ga0207702_10227246 3300026078 Unclassified 1742
636 Ga0207702_10509216 3300026078 Bacteria 1174
637 Ga0207641_10105295 3300026088 Unclassified 2491
638 Ga0207641_10537005 3300026088 Bacteria 1139
639 Ga0207648_11031637 3300026089 Bacteria 771
640 Ga0207676_10002800 3300026095 Bacteria 12398
641 Ga0207676_10087223 3300026095 Bacteria 2552
642 Ga0207674_10001254 3300026116 Bacteria 33164
643 Ga0207674_10001761 3300026116 Bacteria 27686
644 Ga0207674_10003906 3300026116 Bacteria 18131
645 Ga0207674_10232890 3300026116 Bacteria 1790
646 Ga0207674_10348926 3300026116 Bacteria 1431
647 Ga0207674_10725269 3300026116 Bacteria 959
648 Ga0207675_100410887 3300026118 Unclassified 1335
649 Ga0207683_10000329 3300026121 Bacteria 43154
650 Ga0207683_10251139 3300026121 Bacteria 1614
651 Ga0207698_10000109 3300026142 Bacteria 51574
652 Ga0207698_10002320 3300026142 Bacteria 11270
653 Ga0207698_10041267 3300026142 Bacteria 3437
654 Ga0207698_10099352 3300026142 Bacteria 2407
655 Ga0207698_10107593 3300026142 Bacteria 2328
656 Ga0207698_10287994 3300026142 Bacteria 1523
657 Ga0207698_10300006 3300026142 Unclassified 1495
658 Ga0207698_10687859 3300026142 Unclassified 1017
659 Ga0207698_10824643 3300026142 Bacteria 931
660 Ga0207698_11412049 3300026142 Bacteria 711
661 Ga0209967_1035577 3300027364 Bacteria 751
662 Ga0210000_1016879 3300027462 Bacteria 1104
663 Ga0209968_1030049 3300027526 Unclassified 906
664 Ga0209999_1003706 3300027543 Unclassified 2739
665 Ga0209966_1138527 3300027695 Unclassified 564
666 Ga0207428_10011495 3300027907 Bacteria 7825
667 Ga0268266_10014819 3300028379 Bacteria 6695
668 Ga0268266_10108658 3300028379 Bacteria 2455
669 Ga0268266_10159323 3300028379 Bacteria 2041
670 Ga0268266_10161622 3300028379 Bacteria 2027
671 Ga0268266_10634349 3300028379 Bacteria 1028
672 Ga0268266_10813973 3300028379 Unclassified 902
673 Ga0268266_10852963 3300028379 Bacteria 880
674 Ga0268265_10228555 3300028380 Bacteria 1633
675 Ga0268265_12594909 3300028380 Unclassified 512
676 Ga0268264_10025217 3300028381 Bacteria 4857
677 Ga0265319_1165439 3300028563 Bacteria 683
678 Ga0265318_10045097 3300028577 Bacteria 1667
679 Ga0265318_10075307 3300028577 Bacteria 1249
680 Ga0265318_10234322 3300028577 Bacteria 670
681 Ga0265318_10271068 3300028577 Unclassified 619
682 Ga0265323_10149059 3300028653 Unclassified 750
683 Ga0265323_10188211 3300028653 Bacteria 652
684 Ga0265336_10003228 3300028666 Bacteria 6468
685 Ga0265338_10004864 3300028800 Bacteria 17896
686 Ga0265338_10009983 3300028800 Bacteria 11226
687 Ga0265338_10027301 3300028800 Bacteria 5730
688 Ga0265338_10058037 3300028800 Bacteria 3420
689 Ga0265338_10271109 3300028800 Bacteria 1244
690 Ga0265338_10471957 3300028800 Bacteria 886
691 Ga0265338_10640100 3300028800 Bacteria 738
692 Ga0265338_10856134 3300028800 Bacteria 621
693 Ga0265338_11000875 3300028800 Bacteria 566
694 Ga0265770_1011796 3300030878 Bacteria 1287
695 Ga0265770_1021466 3300030878 Bacteria 1027
696 Ga0265765_1017833 3300030879 Unclassified 840
697 Ga0265760_10064375 3300031090 Unclassified 1118
698 Ga0265760_10330854 3300031090 Bacteria 543
699 Ga0265330_10002436 3300031235 Bacteria 10138
700 Ga0265330_10018567 3300031235 Bacteria 3194
701 Ga0265330_10023360 3300031235 Bacteria 2808
702 Ga0265330_10092375 3300031235 Unclassified 1299
703 Ga0265330_10099791 3300031235 Unclassified 1243
704 Ga0265330_10112096 3300031235 Bacteria 1165
705 Ga0265330_10204034 3300031235 Bacteria 836
706 Ga0265330_10215016 3300031235 Bacteria 812
707 Ga0265332_10081563 3300031238 Bacteria 1372
708 Ga0265328_10026137 3300031239 Bacteria 2196
709 Ga0265328_10048673 3300031239 Bacteria 1557
710 Ga0265325_10000115 3300031241 Bacteria 54808
711 Ga0265325_10016335 3300031241 Bacteria 4151
712 Ga0265325_10038953 3300031241 Bacteria 2505
713 Ga0265325_10039205 3300031241 Bacteria 2496
714 Ga0265325_10069413 3300031241 Bacteria 1772
715 Ga0265325_10365419 3300031241 Bacteria 636
716 Ga0265325_10430213 3300031241 Unclassified 576
717 Ga0265329_10038904 3300031242 Bacteria 1530
718 Ga0265340_10011351 3300031247 Bacteria 4736
719 Ga0265340_10076277 3300031247 Bacteria 1583
720 Ga0265340_10094114 3300031247 Unclassified 1398
721 Ga0265340_10123160 3300031247 Bacteria 1192
722 Ga0265340_10125515 3300031247 Bacteria 1179
723 Ga0265340_10183842 3300031247 Bacteria 944
724 Ga0265339_10000557 3300031249 Bacteria 29155
725 Ga0265339_10000694 3300031249 Bacteria 26062
726 Ga0265339_10003616 3300031249 Bacteria 10790
727 Ga0265339_10073954 3300031249 Bacteria 1811
728 Ga0265339_10263109 3300031249 Bacteria 831
729 Ga0265316_10001818 3300031344 Bacteria 22421
730 Ga0265316_10016452 3300031344 Bacteria 6414
731 Ga0265316_10067550 3300031344 Bacteria 2764
732 Ga0265316_10122599 3300031344 Bacteria 1962
733 Ga0265316_10131782 3300031344 Bacteria 1882
734 Ga0265316_10151408 3300031344 Bacteria 1738
735 Ga0265316_10379797 3300031344 Bacteria 1019
736 Ga0265316_10400247 3300031344 Bacteria 989
737 Ga0265316_10979057 3300031344 Bacteria 589
738 Ga0265313_10003472 3300031595 Bacteria 12727
739 Ga0265313_10011695 3300031595 Bacteria 5435
740 Ga0265313_10045080 3300031595 Unclassified 2148
741 Ga0265313_10097836 3300031595 Bacteria 1307
742 Ga0265314_10000081 3300031711 Bacteria 143776
743 Ga0265314_10041564 3300031711 Bacteria 3288
744 Ga0265314_10106077 3300031711 Bacteria 1796
745 Ga0265314_10377088 3300031711 Unclassified 773
746 Ga0265342_10001506 3300031712 Bacteria 21599
747 Ga0265342_10004150 3300031712 Bacteria 11533
748 Ga0265342_10009471 3300031712 Bacteria 6858
749 Ga0265342_10018805 3300031712 Bacteria 4466
750 Ga0265342_10044547 3300031712 Bacteria 2674
751 Ga0265342_10087771 3300031712 Bacteria 1787
752 Ga0265342_10088974 3300031712 Unclassified 1772
753 Ga0265342_10098523 3300031712 Bacteria 1668
754 Ga0265342_10120751 3300031712 Bacteria 1476
755 Ga0265342_10288221 3300031712 Bacteria 868
756 Ga0307413_11770369 3300031824 Unclassified 552
757 Ga0307407_10575892 3300031903 Unclassified 835
758 Ga0307412_10000867 3300031911 Bacteria 17373
759 Ga0307416_100014064 3300032002 Bacteria 5465
760 Ga0307411_10791410 3300032005 Unclassified 834
761 Ga0316212_1055856 3300033547 Unclassified 565
762 Ga0373934_0041393 3300035086 Bacteria 1818
763 Ga0373923_0102840 3300035111 Unclassified 1262
764 Ga0373954_0076840 3300035118 Bacteria 1592
765 Ga0373956_0188645 3300035119 Unclassified 976
766 Ga0373956_0245959 3300035119 Bacteria 850
767 Ga0373943_0066714 3300035170 Unclassified 1813
768 Ga0373935_0020449 3300035692 Bacteria 4046
769 Ga0373935_0474696 3300035692 Bacteria 906
770 Ga0373927_0177651 3300035695 Unclassified 1396
771 Ga0373933_0016019 3300035724 Bacteria 4187
772 Ga0373933_0039060 3300035724 Unclassified 2791
773 Ga0373933_0450197 3300035724 Unclassified 842
774 Ga0373947_0280848 3300035725 Unclassified 1107
775 Ga0373937_0129068 3300036401 Unclassified 2360
776 Ga0373937_0219266 3300036401 Unclassified 1791
777 Ga0373937_1447729 3300036401 Unclassified 635
778 Ga0373925_0085805 3300037068 Bacteria 2400
779 Ga0395899_0000049 3300037312 Bacteria 225231
780 Ga0395900_0183023 3300037418 Unclassified 2128
781 Ga0395900_0237534 3300037418 Unclassified 1830
782 Ga0395900_0323935 3300037418 Bacteria 1521
783 Ga0395900_0492583 3300037418 Bacteria 1177
784 Ga0395898_0383162 3300037466 Unclassified 1341
785 Ga0395898_1623608 3300037466 Bacteria 570
786 Ga0395905_1368075 3300037471 Bacteria 612
787 Ga0395901_1077642 3300038443 Unclassified 775
788 Ga0436365_1104300 3300039437 Bacteria 1215
789 Ga0436360_0796911 3300039438 Bacteria 2617
790 Ga0436360_1350082 3300039438 Bacteria 5150
791 Ga0436361_0032893 3300039447 Bacteria 666
792 Ga0436361_0111045 3300039447 Bacteria 1608
793 Ga0436361_0212937 3300039447 Bacteria 30499
794 Ga0436361_0412341 3300039447 Bacteria 712
795 Ga0436361_0664017 3300039447 Bacteria 5339
796 Ga0436361_1088884 3300039447 Bacteria 8192
797 Ga0436361_1207243 3300039447 Bacteria 1505
798 Ga0436363_0818606 3300039450 Bacteria 1048
799 Ga0436362_0601495 3300039453 Bacteria 1618
800 Ga0439439_0001461 3300041406 Bacteria 4707
801 Ga0451802_0641939 3300041460 Bacteria 659
802 Ga0439448_0025639 3300042005 Bacteria 1850
803 Ga0439434_0011608 3300042435 Bacteria 2604
804 Ga0451577_0000156 3300042876 Bacteria 151954
805 Ga0451577_0001689 3300042876 Bacteria 28478
806 Ga0451577_0350863 3300042876 Bacteria 1338
807 Ga0451577_0547590 3300042876 Bacteria 1050
808 Ga0466969_0086927 3300044656 Bacteria 1485
809 Ga0466969_0480599 3300044656 Unclassified 566
810 Ga0466966_0427979 3300044684 Bacteria 795
811 Ga0466966_0704025 3300044684 Unclassified 609
812 Ga0466961_0488986 3300044693 Bacteria 744
813 Ga0466963_0000873 3300044694 Bacteria 15279
814 Ga0466963_0111430 3300044694 Bacteria 1879
815 Ga0466963_0317102 3300044694 Unclassified 1097
816 Ga0466963_1034897 3300044694 Bacteria 578
817 Ga0453684_0000330 3300044712 Bacteria 198124
818 Ga0466959_0461360 3300045049 Bacteria 861
819 Ga0466959_1043589 3300045049 Unclassified 544
820 Ga0466958_0346800 3300045836 Unclassified 956
821 Ga0466958_0386573 3300045836 Unclassified 903
822 Ga0466958_0510676 3300045836 Bacteria 780
823 Ga0466967_0003352 3300045976 Bacteria 10415
824 Ga0466967_0574163 3300045976 Bacteria 1111
825 Ga0466967_1253151 3300045976 Unclassified 739
826 Ga0495603_0750882 3300046455 Bacteria 557
827 Ga0495629_0030602 3300046459 Bacteria 3816
828 Ga0495629_0123323 3300046459 Unclassified 1805
829 Ga0495629_0229166 3300046459 Bacteria 1281
830 Ga0495638_0072399 3300046460 Bacteria 2106
831 Ga0495651_0056152 3300046462 Bacteria 3025
832 Ga0495653_0037610 3300046463 Bacteria 3801
833 Ga0495580_0004972 3300046472 Bacteria 11106
834 Ga0495580_0151490 3300046472 Bacteria 1607
835 Ga0495639_0274708 3300046475 Unclassified 836
836 Ga0495639_0630219 3300046475 Unclassified 552
837 Ga0495585_0388442 3300046492 Unclassified 673
838 Ga0495594_0028271 3300046499 Bacteria 3025
839 Ga0495583_0288032 3300046506 Bacteria 654
840 Ga0495606_0011416 3300046507 Bacteria 7244
841 Ga0495606_0252848 3300046507 Bacteria 977
842 Ga0495608_0037060 3300046511 Bacteria 3280
843 Ga0495608_0443132 3300046511 Unclassified 791
844 Ga0495618_0047791 3300046514 Bacteria 2701
845 Ga0495628_0274807 3300046516 Bacteria 1252
846 Ga0495630_0025413 3300046517 Bacteria 4380
847 Ga0495652_0006717 3300046529 Bacteria 10678
848 Ga0495652_0093962 3300046529 Bacteria 2447
849 Ga0495665_0007352 3300046531 Bacteria 5953
850 Ga0495640_0315436 3300046533 Unclassified 969
851 Ga0495587_0000661 3300046536 Bacteria 23100
852 Ga0495587_0241525 3300046536 Bacteria 1016
853 Ga0495645_0002092 3300046543 Bacteria 13562
854 Ga0495645_0051474 3300046543 Bacteria 2996
855 Ga0495645_0615865 3300046543 Unclassified 666
856 Ga0495667_0001594 3300046559 Bacteria 15037
857 Ga0495634_0332245 3300046642 Unclassified 913
858 Ga0495635_0942356 3300046663 Unclassified 551
859 Ga0495657_0209785 3300046675 Unclassified 1184
860 Ga0495599_0003492 3300046678 Bacteria 9201
861 Ga0495599_0352514 3300046678 Unclassified 882
862 Ga0495623_0101297 3300046679 Bacteria 1754
863 Ga0495623_0542885 3300046679 Unclassified 609
864 Ga0495646_0281853 3300046680 Bacteria 883
865 Ga0495669_0052475 3300046684 Bacteria 1832
866 Ga0495613_0076371 3300046689 Bacteria 2438
867 Ga0495613_0172457 3300046689 Unclassified 1535
868 Ga0495613_0814292 3300046689 Bacteria 609
869 Ga0495581_0562687 3300047315 Unclassified 661
870 Ga0495604_0452631 3300047317 Unclassified 838
871 Ga0495674_0771961 3300047319 Unclassified 749
872 Ga0495674_0931111 3300047319 Bacteria 669
873 Ga0495674_1454373 3300047319 Unclassified 509
874 Ga0495680_0300434 3300047322 Bacteria 1127
875 Ga0495675_0055752 3300047444 Bacteria 2506
876 Ga0495684_0037556 3300047471 Bacteria 3715
877 Ga0495684_0429877 3300047471 Bacteria 921
878 Ga0495686_0004892 3300047472 Bacteria 10801
879 Ga0495686_0015720 3300047472 Bacteria 5157
880 Ga0495602_0045410 3300048088 Bacteria 3975
881 Ga0495602_0501328 3300048088 Unclassified 849
882 Ga0496101_0297462 3300048904 Bacteria 1264
883 Ga0496102_0168814 3300048905 Bacteria 2060
884 Ga0496104_0287969 3300048907 Bacteria 1555
885 Ga0496104_0498310 3300048907 Bacteria 1129
886 Ga0496104_0743084 3300048907 Unclassified 888
887 Ga0496105_0076727 3300048908 Bacteria 2760
888 Ga0496105_0406818 3300048908 Bacteria 1079
889 Ga0496105_0566538 3300048908 Bacteria 885
890 Ga0496106_0045792 3300048909 Bacteria 3287
891 Ga0496106_0426562 3300048909 Bacteria 1066
892 Ga0496109_0139862 3300048912 Bacteria 2263
893 Ga0496109_0615121 3300048912 Unclassified 1023
894 Ga0496109_1015050 3300048912 Unclassified 767
895 Ga0496110_0062072 3300048913 Bacteria 3300
896 Ga0496112_0623082 3300048915 Unclassified 1010
897 Ga0496113_0959534 3300048916 Unclassified 675
898 Ga0496114_1026635 3300048917 Bacteria 708
899 Ga0496115_0124505 3300048918 Bacteria 2123
900 Ga0496115_0130462 3300048918 Bacteria 2071
901 Ga0496119_0250072 3300048922 Bacteria 894
902 Ga0496120_0279265 3300048923 Bacteria 773
903 Ga0496126_0009992 3300048929 Bacteria 10018
904 Ga0496126_0015586 3300048929 Bacteria 7638
905 Ga0501034_0228194 3300049571 Bacteria 1812
906 Ga0501038_0091426 3300049574 Bacteria 2550
907 Ga0501047_0084069 3300049581 Bacteria 3059
908 Ga0501070_1536464 3300049586 Bacteria 503
909 Ga0501073_0491743 3300049589 Bacteria 848
910 Ga0501044_0123737 3300049823 Bacteria 2585
911 nmdc:mga09592_497300_c1 3300050508 Bacteria 1050
912 nmdc:mga0qj67_38045_c1 3300050509 Bacteria 3773
913 nmdc:mga08y16_440548_c1 3300050511 Bacteria 1330
914 nmdc:mga08x19_26821_c1 3300050514 Bacteria 3598
915 Ga0495601_0105045 3300053077 Unclassified 1826
916 Ga0495601_0192541 3300053077 Bacteria 1332
917 Ga0495601_0496315 3300053077 Bacteria 788
918 Ga0495612_0178694 3300053078 Bacteria 931
919 Ga0495619_0057510 3300053085 Bacteria 2581
920 Ga0500572_236537 3300053111 Unclassified 596
921 2852627099 2852623160 Bacteria 4376875
922 2884935167 2884933994 Bacteria 4535041
923 Ga0265328_10088360
924 rootH1_10160945
925 rootH2_10026678
926 rootH2_10165665
927 rootH2_10260805
928 rootL2_10200354
929 Ga0058862_12011688
930 Ga0065714_10006998
931 Ga0065704_10036673
932 Ga0065712_10217890
933 Ga0065707_10937773
934 Ga0070658_10023555
935 Ga0070658_10032764
936 Ga0070658_10080374
937 Ga0070658_10084667
938 Ga0070658_10203144
939 Ga0070683_100001556
940 Ga0070683_100023527
941 Ga0070683_100081436
942 Ga0070683_100119774
943 Ga0070683_100132018
944 Ga0070683_100185303
945 Ga0070683_100211522
946 Ga0070683_100322832
947 Ga0070690_100529017
948 Ga0068869_100017699
949 Ga0068869_100213801
950 Ga0068869_101467597
951 Ga0070666_10028737
952 Ga0070666_10359297
953 Ga0070680_100042940
954 Ga0070680_100197399
955 Ga0070680_100287859
956 Ga0070680_100329878
957 Ga0070680_100350120
958 Ga0070680_100945723
959 Ga0068868_100004476
960 Ga0068868_100015337
961 Ga0068868_100022297
962 Ga0068868_100346578
963 Ga0068868_100476518
964 Ga0068868_100740633
965 Ga0070660_100006768
966 Ga0070660_100054107
967 Ga0070660_100101301
968 Ga0070689_100490055
969 Ga0070691_10039203
970 Ga0070691_10368595
971 Ga0070691_10860431
972 Ga0070661_100003065
973 Ga0070661_100004616
974 Ga0070661_100107987
975 Ga0070661_100194418
976 Ga0070661_100951947
977 Ga0070668_100061780
978 Ga0070669_100469884
979 Ga0070669_100787855
980 Ga0070675_100186492
981 Ga0070675_100188659
982 Ga0070671_100025737
983 Ga0070671_100027068
984 Ga0070671_100131020
985 Ga0070671_100775859
986 Ga0070673_100023375
987 Ga0070673_100362368
988 Ga0070659_100200491
989 Ga0070659_101006636
990 Ga0070667_100006815
991 Ga0070667_100049090
992 Ga0070667_102316328
993 Ga0070709_10069913
994 Ga0070709_10385238
995 Ga0070709_11178743
996 Ga0070714_100014205
997 Ga0070714_100690404
998 Ga0070713_100010367
999 Ga0070713_100315805
1000 Ga0070713_100740150
1001 Ga0070710_10172280
1002 Ga0070710_10845429
1003 Ga0070711_100102773
1004 Ga0070711_100285151
1005 Ga0070711_101050785
1006 Ga0070705_100458253
1007 Ga0070663_100031150
1008 Ga0070663_100290365
1009 Ga0070663_100627248
1010 Ga0070663_100745487
1011 Ga0070663_100820753
1012 Ga0070678_100003237
1013 Ga0070662_100082083
1014 Ga0070681_10003755
1015 Ga0070681_10004476
1016 Ga0070681_10470233
1017 Ga0070681_10755568
1018 Ga0070698_100000535
1019 Ga0070699_100080454
1020 Ga0070699_100853161
1021 Ga0070679_100020623
1022 Ga0070679_100112249
1023 Ga0070679_100341361
1024 Ga0070679_100357345
1025 Ga0070679_100385382
1026 Ga0070679_100394852
1027 Ga0070684_100002861
1028 Ga0070684_100005055
1029 Ga0070684_100021807
1030 Ga0070684_100050758
1031 Ga0070684_100630286
1032 Ga0070684_100745168
1033 Ga0070684_101176267
1034 Ga0070684_101289172
1035 Ga0068853_100004104
1036 Ga0068853_100043023
1037 Ga0068853_100044174
1038 Ga0068853_100047503
1039 Ga0068853_100084324
1040 Ga0068853_100186843
1041 Ga0070672_100119666
1042 Ga0070665_100024742
1043 Ga0070665_100049315
1044 Ga0070665_100082946
1045 Ga0070665_100171818
1046 Ga0070665_100195887
1047 Ga0070665_100350010
1048 Ga0070665_100869712
1049 Ga0070665_101608419
1050 Ga0070704_100020808
1051 Ga0068855_100000819
1052 Ga0068855_100004206
1053 Ga0068855_100012254
1054 Ga0068855_100014110
1055 Ga0068855_100014511
1056 Ga0068855_100026325
1057 Ga0068855_100057916
1058 Ga0068855_100072112
1059 Ga0068855_100081457
1060 Ga0068855_100152156
1061 Ga0068855_100185794
1062 Ga0068855_100501351
1063 Ga0068855_100532933
1064 Ga0068855_100543429
1065 Ga0068855_100655331
1066 Ga0068855_100859036
1067 Ga0068855_101147539
1068 Ga0068855_101413872
1069 Ga0068855_101814569
1070 Ga0068855_102067886
1071 Ga0068855_102144557
1072 Ga0070664_100136329
1073 Ga0070664_100253364
1074 Ga0070664_101063845
1075 Ga0068857_100001991
1076 Ga0068857_100083477
1077 Ga0068857_100235583
1078 Ga0068857_100335207
1079 Ga0068857_100564421
1080 Ga0068854_100058150
1081 Ga0068854_100368625
1082 Ga0068854_101203020
1083 Ga0068856_100001782
1084 Ga0068856_100008091
1085 Ga0068856_100011451
1086 Ga0068856_100015606
1087 Ga0068856_100060352
1088 Ga0068856_100091653
1089 Ga0068856_100316967
1090 Ga0068856_100382337
1091 Ga0068856_100960335
1092 Ga0068856_101692099
1093 Ga0068852_100003017
1094 Ga0068852_100003172
1095 Ga0068852_100003318
1096 Ga0068852_100008628
1097 Ga0068852_100111185
1098 Ga0068852_100243251
1099 Ga0068852_100260003
1100 Ga0068852_100387959
1101 Ga0068852_100515525
1102 Ga0068852_100558806
1103 Ga0068852_100584811
1104 Ga0068852_100899394
1105 Ga0068859_100083756
1106 Ga0068859_100102578
1107 Ga0068859_100860959
1108 Ga0068859_100866161
1109 Ga0068859_102353838
1110 Ga0068864_100001011
1111 Ga0068851_10016720
1112 Ga0068851_10070517
1113 Ga0068851_10077545
1114 Ga0068851_10092843
1115 Ga0068851_10190298
1116 Ga0068851_10314664
1117 Ga0068870_10567091
1118 Ga0068863_100001678
1119 Ga0068863_100007398
1120 Ga0068863_101106728
1121 Ga0068858_100003486
1122 Ga0068858_100203322
1123 Ga0068858_100284937
1124 Ga0068858_100476504
1125 Ga0068858_100682275
1126 Ga0068860_100007224
1127 Ga0068860_100023371
1128 Ga0068860_100854229
1129 Ga0068862_100244391
1130 Ga0068862_100883479
1131 Ga0070717_10016965
1132 Ga0070717_10216768
1133 Ga0070717_11214219
1134 Ga0070717_11379792
1135 Ga0070712_100082293
1136 Ga0097621_100003579
1137 Ga0097621_100039628
1138 Ga0097621_101410398
1139 Ga0068871_100003833
1140 Ga0068871_100020118
1141 Ga0068871_100028898
1142 Ga0068871_101305172
1143 Ga0068871_101396223
1144 Ga0075428_100272270
1145 Ga0075430_100032755
1146 Ga0075429_100009842
1147 Ga0075429_100488698
1148 Ga0075429_101549622
1149 Ga0068865_100054112
1150 Ga0068865_101181530
1151 Ga0075436_100032986
1152 Ga0097620_100083764
1153 Ga0097620_100102569
1154 Ga0097620_100861045
1155 Ga0097620_100866296
1156 Ga0097620_102354255
1157 Ga0105240_10000531
1158 Ga0105240_10003431
1159 Ga0105240_10009850
1160 Ga0105240_10015189
1161 Ga0105240_10015938
1162 Ga0105240_10034845
1163 Ga0105240_10042759
1164 Ga0105240_10054107
1165 Ga0105240_10084928
1166 Ga0105240_10092926
1167 Ga0105240_10232022
1168 Ga0105240_10311733
1169 Ga0105240_10394695
1170 Ga0105240_10394867
1171 Ga0105240_10470736
1172 Ga0105240_10802720
1173 Ga0105240_10868925
1174 Ga0105240_11241263
1175 Ga0111539_10012544
1176 Ga0111539_10039250
1177 Ga0111539_11272971
1178 Ga0105245_10006340
1179 Ga0105245_10032253
1180 Ga0105245_10045717
1181 Ga0105245_10073426
1182 Ga0105245_10152482
1183 Ga0105245_10480985
1184 Ga0105247_10016685
1185 Ga0105247_10094104
1186 Ga0105247_10168380
1187 Ga0114129_10168959
1188 Ga0114129_10616725
1189 Ga0105243_10009867
1190 Ga0105243_10782929
1191 Ga0105241_10000199
1192 Ga0105241_10001305
1193 Ga0105241_10002734
1194 Ga0105241_10013210
1195 Ga0105241_10018485
1196 Ga0105241_10093630
1197 Ga0105241_10172273
1198 Ga0105241_10402184
1199 Ga0105241_10437407
1200 Ga0105241_10542257
1201 Ga0105241_10814294
1202 Ga0105242_11204845
1203 Ga0105248_10000004
1204 Ga0105248_10000255
1205 Ga0105248_10093925
1206 Ga0105248_10205747
1207 Ga0105248_10400748
1208 Ga0105248_10616549
1209 Ga0105248_11092470
1210 Ga0105237_10003805
1211 Ga0105237_10019484
1212 Ga0105237_10050367
1213 Ga0105237_10230918
1214 Ga0105237_10247869
1215 Ga0105237_10265446
1216 Ga0105237_10321428
1217 Ga0105237_10345581
1218 Ga0105237_11543340
1219 Ga0105238_10000262
1220 Ga0105238_10000292
1221 Ga0105238_10001340
1222 Ga0105238_10007813
1223 Ga0105238_10032054
1224 Ga0105238_10052982
1225 Ga0105238_10078667
1226 Ga0105238_10081743
1227 Ga0105238_10227607
1228 Ga0105238_10232640
1229 Ga0105238_10239389
1230 Ga0105238_10413015
1231 Ga0105238_10684020
1232 Ga0105238_10743348
1233 Ga0105238_12184579
1234 Ga0105249_10035872
1235 Ga0105249_10064494
1236 Ga0105249_12137559
1237 Ga0105239_10001873
1238 Ga0105239_10004032
1239 Ga0105239_10007426
1240 Ga0105239_10054842
1241 Ga0105239_10096949
1242 Ga0105239_10307055
1243 Ga0105239_10316960
1244 Ga0105239_10337112
1245 Ga0105239_10770631
1246 Ga0105239_13561122
1247 Ga0105246_10006772
1248 Ga0105246_10467531
1249 Ga0105246_10884187
1250 Ga0157373_10000734
1251 Ga0157373_10053519
1252 Ga0157373_10459506
1253 Ga0157373_10577668
1254 Ga0157373_11562317
1255 Ga0157371_10029907
1256 Ga0157371_10279736
1257 Ga0157370_10000107
1258 Ga0157370_10010187
1259 Ga0157370_10011099
1260 Ga0157370_10021637
1261 Ga0157370_10028338
1262 Ga0157370_10052263
1263 Ga0157370_10061945
1264 Ga0157370_10101058
1265 Ga0157370_10192159
1266 Ga0157370_10192399
1267 Ga0157370_10361919
1268 Ga0157370_10498118
1269 Ga0157370_10549010
1270 Ga0157370_10838706
1271 Ga0157370_11795871
1272 Ga0157369_10000275
1273 Ga0157369_10002075
1274 Ga0157369_10003741
1275 Ga0157369_10014204
1276 Ga0157369_10017062
1277 Ga0157369_10017846
1278 Ga0157369_10021414
1279 Ga0157369_10042732
1280 Ga0157369_10079311
1281 Ga0157369_10089774
1282 Ga0157369_10092522
1283 Ga0157369_10097179
1284 Ga0157369_10099468
1285 Ga0157369_10112954
1286 Ga0157369_10138740
1287 Ga0157369_10274304
1288 Ga0157369_10339131
1289 Ga0157369_10519471
1290 Ga0157369_11827151
1291 Ga0157374_10009059
1292 Ga0157374_10009888
1293 Ga0157374_10025221
1294 Ga0157374_10043879
1295 Ga0157374_10076869
1296 Ga0157374_10216396
1297 Ga0157374_10220706
1298 Ga0157374_10828369
1299 Ga0157374_10847509
1300 Ga0157374_10884859
1301 Ga0157374_10958257
1302 Ga0157374_11251476
1303 Ga0157374_11725672
1304 Ga0157378_10017511
1305 Ga0157378_10029194
1306 Ga0157378_10037831
1307 Ga0157378_10078165
1308 Ga0157378_10090679
1309 Ga0157378_10110831
1310 Ga0163162_10050845
1311 Ga0163162_10442181
1312 Ga0163162_10474961
1313 Ga0163162_10974753
1314 Ga0157372_10000127
1315 Ga0157372_10001526
1316 Ga0157372_10004316
1317 Ga0157372_10011047
1318 Ga0157372_10016987
1319 Ga0157372_10020604
1320 Ga0157372_10023808
1321 Ga0157372_10024442
1322 Ga0157372_10030644
1323 Ga0157372_10044759
1324 Ga0157372_10047346
1325 Ga0157372_10056981
1326 Ga0157372_10076793
1327 Ga0157372_10096852
1328 Ga0157372_10099093
1329 Ga0157372_10112432
1330 Ga0157372_10179432
1331 Ga0157372_10191598
1332 Ga0157372_10212721
1333 Ga0157372_10252014
1334 Ga0157372_10307228
1335 Ga0157372_10459844
1336 Ga0157372_10566334
1337 Ga0157375_10011935
1338 Ga0157375_10015926
1339 Ga0157375_10032288
1340 Ga0157375_10257217
1341 Ga0157375_11208298
1342 Ga0163163_10016141
1343 Ga0163163_10065040
1344 Ga0163163_10122743
1345 Ga0157380_10173810
1346 Ga0182008_10229877
1347 Ga0157377_10089227
1348 Ga0157379_10005183
1349 Ga0157379_10018173
1350 Ga0157379_10074904
1351 Ga0157379_10140759
1352 Ga0157379_11310565
1353 Ga0157376_10001195
1354 Ga0157376_10021210
1355 Ga0157376_10104173
1356 Ga0157376_10159694
1357 Ga0157376_10192979
1358 Ga0157376_10265556
1359 Ga0157376_11914256
1360 Ga0163161_10035791
1361 Ga0197907_11423606
1362 Ga0206356_11265128
1363 Ga0206351_10892278
1364 Ga0206352_10576970
1365 Ga0206352_11317142
1366 Ga0206354_10491568
1367 Ga0206354_10556744
1368 Ga0206353_11896668
1369 Ga0154015_1346029
1370 Ga0154015_1571093
1371 Ga0213872_10025707
1372 Ga0213872_10048157
1373 Ga0213872_10106642
1374 Ga0213872_10115337
1375 Ga0213874_10349338
1376 Ga0213871_10021294
1377 Ga0213871_10039638
1378 Ga0207697_10026675
1379 Ga0207656_10029705
1380 Ga0207656_10039750
1381 Ga0207656_10057652
1382 Ga0207656_10091433
1383 Ga0207656_10159065
1384 Ga0207656_10334267
1385 Ga0207692_10663357
1386 Ga0207710_10008632
1387 Ga0207710_10165353
1388 Ga0207710_10406345
1389 Ga0207688_10034034
1390 Ga0207688_10318402
1391 Ga0207647_10007335
1392 Ga0207647_10046122
1393 Ga0207647_10096372
1394 Ga0207685_10077323
1395 Ga0207699_11006898
1396 Ga0207645_10005882
1397 Ga0207705_10035919
1398 Ga0207705_10051275
1399 Ga0207705_10052224
1400 Ga0207705_10077691
1401 Ga0207705_10593242
1402 Ga0207705_11227478
1403 Ga0207705_11333878
1404 Ga0207654_10000013
1405 Ga0207654_10000219
1406 Ga0207654_10006439
1407 Ga0207654_10027124
1408 Ga0207654_10111395
1409 Ga0207654_10123076
1410 Ga0207654_10130565
1411 Ga0207654_10496501
1412 Ga0207654_10534572
1413 Ga0207707_10007146
1414 Ga0207707_10030886
1415 Ga0207707_10070052
1416 Ga0207707_10846436
1417 Ga0207707_11055558
1418 Ga0207695_10000233
1419 Ga0207695_10000258
1420 Ga0207695_10000398
1421 Ga0207695_10000501
1422 Ga0207695_10005107
1423 Ga0207695_10009332
1424 Ga0207695_10069784
1425 Ga0207695_10089803
1426 Ga0207695_10095375
1427 Ga0207695_10125935
1428 Ga0207695_10137036
1429 Ga0207695_10260032
1430 Ga0207695_10326451
1431 Ga0207695_10518431
1432 Ga0207695_10747188
1433 Ga0207671_10000022
1434 Ga0207671_10001087
1435 Ga0207671_10054501
1436 Ga0207671_10123056
1437 Ga0207671_10351187
1438 Ga0207693_10496298
1439 Ga0207663_10064936
1440 Ga0207663_10084866
1441 Ga0207663_10644198
1442 Ga0207660_10049572
1443 Ga0207660_10087558
1444 Ga0207660_10107284
1445 Ga0207660_10446806
1446 Ga0207660_10462142
1447 Ga0207660_10719764
1448 Ga0207660_10724152
1449 Ga0207660_11061230
1450 Ga0207657_10107475
1451 Ga0207657_10108566
1452 Ga0207657_10226742
1453 Ga0207649_10014261
1454 Ga0207649_10349614
1455 Ga0207649_10357049
1456 Ga0207652_10172244
1457 Ga0207652_10434536
1458 Ga0207652_10497440
1459 Ga0207652_10811748
1460 Ga0207652_11033143
1461 Ga0207681_10505328
1462 Ga0207681_11139914
1463 Ga0207694_10000009
1464 Ga0207694_10000682
1465 Ga0207694_10001146
1466 Ga0207694_10042704
1467 Ga0207694_10078940
1468 Ga0207694_10273007
1469 Ga0207694_10378282
1470 Ga0207694_10497979
1471 Ga0207694_10572608
1472 Ga0207694_10723890
1473 Ga0207694_10831456
1474 Ga0207659_10110682
1475 Ga0207659_10437636
1476 Ga0207687_10063915
1477 Ga0207687_10112375
1478 Ga0207687_10171439
1479 Ga0207687_10390703
1480 Ga0207687_10521880
1481 Ga0207687_10856468
1482 Ga0207700_10002175
1483 Ga0207700_10984627
1484 Ga0207664_10318671
1485 Ga0207644_10069804
1486 Ga0207644_10240824
1487 Ga0207644_10303894
1488 Ga0207690_10228223
1489 Ga0207690_10536159
1490 Ga0207706_10013501
1491 Ga0207686_10074609
1492 Ga0207709_10021388
1493 Ga0207670_10460519
1494 Ga0207704_10278017
1495 Ga0207704_10286135
1496 Ga0207691_10010218
1497 Ga0207711_10000008
1498 Ga0207711_10000010
1499 Ga0207711_10016171
1500 Ga0207711_10053830
1501 Ga0207711_10184420
1502 Ga0207711_10445447
1503 Ga0207689_10000543
1504 Ga0207689_10028697
1505 Ga0207661_10002791
1506 Ga0207661_10017763
1507 Ga0207661_10074641
1508 Ga0207661_10111456
1509 Ga0207661_10132114
1510 Ga0207661_10149798
1511 Ga0207661_10164465
1512 Ga0207679_10050554
1513 Ga0207667_10000930
1514 Ga0207667_10001644
1515 Ga0207667_10007052
1516 Ga0207667_10007746
1517 Ga0207667_10011149
1518 Ga0207667_10034028
1519 Ga0207667_10034303
1520 Ga0207667_10062025
1521 Ga0207667_10090955
1522 Ga0207667_10299733
1523 Ga0207667_10485896
1524 Ga0207667_10677006
1525 Ga0207667_11014428
1526 Ga0207667_11099345
1527 Ga0207651_10055776
1528 Ga0207712_10018867
1529 Ga0207712_10078847
1530 Ga0207640_10042322
1531 Ga0207640_11528230
1532 Ga0207640_12032103
1533 Ga0207658_10048455
1534 Ga0207658_10328029
1535 Ga0207677_10002256
1536 Ga0207677_10026651
1537 Ga0207677_10137836
1538 Ga0207677_10694240
1539 Ga0207703_11794843
1540 Ga0207639_10002669
1541 Ga0207639_10067330
1542 Ga0207639_10068103
1543 Ga0207639_10126360
1544 Ga0207639_10175555
1545 Ga0207639_10927215
1546 Ga0207678_10001021
1547 Ga0207678_10029470
1548 Ga0207678_10168013
1549 Ga0207678_10198662
1550 Ga0207678_10407698
1551 Ga0207708_10142552
1552 Ga0207708_10867766
1553 Ga0207702_10008532
1554 Ga0207702_10026962
1555 Ga0207702_10032700
1556 Ga0207702_10137200
1557 Ga0207702_10227246
1558 Ga0207702_10509216
1559 Ga0207641_10105295
1560 Ga0207641_10537005
1561 Ga0207648_11031637
1562 Ga0207676_10002800
1563 Ga0207676_10087223
1564 Ga0207674_10001254
1565 Ga0207674_10001761
1566 Ga0207674_10003906
1567 Ga0207674_10232890
1568 Ga0207674_10348926
1569 Ga0207674_10725269
1570 Ga0207675_100410887
1571 Ga0207683_10000329
1572 Ga0207683_10251139
1573 Ga0207698_10000109
1574 Ga0207698_10002320
1575 Ga0207698_10041267
1576 Ga0207698_10099352
1577 Ga0207698_10107593
1578 Ga0207698_10287994
1579 Ga0207698_10300006
1580 Ga0207698_10687859
1581 Ga0207698_10824643
1582 Ga0207698_11412049
1583 Ga0209967_1035577
1584 Ga0210000_1016879
1585 Ga0209968_1030049
1586 Ga0209999_1003706
1587 Ga0209966_1138527
1588 Ga0207428_10011495
1589 Ga0268266_10014819
1590 Ga0268266_10108658
1591 Ga0268266_10159323
1592 Ga0268266_10161622
1593 Ga0268266_10634349
1594 Ga0268266_10813973
1595 Ga0268266_10852963
1596 Ga0268265_10228555
1597 Ga0268265_12594909
1598 Ga0268264_10025217
1599 Ga0265319_1165439
1600 Ga0265318_10045097
1601 Ga0265318_10075307
1602 Ga0265318_10234322
1603 Ga0265318_10271068
1604 Ga0265323_10149059
1605 Ga0265323_10188211
1606 Ga0265336_10003228
1607 Ga0265338_10004864
1608 Ga0265338_10009983
1609 Ga0265338_10027301
1610 Ga0265338_10058037
1611 Ga0265338_10271109
1612 Ga0265338_10471957
1613 Ga0265338_10640100
1614 Ga0265338_10856134
1615 Ga0265338_11000875
1616 Ga0265770_1011796
1617 Ga0265770_1021466
1618 Ga0265765_1017833
1619 Ga0265760_10064375
1620 Ga0265760_10330854
1621 Ga0265330_10002436
1622 Ga0265330_10018567
1623 Ga0265330_10023360
1624 Ga0265330_10092375
1625 Ga0265330_10099791
1626 Ga0265330_10112096
1627 Ga0265330_10204034
1628 Ga0265330_10215016
1629 Ga0265332_10081563
1630 Ga0265328_10026137
1631 Ga0265328_10048673
1632 Ga0265325_10000115
1633 Ga0265325_10016335
1634 Ga0265325_10038953
1635 Ga0265325_10039205
1636 Ga0265325_10069413
1637 Ga0265325_10365419
1638 Ga0265325_10430213
1639 Ga0265329_10038904
1640 Ga0265340_10011351
1641 Ga0265340_10076277
1642 Ga0265340_10094114
1643 Ga0265340_10123160
1644 Ga0265340_10125515
1645 Ga0265340_10183842
1646 Ga0265339_10000557
1647 Ga0265339_10000694
1648 Ga0265339_10003616
1649 Ga0265339_10073954
1650 Ga0265339_10263109
1651 Ga0265316_10001818
1652 Ga0265316_10016452
1653 Ga0265316_10067550
1654 Ga0265316_10122599
1655 Ga0265316_10131782
1656 Ga0265316_10151408
1657 Ga0265316_10379797
1658 Ga0265316_10400247
1659 Ga0265316_10979057
1660 Ga0265313_10003472
1661 Ga0265313_10011695
1662 Ga0265313_10045080
1663 Ga0265313_10097836
1664 Ga0265314_10000081
1665 Ga0265314_10041564
1666 Ga0265314_10106077
1667 Ga0265314_10377088
1668 Ga0265342_10001506
1669 Ga0265342_10004150
1670 Ga0265342_10009471
1671 Ga0265342_10018805
1672 Ga0265342_10044547
1673 Ga0265342_10087771
1674 Ga0265342_10088974
1675 Ga0265342_10098523
1676 Ga0265342_10120751
1677 Ga0265342_10288221
1678 Ga0307413_11770369
1679 Ga0307407_10575892
1680 Ga0307412_10000867
1681 Ga0307416_100014064
1682 Ga0307411_10791410
1683 Ga0316212_1055856
1684 Ga0373934_0041393
1685 Ga0373923_0102840
1686 Ga0373954_0076840
1687 Ga0373956_0188645
1688 Ga0373956_0245959
1689 Ga0373943_0066714
1690 Ga0373935_0020449
1691 Ga0373935_0474696
1692 Ga0373927_0177651
1693 Ga0373933_0016019
1694 Ga0373933_0039060
1695 Ga0373933_0450197
1696 Ga0373947_0280848
1697 Ga0373937_0129068
1698 Ga0373937_0219266
1699 Ga0373937_1447729
1700 Ga0373925_0085805
1701 Ga0395899_0000049
1702 Ga0395900_0183023
1703 Ga0395900_0237534
1704 Ga0395900_0323935
1705 Ga0395900_0492583
1706 Ga0395898_0383162
1707 Ga0395898_1623608
1708 Ga0395905_1368075
1709 Ga0395901_1077642
1710 Ga0436365_1104300
1711 Ga0436360_0796911
1712 Ga0436360_1350082
1713 Ga0436361_0032893
1714 Ga0436361_0111045
1715 Ga0436361_0212937
1716 Ga0436361_0412341
1717 Ga0436361_0664017
1718 Ga0436361_1088884
1719 Ga0436361_1207243
1720 Ga0436363_0818606
1721 Ga0436362_0601495
1722 Ga0439439_0001461
1723 Ga0451802_0641939
1724 Ga0439448_0025639
1725 Ga0439434_0011608
1726 Ga0451577_0000156
1727 Ga0451577_0001689
1728 Ga0451577_0350863
1729 Ga0451577_0547590
1730 Ga0466969_0086927
1731 Ga0466969_0480599
1732 Ga0466966_0427979
1733 Ga0466966_0704025
1734 Ga0466961_0488986
1735 Ga0466963_0000873
1736 Ga0466963_0111430
1737 Ga0466963_0317102
1738 Ga0466963_1034897
1739 Ga0453684_0000330
1740 Ga0466959_0461360
1741 Ga0466959_1043589
1742 Ga0466958_0346800
1743 Ga0466958_0386573
1744 Ga0466958_0510676
1745 Ga0466967_0003352
1746 Ga0466967_0574163
1747 Ga0466967_1253151
1748 Ga0495603_0750882
1749 Ga0495629_0030602
1750 Ga0495629_0123323
1751 Ga0495629_0229166
1752 Ga0495638_0072399
1753 Ga0495651_0056152
1754 Ga0495653_0037610
1755 Ga0495580_0004972
1756 Ga0495580_0151490
1757 Ga0495639_0274708
1758 Ga0495639_0630219
1759 Ga0495585_0388442
1760 Ga0495594_0028271
1761 Ga0495583_0288032
1762 Ga0495606_0011416
1763 Ga0495606_0252848
1764 Ga0495608_0037060
1765 Ga0495608_0443132
1766 Ga0495618_0047791
1767 Ga0495628_0274807
1768 Ga0495630_0025413
1769 Ga0495652_0006717
1770 Ga0495652_0093962
1771 Ga0495665_0007352
1772 Ga0495640_0315436
1773 Ga0495587_0000661
1774 Ga0495587_0241525
1775 Ga0495645_0002092
1776 Ga0495645_0051474
1777 Ga0495645_0615865
1778 Ga0495667_0001594
1779 Ga0495634_0332245
1780 Ga0495635_0942356
1781 Ga0495657_0209785
1782 Ga0495599_0003492
1783 Ga0495599_0352514
1784 Ga0495623_0101297
1785 Ga0495623_0542885
1786 Ga0495646_0281853
1787 Ga0495669_0052475
1788 Ga0495613_0076371
1789 Ga0495613_0172457
1790 Ga0495613_0814292
1791 Ga0495581_0562687
1792 Ga0495604_0452631
1793 Ga0495674_0771961
1794 Ga0495674_0931111
1795 Ga0495674_1454373
1796 Ga0495680_0300434
1797 Ga0495675_0055752
1798 Ga0495684_0037556
1799 Ga0495684_0429877
1800 Ga0495686_0004892
1801 Ga0495686_0015720
1802 Ga0495602_0045410
1803 Ga0495602_0501328
1804 Ga0496101_0297462
1805 Ga0496102_0168814
1806 Ga0496104_0287969
1807 Ga0496104_0498310
1808 Ga0496104_0743084
1809 Ga0496105_0076727
1810 Ga0496105_0406818
1811 Ga0496105_0566538
1812 Ga0496106_0045792
1813 Ga0496106_0426562
1814 Ga0496109_0139862
1815 Ga0496109_0615121
1816 Ga0496109_1015050
1817 Ga0496110_0062072
1818 Ga0496112_0623082
1819 Ga0496113_0959534
1820 Ga0496114_1026635
1821 Ga0496115_0124505
1822 Ga0496115_0130462
1823 Ga0496119_0250072
1824 Ga0496120_0279265
1825 Ga0496126_0009992
1826 Ga0496126_0015586
1827 Ga0501034_0228194
1828 Ga0501038_0091426
1829 Ga0501047_0084069
1830 Ga0501070_1536464
1831 Ga0501073_0491743
1832 Ga0501044_0123737
1833 nmdc:mga09592_497300_c1
1834 nmdc:mga0qj67_38045_c1
1835 nmdc:mga08y16_440548_c1
1836 nmdc:mga08x19_26821_c1
1837 Ga0495601_0105045
1838 Ga0495601_0192541
1839 Ga0495601_0496315
1840 Ga0495612_0178694
1841 Ga0495619_0057510
1842 Ga0500572_236537
1843 2852627099
1844 2884935167

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9638 2 135
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.963 2 135
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9432 2 135
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9424 2 135
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9361 2 135
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9535 2 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9361 2 135 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9267 1 134 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9195 2 135 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9186 1 134 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A372ISJ7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 1.002 1 135 GO:0046872
GO:0070497
AF-A0A1H4JCJ5-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 1.001 1 135 GO:0046872
GO:0070497
AF-A0A372ISJ7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9943 1 135 GO:0046872
GO:0070497
AF-A0A383CQG5-F1-model_v4 6-pyruvoyltetrahydropterin synthase 0.9901 1 87 GO:0016829
GO:0046872
AF-A0A846PD74-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.99 1 136 GO:0016829
GO:0046872

Map