F485801
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 922 | 299 | 1844 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300031239|Ga0265328_10088360|Ga0265328_100883602 |
| Length | 157 |
| Sequence | MIYLTRRATFSASHYYWNDAWTAEKNEQVFGRCSRRAGHGHNYTLEVTVAGEPDPVTGFVVDLKWLKDAIEREVLDAWDHRHLNLEAPEFTEGKLIPTTENLAIAAWKRLEPAVTAAGGARLSRVRIYETPEIFAEYRGPHVRRGGFVSGVDDEGGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 221 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 222 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 298 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 299 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.05 |
| Metatranscriptomes | 1.74 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 2.17 |
| Rhizosphere | 96.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265328_10088360 | 3300031239 | Unclassified | 1144 |
| 2 | rootH1_10160945 | 3300003316 | Bacteria | 2393 |
| 3 | rootH2_10026678 | 3300003320 | Unclassified | 2694 |
| 4 | rootH2_10165665 | 3300003320 | Unclassified | 2365 |
| 5 | rootH2_10260805 | 3300003320 | Unclassified | 1380 |
| 6 | rootL2_10200354 | 3300003322 | Bacteria | 4503 |
| 7 | Ga0058862_12011688 | 3300004803 | Bacteria | 656 |
| 8 | Ga0065714_10006998 | 3300005288 | Bacteria | 3043 |
| 9 | Ga0065704_10036673 | 3300005289 | Unclassified | 843 |
| 10 | Ga0065712_10217890 | 3300005290 | Unclassified | 1051 |
| 11 | Ga0065707_10937773 | 3300005295 | Bacteria | 556 |
| 12 | Ga0070658_10023555 | 3300005327 | Bacteria | 4940 |
| 13 | Ga0070658_10032764 | 3300005327 | Bacteria | 4178 |
| 14 | Ga0070658_10080374 | 3300005327 | Bacteria | 2678 |
| 15 | Ga0070658_10084667 | 3300005327 | Bacteria | 2607 |
| 16 | Ga0070658_10203144 | 3300005327 | Bacteria | 1672 |
| 17 | Ga0070683_100001556 | 3300005329 | Bacteria | 17746 |
| 18 | Ga0070683_100023527 | 3300005329 | Bacteria | 5510 |
| 19 | Ga0070683_100081436 | 3300005329 | Bacteria | 3031 |
| 20 | Ga0070683_100119774 | 3300005329 | Unclassified | 2486 |
| 21 | Ga0070683_100132018 | 3300005329 | Bacteria | 2364 |
| 22 | Ga0070683_100185303 | 3300005329 | Bacteria | 1976 |
| 23 | Ga0070683_100211522 | 3300005329 | Bacteria | 1842 |
| 24 | Ga0070683_100322832 | 3300005329 | Bacteria | 1469 |
| 25 | Ga0070690_100529017 | 3300005330 | Bacteria | 886 |
| 26 | Ga0068869_100017699 | 3300005334 | Bacteria | 4838 |
| 27 | Ga0068869_100213801 | 3300005334 | Bacteria | 1526 |
| 28 | Ga0068869_101467597 | 3300005334 | Bacteria | 605 |
| 29 | Ga0070666_10028737 | 3300005335 | Bacteria | 3651 |
| 30 | Ga0070666_10359297 | 3300005335 | Bacteria | 1043 |
| 31 | Ga0070680_100042940 | 3300005336 | Bacteria | 3670 |
| 32 | Ga0070680_100197399 | 3300005336 | Bacteria | 1696 |
| 33 | Ga0070680_100287859 | 3300005336 | Bacteria | 1392 |
| 34 | Ga0070680_100329878 | 3300005336 | Unclassified | 1296 |
| 35 | Ga0070680_100350120 | 3300005336 | Bacteria | 1256 |
| 36 | Ga0070680_100945723 | 3300005336 | Bacteria | 744 |
| 37 | Ga0068868_100004476 | 3300005338 | Bacteria | 9800 |
| 38 | Ga0068868_100015337 | 3300005338 | Bacteria | 5665 |
| 39 | Ga0068868_100022297 | 3300005338 | Bacteria | 4776 |
| 40 | Ga0068868_100346578 | 3300005338 | Bacteria | 1271 |
| 41 | Ga0068868_100476518 | 3300005338 | Bacteria | 1089 |
| 42 | Ga0068868_100740633 | 3300005338 | Unclassified | 882 |
| 43 | Ga0070660_100006768 | 3300005339 | Bacteria | 7956 |
| 44 | Ga0070660_100054107 | 3300005339 | Bacteria | 3098 |
| 45 | Ga0070660_100101301 | 3300005339 | Unclassified | 2282 |
| 46 | Ga0070689_100490055 | 3300005340 | Unclassified | 1051 |
| 47 | Ga0070691_10039203 | 3300005341 | Unclassified | 2238 |
| 48 | Ga0070691_10368595 | 3300005341 | Bacteria | 802 |
| 49 | Ga0070691_10860431 | 3300005341 | Bacteria | 556 |
| 50 | Ga0070661_100003065 | 3300005344 | Bacteria | 11492 |
| 51 | Ga0070661_100004616 | 3300005344 | Bacteria | 9480 |
| 52 | Ga0070661_100107987 | 3300005344 | Bacteria | 2076 |
| 53 | Ga0070661_100194418 | 3300005344 | Bacteria | 1548 |
| 54 | Ga0070661_100951947 | 3300005344 | Bacteria | 711 |
| 55 | Ga0070668_100061780 | 3300005347 | Bacteria | 2903 |
| 56 | Ga0070669_100469884 | 3300005353 | Bacteria | 1039 |
| 57 | Ga0070669_100787855 | 3300005353 | Unclassified | 807 |
| 58 | Ga0070675_100186492 | 3300005354 | Bacteria | 1795 |
| 59 | Ga0070675_100188659 | 3300005354 | Bacteria | 1785 |
| 60 | Ga0070671_100025737 | 3300005355 | Bacteria | 4831 |
| 61 | Ga0070671_100027068 | 3300005355 | Bacteria | 4717 |
| 62 | Ga0070671_100131020 | 3300005355 | Bacteria | 2112 |
| 63 | Ga0070671_100775859 | 3300005355 | Bacteria | 834 |
| 64 | Ga0070673_100023375 | 3300005364 | Bacteria | 4516 |
| 65 | Ga0070673_100362368 | 3300005364 | Bacteria | 1289 |
| 66 | Ga0070659_100200491 | 3300005366 | Bacteria | 1642 |
| 67 | Ga0070659_101006636 | 3300005366 | Bacteria | 732 |
| 68 | Ga0070667_100006815 | 3300005367 | Bacteria | 9489 |
| 69 | Ga0070667_100049090 | 3300005367 | Bacteria | 3554 |
| 70 | Ga0070667_102316328 | 3300005367 | Bacteria | 506 |
| 71 | Ga0070709_10069913 | 3300005434 | Bacteria | 2262 |
| 72 | Ga0070709_10385238 | 3300005434 | Unclassified | 1043 |
| 73 | Ga0070709_11178743 | 3300005434 | Bacteria | 615 |
| 74 | Ga0070714_100014205 | 3300005435 | Bacteria | 6394 |
| 75 | Ga0070714_100690404 | 3300005435 | Bacteria | 984 |
| 76 | Ga0070713_100010367 | 3300005436 | Bacteria | 6733 |
| 77 | Ga0070713_100315805 | 3300005436 | Unclassified | 1442 |
| 78 | Ga0070713_100740150 | 3300005436 | Unclassified | 940 |
| 79 | Ga0070710_10172280 | 3300005437 | Unclassified | 1349 |
| 80 | Ga0070710_10845429 | 3300005437 | Unclassified | 657 |
| 81 | Ga0070711_100102773 | 3300005439 | Unclassified | 2082 |
| 82 | Ga0070711_100285151 | 3300005439 | Bacteria | 1308 |
| 83 | Ga0070711_101050785 | 3300005439 | Unclassified | 700 |
| 84 | Ga0070705_100458253 | 3300005440 | Bacteria | 958 |
| 85 | Ga0070663_100031150 | 3300005455 | Bacteria | 3663 |
| 86 | Ga0070663_100290365 | 3300005455 | Bacteria | 1306 |
| 87 | Ga0070663_100627248 | 3300005455 | Bacteria | 907 |
| 88 | Ga0070663_100745487 | 3300005455 | Bacteria | 836 |
| 89 | Ga0070663_100820753 | 3300005455 | Bacteria | 798 |
| 90 | Ga0070678_100003237 | 3300005456 | Bacteria | 9044 |
| 91 | Ga0070662_100082083 | 3300005457 | Bacteria | 2403 |
| 92 | Ga0070681_10003755 | 3300005458 | Bacteria | 14254 |
| 93 | Ga0070681_10004476 | 3300005458 | Bacteria | 13323 |
| 94 | Ga0070681_10470233 | 3300005458 | Bacteria | 1170 |
| 95 | Ga0070681_10755568 | 3300005458 | Bacteria | 889 |
| 96 | Ga0070698_100000535 | 3300005471 | Bacteria | 40564 |
| 97 | Ga0070699_100080454 | 3300005518 | Bacteria | 2840 |
| 98 | Ga0070699_100853161 | 3300005518 | Unclassified | 834 |
| 99 | Ga0070679_100020623 | 3300005530 | Bacteria | 6427 |
| 100 | Ga0070679_100112249 | 3300005530 | Bacteria | 2712 |
| 101 | Ga0070679_100341361 | 3300005530 | Bacteria | 1446 |
| 102 | Ga0070679_100357345 | 3300005530 | Bacteria | 1408 |
| 103 | Ga0070679_100385382 | 3300005530 | Bacteria | 1348 |
| 104 | Ga0070679_100394852 | 3300005530 | Unclassified | 1329 |
| 105 | Ga0070684_100002861 | 3300005535 | Bacteria | 12829 |
| 106 | Ga0070684_100005055 | 3300005535 | Bacteria | 10070 |
| 107 | Ga0070684_100021807 | 3300005535 | Bacteria | 5335 |
| 108 | Ga0070684_100050758 | 3300005535 | Bacteria | 3604 |
| 109 | Ga0070684_100630286 | 3300005535 | Bacteria | 997 |
| 110 | Ga0070684_100745168 | 3300005535 | Unclassified | 914 |
| 111 | Ga0070684_101176267 | 3300005535 | Unclassified | 721 |
| 112 | Ga0070684_101289172 | 3300005535 | Bacteria | 687 |
| 113 | Ga0068853_100004104 | 3300005539 | Bacteria | 11220 |
| 114 | Ga0068853_100043023 | 3300005539 | Bacteria | 3864 |
| 115 | Ga0068853_100044174 | 3300005539 | Bacteria | 3814 |
| 116 | Ga0068853_100047503 | 3300005539 | Bacteria | 3683 |
| 117 | Ga0068853_100084324 | 3300005539 | Bacteria | 2784 |
| 118 | Ga0068853_100186843 | 3300005539 | Bacteria | 1881 |
| 119 | Ga0070672_100119666 | 3300005543 | Unclassified | 2154 |
| 120 | Ga0070665_100024742 | 3300005548 | Bacteria | 6049 |
| 121 | Ga0070665_100049315 | 3300005548 | Bacteria | 4225 |
| 122 | Ga0070665_100082946 | 3300005548 | Bacteria | 3211 |
| 123 | Ga0070665_100171818 | 3300005548 | Bacteria | 2168 |
| 124 | Ga0070665_100195887 | 3300005548 | Bacteria | 2021 |
| 125 | Ga0070665_100350010 | 3300005548 | Bacteria | 1483 |
| 126 | Ga0070665_100869712 | 3300005548 | Bacteria | 914 |
| 127 | Ga0070665_101608419 | 3300005548 | Bacteria | 658 |
| 128 | Ga0070704_100020808 | 3300005549 | Bacteria | 4239 |
| 129 | Ga0068855_100000819 | 3300005563 | Bacteria | 38473 |
| 130 | Ga0068855_100004206 | 3300005563 | Bacteria | 17569 |
| 131 | Ga0068855_100012254 | 3300005563 | Bacteria | 10363 |
| 132 | Ga0068855_100014110 | 3300005563 | Bacteria | 9629 |
| 133 | Ga0068855_100014511 | 3300005563 | Bacteria | 9488 |
| 134 | Ga0068855_100026325 | 3300005563 | Bacteria | 6958 |
| 135 | Ga0068855_100057916 | 3300005563 | Bacteria | 4541 |
| 136 | Ga0068855_100072112 | 3300005563 | Bacteria | 4015 |
| 137 | Ga0068855_100081457 | 3300005563 | Bacteria | 3751 |
| 138 | Ga0068855_100152156 | 3300005563 | Bacteria | 2630 |
| 139 | Ga0068855_100185794 | 3300005563 | Unclassified | 2347 |
| 140 | Ga0068855_100501351 | 3300005563 | Bacteria | 1319 |
| 141 | Ga0068855_100532933 | 3300005563 | Bacteria | 1273 |
| 142 | Ga0068855_100543429 | 3300005563 | Bacteria | 1258 |
| 143 | Ga0068855_100655331 | 3300005563 | Bacteria | 1127 |
| 144 | Ga0068855_100859036 | 3300005563 | Unclassified | 961 |
| 145 | Ga0068855_101147539 | 3300005563 | Bacteria | 810 |
| 146 | Ga0068855_101413872 | 3300005563 | Bacteria | 717 |
| 147 | Ga0068855_101814569 | 3300005563 | Bacteria | 619 |
| 148 | Ga0068855_102067886 | 3300005563 | Unclassified | 574 |
| 149 | Ga0068855_102144557 | 3300005563 | Bacteria | 562 |
| 150 | Ga0070664_100136329 | 3300005564 | Unclassified | 2159 |
| 151 | Ga0070664_100253364 | 3300005564 | Bacteria | 1583 |
| 152 | Ga0070664_101063845 | 3300005564 | Unclassified | 761 |
| 153 | Ga0068857_100001991 | 3300005577 | Bacteria | 16557 |
| 154 | Ga0068857_100083477 | 3300005577 | Bacteria | 2854 |
| 155 | Ga0068857_100235583 | 3300005577 | Bacteria | 1675 |
| 156 | Ga0068857_100335207 | 3300005577 | Bacteria | 1399 |
| 157 | Ga0068857_100564421 | 3300005577 | Bacteria | 1073 |
| 158 | Ga0068854_100058150 | 3300005578 | Unclassified | 2790 |
| 159 | Ga0068854_100368625 | 3300005578 | Unclassified | 1180 |
| 160 | Ga0068854_101203020 | 3300005578 | Bacteria | 679 |
| 161 | Ga0068856_100001782 | 3300005614 | Bacteria | 22500 |
| 162 | Ga0068856_100008091 | 3300005614 | Bacteria | 10266 |
| 163 | Ga0068856_100011451 | 3300005614 | Bacteria | 8606 |
| 164 | Ga0068856_100015606 | 3300005614 | Bacteria | 7344 |
| 165 | Ga0068856_100060352 | 3300005614 | Bacteria | 3746 |
| 166 | Ga0068856_100091653 | 3300005614 | Bacteria | 3023 |
| 167 | Ga0068856_100316967 | 3300005614 | Bacteria | 1577 |
| 168 | Ga0068856_100382337 | 3300005614 | Bacteria | 1427 |
| 169 | Ga0068856_100960335 | 3300005614 | Bacteria | 873 |
| 170 | Ga0068856_101692099 | 3300005614 | Unclassified | 645 |
| 171 | Ga0068852_100003017 | 3300005616 | Bacteria | 11711 |
| 172 | Ga0068852_100003172 | 3300005616 | Bacteria | 11474 |
| 173 | Ga0068852_100003318 | 3300005616 | Bacteria | 11236 |
| 174 | Ga0068852_100008628 | 3300005616 | Bacteria | 7527 |
| 175 | Ga0068852_100111185 | 3300005616 | Bacteria | 2491 |
| 176 | Ga0068852_100243251 | 3300005616 | Unclassified | 1721 |
| 177 | Ga0068852_100260003 | 3300005616 | Bacteria | 1666 |
| 178 | Ga0068852_100387959 | 3300005616 | Bacteria | 1371 |
| 179 | Ga0068852_100515525 | 3300005616 | Bacteria | 1192 |
| 180 | Ga0068852_100558806 | 3300005616 | Unclassified | 1145 |
| 181 | Ga0068852_100584811 | 3300005616 | Bacteria | 1120 |
| 182 | Ga0068852_100899394 | 3300005616 | Bacteria | 902 |
| 183 | Ga0068859_100083756 | 3300005617 | Bacteria | 3233 |
| 184 | Ga0068859_100102578 | 3300005617 | Bacteria | 2918 |
| 185 | Ga0068859_100860959 | 3300005617 | Bacteria | 992 |
| 186 | Ga0068859_100866161 | 3300005617 | Bacteria | 989 |
| 187 | Ga0068859_102353838 | 3300005617 | Unclassified | 587 |
| 188 | Ga0068864_100001011 | 3300005618 | Bacteria | 23500 |
| 189 | Ga0068851_10016720 | 3300005834 | Bacteria | 3515 |
| 190 | Ga0068851_10070517 | 3300005834 | Bacteria | 1807 |
| 191 | Ga0068851_10077545 | 3300005834 | Bacteria | 1730 |
| 192 | Ga0068851_10092843 | 3300005834 | Bacteria | 1591 |
| 193 | Ga0068851_10190298 | 3300005834 | Unclassified | 1140 |
| 194 | Ga0068851_10314664 | 3300005834 | Unclassified | 903 |
| 195 | Ga0068870_10567091 | 3300005840 | Bacteria | 767 |
| 196 | Ga0068863_100001678 | 3300005841 | Bacteria | 21916 |
| 197 | Ga0068863_100007398 | 3300005841 | Bacteria | 10747 |
| 198 | Ga0068863_101106728 | 3300005841 | Bacteria | 797 |
| 199 | Ga0068858_100003486 | 3300005842 | Bacteria | 15597 |
| 200 | Ga0068858_100203322 | 3300005842 | Bacteria | 1873 |
| 201 | Ga0068858_100284937 | 3300005842 | Bacteria | 1573 |
| 202 | Ga0068858_100476504 | 3300005842 | Bacteria | 1204 |
| 203 | Ga0068858_100682275 | 3300005842 | Unclassified | 999 |
| 204 | Ga0068860_100007224 | 3300005843 | Bacteria | 11106 |
| 205 | Ga0068860_100023371 | 3300005843 | Bacteria | 5974 |
| 206 | Ga0068860_100854229 | 3300005843 | Bacteria | 925 |
| 207 | Ga0068862_100244391 | 3300005844 | Bacteria | 1633 |
| 208 | Ga0068862_100883479 | 3300005844 | Unclassified | 878 |
| 209 | Ga0070717_10016965 | 3300006028 | Bacteria | 5656 |
| 210 | Ga0070717_10216768 | 3300006028 | Bacteria | 1681 |
| 211 | Ga0070717_11214219 | 3300006028 | Unclassified | 686 |
| 212 | Ga0070717_11379792 | 3300006028 | Bacteria | 640 |
| 213 | Ga0070712_100082293 | 3300006175 | Unclassified | 2335 |
| 214 | Ga0097621_100003579 | 3300006237 | Bacteria | 10736 |
| 215 | Ga0097621_100039628 | 3300006237 | Bacteria | 3785 |
| 216 | Ga0097621_101410398 | 3300006237 | Bacteria | 660 |
| 217 | Ga0068871_100003833 | 3300006358 | Bacteria | 10365 |
| 218 | Ga0068871_100020118 | 3300006358 | Bacteria | 5107 |
| 219 | Ga0068871_100028898 | 3300006358 | Bacteria | 4351 |
| 220 | Ga0068871_101305172 | 3300006358 | Bacteria | 683 |
| 221 | Ga0068871_101396223 | 3300006358 | Unclassified | 660 |
| 222 | Ga0075428_100272270 | 3300006844 | Unclassified | 1822 |
| 223 | Ga0075430_100032755 | 3300006846 | Bacteria | 4410 |
| 224 | Ga0075429_100009842 | 3300006880 | Bacteria | 8288 |
| 225 | Ga0075429_100488698 | 3300006880 | Bacteria | 1079 |
| 226 | Ga0075429_101549622 | 3300006880 | Unclassified | 576 |
| 227 | Ga0068865_100054112 | 3300006881 | Bacteria | 2787 |
| 228 | Ga0068865_101181530 | 3300006881 | Bacteria | 677 |
| 229 | Ga0075436_100032986 | 3300006914 | Bacteria | 3568 |
| 230 | Ga0097620_100083764 | 3300006931 | Bacteria | 3233 |
| 231 | Ga0097620_100102569 | 3300006931 | Bacteria | 2918 |
| 232 | Ga0097620_100861045 | 3300006931 | Bacteria | 992 |
| 233 | Ga0097620_100866296 | 3300006931 | Bacteria | 989 |
| 234 | Ga0097620_102354255 | 3300006931 | Unclassified | 587 |
| 235 | Ga0105240_10000531 | 3300009093 | Bacteria | 70393 |
| 236 | Ga0105240_10003431 | 3300009093 | Bacteria | 24635 |
| 237 | Ga0105240_10009850 | 3300009093 | Bacteria | 13489 |
| 238 | Ga0105240_10015189 | 3300009093 | Bacteria | 10478 |
| 239 | Ga0105240_10015938 | 3300009093 | Bacteria | 10194 |
| 240 | Ga0105240_10034845 | 3300009093 | Bacteria | 6490 |
| 241 | Ga0105240_10042759 | 3300009093 | Bacteria | 5771 |
| 242 | Ga0105240_10054107 | 3300009093 | Bacteria | 5031 |
| 243 | Ga0105240_10084928 | 3300009093 | Bacteria | 3880 |
| 244 | Ga0105240_10092926 | 3300009093 | Unclassified | 3683 |
| 245 | Ga0105240_10232022 | 3300009093 | Bacteria | 2144 |
| 246 | Ga0105240_10311733 | 3300009093 | Bacteria | 1797 |
| 247 | Ga0105240_10394695 | 3300009093 | Unclassified | 1560 |
| 248 | Ga0105240_10394867 | 3300009093 | Bacteria | 1559 |
| 249 | Ga0105240_10470736 | 3300009093 | Unclassified | 1402 |
| 250 | Ga0105240_10802720 | 3300009093 | Bacteria | 1019 |
| 251 | Ga0105240_10868925 | 3300009093 | Bacteria | 972 |
| 252 | Ga0105240_11241263 | 3300009093 | Bacteria | 788 |
| 253 | Ga0111539_10012544 | 3300009094 | Bacteria | 10619 |
| 254 | Ga0111539_10039250 | 3300009094 | Bacteria | 5708 |
| 255 | Ga0111539_11272971 | 3300009094 | Unclassified | 854 |
| 256 | Ga0105245_10006340 | 3300009098 | Bacteria | 10409 |
| 257 | Ga0105245_10032253 | 3300009098 | Unclassified | 4638 |
| 258 | Ga0105245_10045717 | 3300009098 | Bacteria | 3910 |
| 259 | Ga0105245_10073426 | 3300009098 | Bacteria | 3111 |
| 260 | Ga0105245_10152482 | 3300009098 | Bacteria | 2186 |
| 261 | Ga0105245_10480985 | 3300009098 | Bacteria | 1255 |
| 262 | Ga0105247_10016685 | 3300009101 | Bacteria | 4404 |
| 263 | Ga0105247_10094104 | 3300009101 | Bacteria | 1906 |
| 264 | Ga0105247_10168380 | 3300009101 | Unclassified | 1455 |
| 265 | Ga0114129_10168959 | 3300009147 | Unclassified | 2982 |
| 266 | Ga0114129_10616725 | 3300009147 | Bacteria | 1404 |
| 267 | Ga0105243_10009867 | 3300009148 | Bacteria | 7263 |
| 268 | Ga0105243_10782929 | 3300009148 | Bacteria | 938 |
| 269 | Ga0105241_10000199 | 3300009174 | Bacteria | 44908 |
| 270 | Ga0105241_10001305 | 3300009174 | Bacteria | 18974 |
| 271 | Ga0105241_10002734 | 3300009174 | Bacteria | 13219 |
| 272 | Ga0105241_10013210 | 3300009174 | Bacteria | 6053 |
| 273 | Ga0105241_10018485 | 3300009174 | Bacteria | 5127 |
| 274 | Ga0105241_10093630 | 3300009174 | Bacteria | 2375 |
| 275 | Ga0105241_10172273 | 3300009174 | Bacteria | 1789 |
| 276 | Ga0105241_10402184 | 3300009174 | Bacteria | 1201 |
| 277 | Ga0105241_10437407 | 3300009174 | Bacteria | 1154 |
| 278 | Ga0105241_10542257 | 3300009174 | Bacteria | 1043 |
| 279 | Ga0105241_10814294 | 3300009174 | Unclassified | 861 |
| 280 | Ga0105242_11204845 | 3300009176 | Unclassified | 777 |
| 281 | Ga0105248_10000004 | 3300009177 | Bacteria | 695244 |
| 282 | Ga0105248_10000255 | 3300009177 | Bacteria | 62145 |
| 283 | Ga0105248_10093925 | 3300009177 | Bacteria | 3378 |
| 284 | Ga0105248_10205747 | 3300009177 | Bacteria | 2218 |
| 285 | Ga0105248_10400748 | 3300009177 | Bacteria | 1545 |
| 286 | Ga0105248_10616549 | 3300009177 | Bacteria | 1224 |
| 287 | Ga0105248_11092470 | 3300009177 | Bacteria | 901 |
| 288 | Ga0105237_10003805 | 3300009545 | Bacteria | 17734 |
| 289 | Ga0105237_10019484 | 3300009545 | Bacteria | 7007 |
| 290 | Ga0105237_10050367 | 3300009545 | Bacteria | 4184 |
| 291 | Ga0105237_10230918 | 3300009545 | Bacteria | 1851 |
| 292 | Ga0105237_10247869 | 3300009545 | Bacteria | 1783 |
| 293 | Ga0105237_10265446 | 3300009545 | Bacteria | 1720 |
| 294 | Ga0105237_10321428 | 3300009545 | Unclassified | 1551 |
| 295 | Ga0105237_10345581 | 3300009545 | Unclassified | 1492 |
| 296 | Ga0105237_11543340 | 3300009545 | Bacteria | 671 |
| 297 | Ga0105238_10000262 | 3300009551 | Bacteria | 58846 |
| 298 | Ga0105238_10000292 | 3300009551 | Bacteria | 55692 |
| 299 | Ga0105238_10001340 | 3300009551 | Bacteria | 24728 |
| 300 | Ga0105238_10007813 | 3300009551 | Bacteria | 10696 |
| 301 | Ga0105238_10032054 | 3300009551 | Bacteria | 5348 |
| 302 | Ga0105238_10052982 | 3300009551 | Bacteria | 4078 |
| 303 | Ga0105238_10078667 | 3300009551 | Bacteria | 3288 |
| 304 | Ga0105238_10081743 | 3300009551 | Bacteria | 3220 |
| 305 | Ga0105238_10227607 | 3300009551 | Unclassified | 1841 |
| 306 | Ga0105238_10232640 | 3300009551 | Bacteria | 1819 |
| 307 | Ga0105238_10239389 | 3300009551 | Bacteria | 1792 |
| 308 | Ga0105238_10413015 | 3300009551 | Bacteria | 1343 |
| 309 | Ga0105238_10684020 | 3300009551 | Bacteria | 1037 |
| 310 | Ga0105238_10743348 | 3300009551 | Bacteria | 994 |
| 311 | Ga0105238_12184579 | 3300009551 | Unclassified | 588 |
| 312 | Ga0105249_10035872 | 3300009553 | Bacteria | 4497 |
| 313 | Ga0105249_10064494 | 3300009553 | Bacteria | 3368 |
| 314 | Ga0105249_12137559 | 3300009553 | Bacteria | 633 |
| 315 | Ga0105239_10001873 | 3300010375 | Bacteria | 27535 |
| 316 | Ga0105239_10004032 | 3300010375 | Bacteria | 17766 |
| 317 | Ga0105239_10007426 | 3300010375 | Bacteria | 12574 |
| 318 | Ga0105239_10054842 | 3300010375 | Bacteria | 4373 |
| 319 | Ga0105239_10096949 | 3300010375 | Bacteria | 3258 |
| 320 | Ga0105239_10307055 | 3300010375 | Bacteria | 1787 |
| 321 | Ga0105239_10316960 | 3300010375 | Bacteria | 1758 |
| 322 | Ga0105239_10337112 | 3300010375 | Bacteria | 1701 |
| 323 | Ga0105239_10770631 | 3300010375 | Unclassified | 1101 |
| 324 | Ga0105239_13561122 | 3300010375 | Unclassified | 506 |
| 325 | Ga0105246_10006772 | 3300011119 | Bacteria | 7006 |
| 326 | Ga0105246_10467531 | 3300011119 | Bacteria | 1064 |
| 327 | Ga0105246_10884187 | 3300011119 | Unclassified | 800 |
| 328 | Ga0157373_10000734 | 3300013100 | Bacteria | 25474 |
| 329 | Ga0157373_10053519 | 3300013100 | Bacteria | 2870 |
| 330 | Ga0157373_10459506 | 3300013100 | Bacteria | 917 |
| 331 | Ga0157373_10577668 | 3300013100 | Bacteria | 817 |
| 332 | Ga0157373_11562317 | 3300013100 | Unclassified | 505 |
| 333 | Ga0157371_10029907 | 3300013102 | Bacteria | 3933 |
| 334 | Ga0157371_10279736 | 3300013102 | Unclassified | 1205 |
| 335 | Ga0157370_10000107 | 3300013104 | Bacteria | 95413 |
| 336 | Ga0157370_10010187 | 3300013104 | Bacteria | 9927 |
| 337 | Ga0157370_10011099 | 3300013104 | Bacteria | 9444 |
| 338 | Ga0157370_10021637 | 3300013104 | Bacteria | 6407 |
| 339 | Ga0157370_10028338 | 3300013104 | Bacteria | 5511 |
| 340 | Ga0157370_10052263 | 3300013104 | Bacteria | 3901 |
| 341 | Ga0157370_10061945 | 3300013104 | Bacteria | 3550 |
| 342 | Ga0157370_10101058 | 3300013104 | Bacteria | 2701 |
| 343 | Ga0157370_10192159 | 3300013104 | Unclassified | 1895 |
| 344 | Ga0157370_10192399 | 3300013104 | Unclassified | 1894 |
| 345 | Ga0157370_10361919 | 3300013104 | Bacteria | 1337 |
| 346 | Ga0157370_10498118 | 3300013104 | Unclassified | 1119 |
| 347 | Ga0157370_10549010 | 3300013104 | Bacteria | 1059 |
| 348 | Ga0157370_10838706 | 3300013104 | Bacteria | 836 |
| 349 | Ga0157370_11795871 | 3300013104 | Bacteria | 550 |
| 350 | Ga0157369_10000275 | 3300013105 | Bacteria | 69270 |
| 351 | Ga0157369_10002075 | 3300013105 | Bacteria | 24207 |
| 352 | Ga0157369_10003741 | 3300013105 | Bacteria | 18074 |
| 353 | Ga0157369_10014204 | 3300013105 | Bacteria | 8996 |
| 354 | Ga0157369_10017062 | 3300013105 | Bacteria | 8157 |
| 355 | Ga0157369_10017846 | 3300013105 | Bacteria | 7966 |
| 356 | Ga0157369_10021414 | 3300013105 | Bacteria | 7232 |
| 357 | Ga0157369_10042732 | 3300013105 | Bacteria | 4944 |
| 358 | Ga0157369_10079311 | 3300013105 | Bacteria | 3517 |
| 359 | Ga0157369_10089774 | 3300013105 | Bacteria | 3281 |
| 360 | Ga0157369_10092522 | 3300013105 | Bacteria | 3227 |
| 361 | Ga0157369_10097179 | 3300013105 | Bacteria | 3142 |
| 362 | Ga0157369_10099468 | 3300013105 | Bacteria | 3101 |
| 363 | Ga0157369_10112954 | 3300013105 | Bacteria | 2886 |
| 364 | Ga0157369_10138740 | 3300013105 | Bacteria | 2573 |
| 365 | Ga0157369_10274304 | 3300013105 | Bacteria | 1757 |
| 366 | Ga0157369_10339131 | 3300013105 | Bacteria | 1561 |
| 367 | Ga0157369_10519471 | 3300013105 | Bacteria | 1232 |
| 368 | Ga0157369_11827151 | 3300013105 | Unclassified | 617 |
| 369 | Ga0157374_10009059 | 3300013296 | Bacteria | 8529 |
| 370 | Ga0157374_10009888 | 3300013296 | Bacteria | 8185 |
| 371 | Ga0157374_10025221 | 3300013296 | Bacteria | 5334 |
| 372 | Ga0157374_10043879 | 3300013296 | Bacteria | 4131 |
| 373 | Ga0157374_10076869 | 3300013296 | Bacteria | 3157 |
| 374 | Ga0157374_10216396 | 3300013296 | Unclassified | 1879 |
| 375 | Ga0157374_10220706 | 3300013296 | Bacteria | 1860 |
| 376 | Ga0157374_10828369 | 3300013296 | Bacteria | 942 |
| 377 | Ga0157374_10847509 | 3300013296 | Unclassified | 931 |
| 378 | Ga0157374_10884859 | 3300013296 | Bacteria | 910 |
| 379 | Ga0157374_10958257 | 3300013296 | Bacteria | 874 |
| 380 | Ga0157374_11251476 | 3300013296 | Unclassified | 764 |
| 381 | Ga0157374_11725672 | 3300013296 | Bacteria | 651 |
| 382 | Ga0157378_10017511 | 3300013297 | Bacteria | 6289 |
| 383 | Ga0157378_10029194 | 3300013297 | Bacteria | 4868 |
| 384 | Ga0157378_10037831 | 3300013297 | Bacteria | 4276 |
| 385 | Ga0157378_10078165 | 3300013297 | Bacteria | 2984 |
| 386 | Ga0157378_10090679 | 3300013297 | Bacteria | 2778 |
| 387 | Ga0157378_10110831 | 3300013297 | Unclassified | 2516 |
| 388 | Ga0163162_10050845 | 3300013306 | Unclassified | 4157 |
| 389 | Ga0163162_10442181 | 3300013306 | Bacteria | 1432 |
| 390 | Ga0163162_10474961 | 3300013306 | Bacteria | 1382 |
| 391 | Ga0163162_10974753 | 3300013306 | Bacteria | 958 |
| 392 | Ga0157372_10000127 | 3300013307 | Bacteria | 82699 |
| 393 | Ga0157372_10001526 | 3300013307 | Bacteria | 25177 |
| 394 | Ga0157372_10004316 | 3300013307 | Bacteria | 15198 |
| 395 | Ga0157372_10011047 | 3300013307 | Bacteria | 9608 |
| 396 | Ga0157372_10016987 | 3300013307 | Bacteria | 7812 |
| 397 | Ga0157372_10020604 | 3300013307 | Bacteria | 7116 |
| 398 | Ga0157372_10023808 | 3300013307 | Bacteria | 6643 |
| 399 | Ga0157372_10024442 | 3300013307 | Bacteria | 6562 |
| 400 | Ga0157372_10030644 | 3300013307 | Bacteria | 5885 |
| 401 | Ga0157372_10044759 | 3300013307 | Bacteria | 4905 |
| 402 | Ga0157372_10047346 | 3300013307 | Bacteria | 4778 |
| 403 | Ga0157372_10056981 | 3300013307 | Bacteria | 4367 |
| 404 | Ga0157372_10076793 | 3300013307 | Unclassified | 3772 |
| 405 | Ga0157372_10096852 | 3300013307 | Unclassified | 3363 |
| 406 | Ga0157372_10099093 | 3300013307 | Bacteria | 3324 |
| 407 | Ga0157372_10112432 | 3300013307 | Bacteria | 3120 |
| 408 | Ga0157372_10179432 | 3300013307 | Bacteria | 2451 |
| 409 | Ga0157372_10191598 | 3300013307 | Bacteria | 2368 |
| 410 | Ga0157372_10212721 | 3300013307 | Bacteria | 2241 |
| 411 | Ga0157372_10252014 | 3300013307 | Unclassified | 2049 |
| 412 | Ga0157372_10307228 | 3300013307 | Unclassified | 1845 |
| 413 | Ga0157372_10459844 | 3300013307 | Bacteria | 1483 |
| 414 | Ga0157372_10566334 | 3300013307 | Bacteria | 1324 |
| 415 | Ga0157375_10011935 | 3300013308 | Bacteria | 7687 |
| 416 | Ga0157375_10015926 | 3300013308 | Bacteria | 6742 |
| 417 | Ga0157375_10032288 | 3300013308 | Bacteria | 4964 |
| 418 | Ga0157375_10257217 | 3300013308 | Unclassified | 1907 |
| 419 | Ga0157375_11208298 | 3300013308 | Bacteria | 887 |
| 420 | Ga0163163_10016141 | 3300014325 | Bacteria | 6929 |
| 421 | Ga0163163_10065040 | 3300014325 | Bacteria | 3619 |
| 422 | Ga0163163_10122743 | 3300014325 | Bacteria | 2632 |
| 423 | Ga0157380_10173810 | 3300014326 | Unclassified | 1885 |
| 424 | Ga0182008_10229877 | 3300014497 | Bacteria | 951 |
| 425 | Ga0157377_10089227 | 3300014745 | Bacteria | 1817 |
| 426 | Ga0157379_10005183 | 3300014968 | Bacteria | 11193 |
| 427 | Ga0157379_10018173 | 3300014968 | Bacteria | 6195 |
| 428 | Ga0157379_10074904 | 3300014968 | Bacteria | 3030 |
| 429 | Ga0157379_10140759 | 3300014968 | Bacteria | 2175 |
| 430 | Ga0157379_11310565 | 3300014968 | Bacteria | 699 |
| 431 | Ga0157376_10001195 | 3300014969 | Bacteria | 17141 |
| 432 | Ga0157376_10021210 | 3300014969 | Bacteria | 5044 |
| 433 | Ga0157376_10104173 | 3300014969 | Bacteria | 2486 |
| 434 | Ga0157376_10159694 | 3300014969 | Unclassified | 2042 |
| 435 | Ga0157376_10192979 | 3300014969 | Bacteria | 1869 |
| 436 | Ga0157376_10265556 | 3300014969 | Bacteria | 1610 |
| 437 | Ga0157376_11914256 | 3300014969 | Unclassified | 630 |
| 438 | Ga0163161_10035791 | 3300017792 | Bacteria | 3555 |
| 439 | Ga0197907_11423606 | 3300020069 | Bacteria | 1838 |
| 440 | Ga0206356_11265128 | 3300020070 | Bacteria | 1042 |
| 441 | Ga0206351_10892278 | 3300020077 | Bacteria | 748 |
| 442 | Ga0206352_10576970 | 3300020078 | Unclassified | 1036 |
| 443 | Ga0206352_11317142 | 3300020078 | Bacteria | 672 |
| 444 | Ga0206354_10491568 | 3300020081 | Unclassified | 633 |
| 445 | Ga0206354_10556744 | 3300020081 | Bacteria | 1509 |
| 446 | Ga0206353_11896668 | 3300020082 | Bacteria | 808 |
| 447 | Ga0154015_1346029 | 3300020610 | Bacteria | 1302 |
| 448 | Ga0154015_1571093 | 3300020610 | Bacteria | 740 |
| 449 | Ga0213872_10025707 | 3300021361 | Bacteria | 2706 |
| 450 | Ga0213872_10048157 | 3300021361 | Bacteria | 1937 |
| 451 | Ga0213872_10106642 | 3300021361 | Bacteria | 1246 |
| 452 | Ga0213872_10115337 | 3300021361 | Bacteria | 1190 |
| 453 | Ga0213874_10349338 | 3300021377 | Bacteria | 566 |
| 454 | Ga0213871_10021294 | 3300021441 | Bacteria | 1614 |
| 455 | Ga0213871_10039638 | 3300021441 | Unclassified | 1261 |
| 456 | Ga0207697_10026675 | 3300025315 | Bacteria | 2362 |
| 457 | Ga0207656_10029705 | 3300025321 | Bacteria | 2253 |
| 458 | Ga0207656_10039750 | 3300025321 | Bacteria | 1991 |
| 459 | Ga0207656_10057652 | 3300025321 | Bacteria | 1695 |
| 460 | Ga0207656_10091433 | 3300025321 | Bacteria | 1382 |
| 461 | Ga0207656_10159065 | 3300025321 | Bacteria | 1074 |
| 462 | Ga0207656_10334267 | 3300025321 | Bacteria | 754 |
| 463 | Ga0207692_10663357 | 3300025898 | Unclassified | 675 |
| 464 | Ga0207710_10008632 | 3300025900 | Bacteria | 4296 |
| 465 | Ga0207710_10165353 | 3300025900 | Unclassified | 1079 |
| 466 | Ga0207710_10406345 | 3300025900 | Unclassified | 699 |
| 467 | Ga0207688_10034034 | 3300025901 | Bacteria | 2820 |
| 468 | Ga0207688_10318402 | 3300025901 | Unclassified | 954 |
| 469 | Ga0207647_10007335 | 3300025904 | Bacteria | 7974 |
| 470 | Ga0207647_10046122 | 3300025904 | Bacteria | 2716 |
| 471 | Ga0207647_10096372 | 3300025904 | Bacteria | 1761 |
| 472 | Ga0207685_10077323 | 3300025905 | Unclassified | 1367 |
| 473 | Ga0207699_11006898 | 3300025906 | Unclassified | 616 |
| 474 | Ga0207645_10005882 | 3300025907 | Bacteria | 8836 |
| 475 | Ga0207705_10035919 | 3300025909 | Bacteria | 3547 |
| 476 | Ga0207705_10051275 | 3300025909 | Bacteria | 2970 |
| 477 | Ga0207705_10052224 | 3300025909 | Bacteria | 2942 |
| 478 | Ga0207705_10077691 | 3300025909 | Bacteria | 2415 |
| 479 | Ga0207705_10593242 | 3300025909 | Bacteria | 861 |
| 480 | Ga0207705_11227478 | 3300025909 | Bacteria | 574 |
| 481 | Ga0207705_11333878 | 3300025909 | Bacteria | 547 |
| 482 | Ga0207654_10000013 | 3300025911 | Bacteria | 241873 |
| 483 | Ga0207654_10000219 | 3300025911 | Bacteria | 35241 |
| 484 | Ga0207654_10006439 | 3300025911 | Bacteria | 5911 |
| 485 | Ga0207654_10027124 | 3300025911 | Unclassified | 3111 |
| 486 | Ga0207654_10111395 | 3300025911 | Bacteria | 1704 |
| 487 | Ga0207654_10123076 | 3300025911 | Bacteria | 1632 |
| 488 | Ga0207654_10130565 | 3300025911 | Unclassified | 1590 |
| 489 | Ga0207654_10496501 | 3300025911 | Unclassified | 861 |
| 490 | Ga0207654_10534572 | 3300025911 | Bacteria | 831 |
| 491 | Ga0207707_10007146 | 3300025912 | Bacteria | 9722 |
| 492 | Ga0207707_10030886 | 3300025912 | Bacteria | 4686 |
| 493 | Ga0207707_10070052 | 3300025912 | Unclassified | 3056 |
| 494 | Ga0207707_10846436 | 3300025912 | Bacteria | 759 |
| 495 | Ga0207707_11055558 | 3300025912 | Bacteria | 664 |
| 496 | Ga0207695_10000233 | 3300025913 | Bacteria | 147498 |
| 497 | Ga0207695_10000258 | 3300025913 | Bacteria | 134197 |
| 498 | Ga0207695_10000398 | 3300025913 | Bacteria | 97114 |
| 499 | Ga0207695_10000501 | 3300025913 | Bacteria | 83342 |
| 500 | Ga0207695_10005107 | 3300025913 | Bacteria | 17581 |
| 501 | Ga0207695_10009332 | 3300025913 | Bacteria | 12141 |
| 502 | Ga0207695_10069784 | 3300025913 | Bacteria | 3595 |
| 503 | Ga0207695_10089803 | 3300025913 | Bacteria | 3089 |
| 504 | Ga0207695_10095375 | 3300025913 | Bacteria | 2979 |
| 505 | Ga0207695_10125935 | 3300025913 | Bacteria | 2524 |
| 506 | Ga0207695_10137036 | 3300025913 | Bacteria | 2400 |
| 507 | Ga0207695_10260032 | 3300025913 | Bacteria | 1634 |
| 508 | Ga0207695_10326451 | 3300025913 | Bacteria | 1424 |
| 509 | Ga0207695_10518431 | 3300025913 | Bacteria | 1074 |
| 510 | Ga0207695_10747188 | 3300025913 | Unclassified | 858 |
| 511 | Ga0207671_10000022 | 3300025914 | Bacteria | 277803 |
| 512 | Ga0207671_10001087 | 3300025914 | Bacteria | 32869 |
| 513 | Ga0207671_10054501 | 3300025914 | Bacteria | 2963 |
| 514 | Ga0207671_10123056 | 3300025914 | Unclassified | 1984 |
| 515 | Ga0207671_10351187 | 3300025914 | Bacteria | 1169 |
| 516 | Ga0207693_10496298 | 3300025915 | Unclassified | 953 |
| 517 | Ga0207663_10064936 | 3300025916 | Bacteria | 2331 |
| 518 | Ga0207663_10084866 | 3300025916 | Unclassified | 2084 |
| 519 | Ga0207663_10644198 | 3300025916 | Bacteria | 836 |
| 520 | Ga0207660_10049572 | 3300025917 | Bacteria | 2978 |
| 521 | Ga0207660_10087558 | 3300025917 | Bacteria | 2301 |
| 522 | Ga0207660_10107284 | 3300025917 | Bacteria | 2095 |
| 523 | Ga0207660_10446806 | 3300025917 | Unclassified | 1045 |
| 524 | Ga0207660_10462142 | 3300025917 | Unclassified | 1027 |
| 525 | Ga0207660_10719764 | 3300025917 | Bacteria | 814 |
| 526 | Ga0207660_10724152 | 3300025917 | Bacteria | 812 |
| 527 | Ga0207660_11061230 | 3300025917 | Unclassified | 660 |
| 528 | Ga0207657_10107475 | 3300025919 | Bacteria | 2308 |
| 529 | Ga0207657_10108566 | 3300025919 | Bacteria | 2294 |
| 530 | Ga0207657_10226742 | 3300025919 | Bacteria | 1495 |
| 531 | Ga0207649_10014261 | 3300025920 | Bacteria | 4447 |
| 532 | Ga0207649_10349614 | 3300025920 | Bacteria | 1094 |
| 533 | Ga0207649_10357049 | 3300025920 | Bacteria | 1083 |
| 534 | Ga0207652_10172244 | 3300025921 | Bacteria | 1943 |
| 535 | Ga0207652_10434536 | 3300025921 | Bacteria | 1184 |
| 536 | Ga0207652_10497440 | 3300025921 | Bacteria | 1098 |
| 537 | Ga0207652_10811748 | 3300025921 | Bacteria | 830 |
| 538 | Ga0207652_11033143 | 3300025921 | Unclassified | 721 |
| 539 | Ga0207681_10505328 | 3300025923 | Bacteria | 990 |
| 540 | Ga0207681_11139914 | 3300025923 | Unclassified | 655 |
| 541 | Ga0207694_10000009 | 3300025924 | Bacteria | 460687 |
| 542 | Ga0207694_10000682 | 3300025924 | Bacteria | 30458 |
| 543 | Ga0207694_10001146 | 3300025924 | Bacteria | 23003 |
| 544 | Ga0207694_10042704 | 3300025924 | Bacteria | 3498 |
| 545 | Ga0207694_10078940 | 3300025924 | Bacteria | 2581 |
| 546 | Ga0207694_10273007 | 3300025924 | Bacteria | 1387 |
| 547 | Ga0207694_10378282 | 3300025924 | Bacteria | 1175 |
| 548 | Ga0207694_10497979 | 3300025924 | Unclassified | 1020 |
| 549 | Ga0207694_10572608 | 3300025924 | Unclassified | 949 |
| 550 | Ga0207694_10723890 | 3300025924 | Bacteria | 839 |
| 551 | Ga0207694_10831456 | 3300025924 | Bacteria | 780 |
| 552 | Ga0207659_10110682 | 3300025926 | Bacteria | 2087 |
| 553 | Ga0207659_10437636 | 3300025926 | Bacteria | 1099 |
| 554 | Ga0207687_10063915 | 3300025927 | Bacteria | 2607 |
| 555 | Ga0207687_10112375 | 3300025927 | Bacteria | 2024 |
| 556 | Ga0207687_10171439 | 3300025927 | Bacteria | 1674 |
| 557 | Ga0207687_10390703 | 3300025927 | Bacteria | 1142 |
| 558 | Ga0207687_10521880 | 3300025927 | Bacteria | 994 |
| 559 | Ga0207687_10856468 | 3300025927 | Unclassified | 777 |
| 560 | Ga0207700_10002175 | 3300025928 | Bacteria | 11231 |
| 561 | Ga0207700_10984627 | 3300025928 | Unclassified | 755 |
| 562 | Ga0207664_10318671 | 3300025929 | Unclassified | 1371 |
| 563 | Ga0207644_10069804 | 3300025931 | Unclassified | 2566 |
| 564 | Ga0207644_10240824 | 3300025931 | Bacteria | 1440 |
| 565 | Ga0207644_10303894 | 3300025931 | Unclassified | 1286 |
| 566 | Ga0207690_10228223 | 3300025932 | Bacteria | 1428 |
| 567 | Ga0207690_10536159 | 3300025932 | Bacteria | 950 |
| 568 | Ga0207706_10013501 | 3300025933 | Bacteria | 7423 |
| 569 | Ga0207686_10074609 | 3300025934 | Unclassified | 2192 |
| 570 | Ga0207709_10021388 | 3300025935 | Bacteria | 3661 |
| 571 | Ga0207670_10460519 | 3300025936 | Unclassified | 1027 |
| 572 | Ga0207704_10278017 | 3300025938 | Unclassified | 1271 |
| 573 | Ga0207704_10286135 | 3300025938 | Bacteria | 1255 |
| 574 | Ga0207691_10010218 | 3300025940 | Bacteria | 9004 |
| 575 | Ga0207711_10000008 | 3300025941 | Bacteria | 597686 |
| 576 | Ga0207711_10000010 | 3300025941 | Bacteria | 557970 |
| 577 | Ga0207711_10016171 | 3300025941 | Bacteria | 6194 |
| 578 | Ga0207711_10053830 | 3300025941 | Bacteria | 3452 |
| 579 | Ga0207711_10184420 | 3300025941 | Bacteria | 1899 |
| 580 | Ga0207711_10445447 | 3300025941 | Unclassified | 1205 |
| 581 | Ga0207689_10000543 | 3300025942 | Bacteria | 35857 |
| 582 | Ga0207689_10028697 | 3300025942 | Bacteria | 4654 |
| 583 | Ga0207661_10002791 | 3300025944 | Bacteria | 12045 |
| 584 | Ga0207661_10017763 | 3300025944 | Bacteria | 5271 |
| 585 | Ga0207661_10074641 | 3300025944 | Bacteria | 2780 |
| 586 | Ga0207661_10111456 | 3300025944 | Unclassified | 2315 |
| 587 | Ga0207661_10132114 | 3300025944 | Bacteria | 2140 |
| 588 | Ga0207661_10149798 | 3300025944 | Bacteria | 2016 |
| 589 | Ga0207661_10164465 | 3300025944 | Bacteria | 1927 |
| 590 | Ga0207679_10050554 | 3300025945 | Bacteria | 3039 |
| 591 | Ga0207667_10000930 | 3300025949 | Bacteria | 37351 |
| 592 | Ga0207667_10001644 | 3300025949 | Bacteria | 28165 |
| 593 | Ga0207667_10007052 | 3300025949 | Bacteria | 13580 |
| 594 | Ga0207667_10007746 | 3300025949 | Bacteria | 12837 |
| 595 | Ga0207667_10011149 | 3300025949 | Bacteria | 10463 |
| 596 | Ga0207667_10034028 | 3300025949 | Bacteria | 5474 |
| 597 | Ga0207667_10034303 | 3300025949 | Bacteria | 5450 |
| 598 | Ga0207667_10062025 | 3300025949 | Bacteria | 3910 |
| 599 | Ga0207667_10090955 | 3300025949 | Bacteria | 3153 |
| 600 | Ga0207667_10299733 | 3300025949 | Bacteria | 1642 |
| 601 | Ga0207667_10485896 | 3300025949 | Bacteria | 1253 |
| 602 | Ga0207667_10677006 | 3300025949 | Bacteria | 1035 |
| 603 | Ga0207667_11014428 | 3300025949 | Bacteria | 817 |
| 604 | Ga0207667_11099345 | 3300025949 | Bacteria | 778 |
| 605 | Ga0207651_10055776 | 3300025960 | Bacteria | 2716 |
| 606 | Ga0207712_10018867 | 3300025961 | Bacteria | 4497 |
| 607 | Ga0207712_10078847 | 3300025961 | Bacteria | 2391 |
| 608 | Ga0207640_10042322 | 3300025981 | Unclassified | 2904 |
| 609 | Ga0207640_11528230 | 3300025981 | Bacteria | 600 |
| 610 | Ga0207640_12032103 | 3300025981 | Unclassified | 521 |
| 611 | Ga0207658_10048455 | 3300025986 | Unclassified | 3115 |
| 612 | Ga0207658_10328029 | 3300025986 | Bacteria | 1327 |
| 613 | Ga0207677_10002256 | 3300026023 | Bacteria | 10115 |
| 614 | Ga0207677_10026651 | 3300026023 | Bacteria | 3629 |
| 615 | Ga0207677_10137836 | 3300026023 | Bacteria | 1863 |
| 616 | Ga0207677_10694240 | 3300026023 | Bacteria | 902 |
| 617 | Ga0207703_11794843 | 3300026035 | Bacteria | 589 |
| 618 | Ga0207639_10002669 | 3300026041 | Bacteria | 11977 |
| 619 | Ga0207639_10067330 | 3300026041 | Bacteria | 2786 |
| 620 | Ga0207639_10068103 | 3300026041 | Bacteria | 2772 |
| 621 | Ga0207639_10126360 | 3300026041 | Bacteria | 2110 |
| 622 | Ga0207639_10175555 | 3300026041 | Unclassified | 1819 |
| 623 | Ga0207639_10927215 | 3300026041 | Bacteria | 814 |
| 624 | Ga0207678_10001021 | 3300026067 | Bacteria | 25521 |
| 625 | Ga0207678_10029470 | 3300026067 | Bacteria | 4790 |
| 626 | Ga0207678_10168013 | 3300026067 | Bacteria | 1873 |
| 627 | Ga0207678_10198662 | 3300026067 | Unclassified | 1714 |
| 628 | Ga0207678_10407698 | 3300026067 | Bacteria | 1177 |
| 629 | Ga0207708_10142552 | 3300026075 | Bacteria | 1881 |
| 630 | Ga0207708_10867766 | 3300026075 | Bacteria | 780 |
| 631 | Ga0207702_10008532 | 3300026078 | Bacteria | 8638 |
| 632 | Ga0207702_10026962 | 3300026078 | Bacteria | 4770 |
| 633 | Ga0207702_10032700 | 3300026078 | Bacteria | 4340 |
| 634 | Ga0207702_10137200 | 3300026078 | Bacteria | 2208 |
| 635 | Ga0207702_10227246 | 3300026078 | Unclassified | 1742 |
| 636 | Ga0207702_10509216 | 3300026078 | Bacteria | 1174 |
| 637 | Ga0207641_10105295 | 3300026088 | Unclassified | 2491 |
| 638 | Ga0207641_10537005 | 3300026088 | Bacteria | 1139 |
| 639 | Ga0207648_11031637 | 3300026089 | Bacteria | 771 |
| 640 | Ga0207676_10002800 | 3300026095 | Bacteria | 12398 |
| 641 | Ga0207676_10087223 | 3300026095 | Bacteria | 2552 |
| 642 | Ga0207674_10001254 | 3300026116 | Bacteria | 33164 |
| 643 | Ga0207674_10001761 | 3300026116 | Bacteria | 27686 |
| 644 | Ga0207674_10003906 | 3300026116 | Bacteria | 18131 |
| 645 | Ga0207674_10232890 | 3300026116 | Bacteria | 1790 |
| 646 | Ga0207674_10348926 | 3300026116 | Bacteria | 1431 |
| 647 | Ga0207674_10725269 | 3300026116 | Bacteria | 959 |
| 648 | Ga0207675_100410887 | 3300026118 | Unclassified | 1335 |
| 649 | Ga0207683_10000329 | 3300026121 | Bacteria | 43154 |
| 650 | Ga0207683_10251139 | 3300026121 | Bacteria | 1614 |
| 651 | Ga0207698_10000109 | 3300026142 | Bacteria | 51574 |
| 652 | Ga0207698_10002320 | 3300026142 | Bacteria | 11270 |
| 653 | Ga0207698_10041267 | 3300026142 | Bacteria | 3437 |
| 654 | Ga0207698_10099352 | 3300026142 | Bacteria | 2407 |
| 655 | Ga0207698_10107593 | 3300026142 | Bacteria | 2328 |
| 656 | Ga0207698_10287994 | 3300026142 | Bacteria | 1523 |
| 657 | Ga0207698_10300006 | 3300026142 | Unclassified | 1495 |
| 658 | Ga0207698_10687859 | 3300026142 | Unclassified | 1017 |
| 659 | Ga0207698_10824643 | 3300026142 | Bacteria | 931 |
| 660 | Ga0207698_11412049 | 3300026142 | Bacteria | 711 |
| 661 | Ga0209967_1035577 | 3300027364 | Bacteria | 751 |
| 662 | Ga0210000_1016879 | 3300027462 | Bacteria | 1104 |
| 663 | Ga0209968_1030049 | 3300027526 | Unclassified | 906 |
| 664 | Ga0209999_1003706 | 3300027543 | Unclassified | 2739 |
| 665 | Ga0209966_1138527 | 3300027695 | Unclassified | 564 |
| 666 | Ga0207428_10011495 | 3300027907 | Bacteria | 7825 |
| 667 | Ga0268266_10014819 | 3300028379 | Bacteria | 6695 |
| 668 | Ga0268266_10108658 | 3300028379 | Bacteria | 2455 |
| 669 | Ga0268266_10159323 | 3300028379 | Bacteria | 2041 |
| 670 | Ga0268266_10161622 | 3300028379 | Bacteria | 2027 |
| 671 | Ga0268266_10634349 | 3300028379 | Bacteria | 1028 |
| 672 | Ga0268266_10813973 | 3300028379 | Unclassified | 902 |
| 673 | Ga0268266_10852963 | 3300028379 | Bacteria | 880 |
| 674 | Ga0268265_10228555 | 3300028380 | Bacteria | 1633 |
| 675 | Ga0268265_12594909 | 3300028380 | Unclassified | 512 |
| 676 | Ga0268264_10025217 | 3300028381 | Bacteria | 4857 |
| 677 | Ga0265319_1165439 | 3300028563 | Bacteria | 683 |
| 678 | Ga0265318_10045097 | 3300028577 | Bacteria | 1667 |
| 679 | Ga0265318_10075307 | 3300028577 | Bacteria | 1249 |
| 680 | Ga0265318_10234322 | 3300028577 | Bacteria | 670 |
| 681 | Ga0265318_10271068 | 3300028577 | Unclassified | 619 |
| 682 | Ga0265323_10149059 | 3300028653 | Unclassified | 750 |
| 683 | Ga0265323_10188211 | 3300028653 | Bacteria | 652 |
| 684 | Ga0265336_10003228 | 3300028666 | Bacteria | 6468 |
| 685 | Ga0265338_10004864 | 3300028800 | Bacteria | 17896 |
| 686 | Ga0265338_10009983 | 3300028800 | Bacteria | 11226 |
| 687 | Ga0265338_10027301 | 3300028800 | Bacteria | 5730 |
| 688 | Ga0265338_10058037 | 3300028800 | Bacteria | 3420 |
| 689 | Ga0265338_10271109 | 3300028800 | Bacteria | 1244 |
| 690 | Ga0265338_10471957 | 3300028800 | Bacteria | 886 |
| 691 | Ga0265338_10640100 | 3300028800 | Bacteria | 738 |
| 692 | Ga0265338_10856134 | 3300028800 | Bacteria | 621 |
| 693 | Ga0265338_11000875 | 3300028800 | Bacteria | 566 |
| 694 | Ga0265770_1011796 | 3300030878 | Bacteria | 1287 |
| 695 | Ga0265770_1021466 | 3300030878 | Bacteria | 1027 |
| 696 | Ga0265765_1017833 | 3300030879 | Unclassified | 840 |
| 697 | Ga0265760_10064375 | 3300031090 | Unclassified | 1118 |
| 698 | Ga0265760_10330854 | 3300031090 | Bacteria | 543 |
| 699 | Ga0265330_10002436 | 3300031235 | Bacteria | 10138 |
| 700 | Ga0265330_10018567 | 3300031235 | Bacteria | 3194 |
| 701 | Ga0265330_10023360 | 3300031235 | Bacteria | 2808 |
| 702 | Ga0265330_10092375 | 3300031235 | Unclassified | 1299 |
| 703 | Ga0265330_10099791 | 3300031235 | Unclassified | 1243 |
| 704 | Ga0265330_10112096 | 3300031235 | Bacteria | 1165 |
| 705 | Ga0265330_10204034 | 3300031235 | Bacteria | 836 |
| 706 | Ga0265330_10215016 | 3300031235 | Bacteria | 812 |
| 707 | Ga0265332_10081563 | 3300031238 | Bacteria | 1372 |
| 708 | Ga0265328_10026137 | 3300031239 | Bacteria | 2196 |
| 709 | Ga0265328_10048673 | 3300031239 | Bacteria | 1557 |
| 710 | Ga0265325_10000115 | 3300031241 | Bacteria | 54808 |
| 711 | Ga0265325_10016335 | 3300031241 | Bacteria | 4151 |
| 712 | Ga0265325_10038953 | 3300031241 | Bacteria | 2505 |
| 713 | Ga0265325_10039205 | 3300031241 | Bacteria | 2496 |
| 714 | Ga0265325_10069413 | 3300031241 | Bacteria | 1772 |
| 715 | Ga0265325_10365419 | 3300031241 | Bacteria | 636 |
| 716 | Ga0265325_10430213 | 3300031241 | Unclassified | 576 |
| 717 | Ga0265329_10038904 | 3300031242 | Bacteria | 1530 |
| 718 | Ga0265340_10011351 | 3300031247 | Bacteria | 4736 |
| 719 | Ga0265340_10076277 | 3300031247 | Bacteria | 1583 |
| 720 | Ga0265340_10094114 | 3300031247 | Unclassified | 1398 |
| 721 | Ga0265340_10123160 | 3300031247 | Bacteria | 1192 |
| 722 | Ga0265340_10125515 | 3300031247 | Bacteria | 1179 |
| 723 | Ga0265340_10183842 | 3300031247 | Bacteria | 944 |
| 724 | Ga0265339_10000557 | 3300031249 | Bacteria | 29155 |
| 725 | Ga0265339_10000694 | 3300031249 | Bacteria | 26062 |
| 726 | Ga0265339_10003616 | 3300031249 | Bacteria | 10790 |
| 727 | Ga0265339_10073954 | 3300031249 | Bacteria | 1811 |
| 728 | Ga0265339_10263109 | 3300031249 | Bacteria | 831 |
| 729 | Ga0265316_10001818 | 3300031344 | Bacteria | 22421 |
| 730 | Ga0265316_10016452 | 3300031344 | Bacteria | 6414 |
| 731 | Ga0265316_10067550 | 3300031344 | Bacteria | 2764 |
| 732 | Ga0265316_10122599 | 3300031344 | Bacteria | 1962 |
| 733 | Ga0265316_10131782 | 3300031344 | Bacteria | 1882 |
| 734 | Ga0265316_10151408 | 3300031344 | Bacteria | 1738 |
| 735 | Ga0265316_10379797 | 3300031344 | Bacteria | 1019 |
| 736 | Ga0265316_10400247 | 3300031344 | Bacteria | 989 |
| 737 | Ga0265316_10979057 | 3300031344 | Bacteria | 589 |
| 738 | Ga0265313_10003472 | 3300031595 | Bacteria | 12727 |
| 739 | Ga0265313_10011695 | 3300031595 | Bacteria | 5435 |
| 740 | Ga0265313_10045080 | 3300031595 | Unclassified | 2148 |
| 741 | Ga0265313_10097836 | 3300031595 | Bacteria | 1307 |
| 742 | Ga0265314_10000081 | 3300031711 | Bacteria | 143776 |
| 743 | Ga0265314_10041564 | 3300031711 | Bacteria | 3288 |
| 744 | Ga0265314_10106077 | 3300031711 | Bacteria | 1796 |
| 745 | Ga0265314_10377088 | 3300031711 | Unclassified | 773 |
| 746 | Ga0265342_10001506 | 3300031712 | Bacteria | 21599 |
| 747 | Ga0265342_10004150 | 3300031712 | Bacteria | 11533 |
| 748 | Ga0265342_10009471 | 3300031712 | Bacteria | 6858 |
| 749 | Ga0265342_10018805 | 3300031712 | Bacteria | 4466 |
| 750 | Ga0265342_10044547 | 3300031712 | Bacteria | 2674 |
| 751 | Ga0265342_10087771 | 3300031712 | Bacteria | 1787 |
| 752 | Ga0265342_10088974 | 3300031712 | Unclassified | 1772 |
| 753 | Ga0265342_10098523 | 3300031712 | Bacteria | 1668 |
| 754 | Ga0265342_10120751 | 3300031712 | Bacteria | 1476 |
| 755 | Ga0265342_10288221 | 3300031712 | Bacteria | 868 |
| 756 | Ga0307413_11770369 | 3300031824 | Unclassified | 552 |
| 757 | Ga0307407_10575892 | 3300031903 | Unclassified | 835 |
| 758 | Ga0307412_10000867 | 3300031911 | Bacteria | 17373 |
| 759 | Ga0307416_100014064 | 3300032002 | Bacteria | 5465 |
| 760 | Ga0307411_10791410 | 3300032005 | Unclassified | 834 |
| 761 | Ga0316212_1055856 | 3300033547 | Unclassified | 565 |
| 762 | Ga0373934_0041393 | 3300035086 | Bacteria | 1818 |
| 763 | Ga0373923_0102840 | 3300035111 | Unclassified | 1262 |
| 764 | Ga0373954_0076840 | 3300035118 | Bacteria | 1592 |
| 765 | Ga0373956_0188645 | 3300035119 | Unclassified | 976 |
| 766 | Ga0373956_0245959 | 3300035119 | Bacteria | 850 |
| 767 | Ga0373943_0066714 | 3300035170 | Unclassified | 1813 |
| 768 | Ga0373935_0020449 | 3300035692 | Bacteria | 4046 |
| 769 | Ga0373935_0474696 | 3300035692 | Bacteria | 906 |
| 770 | Ga0373927_0177651 | 3300035695 | Unclassified | 1396 |
| 771 | Ga0373933_0016019 | 3300035724 | Bacteria | 4187 |
| 772 | Ga0373933_0039060 | 3300035724 | Unclassified | 2791 |
| 773 | Ga0373933_0450197 | 3300035724 | Unclassified | 842 |
| 774 | Ga0373947_0280848 | 3300035725 | Unclassified | 1107 |
| 775 | Ga0373937_0129068 | 3300036401 | Unclassified | 2360 |
| 776 | Ga0373937_0219266 | 3300036401 | Unclassified | 1791 |
| 777 | Ga0373937_1447729 | 3300036401 | Unclassified | 635 |
| 778 | Ga0373925_0085805 | 3300037068 | Bacteria | 2400 |
| 779 | Ga0395899_0000049 | 3300037312 | Bacteria | 225231 |
| 780 | Ga0395900_0183023 | 3300037418 | Unclassified | 2128 |
| 781 | Ga0395900_0237534 | 3300037418 | Unclassified | 1830 |
| 782 | Ga0395900_0323935 | 3300037418 | Bacteria | 1521 |
| 783 | Ga0395900_0492583 | 3300037418 | Bacteria | 1177 |
| 784 | Ga0395898_0383162 | 3300037466 | Unclassified | 1341 |
| 785 | Ga0395898_1623608 | 3300037466 | Bacteria | 570 |
| 786 | Ga0395905_1368075 | 3300037471 | Bacteria | 612 |
| 787 | Ga0395901_1077642 | 3300038443 | Unclassified | 775 |
| 788 | Ga0436365_1104300 | 3300039437 | Bacteria | 1215 |
| 789 | Ga0436360_0796911 | 3300039438 | Bacteria | 2617 |
| 790 | Ga0436360_1350082 | 3300039438 | Bacteria | 5150 |
| 791 | Ga0436361_0032893 | 3300039447 | Bacteria | 666 |
| 792 | Ga0436361_0111045 | 3300039447 | Bacteria | 1608 |
| 793 | Ga0436361_0212937 | 3300039447 | Bacteria | 30499 |
| 794 | Ga0436361_0412341 | 3300039447 | Bacteria | 712 |
| 795 | Ga0436361_0664017 | 3300039447 | Bacteria | 5339 |
| 796 | Ga0436361_1088884 | 3300039447 | Bacteria | 8192 |
| 797 | Ga0436361_1207243 | 3300039447 | Bacteria | 1505 |
| 798 | Ga0436363_0818606 | 3300039450 | Bacteria | 1048 |
| 799 | Ga0436362_0601495 | 3300039453 | Bacteria | 1618 |
| 800 | Ga0439439_0001461 | 3300041406 | Bacteria | 4707 |
| 801 | Ga0451802_0641939 | 3300041460 | Bacteria | 659 |
| 802 | Ga0439448_0025639 | 3300042005 | Bacteria | 1850 |
| 803 | Ga0439434_0011608 | 3300042435 | Bacteria | 2604 |
| 804 | Ga0451577_0000156 | 3300042876 | Bacteria | 151954 |
| 805 | Ga0451577_0001689 | 3300042876 | Bacteria | 28478 |
| 806 | Ga0451577_0350863 | 3300042876 | Bacteria | 1338 |
| 807 | Ga0451577_0547590 | 3300042876 | Bacteria | 1050 |
| 808 | Ga0466969_0086927 | 3300044656 | Bacteria | 1485 |
| 809 | Ga0466969_0480599 | 3300044656 | Unclassified | 566 |
| 810 | Ga0466966_0427979 | 3300044684 | Bacteria | 795 |
| 811 | Ga0466966_0704025 | 3300044684 | Unclassified | 609 |
| 812 | Ga0466961_0488986 | 3300044693 | Bacteria | 744 |
| 813 | Ga0466963_0000873 | 3300044694 | Bacteria | 15279 |
| 814 | Ga0466963_0111430 | 3300044694 | Bacteria | 1879 |
| 815 | Ga0466963_0317102 | 3300044694 | Unclassified | 1097 |
| 816 | Ga0466963_1034897 | 3300044694 | Bacteria | 578 |
| 817 | Ga0453684_0000330 | 3300044712 | Bacteria | 198124 |
| 818 | Ga0466959_0461360 | 3300045049 | Bacteria | 861 |
| 819 | Ga0466959_1043589 | 3300045049 | Unclassified | 544 |
| 820 | Ga0466958_0346800 | 3300045836 | Unclassified | 956 |
| 821 | Ga0466958_0386573 | 3300045836 | Unclassified | 903 |
| 822 | Ga0466958_0510676 | 3300045836 | Bacteria | 780 |
| 823 | Ga0466967_0003352 | 3300045976 | Bacteria | 10415 |
| 824 | Ga0466967_0574163 | 3300045976 | Bacteria | 1111 |
| 825 | Ga0466967_1253151 | 3300045976 | Unclassified | 739 |
| 826 | Ga0495603_0750882 | 3300046455 | Bacteria | 557 |
| 827 | Ga0495629_0030602 | 3300046459 | Bacteria | 3816 |
| 828 | Ga0495629_0123323 | 3300046459 | Unclassified | 1805 |
| 829 | Ga0495629_0229166 | 3300046459 | Bacteria | 1281 |
| 830 | Ga0495638_0072399 | 3300046460 | Bacteria | 2106 |
| 831 | Ga0495651_0056152 | 3300046462 | Bacteria | 3025 |
| 832 | Ga0495653_0037610 | 3300046463 | Bacteria | 3801 |
| 833 | Ga0495580_0004972 | 3300046472 | Bacteria | 11106 |
| 834 | Ga0495580_0151490 | 3300046472 | Bacteria | 1607 |
| 835 | Ga0495639_0274708 | 3300046475 | Unclassified | 836 |
| 836 | Ga0495639_0630219 | 3300046475 | Unclassified | 552 |
| 837 | Ga0495585_0388442 | 3300046492 | Unclassified | 673 |
| 838 | Ga0495594_0028271 | 3300046499 | Bacteria | 3025 |
| 839 | Ga0495583_0288032 | 3300046506 | Bacteria | 654 |
| 840 | Ga0495606_0011416 | 3300046507 | Bacteria | 7244 |
| 841 | Ga0495606_0252848 | 3300046507 | Bacteria | 977 |
| 842 | Ga0495608_0037060 | 3300046511 | Bacteria | 3280 |
| 843 | Ga0495608_0443132 | 3300046511 | Unclassified | 791 |
| 844 | Ga0495618_0047791 | 3300046514 | Bacteria | 2701 |
| 845 | Ga0495628_0274807 | 3300046516 | Bacteria | 1252 |
| 846 | Ga0495630_0025413 | 3300046517 | Bacteria | 4380 |
| 847 | Ga0495652_0006717 | 3300046529 | Bacteria | 10678 |
| 848 | Ga0495652_0093962 | 3300046529 | Bacteria | 2447 |
| 849 | Ga0495665_0007352 | 3300046531 | Bacteria | 5953 |
| 850 | Ga0495640_0315436 | 3300046533 | Unclassified | 969 |
| 851 | Ga0495587_0000661 | 3300046536 | Bacteria | 23100 |
| 852 | Ga0495587_0241525 | 3300046536 | Bacteria | 1016 |
| 853 | Ga0495645_0002092 | 3300046543 | Bacteria | 13562 |
| 854 | Ga0495645_0051474 | 3300046543 | Bacteria | 2996 |
| 855 | Ga0495645_0615865 | 3300046543 | Unclassified | 666 |
| 856 | Ga0495667_0001594 | 3300046559 | Bacteria | 15037 |
| 857 | Ga0495634_0332245 | 3300046642 | Unclassified | 913 |
| 858 | Ga0495635_0942356 | 3300046663 | Unclassified | 551 |
| 859 | Ga0495657_0209785 | 3300046675 | Unclassified | 1184 |
| 860 | Ga0495599_0003492 | 3300046678 | Bacteria | 9201 |
| 861 | Ga0495599_0352514 | 3300046678 | Unclassified | 882 |
| 862 | Ga0495623_0101297 | 3300046679 | Bacteria | 1754 |
| 863 | Ga0495623_0542885 | 3300046679 | Unclassified | 609 |
| 864 | Ga0495646_0281853 | 3300046680 | Bacteria | 883 |
| 865 | Ga0495669_0052475 | 3300046684 | Bacteria | 1832 |
| 866 | Ga0495613_0076371 | 3300046689 | Bacteria | 2438 |
| 867 | Ga0495613_0172457 | 3300046689 | Unclassified | 1535 |
| 868 | Ga0495613_0814292 | 3300046689 | Bacteria | 609 |
| 869 | Ga0495581_0562687 | 3300047315 | Unclassified | 661 |
| 870 | Ga0495604_0452631 | 3300047317 | Unclassified | 838 |
| 871 | Ga0495674_0771961 | 3300047319 | Unclassified | 749 |
| 872 | Ga0495674_0931111 | 3300047319 | Bacteria | 669 |
| 873 | Ga0495674_1454373 | 3300047319 | Unclassified | 509 |
| 874 | Ga0495680_0300434 | 3300047322 | Bacteria | 1127 |
| 875 | Ga0495675_0055752 | 3300047444 | Bacteria | 2506 |
| 876 | Ga0495684_0037556 | 3300047471 | Bacteria | 3715 |
| 877 | Ga0495684_0429877 | 3300047471 | Bacteria | 921 |
| 878 | Ga0495686_0004892 | 3300047472 | Bacteria | 10801 |
| 879 | Ga0495686_0015720 | 3300047472 | Bacteria | 5157 |
| 880 | Ga0495602_0045410 | 3300048088 | Bacteria | 3975 |
| 881 | Ga0495602_0501328 | 3300048088 | Unclassified | 849 |
| 882 | Ga0496101_0297462 | 3300048904 | Bacteria | 1264 |
| 883 | Ga0496102_0168814 | 3300048905 | Bacteria | 2060 |
| 884 | Ga0496104_0287969 | 3300048907 | Bacteria | 1555 |
| 885 | Ga0496104_0498310 | 3300048907 | Bacteria | 1129 |
| 886 | Ga0496104_0743084 | 3300048907 | Unclassified | 888 |
| 887 | Ga0496105_0076727 | 3300048908 | Bacteria | 2760 |
| 888 | Ga0496105_0406818 | 3300048908 | Bacteria | 1079 |
| 889 | Ga0496105_0566538 | 3300048908 | Bacteria | 885 |
| 890 | Ga0496106_0045792 | 3300048909 | Bacteria | 3287 |
| 891 | Ga0496106_0426562 | 3300048909 | Bacteria | 1066 |
| 892 | Ga0496109_0139862 | 3300048912 | Bacteria | 2263 |
| 893 | Ga0496109_0615121 | 3300048912 | Unclassified | 1023 |
| 894 | Ga0496109_1015050 | 3300048912 | Unclassified | 767 |
| 895 | Ga0496110_0062072 | 3300048913 | Bacteria | 3300 |
| 896 | Ga0496112_0623082 | 3300048915 | Unclassified | 1010 |
| 897 | Ga0496113_0959534 | 3300048916 | Unclassified | 675 |
| 898 | Ga0496114_1026635 | 3300048917 | Bacteria | 708 |
| 899 | Ga0496115_0124505 | 3300048918 | Bacteria | 2123 |
| 900 | Ga0496115_0130462 | 3300048918 | Bacteria | 2071 |
| 901 | Ga0496119_0250072 | 3300048922 | Bacteria | 894 |
| 902 | Ga0496120_0279265 | 3300048923 | Bacteria | 773 |
| 903 | Ga0496126_0009992 | 3300048929 | Bacteria | 10018 |
| 904 | Ga0496126_0015586 | 3300048929 | Bacteria | 7638 |
| 905 | Ga0501034_0228194 | 3300049571 | Bacteria | 1812 |
| 906 | Ga0501038_0091426 | 3300049574 | Bacteria | 2550 |
| 907 | Ga0501047_0084069 | 3300049581 | Bacteria | 3059 |
| 908 | Ga0501070_1536464 | 3300049586 | Bacteria | 503 |
| 909 | Ga0501073_0491743 | 3300049589 | Bacteria | 848 |
| 910 | Ga0501044_0123737 | 3300049823 | Bacteria | 2585 |
| 911 | nmdc:mga09592_497300_c1 | 3300050508 | Bacteria | 1050 |
| 912 | nmdc:mga0qj67_38045_c1 | 3300050509 | Bacteria | 3773 |
| 913 | nmdc:mga08y16_440548_c1 | 3300050511 | Bacteria | 1330 |
| 914 | nmdc:mga08x19_26821_c1 | 3300050514 | Bacteria | 3598 |
| 915 | Ga0495601_0105045 | 3300053077 | Unclassified | 1826 |
| 916 | Ga0495601_0192541 | 3300053077 | Bacteria | 1332 |
| 917 | Ga0495601_0496315 | 3300053077 | Bacteria | 788 |
| 918 | Ga0495612_0178694 | 3300053078 | Bacteria | 931 |
| 919 | Ga0495619_0057510 | 3300053085 | Bacteria | 2581 |
| 920 | Ga0500572_236537 | 3300053111 | Unclassified | 596 |
| 921 | 2852627099 | 2852623160 | Bacteria | 4376875 |
| 922 | 2884935167 | 2884933994 | Bacteria | 4535041 |
| 923 | Ga0265328_10088360 | |||
| 924 | rootH1_10160945 | |||
| 925 | rootH2_10026678 | |||
| 926 | rootH2_10165665 | |||
| 927 | rootH2_10260805 | |||
| 928 | rootL2_10200354 | |||
| 929 | Ga0058862_12011688 | |||
| 930 | Ga0065714_10006998 | |||
| 931 | Ga0065704_10036673 | |||
| 932 | Ga0065712_10217890 | |||
| 933 | Ga0065707_10937773 | |||
| 934 | Ga0070658_10023555 | |||
| 935 | Ga0070658_10032764 | |||
| 936 | Ga0070658_10080374 | |||
| 937 | Ga0070658_10084667 | |||
| 938 | Ga0070658_10203144 | |||
| 939 | Ga0070683_100001556 | |||
| 940 | Ga0070683_100023527 | |||
| 941 | Ga0070683_100081436 | |||
| 942 | Ga0070683_100119774 | |||
| 943 | Ga0070683_100132018 | |||
| 944 | Ga0070683_100185303 | |||
| 945 | Ga0070683_100211522 | |||
| 946 | Ga0070683_100322832 | |||
| 947 | Ga0070690_100529017 | |||
| 948 | Ga0068869_100017699 | |||
| 949 | Ga0068869_100213801 | |||
| 950 | Ga0068869_101467597 | |||
| 951 | Ga0070666_10028737 | |||
| 952 | Ga0070666_10359297 | |||
| 953 | Ga0070680_100042940 | |||
| 954 | Ga0070680_100197399 | |||
| 955 | Ga0070680_100287859 | |||
| 956 | Ga0070680_100329878 | |||
| 957 | Ga0070680_100350120 | |||
| 958 | Ga0070680_100945723 | |||
| 959 | Ga0068868_100004476 | |||
| 960 | Ga0068868_100015337 | |||
| 961 | Ga0068868_100022297 | |||
| 962 | Ga0068868_100346578 | |||
| 963 | Ga0068868_100476518 | |||
| 964 | Ga0068868_100740633 | |||
| 965 | Ga0070660_100006768 | |||
| 966 | Ga0070660_100054107 | |||
| 967 | Ga0070660_100101301 | |||
| 968 | Ga0070689_100490055 | |||
| 969 | Ga0070691_10039203 | |||
| 970 | Ga0070691_10368595 | |||
| 971 | Ga0070691_10860431 | |||
| 972 | Ga0070661_100003065 | |||
| 973 | Ga0070661_100004616 | |||
| 974 | Ga0070661_100107987 | |||
| 975 | Ga0070661_100194418 | |||
| 976 | Ga0070661_100951947 | |||
| 977 | Ga0070668_100061780 | |||
| 978 | Ga0070669_100469884 | |||
| 979 | Ga0070669_100787855 | |||
| 980 | Ga0070675_100186492 | |||
| 981 | Ga0070675_100188659 | |||
| 982 | Ga0070671_100025737 | |||
| 983 | Ga0070671_100027068 | |||
| 984 | Ga0070671_100131020 | |||
| 985 | Ga0070671_100775859 | |||
| 986 | Ga0070673_100023375 | |||
| 987 | Ga0070673_100362368 | |||
| 988 | Ga0070659_100200491 | |||
| 989 | Ga0070659_101006636 | |||
| 990 | Ga0070667_100006815 | |||
| 991 | Ga0070667_100049090 | |||
| 992 | Ga0070667_102316328 | |||
| 993 | Ga0070709_10069913 | |||
| 994 | Ga0070709_10385238 | |||
| 995 | Ga0070709_11178743 | |||
| 996 | Ga0070714_100014205 | |||
| 997 | Ga0070714_100690404 | |||
| 998 | Ga0070713_100010367 | |||
| 999 | Ga0070713_100315805 | |||
| 1000 | Ga0070713_100740150 | |||
| 1001 | Ga0070710_10172280 | |||
| 1002 | Ga0070710_10845429 | |||
| 1003 | Ga0070711_100102773 | |||
| 1004 | Ga0070711_100285151 | |||
| 1005 | Ga0070711_101050785 | |||
| 1006 | Ga0070705_100458253 | |||
| 1007 | Ga0070663_100031150 | |||
| 1008 | Ga0070663_100290365 | |||
| 1009 | Ga0070663_100627248 | |||
| 1010 | Ga0070663_100745487 | |||
| 1011 | Ga0070663_100820753 | |||
| 1012 | Ga0070678_100003237 | |||
| 1013 | Ga0070662_100082083 | |||
| 1014 | Ga0070681_10003755 | |||
| 1015 | Ga0070681_10004476 | |||
| 1016 | Ga0070681_10470233 | |||
| 1017 | Ga0070681_10755568 | |||
| 1018 | Ga0070698_100000535 | |||
| 1019 | Ga0070699_100080454 | |||
| 1020 | Ga0070699_100853161 | |||
| 1021 | Ga0070679_100020623 | |||
| 1022 | Ga0070679_100112249 | |||
| 1023 | Ga0070679_100341361 | |||
| 1024 | Ga0070679_100357345 | |||
| 1025 | Ga0070679_100385382 | |||
| 1026 | Ga0070679_100394852 | |||
| 1027 | Ga0070684_100002861 | |||
| 1028 | Ga0070684_100005055 | |||
| 1029 | Ga0070684_100021807 | |||
| 1030 | Ga0070684_100050758 | |||
| 1031 | Ga0070684_100630286 | |||
| 1032 | Ga0070684_100745168 | |||
| 1033 | Ga0070684_101176267 | |||
| 1034 | Ga0070684_101289172 | |||
| 1035 | Ga0068853_100004104 | |||
| 1036 | Ga0068853_100043023 | |||
| 1037 | Ga0068853_100044174 | |||
| 1038 | Ga0068853_100047503 | |||
| 1039 | Ga0068853_100084324 | |||
| 1040 | Ga0068853_100186843 | |||
| 1041 | Ga0070672_100119666 | |||
| 1042 | Ga0070665_100024742 | |||
| 1043 | Ga0070665_100049315 | |||
| 1044 | Ga0070665_100082946 | |||
| 1045 | Ga0070665_100171818 | |||
| 1046 | Ga0070665_100195887 | |||
| 1047 | Ga0070665_100350010 | |||
| 1048 | Ga0070665_100869712 | |||
| 1049 | Ga0070665_101608419 | |||
| 1050 | Ga0070704_100020808 | |||
| 1051 | Ga0068855_100000819 | |||
| 1052 | Ga0068855_100004206 | |||
| 1053 | Ga0068855_100012254 | |||
| 1054 | Ga0068855_100014110 | |||
| 1055 | Ga0068855_100014511 | |||
| 1056 | Ga0068855_100026325 | |||
| 1057 | Ga0068855_100057916 | |||
| 1058 | Ga0068855_100072112 | |||
| 1059 | Ga0068855_100081457 | |||
| 1060 | Ga0068855_100152156 | |||
| 1061 | Ga0068855_100185794 | |||
| 1062 | Ga0068855_100501351 | |||
| 1063 | Ga0068855_100532933 | |||
| 1064 | Ga0068855_100543429 | |||
| 1065 | Ga0068855_100655331 | |||
| 1066 | Ga0068855_100859036 | |||
| 1067 | Ga0068855_101147539 | |||
| 1068 | Ga0068855_101413872 | |||
| 1069 | Ga0068855_101814569 | |||
| 1070 | Ga0068855_102067886 | |||
| 1071 | Ga0068855_102144557 | |||
| 1072 | Ga0070664_100136329 | |||
| 1073 | Ga0070664_100253364 | |||
| 1074 | Ga0070664_101063845 | |||
| 1075 | Ga0068857_100001991 | |||
| 1076 | Ga0068857_100083477 | |||
| 1077 | Ga0068857_100235583 | |||
| 1078 | Ga0068857_100335207 | |||
| 1079 | Ga0068857_100564421 | |||
| 1080 | Ga0068854_100058150 | |||
| 1081 | Ga0068854_100368625 | |||
| 1082 | Ga0068854_101203020 | |||
| 1083 | Ga0068856_100001782 | |||
| 1084 | Ga0068856_100008091 | |||
| 1085 | Ga0068856_100011451 | |||
| 1086 | Ga0068856_100015606 | |||
| 1087 | Ga0068856_100060352 | |||
| 1088 | Ga0068856_100091653 | |||
| 1089 | Ga0068856_100316967 | |||
| 1090 | Ga0068856_100382337 | |||
| 1091 | Ga0068856_100960335 | |||
| 1092 | Ga0068856_101692099 | |||
| 1093 | Ga0068852_100003017 | |||
| 1094 | Ga0068852_100003172 | |||
| 1095 | Ga0068852_100003318 | |||
| 1096 | Ga0068852_100008628 | |||
| 1097 | Ga0068852_100111185 | |||
| 1098 | Ga0068852_100243251 | |||
| 1099 | Ga0068852_100260003 | |||
| 1100 | Ga0068852_100387959 | |||
| 1101 | Ga0068852_100515525 | |||
| 1102 | Ga0068852_100558806 | |||
| 1103 | Ga0068852_100584811 | |||
| 1104 | Ga0068852_100899394 | |||
| 1105 | Ga0068859_100083756 | |||
| 1106 | Ga0068859_100102578 | |||
| 1107 | Ga0068859_100860959 | |||
| 1108 | Ga0068859_100866161 | |||
| 1109 | Ga0068859_102353838 | |||
| 1110 | Ga0068864_100001011 | |||
| 1111 | Ga0068851_10016720 | |||
| 1112 | Ga0068851_10070517 | |||
| 1113 | Ga0068851_10077545 | |||
| 1114 | Ga0068851_10092843 | |||
| 1115 | Ga0068851_10190298 | |||
| 1116 | Ga0068851_10314664 | |||
| 1117 | Ga0068870_10567091 | |||
| 1118 | Ga0068863_100001678 | |||
| 1119 | Ga0068863_100007398 | |||
| 1120 | Ga0068863_101106728 | |||
| 1121 | Ga0068858_100003486 | |||
| 1122 | Ga0068858_100203322 | |||
| 1123 | Ga0068858_100284937 | |||
| 1124 | Ga0068858_100476504 | |||
| 1125 | Ga0068858_100682275 | |||
| 1126 | Ga0068860_100007224 | |||
| 1127 | Ga0068860_100023371 | |||
| 1128 | Ga0068860_100854229 | |||
| 1129 | Ga0068862_100244391 | |||
| 1130 | Ga0068862_100883479 | |||
| 1131 | Ga0070717_10016965 | |||
| 1132 | Ga0070717_10216768 | |||
| 1133 | Ga0070717_11214219 | |||
| 1134 | Ga0070717_11379792 | |||
| 1135 | Ga0070712_100082293 | |||
| 1136 | Ga0097621_100003579 | |||
| 1137 | Ga0097621_100039628 | |||
| 1138 | Ga0097621_101410398 | |||
| 1139 | Ga0068871_100003833 | |||
| 1140 | Ga0068871_100020118 | |||
| 1141 | Ga0068871_100028898 | |||
| 1142 | Ga0068871_101305172 | |||
| 1143 | Ga0068871_101396223 | |||
| 1144 | Ga0075428_100272270 | |||
| 1145 | Ga0075430_100032755 | |||
| 1146 | Ga0075429_100009842 | |||
| 1147 | Ga0075429_100488698 | |||
| 1148 | Ga0075429_101549622 | |||
| 1149 | Ga0068865_100054112 | |||
| 1150 | Ga0068865_101181530 | |||
| 1151 | Ga0075436_100032986 | |||
| 1152 | Ga0097620_100083764 | |||
| 1153 | Ga0097620_100102569 | |||
| 1154 | Ga0097620_100861045 | |||
| 1155 | Ga0097620_100866296 | |||
| 1156 | Ga0097620_102354255 | |||
| 1157 | Ga0105240_10000531 | |||
| 1158 | Ga0105240_10003431 | |||
| 1159 | Ga0105240_10009850 | |||
| 1160 | Ga0105240_10015189 | |||
| 1161 | Ga0105240_10015938 | |||
| 1162 | Ga0105240_10034845 | |||
| 1163 | Ga0105240_10042759 | |||
| 1164 | Ga0105240_10054107 | |||
| 1165 | Ga0105240_10084928 | |||
| 1166 | Ga0105240_10092926 | |||
| 1167 | Ga0105240_10232022 | |||
| 1168 | Ga0105240_10311733 | |||
| 1169 | Ga0105240_10394695 | |||
| 1170 | Ga0105240_10394867 | |||
| 1171 | Ga0105240_10470736 | |||
| 1172 | Ga0105240_10802720 | |||
| 1173 | Ga0105240_10868925 | |||
| 1174 | Ga0105240_11241263 | |||
| 1175 | Ga0111539_10012544 | |||
| 1176 | Ga0111539_10039250 | |||
| 1177 | Ga0111539_11272971 | |||
| 1178 | Ga0105245_10006340 | |||
| 1179 | Ga0105245_10032253 | |||
| 1180 | Ga0105245_10045717 | |||
| 1181 | Ga0105245_10073426 | |||
| 1182 | Ga0105245_10152482 | |||
| 1183 | Ga0105245_10480985 | |||
| 1184 | Ga0105247_10016685 | |||
| 1185 | Ga0105247_10094104 | |||
| 1186 | Ga0105247_10168380 | |||
| 1187 | Ga0114129_10168959 | |||
| 1188 | Ga0114129_10616725 | |||
| 1189 | Ga0105243_10009867 | |||
| 1190 | Ga0105243_10782929 | |||
| 1191 | Ga0105241_10000199 | |||
| 1192 | Ga0105241_10001305 | |||
| 1193 | Ga0105241_10002734 | |||
| 1194 | Ga0105241_10013210 | |||
| 1195 | Ga0105241_10018485 | |||
| 1196 | Ga0105241_10093630 | |||
| 1197 | Ga0105241_10172273 | |||
| 1198 | Ga0105241_10402184 | |||
| 1199 | Ga0105241_10437407 | |||
| 1200 | Ga0105241_10542257 | |||
| 1201 | Ga0105241_10814294 | |||
| 1202 | Ga0105242_11204845 | |||
| 1203 | Ga0105248_10000004 | |||
| 1204 | Ga0105248_10000255 | |||
| 1205 | Ga0105248_10093925 | |||
| 1206 | Ga0105248_10205747 | |||
| 1207 | Ga0105248_10400748 | |||
| 1208 | Ga0105248_10616549 | |||
| 1209 | Ga0105248_11092470 | |||
| 1210 | Ga0105237_10003805 | |||
| 1211 | Ga0105237_10019484 | |||
| 1212 | Ga0105237_10050367 | |||
| 1213 | Ga0105237_10230918 | |||
| 1214 | Ga0105237_10247869 | |||
| 1215 | Ga0105237_10265446 | |||
| 1216 | Ga0105237_10321428 | |||
| 1217 | Ga0105237_10345581 | |||
| 1218 | Ga0105237_11543340 | |||
| 1219 | Ga0105238_10000262 | |||
| 1220 | Ga0105238_10000292 | |||
| 1221 | Ga0105238_10001340 | |||
| 1222 | Ga0105238_10007813 | |||
| 1223 | Ga0105238_10032054 | |||
| 1224 | Ga0105238_10052982 | |||
| 1225 | Ga0105238_10078667 | |||
| 1226 | Ga0105238_10081743 | |||
| 1227 | Ga0105238_10227607 | |||
| 1228 | Ga0105238_10232640 | |||
| 1229 | Ga0105238_10239389 | |||
| 1230 | Ga0105238_10413015 | |||
| 1231 | Ga0105238_10684020 | |||
| 1232 | Ga0105238_10743348 | |||
| 1233 | Ga0105238_12184579 | |||
| 1234 | Ga0105249_10035872 | |||
| 1235 | Ga0105249_10064494 | |||
| 1236 | Ga0105249_12137559 | |||
| 1237 | Ga0105239_10001873 | |||
| 1238 | Ga0105239_10004032 | |||
| 1239 | Ga0105239_10007426 | |||
| 1240 | Ga0105239_10054842 | |||
| 1241 | Ga0105239_10096949 | |||
| 1242 | Ga0105239_10307055 | |||
| 1243 | Ga0105239_10316960 | |||
| 1244 | Ga0105239_10337112 | |||
| 1245 | Ga0105239_10770631 | |||
| 1246 | Ga0105239_13561122 | |||
| 1247 | Ga0105246_10006772 | |||
| 1248 | Ga0105246_10467531 | |||
| 1249 | Ga0105246_10884187 | |||
| 1250 | Ga0157373_10000734 | |||
| 1251 | Ga0157373_10053519 | |||
| 1252 | Ga0157373_10459506 | |||
| 1253 | Ga0157373_10577668 | |||
| 1254 | Ga0157373_11562317 | |||
| 1255 | Ga0157371_10029907 | |||
| 1256 | Ga0157371_10279736 | |||
| 1257 | Ga0157370_10000107 | |||
| 1258 | Ga0157370_10010187 | |||
| 1259 | Ga0157370_10011099 | |||
| 1260 | Ga0157370_10021637 | |||
| 1261 | Ga0157370_10028338 | |||
| 1262 | Ga0157370_10052263 | |||
| 1263 | Ga0157370_10061945 | |||
| 1264 | Ga0157370_10101058 | |||
| 1265 | Ga0157370_10192159 | |||
| 1266 | Ga0157370_10192399 | |||
| 1267 | Ga0157370_10361919 | |||
| 1268 | Ga0157370_10498118 | |||
| 1269 | Ga0157370_10549010 | |||
| 1270 | Ga0157370_10838706 | |||
| 1271 | Ga0157370_11795871 | |||
| 1272 | Ga0157369_10000275 | |||
| 1273 | Ga0157369_10002075 | |||
| 1274 | Ga0157369_10003741 | |||
| 1275 | Ga0157369_10014204 | |||
| 1276 | Ga0157369_10017062 | |||
| 1277 | Ga0157369_10017846 | |||
| 1278 | Ga0157369_10021414 | |||
| 1279 | Ga0157369_10042732 | |||
| 1280 | Ga0157369_10079311 | |||
| 1281 | Ga0157369_10089774 | |||
| 1282 | Ga0157369_10092522 | |||
| 1283 | Ga0157369_10097179 | |||
| 1284 | Ga0157369_10099468 | |||
| 1285 | Ga0157369_10112954 | |||
| 1286 | Ga0157369_10138740 | |||
| 1287 | Ga0157369_10274304 | |||
| 1288 | Ga0157369_10339131 | |||
| 1289 | Ga0157369_10519471 | |||
| 1290 | Ga0157369_11827151 | |||
| 1291 | Ga0157374_10009059 | |||
| 1292 | Ga0157374_10009888 | |||
| 1293 | Ga0157374_10025221 | |||
| 1294 | Ga0157374_10043879 | |||
| 1295 | Ga0157374_10076869 | |||
| 1296 | Ga0157374_10216396 | |||
| 1297 | Ga0157374_10220706 | |||
| 1298 | Ga0157374_10828369 | |||
| 1299 | Ga0157374_10847509 | |||
| 1300 | Ga0157374_10884859 | |||
| 1301 | Ga0157374_10958257 | |||
| 1302 | Ga0157374_11251476 | |||
| 1303 | Ga0157374_11725672 | |||
| 1304 | Ga0157378_10017511 | |||
| 1305 | Ga0157378_10029194 | |||
| 1306 | Ga0157378_10037831 | |||
| 1307 | Ga0157378_10078165 | |||
| 1308 | Ga0157378_10090679 | |||
| 1309 | Ga0157378_10110831 | |||
| 1310 | Ga0163162_10050845 | |||
| 1311 | Ga0163162_10442181 | |||
| 1312 | Ga0163162_10474961 | |||
| 1313 | Ga0163162_10974753 | |||
| 1314 | Ga0157372_10000127 | |||
| 1315 | Ga0157372_10001526 | |||
| 1316 | Ga0157372_10004316 | |||
| 1317 | Ga0157372_10011047 | |||
| 1318 | Ga0157372_10016987 | |||
| 1319 | Ga0157372_10020604 | |||
| 1320 | Ga0157372_10023808 | |||
| 1321 | Ga0157372_10024442 | |||
| 1322 | Ga0157372_10030644 | |||
| 1323 | Ga0157372_10044759 | |||
| 1324 | Ga0157372_10047346 | |||
| 1325 | Ga0157372_10056981 | |||
| 1326 | Ga0157372_10076793 | |||
| 1327 | Ga0157372_10096852 | |||
| 1328 | Ga0157372_10099093 | |||
| 1329 | Ga0157372_10112432 | |||
| 1330 | Ga0157372_10179432 | |||
| 1331 | Ga0157372_10191598 | |||
| 1332 | Ga0157372_10212721 | |||
| 1333 | Ga0157372_10252014 | |||
| 1334 | Ga0157372_10307228 | |||
| 1335 | Ga0157372_10459844 | |||
| 1336 | Ga0157372_10566334 | |||
| 1337 | Ga0157375_10011935 | |||
| 1338 | Ga0157375_10015926 | |||
| 1339 | Ga0157375_10032288 | |||
| 1340 | Ga0157375_10257217 | |||
| 1341 | Ga0157375_11208298 | |||
| 1342 | Ga0163163_10016141 | |||
| 1343 | Ga0163163_10065040 | |||
| 1344 | Ga0163163_10122743 | |||
| 1345 | Ga0157380_10173810 | |||
| 1346 | Ga0182008_10229877 | |||
| 1347 | Ga0157377_10089227 | |||
| 1348 | Ga0157379_10005183 | |||
| 1349 | Ga0157379_10018173 | |||
| 1350 | Ga0157379_10074904 | |||
| 1351 | Ga0157379_10140759 | |||
| 1352 | Ga0157379_11310565 | |||
| 1353 | Ga0157376_10001195 | |||
| 1354 | Ga0157376_10021210 | |||
| 1355 | Ga0157376_10104173 | |||
| 1356 | Ga0157376_10159694 | |||
| 1357 | Ga0157376_10192979 | |||
| 1358 | Ga0157376_10265556 | |||
| 1359 | Ga0157376_11914256 | |||
| 1360 | Ga0163161_10035791 | |||
| 1361 | Ga0197907_11423606 | |||
| 1362 | Ga0206356_11265128 | |||
| 1363 | Ga0206351_10892278 | |||
| 1364 | Ga0206352_10576970 | |||
| 1365 | Ga0206352_11317142 | |||
| 1366 | Ga0206354_10491568 | |||
| 1367 | Ga0206354_10556744 | |||
| 1368 | Ga0206353_11896668 | |||
| 1369 | Ga0154015_1346029 | |||
| 1370 | Ga0154015_1571093 | |||
| 1371 | Ga0213872_10025707 | |||
| 1372 | Ga0213872_10048157 | |||
| 1373 | Ga0213872_10106642 | |||
| 1374 | Ga0213872_10115337 | |||
| 1375 | Ga0213874_10349338 | |||
| 1376 | Ga0213871_10021294 | |||
| 1377 | Ga0213871_10039638 | |||
| 1378 | Ga0207697_10026675 | |||
| 1379 | Ga0207656_10029705 | |||
| 1380 | Ga0207656_10039750 | |||
| 1381 | Ga0207656_10057652 | |||
| 1382 | Ga0207656_10091433 | |||
| 1383 | Ga0207656_10159065 | |||
| 1384 | Ga0207656_10334267 | |||
| 1385 | Ga0207692_10663357 | |||
| 1386 | Ga0207710_10008632 | |||
| 1387 | Ga0207710_10165353 | |||
| 1388 | Ga0207710_10406345 | |||
| 1389 | Ga0207688_10034034 | |||
| 1390 | Ga0207688_10318402 | |||
| 1391 | Ga0207647_10007335 | |||
| 1392 | Ga0207647_10046122 | |||
| 1393 | Ga0207647_10096372 | |||
| 1394 | Ga0207685_10077323 | |||
| 1395 | Ga0207699_11006898 | |||
| 1396 | Ga0207645_10005882 | |||
| 1397 | Ga0207705_10035919 | |||
| 1398 | Ga0207705_10051275 | |||
| 1399 | Ga0207705_10052224 | |||
| 1400 | Ga0207705_10077691 | |||
| 1401 | Ga0207705_10593242 | |||
| 1402 | Ga0207705_11227478 | |||
| 1403 | Ga0207705_11333878 | |||
| 1404 | Ga0207654_10000013 | |||
| 1405 | Ga0207654_10000219 | |||
| 1406 | Ga0207654_10006439 | |||
| 1407 | Ga0207654_10027124 | |||
| 1408 | Ga0207654_10111395 | |||
| 1409 | Ga0207654_10123076 | |||
| 1410 | Ga0207654_10130565 | |||
| 1411 | Ga0207654_10496501 | |||
| 1412 | Ga0207654_10534572 | |||
| 1413 | Ga0207707_10007146 | |||
| 1414 | Ga0207707_10030886 | |||
| 1415 | Ga0207707_10070052 | |||
| 1416 | Ga0207707_10846436 | |||
| 1417 | Ga0207707_11055558 | |||
| 1418 | Ga0207695_10000233 | |||
| 1419 | Ga0207695_10000258 | |||
| 1420 | Ga0207695_10000398 | |||
| 1421 | Ga0207695_10000501 | |||
| 1422 | Ga0207695_10005107 | |||
| 1423 | Ga0207695_10009332 | |||
| 1424 | Ga0207695_10069784 | |||
| 1425 | Ga0207695_10089803 | |||
| 1426 | Ga0207695_10095375 | |||
| 1427 | Ga0207695_10125935 | |||
| 1428 | Ga0207695_10137036 | |||
| 1429 | Ga0207695_10260032 | |||
| 1430 | Ga0207695_10326451 | |||
| 1431 | Ga0207695_10518431 | |||
| 1432 | Ga0207695_10747188 | |||
| 1433 | Ga0207671_10000022 | |||
| 1434 | Ga0207671_10001087 | |||
| 1435 | Ga0207671_10054501 | |||
| 1436 | Ga0207671_10123056 | |||
| 1437 | Ga0207671_10351187 | |||
| 1438 | Ga0207693_10496298 | |||
| 1439 | Ga0207663_10064936 | |||
| 1440 | Ga0207663_10084866 | |||
| 1441 | Ga0207663_10644198 | |||
| 1442 | Ga0207660_10049572 | |||
| 1443 | Ga0207660_10087558 | |||
| 1444 | Ga0207660_10107284 | |||
| 1445 | Ga0207660_10446806 | |||
| 1446 | Ga0207660_10462142 | |||
| 1447 | Ga0207660_10719764 | |||
| 1448 | Ga0207660_10724152 | |||
| 1449 | Ga0207660_11061230 | |||
| 1450 | Ga0207657_10107475 | |||
| 1451 | Ga0207657_10108566 | |||
| 1452 | Ga0207657_10226742 | |||
| 1453 | Ga0207649_10014261 | |||
| 1454 | Ga0207649_10349614 | |||
| 1455 | Ga0207649_10357049 | |||
| 1456 | Ga0207652_10172244 | |||
| 1457 | Ga0207652_10434536 | |||
| 1458 | Ga0207652_10497440 | |||
| 1459 | Ga0207652_10811748 | |||
| 1460 | Ga0207652_11033143 | |||
| 1461 | Ga0207681_10505328 | |||
| 1462 | Ga0207681_11139914 | |||
| 1463 | Ga0207694_10000009 | |||
| 1464 | Ga0207694_10000682 | |||
| 1465 | Ga0207694_10001146 | |||
| 1466 | Ga0207694_10042704 | |||
| 1467 | Ga0207694_10078940 | |||
| 1468 | Ga0207694_10273007 | |||
| 1469 | Ga0207694_10378282 | |||
| 1470 | Ga0207694_10497979 | |||
| 1471 | Ga0207694_10572608 | |||
| 1472 | Ga0207694_10723890 | |||
| 1473 | Ga0207694_10831456 | |||
| 1474 | Ga0207659_10110682 | |||
| 1475 | Ga0207659_10437636 | |||
| 1476 | Ga0207687_10063915 | |||
| 1477 | Ga0207687_10112375 | |||
| 1478 | Ga0207687_10171439 | |||
| 1479 | Ga0207687_10390703 | |||
| 1480 | Ga0207687_10521880 | |||
| 1481 | Ga0207687_10856468 | |||
| 1482 | Ga0207700_10002175 | |||
| 1483 | Ga0207700_10984627 | |||
| 1484 | Ga0207664_10318671 | |||
| 1485 | Ga0207644_10069804 | |||
| 1486 | Ga0207644_10240824 | |||
| 1487 | Ga0207644_10303894 | |||
| 1488 | Ga0207690_10228223 | |||
| 1489 | Ga0207690_10536159 | |||
| 1490 | Ga0207706_10013501 | |||
| 1491 | Ga0207686_10074609 | |||
| 1492 | Ga0207709_10021388 | |||
| 1493 | Ga0207670_10460519 | |||
| 1494 | Ga0207704_10278017 | |||
| 1495 | Ga0207704_10286135 | |||
| 1496 | Ga0207691_10010218 | |||
| 1497 | Ga0207711_10000008 | |||
| 1498 | Ga0207711_10000010 | |||
| 1499 | Ga0207711_10016171 | |||
| 1500 | Ga0207711_10053830 | |||
| 1501 | Ga0207711_10184420 | |||
| 1502 | Ga0207711_10445447 | |||
| 1503 | Ga0207689_10000543 | |||
| 1504 | Ga0207689_10028697 | |||
| 1505 | Ga0207661_10002791 | |||
| 1506 | Ga0207661_10017763 | |||
| 1507 | Ga0207661_10074641 | |||
| 1508 | Ga0207661_10111456 | |||
| 1509 | Ga0207661_10132114 | |||
| 1510 | Ga0207661_10149798 | |||
| 1511 | Ga0207661_10164465 | |||
| 1512 | Ga0207679_10050554 | |||
| 1513 | Ga0207667_10000930 | |||
| 1514 | Ga0207667_10001644 | |||
| 1515 | Ga0207667_10007052 | |||
| 1516 | Ga0207667_10007746 | |||
| 1517 | Ga0207667_10011149 | |||
| 1518 | Ga0207667_10034028 | |||
| 1519 | Ga0207667_10034303 | |||
| 1520 | Ga0207667_10062025 | |||
| 1521 | Ga0207667_10090955 | |||
| 1522 | Ga0207667_10299733 | |||
| 1523 | Ga0207667_10485896 | |||
| 1524 | Ga0207667_10677006 | |||
| 1525 | Ga0207667_11014428 | |||
| 1526 | Ga0207667_11099345 | |||
| 1527 | Ga0207651_10055776 | |||
| 1528 | Ga0207712_10018867 | |||
| 1529 | Ga0207712_10078847 | |||
| 1530 | Ga0207640_10042322 | |||
| 1531 | Ga0207640_11528230 | |||
| 1532 | Ga0207640_12032103 | |||
| 1533 | Ga0207658_10048455 | |||
| 1534 | Ga0207658_10328029 | |||
| 1535 | Ga0207677_10002256 | |||
| 1536 | Ga0207677_10026651 | |||
| 1537 | Ga0207677_10137836 | |||
| 1538 | Ga0207677_10694240 | |||
| 1539 | Ga0207703_11794843 | |||
| 1540 | Ga0207639_10002669 | |||
| 1541 | Ga0207639_10067330 | |||
| 1542 | Ga0207639_10068103 | |||
| 1543 | Ga0207639_10126360 | |||
| 1544 | Ga0207639_10175555 | |||
| 1545 | Ga0207639_10927215 | |||
| 1546 | Ga0207678_10001021 | |||
| 1547 | Ga0207678_10029470 | |||
| 1548 | Ga0207678_10168013 | |||
| 1549 | Ga0207678_10198662 | |||
| 1550 | Ga0207678_10407698 | |||
| 1551 | Ga0207708_10142552 | |||
| 1552 | Ga0207708_10867766 | |||
| 1553 | Ga0207702_10008532 | |||
| 1554 | Ga0207702_10026962 | |||
| 1555 | Ga0207702_10032700 | |||
| 1556 | Ga0207702_10137200 | |||
| 1557 | Ga0207702_10227246 | |||
| 1558 | Ga0207702_10509216 | |||
| 1559 | Ga0207641_10105295 | |||
| 1560 | Ga0207641_10537005 | |||
| 1561 | Ga0207648_11031637 | |||
| 1562 | Ga0207676_10002800 | |||
| 1563 | Ga0207676_10087223 | |||
| 1564 | Ga0207674_10001254 | |||
| 1565 | Ga0207674_10001761 | |||
| 1566 | Ga0207674_10003906 | |||
| 1567 | Ga0207674_10232890 | |||
| 1568 | Ga0207674_10348926 | |||
| 1569 | Ga0207674_10725269 | |||
| 1570 | Ga0207675_100410887 | |||
| 1571 | Ga0207683_10000329 | |||
| 1572 | Ga0207683_10251139 | |||
| 1573 | Ga0207698_10000109 | |||
| 1574 | Ga0207698_10002320 | |||
| 1575 | Ga0207698_10041267 | |||
| 1576 | Ga0207698_10099352 | |||
| 1577 | Ga0207698_10107593 | |||
| 1578 | Ga0207698_10287994 | |||
| 1579 | Ga0207698_10300006 | |||
| 1580 | Ga0207698_10687859 | |||
| 1581 | Ga0207698_10824643 | |||
| 1582 | Ga0207698_11412049 | |||
| 1583 | Ga0209967_1035577 | |||
| 1584 | Ga0210000_1016879 | |||
| 1585 | Ga0209968_1030049 | |||
| 1586 | Ga0209999_1003706 | |||
| 1587 | Ga0209966_1138527 | |||
| 1588 | Ga0207428_10011495 | |||
| 1589 | Ga0268266_10014819 | |||
| 1590 | Ga0268266_10108658 | |||
| 1591 | Ga0268266_10159323 | |||
| 1592 | Ga0268266_10161622 | |||
| 1593 | Ga0268266_10634349 | |||
| 1594 | Ga0268266_10813973 | |||
| 1595 | Ga0268266_10852963 | |||
| 1596 | Ga0268265_10228555 | |||
| 1597 | Ga0268265_12594909 | |||
| 1598 | Ga0268264_10025217 | |||
| 1599 | Ga0265319_1165439 | |||
| 1600 | Ga0265318_10045097 | |||
| 1601 | Ga0265318_10075307 | |||
| 1602 | Ga0265318_10234322 | |||
| 1603 | Ga0265318_10271068 | |||
| 1604 | Ga0265323_10149059 | |||
| 1605 | Ga0265323_10188211 | |||
| 1606 | Ga0265336_10003228 | |||
| 1607 | Ga0265338_10004864 | |||
| 1608 | Ga0265338_10009983 | |||
| 1609 | Ga0265338_10027301 | |||
| 1610 | Ga0265338_10058037 | |||
| 1611 | Ga0265338_10271109 | |||
| 1612 | Ga0265338_10471957 | |||
| 1613 | Ga0265338_10640100 | |||
| 1614 | Ga0265338_10856134 | |||
| 1615 | Ga0265338_11000875 | |||
| 1616 | Ga0265770_1011796 | |||
| 1617 | Ga0265770_1021466 | |||
| 1618 | Ga0265765_1017833 | |||
| 1619 | Ga0265760_10064375 | |||
| 1620 | Ga0265760_10330854 | |||
| 1621 | Ga0265330_10002436 | |||
| 1622 | Ga0265330_10018567 | |||
| 1623 | Ga0265330_10023360 | |||
| 1624 | Ga0265330_10092375 | |||
| 1625 | Ga0265330_10099791 | |||
| 1626 | Ga0265330_10112096 | |||
| 1627 | Ga0265330_10204034 | |||
| 1628 | Ga0265330_10215016 | |||
| 1629 | Ga0265332_10081563 | |||
| 1630 | Ga0265328_10026137 | |||
| 1631 | Ga0265328_10048673 | |||
| 1632 | Ga0265325_10000115 | |||
| 1633 | Ga0265325_10016335 | |||
| 1634 | Ga0265325_10038953 | |||
| 1635 | Ga0265325_10039205 | |||
| 1636 | Ga0265325_10069413 | |||
| 1637 | Ga0265325_10365419 | |||
| 1638 | Ga0265325_10430213 | |||
| 1639 | Ga0265329_10038904 | |||
| 1640 | Ga0265340_10011351 | |||
| 1641 | Ga0265340_10076277 | |||
| 1642 | Ga0265340_10094114 | |||
| 1643 | Ga0265340_10123160 | |||
| 1644 | Ga0265340_10125515 | |||
| 1645 | Ga0265340_10183842 | |||
| 1646 | Ga0265339_10000557 | |||
| 1647 | Ga0265339_10000694 | |||
| 1648 | Ga0265339_10003616 | |||
| 1649 | Ga0265339_10073954 | |||
| 1650 | Ga0265339_10263109 | |||
| 1651 | Ga0265316_10001818 | |||
| 1652 | Ga0265316_10016452 | |||
| 1653 | Ga0265316_10067550 | |||
| 1654 | Ga0265316_10122599 | |||
| 1655 | Ga0265316_10131782 | |||
| 1656 | Ga0265316_10151408 | |||
| 1657 | Ga0265316_10379797 | |||
| 1658 | Ga0265316_10400247 | |||
| 1659 | Ga0265316_10979057 | |||
| 1660 | Ga0265313_10003472 | |||
| 1661 | Ga0265313_10011695 | |||
| 1662 | Ga0265313_10045080 | |||
| 1663 | Ga0265313_10097836 | |||
| 1664 | Ga0265314_10000081 | |||
| 1665 | Ga0265314_10041564 | |||
| 1666 | Ga0265314_10106077 | |||
| 1667 | Ga0265314_10377088 | |||
| 1668 | Ga0265342_10001506 | |||
| 1669 | Ga0265342_10004150 | |||
| 1670 | Ga0265342_10009471 | |||
| 1671 | Ga0265342_10018805 | |||
| 1672 | Ga0265342_10044547 | |||
| 1673 | Ga0265342_10087771 | |||
| 1674 | Ga0265342_10088974 | |||
| 1675 | Ga0265342_10098523 | |||
| 1676 | Ga0265342_10120751 | |||
| 1677 | Ga0265342_10288221 | |||
| 1678 | Ga0307413_11770369 | |||
| 1679 | Ga0307407_10575892 | |||
| 1680 | Ga0307412_10000867 | |||
| 1681 | Ga0307416_100014064 | |||
| 1682 | Ga0307411_10791410 | |||
| 1683 | Ga0316212_1055856 | |||
| 1684 | Ga0373934_0041393 | |||
| 1685 | Ga0373923_0102840 | |||
| 1686 | Ga0373954_0076840 | |||
| 1687 | Ga0373956_0188645 | |||
| 1688 | Ga0373956_0245959 | |||
| 1689 | Ga0373943_0066714 | |||
| 1690 | Ga0373935_0020449 | |||
| 1691 | Ga0373935_0474696 | |||
| 1692 | Ga0373927_0177651 | |||
| 1693 | Ga0373933_0016019 | |||
| 1694 | Ga0373933_0039060 | |||
| 1695 | Ga0373933_0450197 | |||
| 1696 | Ga0373947_0280848 | |||
| 1697 | Ga0373937_0129068 | |||
| 1698 | Ga0373937_0219266 | |||
| 1699 | Ga0373937_1447729 | |||
| 1700 | Ga0373925_0085805 | |||
| 1701 | Ga0395899_0000049 | |||
| 1702 | Ga0395900_0183023 | |||
| 1703 | Ga0395900_0237534 | |||
| 1704 | Ga0395900_0323935 | |||
| 1705 | Ga0395900_0492583 | |||
| 1706 | Ga0395898_0383162 | |||
| 1707 | Ga0395898_1623608 | |||
| 1708 | Ga0395905_1368075 | |||
| 1709 | Ga0395901_1077642 | |||
| 1710 | Ga0436365_1104300 | |||
| 1711 | Ga0436360_0796911 | |||
| 1712 | Ga0436360_1350082 | |||
| 1713 | Ga0436361_0032893 | |||
| 1714 | Ga0436361_0111045 | |||
| 1715 | Ga0436361_0212937 | |||
| 1716 | Ga0436361_0412341 | |||
| 1717 | Ga0436361_0664017 | |||
| 1718 | Ga0436361_1088884 | |||
| 1719 | Ga0436361_1207243 | |||
| 1720 | Ga0436363_0818606 | |||
| 1721 | Ga0436362_0601495 | |||
| 1722 | Ga0439439_0001461 | |||
| 1723 | Ga0451802_0641939 | |||
| 1724 | Ga0439448_0025639 | |||
| 1725 | Ga0439434_0011608 | |||
| 1726 | Ga0451577_0000156 | |||
| 1727 | Ga0451577_0001689 | |||
| 1728 | Ga0451577_0350863 | |||
| 1729 | Ga0451577_0547590 | |||
| 1730 | Ga0466969_0086927 | |||
| 1731 | Ga0466969_0480599 | |||
| 1732 | Ga0466966_0427979 | |||
| 1733 | Ga0466966_0704025 | |||
| 1734 | Ga0466961_0488986 | |||
| 1735 | Ga0466963_0000873 | |||
| 1736 | Ga0466963_0111430 | |||
| 1737 | Ga0466963_0317102 | |||
| 1738 | Ga0466963_1034897 | |||
| 1739 | Ga0453684_0000330 | |||
| 1740 | Ga0466959_0461360 | |||
| 1741 | Ga0466959_1043589 | |||
| 1742 | Ga0466958_0346800 | |||
| 1743 | Ga0466958_0386573 | |||
| 1744 | Ga0466958_0510676 | |||
| 1745 | Ga0466967_0003352 | |||
| 1746 | Ga0466967_0574163 | |||
| 1747 | Ga0466967_1253151 | |||
| 1748 | Ga0495603_0750882 | |||
| 1749 | Ga0495629_0030602 | |||
| 1750 | Ga0495629_0123323 | |||
| 1751 | Ga0495629_0229166 | |||
| 1752 | Ga0495638_0072399 | |||
| 1753 | Ga0495651_0056152 | |||
| 1754 | Ga0495653_0037610 | |||
| 1755 | Ga0495580_0004972 | |||
| 1756 | Ga0495580_0151490 | |||
| 1757 | Ga0495639_0274708 | |||
| 1758 | Ga0495639_0630219 | |||
| 1759 | Ga0495585_0388442 | |||
| 1760 | Ga0495594_0028271 | |||
| 1761 | Ga0495583_0288032 | |||
| 1762 | Ga0495606_0011416 | |||
| 1763 | Ga0495606_0252848 | |||
| 1764 | Ga0495608_0037060 | |||
| 1765 | Ga0495608_0443132 | |||
| 1766 | Ga0495618_0047791 | |||
| 1767 | Ga0495628_0274807 | |||
| 1768 | Ga0495630_0025413 | |||
| 1769 | Ga0495652_0006717 | |||
| 1770 | Ga0495652_0093962 | |||
| 1771 | Ga0495665_0007352 | |||
| 1772 | Ga0495640_0315436 | |||
| 1773 | Ga0495587_0000661 | |||
| 1774 | Ga0495587_0241525 | |||
| 1775 | Ga0495645_0002092 | |||
| 1776 | Ga0495645_0051474 | |||
| 1777 | Ga0495645_0615865 | |||
| 1778 | Ga0495667_0001594 | |||
| 1779 | Ga0495634_0332245 | |||
| 1780 | Ga0495635_0942356 | |||
| 1781 | Ga0495657_0209785 | |||
| 1782 | Ga0495599_0003492 | |||
| 1783 | Ga0495599_0352514 | |||
| 1784 | Ga0495623_0101297 | |||
| 1785 | Ga0495623_0542885 | |||
| 1786 | Ga0495646_0281853 | |||
| 1787 | Ga0495669_0052475 | |||
| 1788 | Ga0495613_0076371 | |||
| 1789 | Ga0495613_0172457 | |||
| 1790 | Ga0495613_0814292 | |||
| 1791 | Ga0495581_0562687 | |||
| 1792 | Ga0495604_0452631 | |||
| 1793 | Ga0495674_0771961 | |||
| 1794 | Ga0495674_0931111 | |||
| 1795 | Ga0495674_1454373 | |||
| 1796 | Ga0495680_0300434 | |||
| 1797 | Ga0495675_0055752 | |||
| 1798 | Ga0495684_0037556 | |||
| 1799 | Ga0495684_0429877 | |||
| 1800 | Ga0495686_0004892 | |||
| 1801 | Ga0495686_0015720 | |||
| 1802 | Ga0495602_0045410 | |||
| 1803 | Ga0495602_0501328 | |||
| 1804 | Ga0496101_0297462 | |||
| 1805 | Ga0496102_0168814 | |||
| 1806 | Ga0496104_0287969 | |||
| 1807 | Ga0496104_0498310 | |||
| 1808 | Ga0496104_0743084 | |||
| 1809 | Ga0496105_0076727 | |||
| 1810 | Ga0496105_0406818 | |||
| 1811 | Ga0496105_0566538 | |||
| 1812 | Ga0496106_0045792 | |||
| 1813 | Ga0496106_0426562 | |||
| 1814 | Ga0496109_0139862 | |||
| 1815 | Ga0496109_0615121 | |||
| 1816 | Ga0496109_1015050 | |||
| 1817 | Ga0496110_0062072 | |||
| 1818 | Ga0496112_0623082 | |||
| 1819 | Ga0496113_0959534 | |||
| 1820 | Ga0496114_1026635 | |||
| 1821 | Ga0496115_0124505 | |||
| 1822 | Ga0496115_0130462 | |||
| 1823 | Ga0496119_0250072 | |||
| 1824 | Ga0496120_0279265 | |||
| 1825 | Ga0496126_0009992 | |||
| 1826 | Ga0496126_0015586 | |||
| 1827 | Ga0501034_0228194 | |||
| 1828 | Ga0501038_0091426 | |||
| 1829 | Ga0501047_0084069 | |||
| 1830 | Ga0501070_1536464 | |||
| 1831 | Ga0501073_0491743 | |||
| 1832 | Ga0501044_0123737 | |||
| 1833 | nmdc:mga09592_497300_c1 | |||
| 1834 | nmdc:mga0qj67_38045_c1 | |||
| 1835 | nmdc:mga08y16_440548_c1 | |||
| 1836 | nmdc:mga08x19_26821_c1 | |||
| 1837 | Ga0495601_0105045 | |||
| 1838 | Ga0495601_0192541 | |||
| 1839 | Ga0495601_0496315 | |||
| 1840 | Ga0495612_0178694 | |||
| 1841 | Ga0495619_0057510 | |||
| 1842 | Ga0500572_236537 | |||
| 1843 | 2852627099 | |||
| 1844 | 2884935167 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i2b-assembly3.cif.gz_I | the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase | 0.9638 | 2 | 135 |
| 1b66-assembly1.cif.gz_A | 6-pyruvoyl tetrahydropterin synthase | 0.963 | 2 | 135 |
| 3i2b-assembly3.cif.gz_I | the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase | 0.9432 | 2 | 135 |
| 1b66-assembly1.cif.gz_A | 6-pyruvoyl tetrahydropterin synthase | 0.9424 | 2 | 135 |
| 2g64-assembly1.cif.gz_A | structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase | 0.9361 | 2 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q1ZXI0_1_135_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9535 | 2 | 135 | 3.30.479.10 |
| 2g64A00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9361 | 2 | 135 | 3.30.479.10 |
| 4ntmA00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9267 | 1 | 134 | 3.30.479.10 |
| af_Q1ZXI0_1_135_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9195 | 2 | 135 | 3.30.479.10 |
| 4ntmA00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9186 | 1 | 134 | 3.30.479.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A372ISJ7-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 1.002 | 1 | 135 |
GO:0046872
GO:0070497 |
| AF-A0A1H4JCJ5-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 1.001 | 1 | 135 |
GO:0046872
GO:0070497 |
| AF-A0A372ISJ7-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9943 | 1 | 135 |
GO:0046872
GO:0070497 |
| AF-A0A383CQG5-F1-model_v4 | 6-pyruvoyltetrahydropterin synthase | 0.9901 | 1 | 87 |
GO:0016829
GO:0046872 |
| AF-A0A846PD74-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.99 | 1 | 136 |
GO:0016829
GO:0046872 |