F485782
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 922 | 271 | 922 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10073504|Ga0065714_100735044 |
| Length | 246 |
| Sequence | MNRYRHAAVLHSSRLPAARRASIPAAMKLIIGNKAYSSWSLRGWLACKQSGIPFEEVVVPLYDADWDKRREGDEFAPSSGKVPILWDGEAVVWDSLAIMEYLAEKTERAKFWPEDDTARAMARSMAAEMHSSFTALRRKHSMNIRQVFPPKRPDDDVLADIGRIMELWAQARARFGGTGNFLFGEFGAADMMFAPVVTRLVTYGLPIARFATGYMDAVLQHPFMQDWIAGAQEEEWVIEQFEQPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 159 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 185 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 186 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 187 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 188 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 189 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 190 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 194 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 195 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 240 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 241 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 242 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 243 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 244 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 247 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 251 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 253 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 255 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 256 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 257 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 258 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 264 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 265 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 266 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 268 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 271 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.19 |
| Nodule | 0 |
| Rhizoplane | 5.31 |
| Rhizosphere | 93.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004073 | 3300001979 | Bacteria | 6325 |
| 2 | JGI24737J22298_10001469 | 3300001990 | Bacteria | 8398 |
| 3 | JGI24737J22298_10020537 | 3300001990 | Bacteria | 2108 |
| 4 | JGI24737J22298_10026049 | 3300001990 | Bacteria | 1847 |
| 5 | JGI24737J22298_10036136 | 3300001990 | Bacteria | 1527 |
| 6 | JGI24743J22301_10013153 | 3300001991 | Bacteria | 1514 |
| 7 | JGI24735J21928_10016177 | 3300002067 | Bacteria | 2319 |
| 8 | JGI24735J21928_10034464 | 3300002067 | Bacteria | 1492 |
| 9 | JGI24738J21930_10015913 | 3300002075 | Bacteria | 1595 |
| 10 | JGI24744J21845_10011572 | 3300002077 | Bacteria | 1803 |
| 11 | Ga0065714_10073504 | 3300005288 | Bacteria | 3175 |
| 12 | Ga0070658_10002261 | 3300005327 | Bacteria | 16166 |
| 13 | Ga0070658_10003845 | 3300005327 | Bacteria | 12307 |
| 14 | Ga0070658_10014727 | 3300005327 | Bacteria | 6272 |
| 15 | Ga0070658_10016537 | 3300005327 | Bacteria | 5903 |
| 16 | Ga0070658_10081615 | 3300005327 | Bacteria | 2656 |
| 17 | Ga0070658_10095345 | 3300005327 | Bacteria | 2456 |
| 18 | Ga0070658_10097037 | 3300005327 | Bacteria | 2434 |
| 19 | Ga0070658_10147433 | 3300005327 | Bacteria | 1968 |
| 20 | Ga0070658_10203543 | 3300005327 | Bacteria | 1671 |
| 21 | Ga0070658_10470998 | 3300005327 | Bacteria | 1083 |
| 22 | Ga0070658_10814226 | 3300005327 | Bacteria | 811 |
| 23 | Ga0070676_10090890 | 3300005328 | Bacteria | 1870 |
| 24 | Ga0070683_100010399 | 3300005329 | Bacteria | 8004 |
| 25 | Ga0070683_100019869 | 3300005329 | Bacteria | 5971 |
| 26 | Ga0070683_100104557 | 3300005329 | Bacteria | 2669 |
| 27 | Ga0070683_100115603 | 3300005329 | Bacteria | 2533 |
| 28 | Ga0070690_100025929 | 3300005330 | Bacteria | 3612 |
| 29 | Ga0070690_100195783 | 3300005330 | Bacteria | 1403 |
| 30 | Ga0070670_100027175 | 3300005331 | Bacteria | 4923 |
| 31 | Ga0070670_100040285 | 3300005331 | Bacteria | 4017 |
| 32 | Ga0070670_100058431 | 3300005331 | Bacteria | 3311 |
| 33 | Ga0070670_100058924 | 3300005331 | Bacteria | 3296 |
| 34 | Ga0070670_100326572 | 3300005331 | Bacteria | 1345 |
| 35 | Ga0070666_10015314 | 3300005335 | Bacteria | 4889 |
| 36 | Ga0070666_10125854 | 3300005335 | Bacteria | 1779 |
| 37 | Ga0070666_10511985 | 3300005335 | Bacteria | 871 |
| 38 | Ga0070680_100002910 | 3300005336 | Bacteria | 12723 |
| 39 | Ga0070680_100015126 | 3300005336 | Bacteria | 6042 |
| 40 | Ga0070680_100069192 | 3300005336 | Bacteria | 2898 |
| 41 | Ga0070680_100103910 | 3300005336 | Bacteria | 2360 |
| 42 | Ga0070680_100133818 | 3300005336 | Bacteria | 2075 |
| 43 | Ga0070680_100207077 | 3300005336 | Bacteria | 1654 |
| 44 | Ga0070682_100153188 | 3300005337 | Bacteria | 1584 |
| 45 | Ga0070682_100208836 | 3300005337 | Bacteria | 1382 |
| 46 | Ga0068868_100082317 | 3300005338 | Bacteria | 2581 |
| 47 | Ga0068868_100303496 | 3300005338 | Bacteria | 1356 |
| 48 | Ga0068868_100351768 | 3300005338 | Bacteria | 1262 |
| 49 | Ga0070660_100017532 | 3300005339 | Bacteria | 5222 |
| 50 | Ga0070660_100024417 | 3300005339 | Bacteria | 4483 |
| 51 | Ga0070660_100032537 | 3300005339 | Bacteria | 3925 |
| 52 | Ga0070660_100038880 | 3300005339 | Bacteria | 3614 |
| 53 | Ga0070660_100076920 | 3300005339 | Bacteria | 2614 |
| 54 | Ga0070660_100158155 | 3300005339 | Bacteria | 1825 |
| 55 | Ga0070660_100182478 | 3300005339 | Bacteria | 1698 |
| 56 | Ga0070660_100186825 | 3300005339 | Bacteria | 1678 |
| 57 | Ga0070689_100153877 | 3300005340 | Bacteria | 1856 |
| 58 | Ga0070661_100021214 | 3300005344 | Bacteria | 4636 |
| 59 | Ga0070661_100032016 | 3300005344 | Bacteria | 3804 |
| 60 | Ga0070661_100051854 | 3300005344 | Bacteria | 3003 |
| 61 | Ga0070661_100053080 | 3300005344 | Bacteria | 2966 |
| 62 | Ga0070661_100188898 | 3300005344 | Bacteria | 1571 |
| 63 | Ga0070661_100232114 | 3300005344 | Bacteria | 1418 |
| 64 | Ga0070661_100331231 | 3300005344 | Bacteria | 1191 |
| 65 | Ga0070692_10018291 | 3300005345 | Bacteria | 3367 |
| 66 | Ga0070692_10020977 | 3300005345 | Bacteria | 3175 |
| 67 | Ga0070692_10030185 | 3300005345 | Bacteria | 2709 |
| 68 | Ga0070692_10038330 | 3300005345 | Bacteria | 2442 |
| 69 | Ga0070692_10054007 | 3300005345 | Bacteria | 2096 |
| 70 | Ga0070692_10264814 | 3300005345 | Bacteria | 1035 |
| 71 | Ga0070668_100441021 | 3300005347 | Bacteria | 1118 |
| 72 | Ga0070669_100461362 | 3300005353 | Bacteria | 1048 |
| 73 | Ga0070675_100019647 | 3300005354 | Bacteria | 5385 |
| 74 | Ga0070675_100135310 | 3300005354 | Bacteria | 2103 |
| 75 | Ga0070675_100255211 | 3300005354 | Bacteria | 1535 |
| 76 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 77 | Ga0070671_100013831 | 3300005355 | Bacteria | 6512 |
| 78 | Ga0070671_100015000 | 3300005355 | Bacteria | 6257 |
| 79 | Ga0070671_100022193 | 3300005355 | Bacteria | 5185 |
| 80 | Ga0070671_100031974 | 3300005355 | Bacteria | 4350 |
| 81 | Ga0070671_100037652 | 3300005355 | Bacteria | 4012 |
| 82 | Ga0070671_100038168 | 3300005355 | Bacteria | 3987 |
| 83 | Ga0070671_100065937 | 3300005355 | Bacteria | 3017 |
| 84 | Ga0070671_100119756 | 3300005355 | Bacteria | 2215 |
| 85 | Ga0070671_100207204 | 3300005355 | Bacteria | 1663 |
| 86 | Ga0070671_100233092 | 3300005355 | Bacteria | 1562 |
| 87 | Ga0070674_100064899 | 3300005356 | Bacteria | 2560 |
| 88 | Ga0070674_100362538 | 3300005356 | Bacteria | 1174 |
| 89 | Ga0070673_100020625 | 3300005364 | Bacteria | 4755 |
| 90 | Ga0070673_100027808 | 3300005364 | Bacteria | 4196 |
| 91 | Ga0070673_100030292 | 3300005364 | Bacteria | 4046 |
| 92 | Ga0070673_100072770 | 3300005364 | Bacteria | 2765 |
| 93 | Ga0070673_100092486 | 3300005364 | Bacteria | 2474 |
| 94 | Ga0070673_100130300 | 3300005364 | Bacteria | 2109 |
| 95 | Ga0070659_100001058 | 3300005366 | Bacteria | 20125 |
| 96 | Ga0070659_100006754 | 3300005366 | Bacteria | 8297 |
| 97 | Ga0070659_100018867 | 3300005366 | Bacteria | 5210 |
| 98 | Ga0070659_100141380 | 3300005366 | Bacteria | 1960 |
| 99 | Ga0070659_100169340 | 3300005366 | Bacteria | 1788 |
| 100 | Ga0070659_100201266 | 3300005366 | Bacteria | 1639 |
| 101 | Ga0070659_100231674 | 3300005366 | Bacteria | 1526 |
| 102 | Ga0070659_100342055 | 3300005366 | Bacteria | 1254 |
| 103 | Ga0070667_100039693 | 3300005367 | Bacteria | 3946 |
| 104 | Ga0070667_100042609 | 3300005367 | Bacteria | 3809 |
| 105 | Ga0070667_100076481 | 3300005367 | Bacteria | 2858 |
| 106 | Ga0070667_100137560 | 3300005367 | Bacteria | 2136 |
| 107 | Ga0070667_100190149 | 3300005367 | Bacteria | 1818 |
| 108 | Ga0070667_100243392 | 3300005367 | Bacteria | 1607 |
| 109 | Ga0070667_100275906 | 3300005367 | Bacteria | 1508 |
| 110 | Ga0070667_100384195 | 3300005367 | Bacteria | 1276 |
| 111 | Ga0070667_100438584 | 3300005367 | Bacteria | 1192 |
| 112 | Ga0070709_10005496 | 3300005434 | Bacteria | 6867 |
| 113 | Ga0070714_100023828 | 3300005435 | Bacteria | 5034 |
| 114 | Ga0070714_100055018 | 3300005435 | Bacteria | 3401 |
| 115 | Ga0070714_100203405 | 3300005435 | Bacteria | 1812 |
| 116 | Ga0070714_100475198 | 3300005435 | Bacteria | 1190 |
| 117 | Ga0070713_100079220 | 3300005436 | Bacteria | 2798 |
| 118 | Ga0070713_100767591 | 3300005436 | Bacteria | 923 |
| 119 | Ga0070694_100024929 | 3300005444 | Bacteria | 3865 |
| 120 | Ga0070663_100005583 | 3300005455 | Bacteria | 7487 |
| 121 | Ga0070663_100065243 | 3300005455 | Bacteria | 2634 |
| 122 | Ga0070663_100069393 | 3300005455 | Bacteria | 2560 |
| 123 | Ga0070663_100081186 | 3300005455 | Bacteria | 2383 |
| 124 | Ga0070663_100087432 | 3300005455 | Bacteria | 2304 |
| 125 | Ga0070663_100105736 | 3300005455 | Bacteria | 2107 |
| 126 | Ga0070663_100162654 | 3300005455 | Bacteria | 1719 |
| 127 | Ga0070663_100293253 | 3300005455 | Bacteria | 1300 |
| 128 | Ga0070663_101007415 | 3300005455 | Bacteria | 724 |
| 129 | Ga0070678_100006370 | 3300005456 | Bacteria | 6924 |
| 130 | Ga0070678_100274305 | 3300005456 | Bacteria | 1423 |
| 131 | Ga0070678_100491904 | 3300005456 | Bacteria | 1081 |
| 132 | Ga0070662_100013853 | 3300005457 | Bacteria | 5371 |
| 133 | Ga0070662_100026151 | 3300005457 | Bacteria | 4040 |
| 134 | Ga0070662_100039010 | 3300005457 | Bacteria | 3377 |
| 135 | Ga0070662_100055298 | 3300005457 | Bacteria | 2879 |
| 136 | Ga0070662_100183278 | 3300005457 | Bacteria | 1652 |
| 137 | Ga0070662_100406978 | 3300005457 | Bacteria | 1124 |
| 138 | Ga0070681_10024034 | 3300005458 | Bacteria | 6135 |
| 139 | Ga0070681_10204929 | 3300005458 | Bacteria | 1890 |
| 140 | Ga0070681_10510917 | 3300005458 | Bacteria | 1115 |
| 141 | Ga0070681_10603511 | 3300005458 | Bacteria | 1012 |
| 142 | Ga0068867_100041083 | 3300005459 | Bacteria | 3379 |
| 143 | Ga0068867_100161438 | 3300005459 | Bacteria | 1767 |
| 144 | Ga0070706_100142271 | 3300005467 | Bacteria | 2239 |
| 145 | Ga0070679_100119159 | 3300005530 | Bacteria | 2624 |
| 146 | Ga0070679_100236282 | 3300005530 | Bacteria | 1786 |
| 147 | Ga0070679_100305737 | 3300005530 | Bacteria | 1541 |
| 148 | Ga0070679_101085525 | 3300005530 | Bacteria | 745 |
| 149 | Ga0070684_100101049 | 3300005535 | Bacteria | 2576 |
| 150 | Ga0068853_100010266 | 3300005539 | Bacteria | 7574 |
| 151 | Ga0068853_100053054 | 3300005539 | Bacteria | 3492 |
| 152 | Ga0068853_100155009 | 3300005539 | Bacteria | 2064 |
| 153 | Ga0068853_100270493 | 3300005539 | Bacteria | 1564 |
| 154 | Ga0068853_100381695 | 3300005539 | Bacteria | 1316 |
| 155 | Ga0070672_100135761 | 3300005543 | Bacteria | 2026 |
| 156 | Ga0070672_100137257 | 3300005543 | Bacteria | 2014 |
| 157 | Ga0070672_100164139 | 3300005543 | Bacteria | 1844 |
| 158 | Ga0070672_100175908 | 3300005543 | Bacteria | 1782 |
| 159 | Ga0070672_100310003 | 3300005543 | Bacteria | 1339 |
| 160 | Ga0070686_100014585 | 3300005544 | Bacteria | 4534 |
| 161 | Ga0070695_100008415 | 3300005545 | Bacteria | 6125 |
| 162 | Ga0070695_100442645 | 3300005545 | Bacteria | 994 |
| 163 | Ga0070696_100077670 | 3300005546 | Bacteria | 2346 |
| 164 | Ga0070696_100449070 | 3300005546 | Bacteria | 1017 |
| 165 | Ga0070693_100256733 | 3300005547 | Bacteria | 1161 |
| 166 | Ga0070665_100075397 | 3300005548 | Bacteria | 3380 |
| 167 | Ga0068855_100052153 | 3300005563 | Bacteria | 4816 |
| 168 | Ga0068855_100141328 | 3300005563 | Bacteria | 2744 |
| 169 | Ga0068855_100197776 | 3300005563 | Bacteria | 2264 |
| 170 | Ga0068855_100452052 | 3300005563 | Bacteria | 1402 |
| 171 | Ga0070664_100000796 | 3300005564 | Bacteria | 24295 |
| 172 | Ga0070664_100006146 | 3300005564 | Bacteria | 9711 |
| 173 | Ga0070664_100013519 | 3300005564 | Bacteria | 6650 |
| 174 | Ga0070664_100028663 | 3300005564 | Bacteria | 4634 |
| 175 | Ga0070664_100043787 | 3300005564 | Bacteria | 3778 |
| 176 | Ga0070664_100157013 | 3300005564 | Bacteria | 2011 |
| 177 | Ga0068857_100004732 | 3300005577 | Bacteria | 11531 |
| 178 | Ga0068857_100004979 | 3300005577 | Bacteria | 11284 |
| 179 | Ga0068857_100036364 | 3300005577 | Bacteria | 4362 |
| 180 | Ga0068857_100087634 | 3300005577 | Bacteria | 2784 |
| 181 | Ga0068857_100247423 | 3300005577 | Bacteria | 1634 |
| 182 | Ga0068857_100437446 | 3300005577 | Bacteria | 1221 |
| 183 | Ga0068854_100035473 | 3300005578 | Bacteria | 3490 |
| 184 | Ga0068854_100084612 | 3300005578 | Bacteria | 2347 |
| 185 | Ga0068854_100114054 | 3300005578 | Bacteria | 2042 |
| 186 | Ga0068854_100302470 | 3300005578 | Bacteria | 1294 |
| 187 | Ga0068856_100045365 | 3300005614 | Bacteria | 4328 |
| 188 | Ga0068856_100128955 | 3300005614 | Bacteria | 2533 |
| 189 | Ga0068856_100159289 | 3300005614 | Bacteria | 2267 |
| 190 | Ga0068856_100186165 | 3300005614 | Bacteria | 2090 |
| 191 | Ga0068856_100292947 | 3300005614 | Bacteria | 1644 |
| 192 | Ga0068856_100504088 | 3300005614 | Bacteria | 1231 |
| 193 | Ga0068852_100030855 | 3300005616 | Bacteria | 4417 |
| 194 | Ga0068852_100095052 | 3300005616 | Bacteria | 2675 |
| 195 | Ga0068852_100096053 | 3300005616 | Bacteria | 2663 |
| 196 | Ga0068852_100298140 | 3300005616 | Bacteria | 1559 |
| 197 | Ga0068852_100862258 | 3300005616 | Bacteria | 921 |
| 198 | Ga0068859_100045068 | 3300005617 | Bacteria | 4431 |
| 199 | Ga0068859_100060739 | 3300005617 | Bacteria | 3808 |
| 200 | Ga0068859_100067596 | 3300005617 | Bacteria | 3608 |
| 201 | Ga0068859_100203807 | 3300005617 | Bacteria | 2063 |
| 202 | Ga0068859_100516916 | 3300005617 | Bacteria | 1289 |
| 203 | Ga0068864_100003062 | 3300005618 | Bacteria | 13803 |
| 204 | Ga0068864_100004851 | 3300005618 | Bacteria | 11014 |
| 205 | Ga0068864_100007707 | 3300005618 | Bacteria | 8868 |
| 206 | Ga0068864_100010589 | 3300005618 | Bacteria | 7624 |
| 207 | Ga0068864_100015388 | 3300005618 | Bacteria | 6361 |
| 208 | Ga0068864_100038121 | 3300005618 | Bacteria | 4103 |
| 209 | Ga0068864_100192759 | 3300005618 | Bacteria | 1869 |
| 210 | Ga0068864_100219348 | 3300005618 | Bacteria | 1754 |
| 211 | Ga0068866_10013503 | 3300005718 | Bacteria | 3586 |
| 212 | Ga0068866_10033761 | 3300005718 | Bacteria | 2486 |
| 213 | Ga0068866_10064003 | 3300005718 | Bacteria | 1919 |
| 214 | Ga0068851_10012401 | 3300005834 | Bacteria | 4018 |
| 215 | Ga0068851_10027197 | 3300005834 | Bacteria | 2818 |
| 216 | Ga0068863_100003320 | 3300005841 | Bacteria | 15888 |
| 217 | Ga0068863_100012076 | 3300005841 | Bacteria | 8344 |
| 218 | Ga0068863_100012542 | 3300005841 | Bacteria | 8178 |
| 219 | Ga0068863_100015268 | 3300005841 | Bacteria | 7380 |
| 220 | Ga0068863_100028603 | 3300005841 | Bacteria | 5321 |
| 221 | Ga0068863_100031781 | 3300005841 | Bacteria | 5036 |
| 222 | Ga0068863_100107343 | 3300005841 | Bacteria | 2657 |
| 223 | Ga0068863_100114464 | 3300005841 | Bacteria | 2569 |
| 224 | Ga0068858_100008141 | 3300005842 | Bacteria | 10078 |
| 225 | Ga0068858_100009043 | 3300005842 | Bacteria | 9524 |
| 226 | Ga0068858_100021992 | 3300005842 | Bacteria | 5956 |
| 227 | Ga0068858_100039425 | 3300005842 | Bacteria | 4380 |
| 228 | Ga0068860_100006788 | 3300005843 | Bacteria | 11471 |
| 229 | Ga0068860_100043789 | 3300005843 | Bacteria | 4268 |
| 230 | Ga0068860_100248780 | 3300005843 | Bacteria | 1730 |
| 231 | Ga0068860_100311993 | 3300005843 | Bacteria | 1542 |
| 232 | Ga0068860_100335386 | 3300005843 | Bacteria | 1486 |
| 233 | Ga0068862_100000163 | 3300005844 | Bacteria | 74506 |
| 234 | Ga0068862_100005148 | 3300005844 | Bacteria | 10993 |
| 235 | Ga0068862_100011375 | 3300005844 | Bacteria | 7348 |
| 236 | Ga0070712_100015111 | 3300006175 | Bacteria | 4964 |
| 237 | Ga0070712_100307818 | 3300006175 | Bacteria | 1284 |
| 238 | Ga0097621_100044451 | 3300006237 | Bacteria | 3583 |
| 239 | Ga0097621_100078299 | 3300006237 | Bacteria | 2746 |
| 240 | Ga0097621_100308752 | 3300006237 | Bacteria | 1399 |
| 241 | Ga0068871_100043912 | 3300006358 | Bacteria | 3592 |
| 242 | Ga0068871_100055598 | 3300006358 | Bacteria | 3213 |
| 243 | Ga0068871_100246315 | 3300006358 | Bacteria | 1555 |
| 244 | Ga0068865_100059555 | 3300006881 | Bacteria | 2671 |
| 245 | Ga0068865_100099551 | 3300006881 | Bacteria | 2126 |
| 246 | Ga0068865_100239660 | 3300006881 | Bacteria | 1426 |
| 247 | Ga0097620_100045068 | 3300006931 | Bacteria | 4431 |
| 248 | Ga0097620_100060743 | 3300006931 | Bacteria | 3808 |
| 249 | Ga0097620_100067588 | 3300006931 | Bacteria | 3608 |
| 250 | Ga0097620_100203811 | 3300006931 | Bacteria | 2063 |
| 251 | Ga0097620_100516999 | 3300006931 | Bacteria | 1289 |
| 252 | Ga0075435_100725534 | 3300007076 | Bacteria | 864 |
| 253 | Ga0105250_10177509 | 3300009092 | Bacteria | 893 |
| 254 | Ga0105240_10010767 | 3300009093 | Bacteria | 12824 |
| 255 | Ga0105240_10048454 | 3300009093 | Bacteria | 5370 |
| 256 | Ga0105240_10140421 | 3300009093 | Bacteria | 2888 |
| 257 | Ga0105240_10151447 | 3300009093 | Bacteria | 2762 |
| 258 | Ga0105240_11409483 | 3300009093 | Bacteria | 732 |
| 259 | Ga0111539_10180978 | 3300009094 | Bacteria | 2462 |
| 260 | Ga0105245_10011260 | 3300009098 | Bacteria | 7787 |
| 261 | Ga0105245_10028099 | 3300009098 | Bacteria | 4958 |
| 262 | Ga0105247_10002736 | 3300009101 | Bacteria | 11818 |
| 263 | Ga0105247_10234584 | 3300009101 | Bacteria | 1247 |
| 264 | Ga0114129_11079262 | 3300009147 | Bacteria | 1006 |
| 265 | Ga0105243_10034437 | 3300009148 | Bacteria | 3921 |
| 266 | Ga0105243_10285527 | 3300009148 | Bacteria | 1489 |
| 267 | Ga0105241_10117004 | 3300009174 | Bacteria | 2141 |
| 268 | Ga0105241_10144750 | 3300009174 | Bacteria | 1938 |
| 269 | Ga0105242_10000993 | 3300009176 | Bacteria | 22209 |
| 270 | Ga0105248_10046063 | 3300009177 | Bacteria | 4888 |
| 271 | Ga0105248_10118171 | 3300009177 | Bacteria | 2990 |
| 272 | Ga0105248_10278152 | 3300009177 | Bacteria | 1884 |
| 273 | Ga0105248_10431621 | 3300009177 | Bacteria | 1484 |
| 274 | Ga0105248_10436949 | 3300009177 | Bacteria | 1474 |
| 275 | Ga0105248_10523825 | 3300009177 | Bacteria | 1337 |
| 276 | Ga0105248_10641816 | 3300009177 | Bacteria | 1198 |
| 277 | Ga0105237_10013830 | 3300009545 | Bacteria | 8449 |
| 278 | Ga0105237_10044364 | 3300009545 | Bacteria | 4476 |
| 279 | Ga0105249_10000103 | 3300009553 | Bacteria | 118397 |
| 280 | Ga0105249_10048325 | 3300009553 | Bacteria | 3879 |
| 281 | Ga0105249_10275951 | 3300009553 | Bacteria | 1677 |
| 282 | Ga0105239_10031723 | 3300010375 | Bacteria | 5806 |
| 283 | Ga0105246_10031026 | 3300011119 | Bacteria | 3535 |
| 284 | Ga0105246_10145616 | 3300011119 | Bacteria | 1787 |
| 285 | Ga0157373_10056835 | 3300013100 | Bacteria | 2777 |
| 286 | Ga0157373_10093388 | 3300013100 | Bacteria | 2119 |
| 287 | Ga0157373_10096850 | 3300013100 | Bacteria | 2077 |
| 288 | Ga0157373_10298304 | 3300013100 | Bacteria | 1144 |
| 289 | Ga0157371_10012875 | 3300013102 | Bacteria | 6370 |
| 290 | Ga0157371_10014315 | 3300013102 | Bacteria | 5991 |
| 291 | Ga0157371_10169089 | 3300013102 | Bacteria | 1562 |
| 292 | Ga0157371_10330549 | 3300013102 | Bacteria | 1107 |
| 293 | Ga0157370_10002976 | 3300013104 | Bacteria | 20144 |
| 294 | Ga0157370_10154929 | 3300013104 | Bacteria | 2132 |
| 295 | Ga0157370_10162569 | 3300013104 | Bacteria | 2077 |
| 296 | Ga0157370_10605659 | 3300013104 | Bacteria | 1003 |
| 297 | Ga0157369_10013407 | 3300013105 | Bacteria | 9269 |
| 298 | Ga0157369_10016077 | 3300013105 | Bacteria | 8419 |
| 299 | Ga0157369_10019843 | 3300013105 | Bacteria | 7521 |
| 300 | Ga0157369_10038407 | 3300013105 | Bacteria | 5235 |
| 301 | Ga0157369_10079144 | 3300013105 | Bacteria | 3521 |
| 302 | Ga0157369_10165472 | 3300013105 | Bacteria | 2333 |
| 303 | Ga0157369_10236852 | 3300013105 | Bacteria | 1907 |
| 304 | Ga0157369_10280956 | 3300013105 | Bacteria | 1734 |
| 305 | Ga0157369_10297249 | 3300013105 | Bacteria | 1680 |
| 306 | Ga0157369_10418927 | 3300013105 | Bacteria | 1388 |
| 307 | Ga0157369_10850614 | 3300013105 | Bacteria | 936 |
| 308 | Ga0157369_11116845 | 3300013105 | Bacteria | 806 |
| 309 | Ga0157374_10013322 | 3300013296 | Bacteria | 7177 |
| 310 | Ga0157378_10086575 | 3300013297 | Bacteria | 2840 |
| 311 | Ga0157378_10378001 | 3300013297 | Bacteria | 1390 |
| 312 | Ga0157378_10564458 | 3300013297 | Bacteria | 1145 |
| 313 | Ga0163162_10114586 | 3300013306 | Bacteria | 2795 |
| 314 | Ga0163162_10211034 | 3300013306 | Bacteria | 2071 |
| 315 | Ga0163162_10230282 | 3300013306 | Bacteria | 1983 |
| 316 | Ga0163162_10424950 | 3300013306 | Bacteria | 1461 |
| 317 | Ga0157372_10100671 | 3300013307 | Bacteria | 3298 |
| 318 | Ga0157372_10306604 | 3300013307 | Bacteria | 1847 |
| 319 | Ga0157372_10373787 | 3300013307 | Bacteria | 1661 |
| 320 | Ga0157372_10473093 | 3300013307 | Bacteria | 1461 |
| 321 | Ga0157375_10010035 | 3300013308 | Bacteria | 8325 |
| 322 | Ga0157375_10096009 | 3300013308 | Bacteria | 3036 |
| 323 | Ga0157375_10518817 | 3300013308 | Bacteria | 1355 |
| 324 | Ga0163163_10047615 | 3300014325 | Bacteria | 4215 |
| 325 | Ga0163163_10060403 | 3300014325 | Bacteria | 3753 |
| 326 | Ga0163163_10196699 | 3300014325 | Bacteria | 2064 |
| 327 | Ga0163163_10280831 | 3300014325 | Bacteria | 1716 |
| 328 | Ga0182008_10180292 | 3300014497 | Bacteria | 1069 |
| 329 | Ga0157379_10020049 | 3300014968 | Bacteria | 5909 |
| 330 | Ga0157379_10106721 | 3300014968 | Bacteria | 2514 |
| 331 | Ga0157379_10133277 | 3300014968 | Bacteria | 2237 |
| 332 | Ga0157379_10153862 | 3300014968 | Bacteria | 2074 |
| 333 | Ga0157379_10211568 | 3300014968 | Bacteria | 1755 |
| 334 | Ga0157376_10033036 | 3300014969 | Bacteria | 4162 |
| 335 | Ga0206356_11154504 | 3300020070 | Bacteria | 1164 |
| 336 | Ga0207697_10003593 | 3300025315 | Bacteria | 7608 |
| 337 | Ga0207697_10054258 | 3300025315 | Bacteria | 1661 |
| 338 | Ga0207656_10029165 | 3300025321 | Bacteria | 2270 |
| 339 | Ga0207656_10258873 | 3300025321 | Bacteria | 854 |
| 340 | Ga0207713_1029090 | 3300025735 | Bacteria | 2481 |
| 341 | Ga0207642_10005526 | 3300025899 | Bacteria | 4129 |
| 342 | Ga0207642_10169499 | 3300025899 | Bacteria | 1180 |
| 343 | Ga0207642_10183420 | 3300025899 | Bacteria | 1142 |
| 344 | Ga0207710_10007562 | 3300025900 | Bacteria | 4596 |
| 345 | Ga0207688_10046065 | 3300025901 | Bacteria | 2434 |
| 346 | Ga0207688_10116969 | 3300025901 | Bacteria | 1553 |
| 347 | Ga0207688_10161699 | 3300025901 | Bacteria | 1328 |
| 348 | Ga0207680_10101433 | 3300025903 | Bacteria | 1850 |
| 349 | Ga0207647_10003324 | 3300025904 | Bacteria | 12082 |
| 350 | Ga0207647_10004997 | 3300025904 | Bacteria | 9779 |
| 351 | Ga0207647_10007616 | 3300025904 | Bacteria | 7802 |
| 352 | Ga0207647_10036318 | 3300025904 | Bacteria | 3131 |
| 353 | Ga0207647_10037451 | 3300025904 | Bacteria | 3076 |
| 354 | Ga0207647_10039154 | 3300025904 | Bacteria | 2993 |
| 355 | Ga0207647_10039324 | 3300025904 | Bacteria | 2985 |
| 356 | Ga0207647_10081869 | 3300025904 | Bacteria | 1934 |
| 357 | Ga0207699_10030222 | 3300025906 | Bacteria | 3030 |
| 358 | Ga0207645_10161572 | 3300025907 | Bacteria | 1466 |
| 359 | Ga0207643_10084056 | 3300025908 | Bacteria | 1847 |
| 360 | Ga0207705_10000581 | 3300025909 | Bacteria | 30651 |
| 361 | Ga0207705_10002967 | 3300025909 | Bacteria | 12964 |
| 362 | Ga0207705_10004513 | 3300025909 | Bacteria | 10521 |
| 363 | Ga0207705_10006704 | 3300025909 | Bacteria | 8515 |
| 364 | Ga0207705_10008821 | 3300025909 | Bacteria | 7352 |
| 365 | Ga0207705_10046716 | 3300025909 | Bacteria | 3112 |
| 366 | Ga0207705_10051015 | 3300025909 | Bacteria | 2979 |
| 367 | Ga0207705_10058971 | 3300025909 | Bacteria | 2769 |
| 368 | Ga0207705_10125769 | 3300025909 | Bacteria | 1905 |
| 369 | Ga0207705_10134511 | 3300025909 | Bacteria | 1842 |
| 370 | Ga0207705_10468731 | 3300025909 | Bacteria | 977 |
| 371 | Ga0207684_10095695 | 3300025910 | Bacteria | 2534 |
| 372 | Ga0207707_10068256 | 3300025912 | Bacteria | 3098 |
| 373 | Ga0207707_10634720 | 3300025912 | Bacteria | 901 |
| 374 | Ga0207695_10032866 | 3300025913 | Bacteria | 5671 |
| 375 | Ga0207695_10040264 | 3300025913 | Bacteria | 5014 |
| 376 | Ga0207695_10040940 | 3300025913 | Bacteria | 4962 |
| 377 | Ga0207671_10027417 | 3300025914 | Bacteria | 4259 |
| 378 | Ga0207671_10242119 | 3300025914 | Bacteria | 1417 |
| 379 | Ga0207693_10049511 | 3300025915 | Bacteria | 3299 |
| 380 | Ga0207693_10069429 | 3300025915 | Bacteria | 2757 |
| 381 | Ga0207660_10000049 | 3300025917 | Bacteria | 59933 |
| 382 | Ga0207660_10001261 | 3300025917 | Bacteria | 16979 |
| 383 | Ga0207660_10003546 | 3300025917 | Bacteria | 10168 |
| 384 | Ga0207660_10039020 | 3300025917 | Bacteria | 3318 |
| 385 | Ga0207660_10047117 | 3300025917 | Bacteria | 3045 |
| 386 | Ga0207660_10071621 | 3300025917 | Bacteria | 2522 |
| 387 | Ga0207662_10017379 | 3300025918 | Bacteria | 4069 |
| 388 | Ga0207657_10000504 | 3300025919 | Bacteria | 41239 |
| 389 | Ga0207657_10001024 | 3300025919 | Bacteria | 29655 |
| 390 | Ga0207657_10002291 | 3300025919 | Bacteria | 20732 |
| 391 | Ga0207657_10014804 | 3300025919 | Bacteria | 7593 |
| 392 | Ga0207657_10032219 | 3300025919 | Bacteria | 4738 |
| 393 | Ga0207657_10036194 | 3300025919 | Bacteria | 4420 |
| 394 | Ga0207657_10139372 | 3300025919 | Bacteria | 1982 |
| 395 | Ga0207657_10186690 | 3300025919 | Bacteria | 1674 |
| 396 | Ga0207649_10007445 | 3300025920 | Bacteria | 5954 |
| 397 | Ga0207649_10045907 | 3300025920 | Bacteria | 2681 |
| 398 | Ga0207649_10062698 | 3300025920 | Bacteria | 2344 |
| 399 | Ga0207649_10091160 | 3300025920 | Bacteria | 1996 |
| 400 | Ga0207649_10469903 | 3300025920 | Bacteria | 952 |
| 401 | Ga0207652_10024932 | 3300025921 | Bacteria | 4966 |
| 402 | Ga0207652_10035912 | 3300025921 | Bacteria | 4187 |
| 403 | Ga0207652_10108402 | 3300025921 | Bacteria | 2461 |
| 404 | Ga0207652_10208467 | 3300025921 | Bacteria | 1759 |
| 405 | Ga0207652_10721397 | 3300025921 | Bacteria | 889 |
| 406 | Ga0207681_10262839 | 3300025923 | Bacteria | 1352 |
| 407 | Ga0207681_10879605 | 3300025923 | Bacteria | 750 |
| 408 | Ga0207694_10142998 | 3300025924 | Bacteria | 1924 |
| 409 | Ga0207694_10264427 | 3300025924 | Bacteria | 1410 |
| 410 | Ga0207650_10067232 | 3300025925 | Bacteria | 2689 |
| 411 | Ga0207650_10079682 | 3300025925 | Bacteria | 2481 |
| 412 | Ga0207650_10113401 | 3300025925 | Bacteria | 2101 |
| 413 | Ga0207650_10452633 | 3300025925 | Bacteria | 1068 |
| 414 | Ga0207659_10192355 | 3300025926 | Bacteria | 1624 |
| 415 | Ga0207687_10021225 | 3300025927 | Bacteria | 4313 |
| 416 | Ga0207700_10021189 | 3300025928 | Bacteria | 4432 |
| 417 | Ga0207700_10304307 | 3300025928 | Bacteria | 1377 |
| 418 | Ga0207700_10538297 | 3300025928 | Bacteria | 1036 |
| 419 | Ga0207664_10103067 | 3300025929 | Bacteria | 2360 |
| 420 | Ga0207664_10460823 | 3300025929 | Bacteria | 1135 |
| 421 | Ga0207664_10969368 | 3300025929 | Bacteria | 762 |
| 422 | Ga0207644_10003758 | 3300025931 | Bacteria | 9837 |
| 423 | Ga0207644_10007787 | 3300025931 | Bacteria | 6995 |
| 424 | Ga0207644_10009596 | 3300025931 | Bacteria | 6356 |
| 425 | Ga0207644_10013861 | 3300025931 | Bacteria | 5385 |
| 426 | Ga0207644_10024091 | 3300025931 | Bacteria | 4175 |
| 427 | Ga0207644_10144097 | 3300025931 | Bacteria | 1837 |
| 428 | Ga0207644_10318803 | 3300025931 | Bacteria | 1256 |
| 429 | Ga0207690_10001173 | 3300025932 | Bacteria | 16570 |
| 430 | Ga0207690_10021317 | 3300025932 | Bacteria | 4018 |
| 431 | Ga0207690_10035197 | 3300025932 | Bacteria | 3233 |
| 432 | Ga0207690_10049447 | 3300025932 | Bacteria | 2803 |
| 433 | Ga0207690_10062335 | 3300025932 | Bacteria | 2538 |
| 434 | Ga0207706_10010762 | 3300025933 | Bacteria | 8351 |
| 435 | Ga0207706_10018225 | 3300025933 | Bacteria | 6316 |
| 436 | Ga0207706_10032000 | 3300025933 | Bacteria | 4686 |
| 437 | Ga0207706_10035781 | 3300025933 | Bacteria | 4412 |
| 438 | Ga0207706_10040471 | 3300025933 | Bacteria | 4130 |
| 439 | Ga0207706_10063866 | 3300025933 | Bacteria | 3241 |
| 440 | Ga0207706_10065748 | 3300025933 | Bacteria | 3192 |
| 441 | Ga0207706_10228140 | 3300025933 | Bacteria | 1630 |
| 442 | Ga0207706_10238712 | 3300025933 | Bacteria | 1589 |
| 443 | Ga0207686_10086113 | 3300025934 | Bacteria | 2063 |
| 444 | Ga0207669_10013644 | 3300025937 | Bacteria | 4045 |
| 445 | Ga0207669_10178272 | 3300025937 | Bacteria | 1520 |
| 446 | Ga0207704_10060736 | 3300025938 | Bacteria | 2340 |
| 447 | Ga0207704_10128411 | 3300025938 | Bacteria | 1750 |
| 448 | Ga0207691_10001370 | 3300025940 | Bacteria | 24300 |
| 449 | Ga0207691_10093754 | 3300025940 | Bacteria | 2687 |
| 450 | Ga0207691_10111195 | 3300025940 | Bacteria | 2436 |
| 451 | Ga0207691_10149557 | 3300025940 | Bacteria | 2053 |
| 452 | Ga0207691_10151505 | 3300025940 | Bacteria | 2039 |
| 453 | Ga0207691_10205146 | 3300025940 | Bacteria | 1714 |
| 454 | Ga0207691_10302633 | 3300025940 | Bacteria | 1374 |
| 455 | Ga0207711_10003771 | 3300025941 | Bacteria | 13052 |
| 456 | Ga0207711_10003910 | 3300025941 | Bacteria | 12816 |
| 457 | Ga0207711_10011332 | 3300025941 | Bacteria | 7407 |
| 458 | Ga0207711_10164784 | 3300025941 | Bacteria | 2009 |
| 459 | Ga0207711_10218380 | 3300025941 | Bacteria | 1743 |
| 460 | Ga0207711_10223834 | 3300025941 | Bacteria | 1722 |
| 461 | Ga0207711_10542536 | 3300025941 | Bacteria | 1085 |
| 462 | Ga0207711_10565870 | 3300025941 | Bacteria | 1060 |
| 463 | Ga0207689_10021845 | 3300025942 | Bacteria | 5381 |
| 464 | Ga0207689_10383070 | 3300025942 | Bacteria | 1171 |
| 465 | Ga0207661_10013094 | 3300025944 | Bacteria | 6052 |
| 466 | Ga0207661_10090118 | 3300025944 | Bacteria | 2553 |
| 467 | Ga0207661_10441488 | 3300025944 | Bacteria | 1184 |
| 468 | Ga0207679_10033691 | 3300025945 | Bacteria | 3607 |
| 469 | Ga0207679_10137075 | 3300025945 | Bacteria | 1972 |
| 470 | Ga0207679_10215811 | 3300025945 | Bacteria | 1612 |
| 471 | Ga0207679_10588747 | 3300025945 | Bacteria | 1001 |
| 472 | Ga0207667_10017613 | 3300025949 | Bacteria | 8035 |
| 473 | Ga0207667_10038314 | 3300025949 | Bacteria | 5121 |
| 474 | Ga0207667_10080420 | 3300025949 | Bacteria | 3376 |
| 475 | Ga0207667_10247312 | 3300025949 | Bacteria | 1825 |
| 476 | Ga0207651_10001484 | 3300025960 | Bacteria | 10671 |
| 477 | Ga0207651_10041421 | 3300025960 | Bacteria | 3057 |
| 478 | Ga0207651_10042885 | 3300025960 | Bacteria | 3015 |
| 479 | Ga0207651_10051538 | 3300025960 | Bacteria | 2801 |
| 480 | Ga0207651_10140550 | 3300025960 | Bacteria | 1864 |
| 481 | Ga0207651_10153924 | 3300025960 | Bacteria | 1794 |
| 482 | Ga0207651_10191294 | 3300025960 | Bacteria | 1632 |
| 483 | Ga0207651_10205174 | 3300025960 | Bacteria | 1583 |
| 484 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 485 | Ga0207712_10043240 | 3300025961 | Bacteria | 3106 |
| 486 | Ga0207712_10155645 | 3300025961 | Bacteria | 1770 |
| 487 | Ga0207668_10037107 | 3300025972 | Bacteria | 3259 |
| 488 | Ga0207640_10018699 | 3300025981 | Bacteria | 4077 |
| 489 | Ga0207640_10023246 | 3300025981 | Bacteria | 3723 |
| 490 | Ga0207640_10048921 | 3300025981 | Bacteria | 2736 |
| 491 | Ga0207640_10054510 | 3300025981 | Bacteria | 2614 |
| 492 | Ga0207658_10008045 | 3300025986 | Bacteria | 7184 |
| 493 | Ga0207658_10016283 | 3300025986 | Bacteria | 5112 |
| 494 | Ga0207658_10042081 | 3300025986 | Bacteria | 3311 |
| 495 | Ga0207658_10069963 | 3300025986 | Bacteria | 2653 |
| 496 | Ga0207658_10070845 | 3300025986 | Bacteria | 2638 |
| 497 | Ga0207658_10135376 | 3300025986 | Bacteria | 1985 |
| 498 | Ga0207658_10256317 | 3300025986 | Bacteria | 1489 |
| 499 | Ga0207658_10427161 | 3300025986 | Bacteria | 1169 |
| 500 | Ga0207658_10552442 | 3300025986 | Bacteria | 1030 |
| 501 | Ga0207677_10018043 | 3300026023 | Bacteria | 4226 |
| 502 | Ga0207677_10038156 | 3300026023 | Bacteria | 3147 |
| 503 | Ga0207677_10126659 | 3300026023 | Bacteria | 1931 |
| 504 | Ga0207677_10253772 | 3300026023 | Bacteria | 1430 |
| 505 | Ga0207677_10274496 | 3300026023 | Bacteria | 1381 |
| 506 | Ga0207703_10002473 | 3300026035 | Bacteria | 16026 |
| 507 | Ga0207703_10020734 | 3300026035 | Bacteria | 5143 |
| 508 | Ga0207703_10038460 | 3300026035 | Bacteria | 3818 |
| 509 | Ga0207639_10000798 | 3300026041 | Bacteria | 21425 |
| 510 | Ga0207639_10234441 | 3300026041 | Bacteria | 1593 |
| 511 | Ga0207678_10009190 | 3300026067 | Bacteria | 8701 |
| 512 | Ga0207678_10012937 | 3300026067 | Bacteria | 7323 |
| 513 | Ga0207678_10025444 | 3300026067 | Bacteria | 5165 |
| 514 | Ga0207678_10045966 | 3300026067 | Bacteria | 3775 |
| 515 | Ga0207678_10099798 | 3300026067 | Bacteria | 2480 |
| 516 | Ga0207678_10141300 | 3300026067 | Bacteria | 2055 |
| 517 | Ga0207678_10267938 | 3300026067 | Bacteria | 1464 |
| 518 | Ga0207702_10004418 | 3300026078 | Bacteria | 12500 |
| 519 | Ga0207702_10028286 | 3300026078 | Bacteria | 4658 |
| 520 | Ga0207702_10066302 | 3300026078 | Bacteria | 3094 |
| 521 | Ga0207702_10091175 | 3300026078 | Bacteria | 2668 |
| 522 | Ga0207702_10119857 | 3300026078 | Bacteria | 2353 |
| 523 | Ga0207702_10605623 | 3300026078 | Bacteria | 1075 |
| 524 | Ga0207702_10929694 | 3300026078 | Bacteria | 862 |
| 525 | Ga0207641_10005331 | 3300026088 | Bacteria | 10984 |
| 526 | Ga0207641_10010488 | 3300026088 | Bacteria | 7606 |
| 527 | Ga0207641_10014002 | 3300026088 | Bacteria | 6575 |
| 528 | Ga0207641_10016333 | 3300026088 | Bacteria | 6078 |
| 529 | Ga0207641_10017560 | 3300026088 | Bacteria | 5858 |
| 530 | Ga0207641_10053480 | 3300026088 | Bacteria | 3423 |
| 531 | Ga0207648_10004524 | 3300026089 | Bacteria | 14251 |
| 532 | Ga0207676_10009112 | 3300026095 | Bacteria | 7069 |
| 533 | Ga0207676_10064299 | 3300026095 | Bacteria | 2917 |
| 534 | Ga0207676_10112195 | 3300026095 | Bacteria | 2283 |
| 535 | Ga0207676_10141914 | 3300026095 | Bacteria | 2057 |
| 536 | Ga0207676_10249643 | 3300026095 | Bacteria | 1596 |
| 537 | Ga0207674_10000291 | 3300026116 | Bacteria | 63446 |
| 538 | Ga0207674_10000527 | 3300026116 | Bacteria | 50282 |
| 539 | Ga0207674_10000580 | 3300026116 | Bacteria | 48154 |
| 540 | Ga0207674_10011858 | 3300026116 | Bacteria | 9770 |
| 541 | Ga0207674_10015259 | 3300026116 | Bacteria | 8449 |
| 542 | Ga0207674_11010753 | 3300026116 | Bacteria | 801 |
| 543 | Ga0207675_100104253 | 3300026118 | Bacteria | 2673 |
| 544 | Ga0207675_100359630 | 3300026118 | Bacteria | 1428 |
| 545 | Ga0207683_10007206 | 3300026121 | Bacteria | 9534 |
| 546 | Ga0207683_10016776 | 3300026121 | Bacteria | 6233 |
| 547 | Ga0207683_10040094 | 3300026121 | Bacteria | 4085 |
| 548 | Ga0207683_10040215 | 3300026121 | Bacteria | 4079 |
| 549 | Ga0207683_10196562 | 3300026121 | Bacteria | 1832 |
| 550 | Ga0207683_10213917 | 3300026121 | Bacteria | 1755 |
| 551 | Ga0207683_10899942 | 3300026121 | Bacteria | 822 |
| 552 | Ga0207698_10000703 | 3300026142 | Bacteria | 19442 |
| 553 | Ga0207698_10002428 | 3300026142 | Bacteria | 11031 |
| 554 | Ga0207698_10104662 | 3300026142 | Bacteria | 2355 |
| 555 | Ga0207698_10121337 | 3300026142 | Bacteria | 2213 |
| 556 | Ga0207698_10504956 | 3300026142 | Bacteria | 1177 |
| 557 | Ga0209974_10011638 | 3300027876 | Bacteria | 2953 |
| 558 | Ga0268266_10124657 | 3300028379 | Bacteria | 2297 |
| 559 | Ga0268266_10283725 | 3300028379 | Bacteria | 1540 |
| 560 | Ga0268266_10562897 | 3300028379 | Unclassified | 1093 |
| 561 | Ga0268265_10000182 | 3300028380 | Bacteria | 74651 |
| 562 | Ga0268265_10044163 | 3300028380 | Bacteria | 3317 |
| 563 | Ga0268264_10004758 | 3300028381 | Bacteria | 11524 |
| 564 | Ga0268264_10029877 | 3300028381 | Bacteria | 4467 |
| 565 | Ga0268264_10056900 | 3300028381 | Bacteria | 3269 |
| 566 | Ga0268264_10063115 | 3300028381 | Bacteria | 3113 |
| 567 | Ga0268264_10396532 | 3300028381 | Bacteria | 1325 |
| 568 | Ga0316180_1176809 | 3300030736 | Bacteria | 1301 |
| 569 | Ga0316183_1203903 | 3300030742 | Bacteria | 860 |
| 570 | Ga0307513_10035516 | 3300031456 | Bacteria | 5575 |
| 571 | Ga0307408_100375539 | 3300031548 | Bacteria | 1214 |
| 572 | Ga0307405_10033725 | 3300031731 | Bacteria | 3040 |
| 573 | Ga0307405_10324564 | 3300031731 | Bacteria | 1177 |
| 574 | Ga0307413_10016128 | 3300031824 | Bacteria | 3849 |
| 575 | Ga0307413_10068484 | 3300031824 | Bacteria | 2223 |
| 576 | Ga0307410_10007481 | 3300031852 | Bacteria | 5982 |
| 577 | Ga0307410_10042547 | 3300031852 | Bacteria | 3004 |
| 578 | Ga0307410_10071481 | 3300031852 | Bacteria | 2406 |
| 579 | Ga0307410_10225692 | 3300031852 | Bacteria | 1443 |
| 580 | Ga0307406_10138467 | 3300031901 | Bacteria | 1719 |
| 581 | Ga0307406_10148634 | 3300031901 | Bacteria | 1668 |
| 582 | Ga0307407_10345909 | 3300031903 | Bacteria | 1051 |
| 583 | Ga0307412_10151425 | 3300031911 | Bacteria | 1712 |
| 584 | Ga0307412_10498930 | 3300031911 | Bacteria | 1013 |
| 585 | Ga0307409_100009048 | 3300031995 | Bacteria | 6093 |
| 586 | Ga0307409_100011708 | 3300031995 | Bacteria | 5548 |
| 587 | Ga0307409_100117414 | 3300031995 | Bacteria | 2245 |
| 588 | Ga0307409_100705244 | 3300031995 | Bacteria | 1009 |
| 589 | Ga0307416_100008789 | 3300032002 | Bacteria | 6550 |
| 590 | Ga0307416_100890947 | 3300032002 | Bacteria | 989 |
| 591 | Ga0307414_10029208 | 3300032004 | Bacteria | 3586 |
| 592 | Ga0307414_10137642 | 3300032004 | Bacteria | 1906 |
| 593 | Ga0307411_10006836 | 3300032005 | Bacteria | 5744 |
| 594 | Ga0307411_10035433 | 3300032005 | Bacteria | 3117 |
| 595 | Ga0307411_10086347 | 3300032005 | Bacteria | 2176 |
| 596 | Ga0307411_10105023 | 3300032005 | Bacteria | 2007 |
| 597 | Ga0307411_10155346 | 3300032005 | Bacteria | 1706 |
| 598 | Ga0307411_10385226 | 3300032005 | Bacteria | 1154 |
| 599 | Ga0307415_100012202 | 3300032126 | Bacteria | 4960 |
| 600 | Ga0307415_100226055 | 3300032126 | Bacteria | 1504 |
| 601 | Ga0307415_100282974 | 3300032126 | Bacteria | 1365 |
| 602 | Ga0373943_0013861 | 3300035170 | Bacteria | 3645 |
| 603 | Ga0373931_0067265 | 3300035691 | Bacteria | 1946 |
| 604 | Ga0373935_0101081 | 3300035692 | Bacteria | 1901 |
| 605 | Ga0373935_0198422 | 3300035692 | Bacteria | 1385 |
| 606 | Ga0373925_0016074 | 3300037068 | Bacteria | 5419 |
| 607 | Ga0395899_0000287 | 3300037312 | Bacteria | 64885 |
| 608 | Ga0395899_0020496 | 3300037312 | Bacteria | 5011 |
| 609 | Ga0395899_0025056 | 3300037312 | Bacteria | 4504 |
| 610 | Ga0395899_0049564 | 3300037312 | Bacteria | 3121 |
| 611 | Ga0395899_0054770 | 3300037312 | Bacteria | 2951 |
| 612 | Ga0395899_0086819 | 3300037312 | Bacteria | 2272 |
| 613 | Ga0395899_0094844 | 3300037312 | Bacteria | 2158 |
| 614 | Ga0395899_0113132 | 3300037312 | Bacteria | 1950 |
| 615 | Ga0395899_0155462 | 3300037312 | Bacteria | 1618 |
| 616 | Ga0395899_0158687 | 3300037312 | Bacteria | 1599 |
| 617 | Ga0395899_0158878 | 3300037312 | Bacteria | 1598 |
| 618 | Ga0395899_0198001 | 3300037312 | Bacteria | 1402 |
| 619 | Ga0395899_0415461 | 3300037312 | Bacteria | 887 |
| 620 | Ga0395899_0430060 | 3300037312 | Bacteria | 868 |
| 621 | Ga0395899_0475788 | 3300037312 | Bacteria | 814 |
| 622 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 623 | Ga0395900_0001820 | 3300037418 | Bacteria | 24365 |
| 624 | Ga0395900_0016658 | 3300037418 | Bacteria | 7496 |
| 625 | Ga0395900_0017792 | 3300037418 | Bacteria | 7256 |
| 626 | Ga0395900_0018428 | 3300037418 | Bacteria | 7120 |
| 627 | Ga0395900_0020351 | 3300037418 | Bacteria | 6773 |
| 628 | Ga0395900_0021255 | 3300037418 | Bacteria | 6635 |
| 629 | Ga0395900_0021453 | 3300037418 | Bacteria | 6603 |
| 630 | Ga0395900_0031110 | 3300037418 | Bacteria | 5483 |
| 631 | Ga0395900_0046969 | 3300037418 | Bacteria | 4446 |
| 632 | Ga0395900_0049580 | 3300037418 | Bacteria | 4326 |
| 633 | Ga0395900_0060055 | 3300037418 | Bacteria | 3913 |
| 634 | Ga0395900_0061775 | 3300037418 | Bacteria | 3851 |
| 635 | Ga0395900_0077266 | 3300037418 | Bacteria | 3420 |
| 636 | Ga0395900_0094309 | 3300037418 | Bacteria | 3074 |
| 637 | Ga0395900_0100391 | 3300037418 | Bacteria | 2973 |
| 638 | Ga0395900_0100615 | 3300037418 | Bacteria | 2969 |
| 639 | Ga0395900_0106134 | 3300037418 | Bacteria | 2885 |
| 640 | Ga0395900_0137970 | 3300037418 | Bacteria | 2498 |
| 641 | Ga0395900_0178125 | 3300037418 | Bacteria | 2162 |
| 642 | Ga0395900_0205781 | 3300037418 | Bacteria | 1989 |
| 643 | Ga0395900_0244736 | 3300037418 | Bacteria | 1797 |
| 644 | Ga0395900_0359188 | 3300037418 | Bacteria | 1428 |
| 645 | Ga0395900_0396418 | 3300037418 | Bacteria | 1345 |
| 646 | Ga0395900_0409531 | 3300037418 | Bacteria | 1318 |
| 647 | Ga0395900_0480744 | 3300037418 | Bacteria | 1194 |
| 648 | Ga0395900_0582656 | 3300037418 | Bacteria | 1061 |
| 649 | Ga0395900_0778953 | 3300037418 | Bacteria | 885 |
| 650 | Ga0395900_1004937 | 3300037418 | Bacteria | 754 |
| 651 | Ga0395898_0003799 | 3300037466 | Bacteria | 16718 |
| 652 | Ga0395898_0006374 | 3300037466 | Bacteria | 12605 |
| 653 | Ga0395898_0008195 | 3300037466 | Bacteria | 11054 |
| 654 | Ga0395898_0012131 | 3300037466 | Bacteria | 8917 |
| 655 | Ga0395898_0015150 | 3300037466 | Bacteria | 7913 |
| 656 | Ga0395898_0023568 | 3300037466 | Bacteria | 6218 |
| 657 | Ga0395898_0083097 | 3300037466 | Bacteria | 3086 |
| 658 | Ga0395898_0086427 | 3300037466 | Bacteria | 3022 |
| 659 | Ga0395898_0088294 | 3300037466 | Bacteria | 2985 |
| 660 | Ga0395898_0157155 | 3300037466 | Bacteria | 2175 |
| 661 | Ga0395898_0249873 | 3300037466 | Bacteria | 1691 |
| 662 | Ga0395898_0318162 | 3300037466 | Bacteria | 1484 |
| 663 | Ga0395898_0378895 | 3300037466 | Bacteria | 1349 |
| 664 | Ga0395905_0002222 | 3300037471 | Bacteria | 21895 |
| 665 | Ga0395905_0006961 | 3300037471 | Bacteria | 11302 |
| 666 | Ga0395905_0009030 | 3300037471 | Bacteria | 9780 |
| 667 | Ga0395905_0013050 | 3300037471 | Bacteria | 7980 |
| 668 | Ga0395905_0018675 | 3300037471 | Bacteria | 6576 |
| 669 | Ga0395905_0024947 | 3300037471 | Bacteria | 5640 |
| 670 | Ga0395905_0029724 | 3300037471 | Bacteria | 5150 |
| 671 | Ga0395905_0030597 | 3300037471 | Bacteria | 5070 |
| 672 | Ga0395905_0031077 | 3300037471 | Bacteria | 5029 |
| 673 | Ga0395905_0035114 | 3300037471 | Bacteria | 4707 |
| 674 | Ga0395905_0042384 | 3300037471 | Bacteria | 4271 |
| 675 | Ga0395905_0047522 | 3300037471 | Bacteria | 4022 |
| 676 | Ga0395905_0049013 | 3300037471 | Bacteria | 3958 |
| 677 | Ga0395905_0069814 | 3300037471 | Bacteria | 3291 |
| 678 | Ga0395905_0076008 | 3300037471 | Bacteria | 3147 |
| 679 | Ga0395905_0079252 | 3300037471 | Bacteria | 3078 |
| 680 | Ga0395905_0082571 | 3300037471 | Bacteria | 3011 |
| 681 | Ga0395905_0084968 | 3300037471 | Bacteria | 2965 |
| 682 | Ga0395905_0105416 | 3300037471 | Bacteria | 2647 |
| 683 | Ga0395905_0142162 | 3300037471 | Bacteria | 2257 |
| 684 | Ga0395905_0142472 | 3300037471 | Bacteria | 2254 |
| 685 | Ga0395905_0160258 | 3300037471 | Bacteria | 2115 |
| 686 | Ga0395905_0186035 | 3300037471 | Bacteria | 1949 |
| 687 | Ga0395905_0204800 | 3300037471 | Bacteria | 1849 |
| 688 | Ga0395905_0230407 | 3300037471 | Bacteria | 1732 |
| 689 | Ga0395905_0508347 | 3300037471 | Bacteria | 1105 |
| 690 | Ga0395905_0580452 | 3300037471 | Bacteria | 1022 |
| 691 | Ga0395905_0590118 | 3300037471 | Bacteria | 1013 |
| 692 | Ga0395901_0000035 | 3300038443 | Bacteria | 223888 |
| 693 | Ga0395901_0000329 | 3300038443 | Bacteria | 58460 |
| 694 | Ga0395901_0006312 | 3300038443 | Bacteria | 12008 |
| 695 | Ga0395901_0012265 | 3300038443 | Bacteria | 8698 |
| 696 | Ga0395901_0020998 | 3300038443 | Bacteria | 6689 |
| 697 | Ga0395901_0022979 | 3300038443 | Bacteria | 6391 |
| 698 | Ga0395901_0038552 | 3300038443 | Bacteria | 4943 |
| 699 | Ga0395901_0039511 | 3300038443 | Bacteria | 4882 |
| 700 | Ga0395901_0042251 | 3300038443 | Bacteria | 4726 |
| 701 | Ga0395901_0053777 | 3300038443 | Bacteria | 4184 |
| 702 | Ga0395901_0058872 | 3300038443 | Bacteria | 3996 |
| 703 | Ga0395901_0072007 | 3300038443 | Bacteria | 3602 |
| 704 | Ga0395901_0081482 | 3300038443 | Bacteria | 3380 |
| 705 | Ga0395901_0085473 | 3300038443 | Bacteria | 3298 |
| 706 | Ga0395901_0120953 | 3300038443 | Bacteria | 2751 |
| 707 | Ga0395901_0136801 | 3300038443 | Bacteria | 2574 |
| 708 | Ga0395901_0180313 | 3300038443 | Bacteria | 2215 |
| 709 | Ga0395901_0192161 | 3300038443 | Bacteria | 2140 |
| 710 | Ga0395901_0240012 | 3300038443 | Bacteria | 1890 |
| 711 | Ga0395901_0255376 | 3300038443 | Bacteria | 1825 |
| 712 | Ga0395901_0282993 | 3300038443 | Bacteria | 1722 |
| 713 | Ga0395901_0362357 | 3300038443 | Bacteria | 1495 |
| 714 | Ga0395901_0548787 | 3300038443 | Bacteria | 1171 |
| 715 | Ga0395901_0577847 | 3300038443 | Bacteria | 1136 |
| 716 | Ga0395901_0679498 | 3300038443 | Bacteria | 1029 |
| 717 | Ga0395901_0703211 | 3300038443 | Bacteria | 1008 |
| 718 | Ga0436365_0693987 | 3300039437 | Bacteria | 2766 |
| 719 | Ga0436363_0985832 | 3300039450 | Bacteria | 2098 |
| 720 | Ga0450914_000439 | 3300042118 | Bacteria | 1929 |
| 721 | Ga0450890_004047 | 3300042127 | Bacteria | 1928 |
| 722 | Ga0450903_020219 | 3300042138 | Bacteria | 1030 |
| 723 | Ga0450889_000044 | 3300042144 | Bacteria | 11037 |
| 724 | Ga0439458_0000547 | 3300042157 | Bacteria | 9684 |
| 725 | Ga0439458_0029266 | 3300042157 | Bacteria | 1306 |
| 726 | Ga0439464_0002797 | 3300042439 | Bacteria | 4332 |
| 727 | Ga0450916_008215 | 3300042530 | Bacteria | 1267 |
| 728 | Ga0466969_0003047 | 3300044656 | Bacteria | 8932 |
| 729 | Ga0466969_0040687 | 3300044656 | Bacteria | 2328 |
| 730 | Ga0466969_0121746 | 3300044656 | Bacteria | 1214 |
| 731 | Ga0466972_0024711 | 3300044658 | Bacteria | 2982 |
| 732 | Ga0466972_0071209 | 3300044658 | Bacteria | 1659 |
| 733 | Ga0466972_0102093 | 3300044658 | Bacteria | 1357 |
| 734 | Ga0466965_0161878 | 3300044683 | Bacteria | 1174 |
| 735 | Ga0466965_0216184 | 3300044683 | Bacteria | 1020 |
| 736 | Ga0466966_0007715 | 3300044684 | Bacteria | 7125 |
| 737 | Ga0466966_0044030 | 3300044684 | Bacteria | 2859 |
| 738 | Ga0466966_0085056 | 3300044684 | Bacteria | 1966 |
| 739 | Ga0466966_0255387 | 3300044684 | Bacteria | 1056 |
| 740 | Ga0466961_0007983 | 3300044693 | Bacteria | 6746 |
| 741 | Ga0466961_0063839 | 3300044693 | Bacteria | 2340 |
| 742 | Ga0466961_0076150 | 3300044693 | Bacteria | 2126 |
| 743 | Ga0466961_0107878 | 3300044693 | Bacteria | 1753 |
| 744 | Ga0466961_0186633 | 3300044693 | Bacteria | 1286 |
| 745 | Ga0466963_0004259 | 3300044694 | Bacteria | 8302 |
| 746 | Ga0466963_0019600 | 3300044694 | Bacteria | 4245 |
| 747 | Ga0466963_0023316 | 3300044694 | Bacteria | 3928 |
| 748 | Ga0466963_0034898 | 3300044694 | Bacteria | 3275 |
| 749 | Ga0466963_0035336 | 3300044694 | Bacteria | 3255 |
| 750 | Ga0466963_0132080 | 3300044694 | Bacteria | 1725 |
| 751 | Ga0466963_0243668 | 3300044694 | Bacteria | 1261 |
| 752 | Ga0466963_0251544 | 3300044694 | Bacteria | 1240 |
| 753 | Ga0466964_0007184 | 3300044706 | Bacteria | 4165 |
| 754 | Ga0466964_0139791 | 3300044706 | Bacteria | 1112 |
| 755 | Ga0466964_0150964 | 3300044706 | Bacteria | 1077 |
| 756 | Ga0466971_0004107 | 3300044719 | Bacteria | 6270 |
| 757 | Ga0466971_0019803 | 3300044719 | Bacteria | 2989 |
| 758 | Ga0466971_0024097 | 3300044719 | Bacteria | 2714 |
| 759 | Ga0466971_0072633 | 3300044719 | Bacteria | 1563 |
| 760 | Ga0466971_0103199 | 3300044719 | Bacteria | 1312 |
| 761 | Ga0466968_0076791 | 3300044735 | Bacteria | 1462 |
| 762 | Ga0466970_0020907 | 3300044765 | Bacteria | 3406 |
| 763 | Ga0466970_0021787 | 3300044765 | Bacteria | 3341 |
| 764 | Ga0466970_0105509 | 3300044765 | Bacteria | 1537 |
| 765 | Ga0466970_0136491 | 3300044765 | Bacteria | 1349 |
| 766 | Ga0466957_0000953 | 3300044842 | Bacteria | 14840 |
| 767 | Ga0466957_0007678 | 3300044842 | Bacteria | 6099 |
| 768 | Ga0466957_0007713 | 3300044842 | Bacteria | 6087 |
| 769 | Ga0466957_0084239 | 3300044842 | Bacteria | 1984 |
| 770 | Ga0466957_0130723 | 3300044842 | Bacteria | 1608 |
| 771 | Ga0466957_0183451 | 3300044842 | Bacteria | 1367 |
| 772 | Ga0466957_0224685 | 3300044842 | Bacteria | 1241 |
| 773 | Ga0466957_0448181 | 3300044842 | Bacteria | 889 |
| 774 | Ga0466957_0455965 | 3300044842 | Bacteria | 881 |
| 775 | Ga0466957_0725802 | 3300044842 | Bacteria | 702 |
| 776 | Ga0466959_0012236 | 3300045049 | Bacteria | 6192 |
| 777 | Ga0466959_0018998 | 3300045049 | Bacteria | 5051 |
| 778 | Ga0466959_0036055 | 3300045049 | Bacteria | 3655 |
| 779 | Ga0466959_0071944 | 3300045049 | Bacteria | 2503 |
| 780 | Ga0466959_0122746 | 3300045049 | Bacteria | 1845 |
| 781 | Ga0466959_0607179 | 3300045049 | Bacteria | 736 |
| 782 | Ga0466958_0000295 | 3300045836 | Bacteria | 19538 |
| 783 | Ga0466958_0014596 | 3300045836 | Bacteria | 4484 |
| 784 | Ga0466958_0074564 | 3300045836 | Bacteria | 2080 |
| 785 | Ga0466958_0122981 | 3300045836 | Bacteria | 1625 |
| 786 | Ga0466967_0022991 | 3300045976 | Bacteria | 5100 |
| 787 | Ga0466967_0139934 | 3300045976 | Bacteria | 2253 |
| 788 | Ga0466967_0180879 | 3300045976 | Bacteria | 1989 |
| 789 | Ga0466967_0312726 | 3300045976 | Bacteria | 1513 |
| 790 | Ga0466967_0351704 | 3300045976 | Bacteria | 1426 |
| 791 | Ga0466967_0447165 | 3300045976 | Bacteria | 1263 |
| 792 | Ga0466967_0626680 | 3300045976 | Bacteria | 1062 |
| 793 | Ga0466967_1195944 | 3300045976 | Bacteria | 757 |
| 794 | Ga0495638_0001274 | 3300046460 | Bacteria | 23496 |
| 795 | Ga0495583_0139937 | 3300046506 | Bacteria | 1008 |
| 796 | Ga0495616_0000013 | 3300046513 | Bacteria | 202334 |
| 797 | Ga0495616_0046374 | 3300046513 | Bacteria | 2194 |
| 798 | Ga0495663_0002538 | 3300046525 | Bacteria | 5468 |
| 799 | Ga0495663_0048754 | 3300046525 | Bacteria | 1307 |
| 800 | Ga0495663_0188753 | 3300046525 | Bacteria | 716 |
| 801 | Ga0495642_0134846 | 3300046528 | Bacteria | 1064 |
| 802 | Ga0495654_0087984 | 3300046530 | Bacteria | 1445 |
| 803 | Ga0495598_0000845 | 3300046537 | Bacteria | 5871 |
| 804 | Ga0495621_0000149 | 3300046539 | Bacteria | 15217 |
| 805 | Ga0495621_0001328 | 3300046539 | Bacteria | 6390 |
| 806 | Ga0495633_0002984 | 3300046558 | Bacteria | 11573 |
| 807 | Ga0495668_0006182 | 3300046616 | Bacteria | 7917 |
| 808 | Ga0495668_0014546 | 3300046616 | Bacteria | 4610 |
| 809 | Ga0495668_0018230 | 3300046616 | Bacteria | 4057 |
| 810 | Ga0495668_0035340 | 3300046616 | Bacteria | 2802 |
| 811 | Ga0495625_0000231 | 3300046660 | Bacteria | 87237 |
| 812 | Ga0495661_0070681 | 3300046665 | Bacteria | 2042 |
| 813 | Ga0495669_0002257 | 3300046684 | Bacteria | 7905 |
| 814 | Ga0495669_0003671 | 3300046684 | Bacteria | 6318 |
| 815 | Ga0495669_0003927 | 3300046684 | Bacteria | 6123 |
| 816 | Ga0495669_0004671 | 3300046684 | Bacteria | 5677 |
| 817 | Ga0495669_0029506 | 3300046684 | Bacteria | 2405 |
| 818 | Ga0495669_0030479 | 3300046684 | Bacteria | 2368 |
| 819 | Ga0495669_0031735 | 3300046684 | Bacteria | 2320 |
| 820 | Ga0495669_0044364 | 3300046684 | Bacteria | 1980 |
| 821 | Ga0495670_0004834 | 3300046691 | Bacteria | 6616 |
| 822 | Ga0495670_0005175 | 3300046691 | Bacteria | 6418 |
| 823 | Ga0495670_0068840 | 3300046691 | Bacteria | 1789 |
| 824 | Ga0495649_0178906 | 3300046694 | Bacteria | 1107 |
| 825 | Ga0495677_0004046 | 3300047445 | Bacteria | 5658 |
| 826 | Ga0495677_0005059 | 3300047445 | Bacteria | 5024 |
| 827 | Ga0495677_0096117 | 3300047445 | Bacteria | 1119 |
| 828 | Ga0495685_094551 | 3300047447 | Bacteria | 989 |
| 829 | Ga0495686_0054742 | 3300047472 | Bacteria | 2497 |
| 830 | Ga0496100_0000581 | 3300048903 | Bacteria | 17237 |
| 831 | Ga0496100_0190503 | 3300048903 | Bacteria | 1489 |
| 832 | Ga0496101_0001704 | 3300048904 | Bacteria | 13163 |
| 833 | Ga0496101_0521870 | 3300048904 | Bacteria | 939 |
| 834 | Ga0496101_0774371 | 3300048904 | Bacteria | 757 |
| 835 | Ga0496102_0041388 | 3300048905 | Bacteria | 4172 |
| 836 | Ga0496102_0266140 | 3300048905 | Bacteria | 1616 |
| 837 | Ga0496102_0753257 | 3300048905 | Bacteria | 897 |
| 838 | Ga0496102_0787460 | 3300048905 | Bacteria | 873 |
| 839 | Ga0496103_0032276 | 3300048906 | Bacteria | 3195 |
| 840 | Ga0496103_0046272 | 3300048906 | Bacteria | 2686 |
| 841 | Ga0496105_0012037 | 3300048908 | Bacteria | 6849 |
| 842 | Ga0496105_0255429 | 3300048908 | Bacteria | 1419 |
| 843 | Ga0496106_0077615 | 3300048909 | Bacteria | 2547 |
| 844 | Ga0496106_0203935 | 3300048909 | Bacteria | 1574 |
| 845 | Ga0496107_0002199 | 3300048910 | Bacteria | 12535 |
| 846 | Ga0496107_0005092 | 3300048910 | Bacteria | 8960 |
| 847 | Ga0496107_0120342 | 3300048910 | Bacteria | 1934 |
| 848 | Ga0496107_0132761 | 3300048910 | Bacteria | 1839 |
| 849 | Ga0496107_0675035 | 3300048910 | Bacteria | 761 |
| 850 | Ga0496108_0031895 | 3300048911 | Bacteria | 4373 |
| 851 | Ga0496108_0089414 | 3300048911 | Bacteria | 2617 |
| 852 | Ga0496108_0214243 | 3300048911 | Bacteria | 1672 |
| 853 | Ga0496109_0023088 | 3300048912 | Bacteria | 5517 |
| 854 | Ga0496109_0036533 | 3300048912 | Bacteria | 4434 |
| 855 | Ga0496109_0195282 | 3300048912 | Bacteria | 1902 |
| 856 | Ga0496109_0379959 | 3300048912 | Bacteria | 1334 |
| 857 | Ga0496109_0419175 | 3300048912 | Bacteria | 1265 |
| 858 | Ga0496109_0606904 | 3300048912 | Bacteria | 1030 |
| 859 | Ga0496110_0008123 | 3300048913 | Bacteria | 8431 |
| 860 | Ga0496110_0074820 | 3300048913 | Bacteria | 3009 |
| 861 | Ga0496110_0170360 | 3300048913 | Bacteria | 1975 |
| 862 | Ga0496110_0202350 | 3300048913 | Bacteria | 1804 |
| 863 | Ga0496110_0214298 | 3300048913 | Bacteria | 1751 |
| 864 | Ga0496111_0002477 | 3300048914 | Bacteria | 11134 |
| 865 | Ga0496111_0011633 | 3300048914 | Bacteria | 5936 |
| 866 | Ga0496111_0020455 | 3300048914 | Bacteria | 4608 |
| 867 | Ga0496111_0038303 | 3300048914 | Bacteria | 3435 |
| 868 | Ga0496112_0087728 | 3300048915 | Bacteria | 3078 |
| 869 | Ga0496112_0313210 | 3300048915 | Bacteria | 1514 |
| 870 | Ga0496112_0351193 | 3300048915 | Bacteria | 1417 |
| 871 | Ga0496112_0556830 | 3300048915 | Bacteria | 1080 |
| 872 | Ga0496113_0001059 | 3300048916 | Bacteria | 14849 |
| 873 | Ga0496113_0012777 | 3300048916 | Bacteria | 5657 |
| 874 | Ga0496113_0037803 | 3300048916 | Bacteria | 3545 |
| 875 | Ga0496114_0000131 | 3300048917 | Bacteria | 54315 |
| 876 | Ga0496114_0060135 | 3300048917 | Bacteria | 3175 |
| 877 | Ga0496114_0113894 | 3300048917 | Bacteria | 2319 |
| 878 | Ga0496115_0018686 | 3300048918 | Bacteria | 5328 |
| 879 | Ga0496124_0279507 | 3300048927 | Bacteria | 1218 |
| 880 | Ga0501290_000784 | 3300049513 | Bacteria | 4724 |
| 881 | Ga0501292_000330 | 3300049515 | Bacteria | 6574 |
| 882 | Ga0501293_004781 | 3300049516 | Bacteria | 1074 |
| 883 | Ga0501294_002728 | 3300049517 | Bacteria | 1671 |
| 884 | Ga0501300_006564 | 3300049523 | Bacteria | 1709 |
| 885 | Ga0501300_007540 | 3300049523 | Bacteria | 1595 |
| 886 | Ga0501067_0221548 | 3300049583 | Bacteria | 1054 |
| 887 | Ga0501068_0169210 | 3300049584 | Bacteria | 1379 |
| 888 | Ga0501222_000610 | 3300049662 | Bacteria | 5244 |
| 889 | Ga0501223_001165 | 3300049663 | Bacteria | 6192 |
| 890 | Ga0501224_003213 | 3300049664 | Bacteria | 2272 |
| 891 | Ga0501233_011501 | 3300049668 | Bacteria | 1761 |
| 892 | Ga0501233_024584 | 3300049668 | Bacteria | 1318 |
| 893 | Ga0501257_000041 | 3300049686 | Bacteria | 36608 |
| 894 | Ga0501261_000343 | 3300049690 | Bacteria | 6289 |
| 895 | Ga0501221_039334 | 3300049704 | Bacteria | 1025 |
| 896 | Ga0501225_0005416 | 3300049705 | Bacteria | 3748 |
| 897 | Ga0501245_004320 | 3300049708 | Bacteria | 1947 |
| 898 | Ga0501276_008220 | 3300049773 | Bacteria | 846 |
| 899 | Ga0501279_000008 | 3300049775 | Bacteria | 125267 |
| 900 | Ga0501280_000013 | 3300049776 | Bacteria | 59205 |
| 901 | Ga0501280_000355 | 3300049776 | Bacteria | 11410 |
| 902 | Ga0501281_01010 | 3300049777 | Bacteria | 2338 |
| 903 | nmdc:mga0k408_130937_c1 | 3300050493 | Bacteria | 1489 |
| 904 | nmdc:mga05p37_762090_c1 | 3300050507 | Bacteria | 1065 |
| 905 | nmdc:mga08y16_210415_c1 | 3300050511 | Bacteria | 2014 |
| 906 | nmdc:mga0n895_571058_c1 | 3300050512 | Bacteria | 1135 |
| 907 | Ga0500641_0023428 | 3300053096 | Bacteria | 2374 |
| 908 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 909 | Ga0500595_000183 | 3300053119 | Bacteria | 42685 |
| 910 | Ga0500658_0000073 | 3300053134 | Bacteria | 46171 |
| 911 | Ga0500658_0001099 | 3300053134 | Bacteria | 11057 |
| 912 | Ga0500573_0000089 | 3300053140 | Bacteria | 41855 |
| 913 | Ga0500616_0030758 | 3300053153 | Bacteria | 2945 |
| 914 | Ga0500627_0000090 | 3300053158 | Bacteria | 30885 |
| 915 | Ga0500627_0004208 | 3300053158 | Bacteria | 4583 |
| 916 | Ga0500645_001583 | 3300053730 | Bacteria | 11316 |
| 917 | Ga0466962_0012879 | 3300061719 | Bacteria | 4023 |
| 918 | Ga0466962_0016754 | 3300061719 | Bacteria | 3533 |
| 919 | Ga0466962_0057299 | 3300061719 | Bacteria | 1860 |
| 920 | Ga0466962_0114188 | 3300061719 | Bacteria | 1301 |
| 921 | Ga0466962_0229622 | 3300061719 | Bacteria | 910 |
| 922 | Ga0466962_0284212 | 3300061719 | Bacteria | 817 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049513 | Ga0501290_000784 | Ga0501290_000784_2356_3027 | 200 |
| 2 | 3300049515 | Ga0501292_000330 | Ga0501292_000330_4394_5065 | 200 |
| 3 | 3300049516 | Ga0501293_004781 | Ga0501293_004781_95_766 | 200 |
| 4 | 3300049517 | Ga0501294_002728 | Ga0501294_002728_944_1615 | 200 |
| 5 | 3300049523 | Ga0501300_006564 | Ga0501300_006564_177_848 | 200 |
| 6 | 3300049662 | Ga0501222_000610 | Ga0501222_000610_4422_5093 | 200 |
| 7 | 3300049663 | Ga0501223_001165 | Ga0501223_001165_2773_3444 | 200 |
| 8 | 3300049664 | Ga0501224_003213 | Ga0501224_003213_1230_1901 | 200 |
| 9 | 3300049668 | Ga0501233_011501 | Ga0501233_011501_944_1615 | 200 |
| 10 | 3300049690 | Ga0501261_000343 | Ga0501261_000343_1485_2156 | 200 |
| 11 | 3300049704 | Ga0501221_039334 | Ga0501221_039334_321_992 | 200 |
| 12 | 3300049705 | Ga0501225_0005416 | Ga0501225_0005416_1883_2554 | 200 |
| 13 | 3300049708 | Ga0501245_004320 | Ga0501245_004320_1136_1807 | 200 |
| 14 | 3300049773 | Ga0501276_008220 | Ga0501276_008220_136_807 | 200 |
| 15 | 3300049775 | Ga0501279_000008 | Ga0501279_000008_36666_37337 | 200 |
| 16 | 3300049776 | Ga0501280_000013 | Ga0501280_000013_44244_44915 | 200 |
| 17 | 3300049777 | Ga0501281_01010 | Ga0501281_01010_1300_1971 | 200 |
| 18 | 3300049668 | Ga0501233_024584 | Ga0501233_024584_520_1182 | 202 |
| 19 | 3300005364 | Ga0070673_100130300 | Ga0070673_1001303003 | 204 |
| 20 | 3300005436 | Ga0070713_100767591 | Ga0070713_1007675911 | 204 |
| 21 | 3300005564 | Ga0070664_100043787 | Ga0070664_1000437872 | 204 |
| 22 | 3300025921 | Ga0207652_10108402 | Ga0207652_101084023 | 204 |
| 23 | 3300038443 | Ga0395901_0020998 | Ga0395901_0020998_6059_6676 | 205 |
| 24 | 3300005337 | Ga0070682_100153188 | Ga0070682_1001531881 | 207 |
| 25 | 3300005367 | Ga0070667_100076481 | Ga0070667_1000764813 | 207 |
| 26 | 3300005547 | Ga0070693_100256733 | Ga0070693_1002567331 | 207 |
| 27 | 3300005617 | Ga0068859_100067596 | Ga0068859_1000675962 | 207 |
| 28 | 3300005841 | Ga0068863_100114464 | Ga0068863_1001144643 | 207 |
| 29 | 3300005843 | Ga0068860_100248780 | Ga0068860_1002487801 | 207 |
| 30 | 3300006931 | Ga0097620_100067588 | Ga0097620_1000675882 | 207 |
| 31 | 3300025941 | Ga0207711_10164784 | Ga0207711_101647842 | 207 |
| 32 | 3300025986 | Ga0207658_10016283 | Ga0207658_100162833 | 207 |
| 33 | 3300025986 | Ga0207658_10069963 | Ga0207658_100699634 | 207 |
| 34 | 3300026088 | Ga0207641_10053480 | Ga0207641_100534802 | 207 |
| 35 | 3300026116 | Ga0207674_11010753 | Ga0207674_110107531 | 207 |
| 36 | 3300035170 | Ga0373943_0013861 | Ga0373943_0013861_471_1094 | 207 |
| 37 | 3300035692 | Ga0373935_0198422 | Ga0373935_0198422_161_784 | 207 |
| 38 | 3300037068 | Ga0373925_0016074 | Ga0373925_0016074_472_1095 | 207 |
| 39 | 3300037312 | Ga0395899_0430060 | Ga0395899_0430060_18_641 | 207 |
| 40 | 3300037418 | Ga0395900_1004937 | Ga0395900_1004937_110_733 | 207 |
| 41 | 3300045976 | Ga0466967_1195944 | Ga0466967_1195944_106_729 | 207 |
| 42 | 3300050512 | nmdc:mga0n895_571058_c1 | nmdc:mga0n895_571058_c1_16_639 | 207 |
| 43 | 3300049523 | Ga0501300_007540 | Ga0501300_007540_535_1200 | 212 |
| 44 | 3300049686 | Ga0501257_000041 | Ga0501257_000041_4690_5355 | 212 |
| 45 | 3300049776 | Ga0501280_000355 | Ga0501280_000355_7878_8543 | 212 |
| 46 | 3300005327 | Ga0070658_10014727 | Ga0070658_100147273 | 219 |
| 47 | 3300005327 | Ga0070658_10147433 | Ga0070658_101474331 | 219 |
| 48 | 3300005327 | Ga0070658_10470998 | Ga0070658_104709982 | 219 |
| 49 | 3300005336 | Ga0070680_100103910 | Ga0070680_1001039102 | 219 |
| 50 | 3300005339 | Ga0070660_100076920 | Ga0070660_1000769204 | 219 |
| 51 | 3300005344 | Ga0070661_100331231 | Ga0070661_1003312313 | 219 |
| 52 | 3300005354 | Ga0070675_100019647 | Ga0070675_1000196474 | 219 |
| 53 | 3300005355 | Ga0070671_100031974 | Ga0070671_1000319747 | 219 |
| 54 | 3300005355 | Ga0070671_100038168 | Ga0070671_1000381682 | 219 |
| 55 | 3300005563 | Ga0068855_100141328 | Ga0068855_1001413284 | 219 |
| 56 | 3300005618 | Ga0068864_100038121 | Ga0068864_1000381213 | 219 |
| 57 | 3300013100 | Ga0157373_10093388 | Ga0157373_100933884 | 219 |
| 58 | 3300013104 | Ga0157370_10002976 | Ga0157370_100029762 | 219 |
| 59 | 3300013296 | Ga0157374_10013322 | Ga0157374_100133227 | 219 |
| 60 | 3300025909 | Ga0207705_10046716 | Ga0207705_100467162 | 219 |
| 61 | 3300025909 | Ga0207705_10051015 | Ga0207705_100510151 | 219 |
| 62 | 3300025919 | Ga0207657_10032219 | Ga0207657_100322194 | 219 |
| 63 | 3300025928 | Ga0207700_10538297 | Ga0207700_105382972 | 219 |
| 64 | 3300025931 | Ga0207644_10009596 | Ga0207644_100095963 | 219 |
| 65 | 3300025931 | Ga0207644_10024091 | Ga0207644_100240914 | 219 |
| 66 | 3300025941 | Ga0207711_10223834 | Ga0207711_102238343 | 219 |
| 67 | 3300025945 | Ga0207679_10215811 | Ga0207679_102158112 | 219 |
| 68 | 3300025945 | Ga0207679_10588747 | Ga0207679_105887472 | 219 |
| 69 | 3300025960 | Ga0207651_10140550 | Ga0207651_101405502 | 219 |
| 70 | 3300026078 | Ga0207702_10091175 | Ga0207702_100911752 | 219 |
| 71 | 3300026095 | Ga0207676_10064299 | Ga0207676_100642993 | 219 |
| 72 | 3300026142 | Ga0207698_10121337 | Ga0207698_101213374 | 219 |
| 73 | 3300026142 | Ga0207698_10504956 | Ga0207698_105049562 | 219 |
| 74 | 3300030742 | Ga0316183_1203903 | Ga0316183_12039032 | 219 |
| 75 | 3300031852 | Ga0307410_10007481 | Ga0307410_100074816 | 219 |
| 76 | 3300031911 | Ga0307412_10498930 | Ga0307412_104989302 | 219 |
| 77 | 3300031995 | Ga0307409_100009048 | Ga0307409_1000090483 | 219 |
| 78 | 3300032002 | Ga0307416_100890947 | Ga0307416_1008909472 | 219 |
| 79 | 3300032005 | Ga0307411_10035433 | Ga0307411_100354332 | 219 |
| 80 | 3300037312 | Ga0395899_0025056 | Ga0395899_0025056_776_1435 | 219 |
| 81 | 3300037312 | Ga0395899_0113132 | Ga0395899_0113132_1001_1660 | 219 |
| 82 | 3300037312 | Ga0395899_0198001 | Ga0395899_0198001_541_1200 | 219 |
| 83 | 3300037418 | Ga0395900_0021255 | Ga0395900_0021255_4095_4754 | 219 |
| 84 | 3300037418 | Ga0395900_0046969 | Ga0395900_0046969_3241_3900 | 219 |
| 85 | 3300037418 | Ga0395900_0049580 | Ga0395900_0049580_1730_2389 | 219 |
| 86 | 3300037418 | Ga0395900_0480744 | Ga0395900_0480744_398_1057 | 219 |
| 87 | 3300037466 | Ga0395898_0083097 | Ga0395898_0083097_139_798 | 219 |
| 88 | 3300037471 | Ga0395905_0069814 | Ga0395905_0069814_1470_2129 | 219 |
| 89 | 3300037471 | Ga0395905_0082571 | Ga0395905_0082571_1114_1773 | 219 |
| 90 | 3300037471 | Ga0395905_0105416 | Ga0395905_0105416_237_896 | 219 |
| 91 | 3300038443 | Ga0395901_0192161 | Ga0395901_0192161_693_1352 | 219 |
| 92 | 3300044656 | Ga0466969_0121746 | Ga0466969_0121746_70_729 | 219 |
| 93 | 3300044693 | Ga0466961_0107878 | Ga0466961_0107878_336_995 | 219 |
| 94 | 3300044693 | Ga0466961_0186633 | Ga0466961_0186633_146_805 | 219 |
| 95 | 3300044694 | Ga0466963_0034898 | Ga0466963_0034898_2058_2717 | 219 |
| 96 | 3300044694 | Ga0466963_0035336 | Ga0466963_0035336_313_972 | 219 |
| 97 | 3300044694 | Ga0466963_0243668 | Ga0466963_0243668_91_750 | 219 |
| 98 | 3300044694 | Ga0466963_0251544 | Ga0466963_0251544_181_840 | 219 |
| 99 | 3300044706 | Ga0466964_0139791 | Ga0466964_0139791_146_805 | 219 |
| 100 | 3300044765 | Ga0466970_0105509 | Ga0466970_0105509_492_1151 | 219 |
| 101 | 3300044842 | Ga0466957_0084239 | Ga0466957_0084239_132_791 | 219 |
| 102 | 3300044842 | Ga0466957_0130723 | Ga0466957_0130723_771_1430 | 219 |
| 103 | 3300044842 | Ga0466957_0455965 | Ga0466957_0455965_33_692 | 219 |
| 104 | 3300045049 | Ga0466959_0071944 | Ga0466959_0071944_116_775 | 219 |
| 105 | 3300045049 | Ga0466959_0122746 | Ga0466959_0122746_957_1616 | 219 |
| 106 | 3300045976 | Ga0466967_0139934 | Ga0466967_0139934_376_1035 | 219 |
| 107 | 3300045976 | Ga0466967_0180879 | Ga0466967_0180879_442_1101 | 219 |
| 108 | 3300045976 | Ga0466967_0312726 | Ga0466967_0312726_126_785 | 219 |
| 109 | 3300045976 | Ga0466967_0351704 | Ga0466967_0351704_587_1246 | 219 |
| 110 | 3300046525 | Ga0495663_0048754 | Ga0495663_0048754_361_1020 | 219 |
| 111 | 3300048910 | Ga0496107_0120342 | Ga0496107_0120342_1172_1831 | 219 |
| 112 | 3300048912 | Ga0496109_0379959 | Ga0496109_0379959_584_1243 | 219 |
| 113 | 3300048912 | Ga0496109_0606904 | Ga0496109_0606904_68_727 | 219 |
| 114 | 3300048913 | Ga0496110_0170360 | Ga0496110_0170360_306_965 | 219 |
| 115 | 3300048914 | Ga0496111_0038303 | Ga0496111_0038303_770_1429 | 219 |
| 116 | 3300048915 | Ga0496112_0087728 | Ga0496112_0087728_1852_2511 | 219 |
| 117 | 3300048915 | Ga0496112_0351193 | Ga0496112_0351193_269_928 | 219 |
| 118 | 3300048916 | Ga0496113_0037803 | Ga0496113_0037803_2715_3374 | 219 |
| 119 | 3300048917 | Ga0496114_0060135 | Ga0496114_0060135_949_1608 | 219 |
| 120 | 3300048918 | Ga0496115_0018686 | Ga0496115_0018686_3616_4275 | 219 |
| 121 | 3300049583 | Ga0501067_0221548 | Ga0501067_0221548_82_741 | 219 |
| 122 | 3300049584 | Ga0501068_0169210 | Ga0501068_0169210_671_1330 | 219 |
| 123 | 3300061719 | Ga0466962_0057299 | Ga0466962_0057299_1049_1708 | 219 |
| 124 | 3300061719 | Ga0466962_0114188 | Ga0466962_0114188_126_785 | 219 |
| 125 | 3300001990 | JGI24737J22298_10001469 | JGI24737J22298_100014694 | 220 |
| 126 | 3300005331 | Ga0070670_100058431 | Ga0070670_1000584313 | 220 |
| 127 | 3300005354 | Ga0070675_100135310 | Ga0070675_1001353102 | 220 |
| 128 | 3300005364 | Ga0070673_100027808 | Ga0070673_1000278083 | 220 |
| 129 | 3300005367 | Ga0070667_100384195 | Ga0070667_1003841952 | 220 |
| 130 | 3300005577 | Ga0068857_100004732 | Ga0068857_1000047325 | 220 |
| 131 | 3300005618 | Ga0068864_100192759 | Ga0068864_1001927593 | 220 |
| 132 | 3300005841 | Ga0068863_100012542 | Ga0068863_1000125424 | 220 |
| 133 | 3300011119 | Ga0105246_10031026 | Ga0105246_100310263 | 220 |
| 134 | 3300013307 | Ga0157372_10473093 | Ga0157372_104730932 | 220 |
| 135 | 3300014325 | Ga0163163_10196699 | Ga0163163_101966993 | 220 |
| 136 | 3300025904 | Ga0207647_10081869 | Ga0207647_100818693 | 220 |
| 137 | 3300025925 | Ga0207650_10067232 | Ga0207650_100672323 | 220 |
| 138 | 3300026116 | Ga0207674_10000291 | Ga0207674_100002918 | 220 |
| 139 | 3300027876 | Ga0209974_10011638 | Ga0209974_100116383 | 220 |
| 140 | 3300037312 | Ga0395899_0155462 | Ga0395899_0155462_143_805 | 220 |
| 141 | 3300037312 | Ga0395899_0158878 | Ga0395899_0158878_529_1191 | 220 |
| 142 | 3300037418 | Ga0395900_0077266 | Ga0395900_0077266_1134_1796 | 220 |
| 143 | 3300037418 | Ga0395900_0396418 | Ga0395900_0396418_548_1210 | 220 |
| 144 | 3300037466 | Ga0395898_0006374 | Ga0395898_0006374_5583_6245 | 220 |
| 145 | 3300037466 | Ga0395898_0088294 | Ga0395898_0088294_1805_2467 | 220 |
| 146 | 3300037471 | Ga0395905_0009030 | Ga0395905_0009030_1840_2502 | 220 |
| 147 | 3300037471 | Ga0395905_0035114 | Ga0395905_0035114_2001_2663 | 220 |
| 148 | 3300037471 | Ga0395905_0230407 | Ga0395905_0230407_503_1165 | 220 |
| 149 | 3300038443 | Ga0395901_0006312 | Ga0395901_0006312_6431_7093 | 220 |
| 150 | 3300038443 | Ga0395901_0085473 | Ga0395901_0085473_2481_3143 | 220 |
| 151 | 3300038443 | Ga0395901_0240012 | Ga0395901_0240012_548_1210 | 220 |
| 152 | 3300042530 | Ga0450916_008215 | Ga0450916_008215_336_998 | 220 |
| 153 | 3300044658 | Ga0466972_0102093 | Ga0466972_0102093_223_885 | 220 |
| 154 | 3300044684 | Ga0466966_0085056 | Ga0466966_0085056_890_1552 | 220 |
| 155 | 3300044719 | Ga0466971_0103199 | Ga0466971_0103199_603_1265 | 220 |
| 156 | 3300044842 | Ga0466957_0448181 | Ga0466957_0448181_25_687 | 220 |
| 157 | 3300045049 | Ga0466959_0018998 | Ga0466959_0018998_2242_2904 | 220 |
| 158 | 3300046616 | Ga0495668_0035340 | Ga0495668_0035340_1400_2062 | 220 |
| 159 | 3300048912 | Ga0496109_0195282 | Ga0496109_0195282_65_727 | 220 |
| 160 | 3300048913 | Ga0496110_0074820 | Ga0496110_0074820_244_906 | 220 |
| 161 | 3300048914 | Ga0496111_0020455 | Ga0496111_0020455_1339_2001 | 220 |
| 162 | 3300050493 | nmdc:mga0k408_130937_c1 | nmdc:mga0k408_130937_c1_550_1215 | 220 |
| 163 | 3300005288 | Ga0065714_10073504 | Ga0065714_100735044 | 221 |
| 164 | 3300005327 | Ga0070658_10097037 | Ga0070658_100970373 | 221 |
| 165 | 3300005329 | Ga0070683_100115603 | Ga0070683_1001156033 | 221 |
| 166 | 3300005339 | Ga0070660_100032537 | Ga0070660_1000325373 | 221 |
| 167 | 3300005345 | Ga0070692_10018291 | Ga0070692_100182913 | 221 |
| 168 | 3300005345 | Ga0070692_10038330 | Ga0070692_100383303 | 221 |
| 169 | 3300005355 | Ga0070671_100000006 | Ga0070671_100000006184 | 221 |
| 170 | 3300005355 | Ga0070671_100022193 | Ga0070671_1000221935 | 221 |
| 171 | 3300005366 | Ga0070659_100006754 | Ga0070659_1000067543 | 221 |
| 172 | 3300005455 | Ga0070663_100005583 | Ga0070663_1000055834 | 221 |
| 173 | 3300005457 | Ga0070662_100026151 | Ga0070662_1000261511 | 221 |
| 174 | 3300005458 | Ga0070681_10603511 | Ga0070681_106035112 | 221 |
| 175 | 3300005530 | Ga0070679_101085525 | Ga0070679_1010855251 | 221 |
| 176 | 3300005539 | Ga0068853_100155009 | Ga0068853_1001550093 | 221 |
| 177 | 3300005617 | Ga0068859_100203807 | Ga0068859_1002038072 | 221 |
| 178 | 3300005618 | Ga0068864_100007707 | Ga0068864_1000077079 | 221 |
| 179 | 3300005841 | Ga0068863_100003320 | Ga0068863_1000033202 | 221 |
| 180 | 3300005841 | Ga0068863_100015268 | Ga0068863_1000152683 | 221 |
| 181 | 3300005843 | Ga0068860_100006788 | Ga0068860_10000678810 | 221 |
| 182 | 3300005844 | Ga0068862_100000163 | Ga0068862_10000016373 | 221 |
| 183 | 3300006931 | Ga0097620_100203811 | Ga0097620_1002038112 | 221 |
| 184 | 3300009101 | Ga0105247_10002736 | Ga0105247_100027366 | 221 |
| 185 | 3300009177 | Ga0105248_10046063 | Ga0105248_100460635 | 221 |
| 186 | 3300009177 | Ga0105248_10436949 | Ga0105248_104369492 | 221 |
| 187 | 3300009553 | Ga0105249_10000103 | Ga0105249_1000010320 | 221 |
| 188 | 3300013104 | Ga0157370_10162569 | Ga0157370_101625692 | 221 |
| 189 | 3300013105 | Ga0157369_10016077 | Ga0157369_100160776 | 221 |
| 190 | 3300013105 | Ga0157369_10280956 | Ga0157369_102809563 | 221 |
| 191 | 3300013308 | Ga0157375_10518817 | Ga0157375_105188172 | 221 |
| 192 | 3300014968 | Ga0157379_10106721 | Ga0157379_101067212 | 221 |
| 193 | 3300025900 | Ga0207710_10007562 | Ga0207710_100075623 | 221 |
| 194 | 3300025904 | Ga0207647_10007616 | Ga0207647_100076166 | 221 |
| 195 | 3300025909 | Ga0207705_10008821 | Ga0207705_100088213 | 221 |
| 196 | 3300025919 | Ga0207657_10000504 | Ga0207657_1000050412 | 221 |
| 197 | 3300025921 | Ga0207652_10035912 | Ga0207652_100359123 | 221 |
| 198 | 3300025932 | Ga0207690_10001173 | Ga0207690_1000117310 | 221 |
| 199 | 3300025933 | Ga0207706_10040471 | Ga0207706_100404715 | 221 |
| 200 | 3300025941 | Ga0207711_10565870 | Ga0207711_105658702 | 221 |
| 201 | 3300025944 | Ga0207661_10090118 | Ga0207661_100901183 | 221 |
| 202 | 3300025961 | Ga0207712_10000069 | Ga0207712_1000006922 | 221 |
| 203 | 3300026067 | Ga0207678_10009190 | Ga0207678_100091909 | 221 |
| 204 | 3300026088 | Ga0207641_10010488 | Ga0207641_100104888 | 221 |
| 205 | 3300028380 | Ga0268265_10000182 | Ga0268265_1000018274 | 221 |
| 206 | 3300028381 | Ga0268264_10004758 | Ga0268264_1000475811 | 221 |
| 207 | 3300031456 | Ga0307513_10035516 | Ga0307513_100355167 | 221 |
| 208 | 3300031824 | Ga0307413_10016128 | Ga0307413_100161281 | 221 |
| 209 | 3300031824 | Ga0307413_10068484 | Ga0307413_100684842 | 221 |
| 210 | 3300031852 | Ga0307410_10071481 | Ga0307410_100714813 | 221 |
| 211 | 3300031901 | Ga0307406_10138467 | Ga0307406_101384673 | 221 |
| 212 | 3300031903 | Ga0307407_10345909 | Ga0307407_103459092 | 221 |
| 213 | 3300031911 | Ga0307412_10151425 | Ga0307412_101514252 | 221 |
| 214 | 3300031995 | Ga0307409_100117414 | Ga0307409_1001174141 | 221 |
| 215 | 3300032004 | Ga0307414_10029208 | Ga0307414_100292082 | 221 |
| 216 | 3300032005 | Ga0307411_10006836 | Ga0307411_100068368 | 221 |
| 217 | 3300032126 | Ga0307415_100226055 | Ga0307415_1002260552 | 221 |
| 218 | 3300037312 | Ga0395899_0000287 | Ga0395899_0000287_45953_46618 | 221 |
| 219 | 3300037312 | Ga0395899_0158687 | Ga0395899_0158687_492_1157 | 221 |
| 220 | 3300037418 | Ga0395900_0000031 | Ga0395900_0000031_210238_210903 | 221 |
| 221 | 3300037418 | Ga0395900_0061775 | Ga0395900_0061775_1870_2535 | 221 |
| 222 | 3300037418 | Ga0395900_0106134 | Ga0395900_0106134_1205_1870 | 221 |
| 223 | 3300037418 | Ga0395900_0137970 | Ga0395900_0137970_865_1530 | 221 |
| 224 | 3300037418 | Ga0395900_0582656 | Ga0395900_0582656_311_976 | 221 |
| 225 | 3300037466 | Ga0395898_0012131 | Ga0395898_0012131_3094_3759 | 221 |
| 226 | 3300037466 | Ga0395898_0023568 | Ga0395898_0023568_3471_4136 | 221 |
| 227 | 3300037466 | Ga0395898_0378895 | Ga0395898_0378895_396_1061 | 221 |
| 228 | 3300037471 | Ga0395905_0018675 | Ga0395905_0018675_1129_1794 | 221 |
| 229 | 3300037471 | Ga0395905_0047522 | Ga0395905_0047522_2367_3032 | 221 |
| 230 | 3300037471 | Ga0395905_0049013 | Ga0395905_0049013_1659_2324 | 221 |
| 231 | 3300038443 | Ga0395901_0000035 | Ga0395901_0000035_75009_75674 | 221 |
| 232 | 3300038443 | Ga0395901_0012265 | Ga0395901_0012265_7183_7848 | 221 |
| 233 | 3300038443 | Ga0395901_0081482 | Ga0395901_0081482_1029_1694 | 221 |
| 234 | 3300042157 | Ga0439458_0000547 | Ga0439458_0000547_1334_1999 | 221 |
| 235 | 3300042157 | Ga0439458_0029266 | Ga0439458_0029266_622_1287 | 221 |
| 236 | 3300046513 | Ga0495616_0000013 | Ga0495616_0000013_79276_79941 | 221 |
| 237 | 3300046528 | Ga0495642_0134846 | Ga0495642_0134846_330_995 | 221 |
| 238 | 3300046530 | Ga0495654_0087984 | Ga0495654_0087984_284_955 | 221 |
| 239 | 3300046539 | Ga0495621_0000149 | Ga0495621_0000149_5709_6374 | 221 |
| 240 | 3300046616 | Ga0495668_0014546 | Ga0495668_0014546_2855_3520 | 221 |
| 241 | 3300046684 | Ga0495669_0031735 | Ga0495669_0031735_1117_1782 | 221 |
| 242 | 3300046691 | Ga0495670_0004834 | Ga0495670_0004834_3759_4424 | 221 |
| 243 | 3300046691 | Ga0495670_0005175 | Ga0495670_0005175_500_1165 | 221 |
| 244 | 3300046694 | Ga0495649_0178906 | Ga0495649_0178906_165_836 | 221 |
| 245 | 3300047445 | Ga0495677_0096117 | Ga0495677_0096117_392_1057 | 221 |
| 246 | 3300048927 | Ga0496124_0279507 | Ga0496124_0279507_66_731 | 221 |
| 247 | 3300053096 | Ga0500641_0023428 | Ga0500641_0023428_243_983 | 221 |
| 248 | 3300053116 | Ga0500592_000031 | Ga0500592_000031_26595_27266 | 221 |
| 249 | 3300053119 | Ga0500595_000183 | Ga0500595_000183_18742_19410 | 221 |
| 250 | 3300053140 | Ga0500573_0000089 | Ga0500573_0000089_8846_9511 | 221 |
| 251 | 3300053153 | Ga0500616_0030758 | Ga0500616_0030758_1792_2532 | 221 |
| 252 | 3300053158 | Ga0500627_0000090 | Ga0500627_0000090_14963_15634 | 221 |
| 253 | 3300053158 | Ga0500627_0004208 | Ga0500627_0004208_81_746 | 221 |
| 254 | 3300001979 | JGI24740J21852_10004073 | JGI24740J21852_100040733 | 222 |
| 255 | 3300001990 | JGI24737J22298_10020537 | JGI24737J22298_100205373 | 222 |
| 256 | 3300001990 | JGI24737J22298_10026049 | JGI24737J22298_100260492 | 222 |
| 257 | 3300001990 | JGI24737J22298_10036136 | JGI24737J22298_100361362 | 222 |
| 258 | 3300001991 | JGI24743J22301_10013153 | JGI24743J22301_100131532 | 222 |
| 259 | 3300002067 | JGI24735J21928_10016177 | JGI24735J21928_100161773 | 222 |
| 260 | 3300002067 | JGI24735J21928_10034464 | JGI24735J21928_100344642 | 222 |
| 261 | 3300002075 | JGI24738J21930_10015913 | JGI24738J21930_100159132 | 222 |
| 262 | 3300002077 | JGI24744J21845_10011572 | JGI24744J21845_100115722 | 222 |
| 263 | 3300005327 | Ga0070658_10002261 | Ga0070658_100022618 | 222 |
| 264 | 3300005327 | Ga0070658_10003845 | Ga0070658_1000384511 | 222 |
| 265 | 3300005327 | Ga0070658_10016537 | Ga0070658_100165374 | 222 |
| 266 | 3300005327 | Ga0070658_10081615 | Ga0070658_100816152 | 222 |
| 267 | 3300005327 | Ga0070658_10095345 | Ga0070658_100953452 | 222 |
| 268 | 3300005327 | Ga0070658_10203543 | Ga0070658_102035431 | 222 |
| 269 | 3300005327 | Ga0070658_10814226 | Ga0070658_108142261 | 222 |
| 270 | 3300005328 | Ga0070676_10090890 | Ga0070676_100908903 | 222 |
| 271 | 3300005329 | Ga0070683_100010399 | Ga0070683_1000103997 | 222 |
| 272 | 3300005329 | Ga0070683_100019869 | Ga0070683_1000198693 | 222 |
| 273 | 3300005329 | Ga0070683_100104557 | Ga0070683_1001045573 | 222 |
| 274 | 3300005330 | Ga0070690_100025929 | Ga0070690_1000259293 | 222 |
| 275 | 3300005330 | Ga0070690_100195783 | Ga0070690_1001957831 | 222 |
| 276 | 3300005331 | Ga0070670_100027175 | Ga0070670_1000271757 | 222 |
| 277 | 3300005331 | Ga0070670_100040285 | Ga0070670_1000402853 | 222 |
| 278 | 3300005331 | Ga0070670_100058924 | Ga0070670_1000589243 | 222 |
| 279 | 3300005331 | Ga0070670_100326572 | Ga0070670_1003265722 | 222 |
| 280 | 3300005335 | Ga0070666_10015314 | Ga0070666_100153147 | 222 |
| 281 | 3300005335 | Ga0070666_10125854 | Ga0070666_101258543 | 222 |
| 282 | 3300005335 | Ga0070666_10511985 | Ga0070666_105119852 | 222 |
| 283 | 3300005336 | Ga0070680_100002910 | Ga0070680_1000029102 | 222 |
| 284 | 3300005336 | Ga0070680_100015126 | Ga0070680_1000151263 | 222 |
| 285 | 3300005336 | Ga0070680_100069192 | Ga0070680_1000691923 | 222 |
| 286 | 3300005336 | Ga0070680_100133818 | Ga0070680_1001338183 | 222 |
| 287 | 3300005336 | Ga0070680_100207077 | Ga0070680_1002070772 | 222 |
| 288 | 3300005337 | Ga0070682_100208836 | Ga0070682_1002088361 | 222 |
| 289 | 3300005338 | Ga0068868_100082317 | Ga0068868_1000823173 | 222 |
| 290 | 3300005338 | Ga0068868_100303496 | Ga0068868_1003034963 | 222 |
| 291 | 3300005338 | Ga0068868_100351768 | Ga0068868_1003517682 | 222 |
| 292 | 3300005339 | Ga0070660_100017532 | Ga0070660_1000175327 | 222 |
| 293 | 3300005339 | Ga0070660_100024417 | Ga0070660_1000244175 | 222 |
| 294 | 3300005339 | Ga0070660_100038880 | Ga0070660_1000388803 | 222 |
| 295 | 3300005339 | Ga0070660_100158155 | Ga0070660_1001581553 | 222 |
| 296 | 3300005339 | Ga0070660_100182478 | Ga0070660_1001824782 | 222 |
| 297 | 3300005339 | Ga0070660_100186825 | Ga0070660_1001868252 | 222 |
| 298 | 3300005340 | Ga0070689_100153877 | Ga0070689_1001538773 | 222 |
| 299 | 3300005344 | Ga0070661_100021214 | Ga0070661_1000212143 | 222 |
| 300 | 3300005344 | Ga0070661_100032016 | Ga0070661_1000320163 | 222 |
| 301 | 3300005344 | Ga0070661_100051854 | Ga0070661_1000518543 | 222 |
| 302 | 3300005344 | Ga0070661_100053080 | Ga0070661_1000530803 | 222 |
| 303 | 3300005344 | Ga0070661_100188898 | Ga0070661_1001888982 | 222 |
| 304 | 3300005344 | Ga0070661_100232114 | Ga0070661_1002321142 | 222 |
| 305 | 3300005345 | Ga0070692_10020977 | Ga0070692_100209773 | 222 |
| 306 | 3300005345 | Ga0070692_10030185 | Ga0070692_100301853 | 222 |
| 307 | 3300005345 | Ga0070692_10054007 | Ga0070692_100540072 | 222 |
| 308 | 3300005345 | Ga0070692_10264814 | Ga0070692_102648142 | 222 |
| 309 | 3300005347 | Ga0070668_100441021 | Ga0070668_1004410212 | 222 |
| 310 | 3300005353 | Ga0070669_100461362 | Ga0070669_1004613621 | 222 |
| 311 | 3300005354 | Ga0070675_100255211 | Ga0070675_1002552112 | 222 |
| 312 | 3300005355 | Ga0070671_100013831 | Ga0070671_1000138319 | 222 |
| 313 | 3300005355 | Ga0070671_100015000 | Ga0070671_1000150002 | 222 |
| 314 | 3300005355 | Ga0070671_100037652 | Ga0070671_1000376523 | 222 |
| 315 | 3300005355 | Ga0070671_100065937 | Ga0070671_1000659372 | 222 |
| 316 | 3300005355 | Ga0070671_100119756 | Ga0070671_1001197562 | 222 |
| 317 | 3300005355 | Ga0070671_100207204 | Ga0070671_1002072043 | 222 |
| 318 | 3300005355 | Ga0070671_100233092 | Ga0070671_1002330922 | 222 |
| 319 | 3300005356 | Ga0070674_100064899 | Ga0070674_1000648993 | 222 |
| 320 | 3300005356 | Ga0070674_100362538 | Ga0070674_1003625382 | 222 |
| 321 | 3300005364 | Ga0070673_100020625 | Ga0070673_1000206253 | 222 |
| 322 | 3300005364 | Ga0070673_100030292 | Ga0070673_1000302923 | 222 |
| 323 | 3300005364 | Ga0070673_100072770 | Ga0070673_1000727702 | 222 |
| 324 | 3300005364 | Ga0070673_100092486 | Ga0070673_1000924863 | 222 |
| 325 | 3300005366 | Ga0070659_100001058 | Ga0070659_1000010586 | 222 |
| 326 | 3300005366 | Ga0070659_100018867 | Ga0070659_1000188675 | 222 |
| 327 | 3300005366 | Ga0070659_100141380 | Ga0070659_1001413803 | 222 |
| 328 | 3300005366 | Ga0070659_100169340 | Ga0070659_1001693403 | 222 |
| 329 | 3300005366 | Ga0070659_100201266 | Ga0070659_1002012662 | 222 |
| 330 | 3300005366 | Ga0070659_100231674 | Ga0070659_1002316742 | 222 |
| 331 | 3300005366 | Ga0070659_100342055 | Ga0070659_1003420552 | 222 |
| 332 | 3300005367 | Ga0070667_100039693 | Ga0070667_1000396933 | 222 |
| 333 | 3300005367 | Ga0070667_100042609 | Ga0070667_1000426093 | 222 |
| 334 | 3300005367 | Ga0070667_100137560 | Ga0070667_1001375602 | 222 |
| 335 | 3300005367 | Ga0070667_100190149 | Ga0070667_1001901491 | 222 |
| 336 | 3300005367 | Ga0070667_100243392 | Ga0070667_1002433922 | 222 |
| 337 | 3300005367 | Ga0070667_100275906 | Ga0070667_1002759062 | 222 |
| 338 | 3300005367 | Ga0070667_100438584 | Ga0070667_1004385842 | 222 |
| 339 | 3300005434 | Ga0070709_10005496 | Ga0070709_100054961 | 222 |
| 340 | 3300005435 | Ga0070714_100023828 | Ga0070714_1000238285 | 222 |
| 341 | 3300005435 | Ga0070714_100055018 | Ga0070714_1000550183 | 222 |
| 342 | 3300005435 | Ga0070714_100203405 | Ga0070714_1002034052 | 222 |
| 343 | 3300005435 | Ga0070714_100475198 | Ga0070714_1004751982 | 222 |
| 344 | 3300005436 | Ga0070713_100079220 | Ga0070713_1000792203 | 222 |
| 345 | 3300005444 | Ga0070694_100024929 | Ga0070694_1000249293 | 222 |
| 346 | 3300005455 | Ga0070663_100065243 | Ga0070663_1000652433 | 222 |
| 347 | 3300005455 | Ga0070663_100069393 | Ga0070663_1000693932 | 222 |
| 348 | 3300005455 | Ga0070663_100081186 | Ga0070663_1000811862 | 222 |
| 349 | 3300005455 | Ga0070663_100087432 | Ga0070663_1000874322 | 222 |
| 350 | 3300005455 | Ga0070663_100105736 | Ga0070663_1001057363 | 222 |
| 351 | 3300005455 | Ga0070663_100162654 | Ga0070663_1001626542 | 222 |
| 352 | 3300005455 | Ga0070663_100293253 | Ga0070663_1002932532 | 222 |
| 353 | 3300005455 | Ga0070663_101007415 | Ga0070663_1010074151 | 222 |
| 354 | 3300005456 | Ga0070678_100006370 | Ga0070678_1000063707 | 222 |
| 355 | 3300005456 | Ga0070678_100274305 | Ga0070678_1002743052 | 222 |
| 356 | 3300005456 | Ga0070678_100491904 | Ga0070678_1004919041 | 222 |
| 357 | 3300005457 | Ga0070662_100013853 | Ga0070662_1000138533 | 222 |
| 358 | 3300005457 | Ga0070662_100039010 | Ga0070662_1000390103 | 222 |
| 359 | 3300005457 | Ga0070662_100055298 | Ga0070662_1000552983 | 222 |
| 360 | 3300005457 | Ga0070662_100183278 | Ga0070662_1001832781 | 222 |
| 361 | 3300005457 | Ga0070662_100406978 | Ga0070662_1004069781 | 222 |
| 362 | 3300005458 | Ga0070681_10024034 | Ga0070681_100240343 | 222 |
| 363 | 3300005458 | Ga0070681_10204929 | Ga0070681_102049293 | 222 |
| 364 | 3300005458 | Ga0070681_10510917 | Ga0070681_105109172 | 222 |
| 365 | 3300005459 | Ga0068867_100041083 | Ga0068867_1000410833 | 222 |
| 366 | 3300005459 | Ga0068867_100161438 | Ga0068867_1001614382 | 222 |
| 367 | 3300005467 | Ga0070706_100142271 | Ga0070706_1001422711 | 222 |
| 368 | 3300005530 | Ga0070679_100119159 | Ga0070679_1001191593 | 222 |
| 369 | 3300005530 | Ga0070679_100236282 | Ga0070679_1002362823 | 222 |
| 370 | 3300005530 | Ga0070679_100305737 | Ga0070679_1003057371 | 222 |
| 371 | 3300005535 | Ga0070684_100101049 | Ga0070684_1001010493 | 222 |
| 372 | 3300005539 | Ga0068853_100010266 | Ga0068853_1000102668 | 222 |
| 373 | 3300005539 | Ga0068853_100053054 | Ga0068853_1000530542 | 222 |
| 374 | 3300005539 | Ga0068853_100270493 | Ga0068853_1002704932 | 222 |
| 375 | 3300005539 | Ga0068853_100381695 | Ga0068853_1003816952 | 222 |
| 376 | 3300005543 | Ga0070672_100135761 | Ga0070672_1001357613 | 222 |
| 377 | 3300005543 | Ga0070672_100137257 | Ga0070672_1001372572 | 222 |
| 378 | 3300005543 | Ga0070672_100164139 | Ga0070672_1001641392 | 222 |
| 379 | 3300005543 | Ga0070672_100175908 | Ga0070672_1001759081 | 222 |
| 380 | 3300005543 | Ga0070672_100310003 | Ga0070672_1003100033 | 222 |
| 381 | 3300005544 | Ga0070686_100014585 | Ga0070686_1000145853 | 222 |
| 382 | 3300005545 | Ga0070695_100008415 | Ga0070695_1000084157 | 222 |
| 383 | 3300005545 | Ga0070695_100442645 | Ga0070695_1004426452 | 222 |
| 384 | 3300005546 | Ga0070696_100077670 | Ga0070696_1000776701 | 222 |
| 385 | 3300005546 | Ga0070696_100449070 | Ga0070696_1004490701 | 222 |
| 386 | 3300005548 | Ga0070665_100075397 | Ga0070665_1000753973 | 222 |
| 387 | 3300005563 | Ga0068855_100052153 | Ga0068855_1000521537 | 222 |
| 388 | 3300005563 | Ga0068855_100197776 | Ga0068855_1001977762 | 222 |
| 389 | 3300005563 | Ga0068855_100452052 | Ga0068855_1004520522 | 222 |
| 390 | 3300005564 | Ga0070664_100000796 | Ga0070664_10000079625 | 222 |
| 391 | 3300005564 | Ga0070664_100006146 | Ga0070664_1000061466 | 222 |
| 392 | 3300005564 | Ga0070664_100013519 | Ga0070664_1000135193 | 222 |
| 393 | 3300005564 | Ga0070664_100028663 | Ga0070664_1000286633 | 222 |
| 394 | 3300005564 | Ga0070664_100157013 | Ga0070664_1001570132 | 222 |
| 395 | 3300005577 | Ga0068857_100004979 | Ga0068857_10000497914 | 222 |
| 396 | 3300005577 | Ga0068857_100036364 | Ga0068857_1000363643 | 222 |
| 397 | 3300005577 | Ga0068857_100087634 | Ga0068857_1000876343 | 222 |
| 398 | 3300005577 | Ga0068857_100247423 | Ga0068857_1002474232 | 222 |
| 399 | 3300005577 | Ga0068857_100437446 | Ga0068857_1004374461 | 222 |
| 400 | 3300005578 | Ga0068854_100035473 | Ga0068854_1000354732 | 222 |
| 401 | 3300005578 | Ga0068854_100084612 | Ga0068854_1000846122 | 222 |
| 402 | 3300005578 | Ga0068854_100114054 | Ga0068854_1001140543 | 222 |
| 403 | 3300005578 | Ga0068854_100302470 | Ga0068854_1003024702 | 222 |
| 404 | 3300005614 | Ga0068856_100045365 | Ga0068856_1000453653 | 222 |
| 405 | 3300005614 | Ga0068856_100128955 | Ga0068856_1001289551 | 222 |
| 406 | 3300005614 | Ga0068856_100159289 | Ga0068856_1001592893 | 222 |
| 407 | 3300005614 | Ga0068856_100186165 | Ga0068856_1001861653 | 222 |
| 408 | 3300005614 | Ga0068856_100292947 | Ga0068856_1002929472 | 222 |
| 409 | 3300005614 | Ga0068856_100504088 | Ga0068856_1005040881 | 222 |
| 410 | 3300005616 | Ga0068852_100030855 | Ga0068852_1000308554 | 222 |
| 411 | 3300005616 | Ga0068852_100095052 | Ga0068852_1000950522 | 222 |
| 412 | 3300005616 | Ga0068852_100096053 | Ga0068852_1000960532 | 222 |
| 413 | 3300005616 | Ga0068852_100298140 | Ga0068852_1002981401 | 222 |
| 414 | 3300005616 | Ga0068852_100862258 | Ga0068852_1008622581 | 222 |
| 415 | 3300005617 | Ga0068859_100045068 | Ga0068859_1000450683 | 222 |
| 416 | 3300005617 | Ga0068859_100060739 | Ga0068859_1000607393 | 222 |
| 417 | 3300005617 | Ga0068859_100516916 | Ga0068859_1005169161 | 222 |
| 418 | 3300005618 | Ga0068864_100003062 | Ga0068864_1000030624 | 222 |
| 419 | 3300005618 | Ga0068864_100004851 | Ga0068864_10000485110 | 222 |
| 420 | 3300005618 | Ga0068864_100010589 | Ga0068864_1000105896 | 222 |
| 421 | 3300005618 | Ga0068864_100015388 | Ga0068864_1000153888 | 222 |
| 422 | 3300005618 | Ga0068864_100219348 | Ga0068864_1002193482 | 222 |
| 423 | 3300005718 | Ga0068866_10013503 | Ga0068866_100135033 | 222 |
| 424 | 3300005718 | Ga0068866_10033761 | Ga0068866_100337613 | 222 |
| 425 | 3300005718 | Ga0068866_10064003 | Ga0068866_100640032 | 222 |
| 426 | 3300005834 | Ga0068851_10012401 | Ga0068851_100124012 | 222 |
| 427 | 3300005834 | Ga0068851_10027197 | Ga0068851_100271973 | 222 |
| 428 | 3300005841 | Ga0068863_100012076 | Ga0068863_1000120763 | 222 |
| 429 | 3300005841 | Ga0068863_100028603 | Ga0068863_1000286038 | 222 |
| 430 | 3300005841 | Ga0068863_100031781 | Ga0068863_1000317813 | 222 |
| 431 | 3300005841 | Ga0068863_100107343 | Ga0068863_1001073433 | 222 |
| 432 | 3300005842 | Ga0068858_100008141 | Ga0068858_10000814110 | 222 |
| 433 | 3300005842 | Ga0068858_100009043 | Ga0068858_10000904310 | 222 |
| 434 | 3300005842 | Ga0068858_100021992 | Ga0068858_1000219923 | 222 |
| 435 | 3300005842 | Ga0068858_100039425 | Ga0068858_1000394252 | 222 |
| 436 | 3300005843 | Ga0068860_100043789 | Ga0068860_1000437893 | 222 |
| 437 | 3300005843 | Ga0068860_100311993 | Ga0068860_1003119933 | 222 |
| 438 | 3300005843 | Ga0068860_100335386 | Ga0068860_1003353862 | 222 |
| 439 | 3300005844 | Ga0068862_100005148 | Ga0068862_1000051487 | 222 |
| 440 | 3300005844 | Ga0068862_100011375 | Ga0068862_1000113759 | 222 |
| 441 | 3300006175 | Ga0070712_100015111 | Ga0070712_1000151113 | 222 |
| 442 | 3300006175 | Ga0070712_100307818 | Ga0070712_1003078182 | 222 |
| 443 | 3300006237 | Ga0097621_100044451 | Ga0097621_1000444513 | 222 |
| 444 | 3300006237 | Ga0097621_100078299 | Ga0097621_1000782993 | 222 |
| 445 | 3300006237 | Ga0097621_100308752 | Ga0097621_1003087522 | 222 |
| 446 | 3300006358 | Ga0068871_100043912 | Ga0068871_1000439123 | 222 |
| 447 | 3300006358 | Ga0068871_100055598 | Ga0068871_1000555982 | 222 |
| 448 | 3300006358 | Ga0068871_100246315 | Ga0068871_1002463152 | 222 |
| 449 | 3300006881 | Ga0068865_100059555 | Ga0068865_1000595553 | 222 |
| 450 | 3300006881 | Ga0068865_100099551 | Ga0068865_1000995512 | 222 |
| 451 | 3300006881 | Ga0068865_100239660 | Ga0068865_1002396602 | 222 |
| 452 | 3300006931 | Ga0097620_100045068 | Ga0097620_1000450683 | 222 |
| 453 | 3300006931 | Ga0097620_100060743 | Ga0097620_1000607433 | 222 |
| 454 | 3300006931 | Ga0097620_100516999 | Ga0097620_1005169991 | 222 |
| 455 | 3300007076 | Ga0075435_100725534 | Ga0075435_1007255342 | 222 |
| 456 | 3300009092 | Ga0105250_10177509 | Ga0105250_101775091 | 222 |
| 457 | 3300009093 | Ga0105240_10010767 | Ga0105240_100107674 | 222 |
| 458 | 3300009093 | Ga0105240_10048454 | Ga0105240_100484543 | 222 |
| 459 | 3300009093 | Ga0105240_10140421 | Ga0105240_101404213 | 222 |
| 460 | 3300009093 | Ga0105240_10151447 | Ga0105240_101514473 | 222 |
| 461 | 3300009093 | Ga0105240_11409483 | Ga0105240_114094831 | 222 |
| 462 | 3300009094 | Ga0111539_10180978 | Ga0111539_101809783 | 222 |
| 463 | 3300009098 | Ga0105245_10011260 | Ga0105245_100112605 | 222 |
| 464 | 3300009098 | Ga0105245_10028099 | Ga0105245_100280993 | 222 |
| 465 | 3300009101 | Ga0105247_10234584 | Ga0105247_102345842 | 222 |
| 466 | 3300009147 | Ga0114129_11079262 | Ga0114129_110792621 | 222 |
| 467 | 3300009148 | Ga0105243_10034437 | Ga0105243_100344373 | 222 |
| 468 | 3300009148 | Ga0105243_10285527 | Ga0105243_102855272 | 222 |
| 469 | 3300009174 | Ga0105241_10117004 | Ga0105241_101170041 | 222 |
| 470 | 3300009174 | Ga0105241_10144750 | Ga0105241_101447502 | 222 |
| 471 | 3300009176 | Ga0105242_10000993 | Ga0105242_100009933 | 222 |
| 472 | 3300009177 | Ga0105248_10118171 | Ga0105248_101181713 | 222 |
| 473 | 3300009177 | Ga0105248_10278152 | Ga0105248_102781522 | 222 |
| 474 | 3300009177 | Ga0105248_10431621 | Ga0105248_104316212 | 222 |
| 475 | 3300009177 | Ga0105248_10523825 | Ga0105248_105238252 | 222 |
| 476 | 3300009177 | Ga0105248_10641816 | Ga0105248_106418162 | 222 |
| 477 | 3300009545 | Ga0105237_10013830 | Ga0105237_100138303 | 222 |
| 478 | 3300009545 | Ga0105237_10044364 | Ga0105237_100443646 | 222 |
| 479 | 3300009553 | Ga0105249_10048325 | Ga0105249_100483255 | 222 |
| 480 | 3300009553 | Ga0105249_10275951 | Ga0105249_102759513 | 222 |
| 481 | 3300010375 | Ga0105239_10031723 | Ga0105239_100317233 | 222 |
| 482 | 3300011119 | Ga0105246_10145616 | Ga0105246_101456162 | 222 |
| 483 | 3300013100 | Ga0157373_10056835 | Ga0157373_100568355 | 222 |
| 484 | 3300013100 | Ga0157373_10096850 | Ga0157373_100968502 | 222 |
| 485 | 3300013100 | Ga0157373_10298304 | Ga0157373_102983041 | 222 |
| 486 | 3300013102 | Ga0157371_10012875 | Ga0157371_100128753 | 222 |
| 487 | 3300013102 | Ga0157371_10014315 | Ga0157371_100143155 | 222 |
| 488 | 3300013102 | Ga0157371_10169089 | Ga0157371_101690892 | 222 |
| 489 | 3300013102 | Ga0157371_10330549 | Ga0157371_103305492 | 222 |
| 490 | 3300013104 | Ga0157370_10154929 | Ga0157370_101549293 | 222 |
| 491 | 3300013104 | Ga0157370_10605659 | Ga0157370_106056592 | 222 |
| 492 | 3300013105 | Ga0157369_10013407 | Ga0157369_100134075 | 222 |
| 493 | 3300013105 | Ga0157369_10019843 | Ga0157369_100198433 | 222 |
| 494 | 3300013105 | Ga0157369_10038407 | Ga0157369_100384074 | 222 |
| 495 | 3300013105 | Ga0157369_10079144 | Ga0157369_100791442 | 222 |
| 496 | 3300013105 | Ga0157369_10165472 | Ga0157369_101654723 | 222 |
| 497 | 3300013105 | Ga0157369_10236852 | Ga0157369_102368523 | 222 |
| 498 | 3300013105 | Ga0157369_10297249 | Ga0157369_102972492 | 222 |
| 499 | 3300013105 | Ga0157369_10418927 | Ga0157369_104189271 | 222 |
| 500 | 3300013105 | Ga0157369_10850614 | Ga0157369_108506141 | 222 |
| 501 | 3300013105 | Ga0157369_11116845 | Ga0157369_111168451 | 222 |
| 502 | 3300013297 | Ga0157378_10086575 | Ga0157378_100865753 | 222 |
| 503 | 3300013297 | Ga0157378_10378001 | Ga0157378_103780012 | 222 |
| 504 | 3300013297 | Ga0157378_10564458 | Ga0157378_105644581 | 222 |
| 505 | 3300013306 | Ga0163162_10114586 | Ga0163162_101145863 | 222 |
| 506 | 3300013306 | Ga0163162_10211034 | Ga0163162_102110343 | 222 |
| 507 | 3300013306 | Ga0163162_10230282 | Ga0163162_102302823 | 222 |
| 508 | 3300013306 | Ga0163162_10424950 | Ga0163162_104249501 | 222 |
| 509 | 3300013307 | Ga0157372_10100671 | Ga0157372_101006713 | 222 |
| 510 | 3300013307 | Ga0157372_10306604 | Ga0157372_103066042 | 222 |
| 511 | 3300013307 | Ga0157372_10373787 | Ga0157372_103737872 | 222 |
| 512 | 3300013308 | Ga0157375_10010035 | Ga0157375_100100353 | 222 |
| 513 | 3300013308 | Ga0157375_10096009 | Ga0157375_100960092 | 222 |
| 514 | 3300014325 | Ga0163163_10047615 | Ga0163163_100476153 | 222 |
| 515 | 3300014325 | Ga0163163_10060403 | Ga0163163_100604036 | 222 |
| 516 | 3300014325 | Ga0163163_10280831 | Ga0163163_102808313 | 222 |
| 517 | 3300014497 | Ga0182008_10180292 | Ga0182008_101802922 | 222 |
| 518 | 3300014968 | Ga0157379_10020049 | Ga0157379_100200492 | 222 |
| 519 | 3300014968 | Ga0157379_10133277 | Ga0157379_101332773 | 222 |
| 520 | 3300014968 | Ga0157379_10153862 | Ga0157379_101538622 | 222 |
| 521 | 3300014968 | Ga0157379_10211568 | Ga0157379_102115683 | 222 |
| 522 | 3300014969 | Ga0157376_10033036 | Ga0157376_100330363 | 222 |
| 523 | 3300020070 | Ga0206356_11154504 | Ga0206356_111545041 | 222 |
| 524 | 3300025315 | Ga0207697_10003593 | Ga0207697_100035933 | 222 |
| 525 | 3300025315 | Ga0207697_10054258 | Ga0207697_100542581 | 222 |
| 526 | 3300025321 | Ga0207656_10029165 | Ga0207656_100291652 | 222 |
| 527 | 3300025321 | Ga0207656_10258873 | Ga0207656_102588731 | 222 |
| 528 | 3300025735 | Ga0207713_1029090 | Ga0207713_10290901 | 222 |
| 529 | 3300025899 | Ga0207642_10005526 | Ga0207642_100055263 | 222 |
| 530 | 3300025899 | Ga0207642_10169499 | Ga0207642_101694992 | 222 |
| 531 | 3300025899 | Ga0207642_10183420 | Ga0207642_101834202 | 222 |
| 532 | 3300025901 | Ga0207688_10046065 | Ga0207688_100460652 | 222 |
| 533 | 3300025901 | Ga0207688_10116969 | Ga0207688_101169692 | 222 |
| 534 | 3300025901 | Ga0207688_10161699 | Ga0207688_101616992 | 222 |
| 535 | 3300025903 | Ga0207680_10101433 | Ga0207680_101014333 | 222 |
| 536 | 3300025904 | Ga0207647_10003324 | Ga0207647_1000332410 | 222 |
| 537 | 3300025904 | Ga0207647_10004997 | Ga0207647_1000499712 | 222 |
| 538 | 3300025904 | Ga0207647_10036318 | Ga0207647_100363183 | 222 |
| 539 | 3300025904 | Ga0207647_10037451 | Ga0207647_100374513 | 222 |
| 540 | 3300025904 | Ga0207647_10039154 | Ga0207647_100391543 | 222 |
| 541 | 3300025904 | Ga0207647_10039324 | Ga0207647_100393242 | 222 |
| 542 | 3300025906 | Ga0207699_10030222 | Ga0207699_100302222 | 222 |
| 543 | 3300025907 | Ga0207645_10161572 | Ga0207645_101615722 | 222 |
| 544 | 3300025908 | Ga0207643_10084056 | Ga0207643_100840563 | 222 |
| 545 | 3300025909 | Ga0207705_10000581 | Ga0207705_1000058114 | 222 |
| 546 | 3300025909 | Ga0207705_10002967 | Ga0207705_100029673 | 222 |
| 547 | 3300025909 | Ga0207705_10004513 | Ga0207705_100045133 | 222 |
| 548 | 3300025909 | Ga0207705_10006704 | Ga0207705_100067048 | 222 |
| 549 | 3300025909 | Ga0207705_10058971 | Ga0207705_100589712 | 222 |
| 550 | 3300025909 | Ga0207705_10125769 | Ga0207705_101257693 | 222 |
| 551 | 3300025909 | Ga0207705_10134511 | Ga0207705_101345113 | 222 |
| 552 | 3300025909 | Ga0207705_10468731 | Ga0207705_104687311 | 222 |
| 553 | 3300025910 | Ga0207684_10095695 | Ga0207684_100956953 | 222 |
| 554 | 3300025912 | Ga0207707_10068256 | Ga0207707_100682563 | 222 |
| 555 | 3300025912 | Ga0207707_10634720 | Ga0207707_106347202 | 222 |
| 556 | 3300025913 | Ga0207695_10032866 | Ga0207695_100328662 | 222 |
| 557 | 3300025913 | Ga0207695_10040264 | Ga0207695_100402643 | 222 |
| 558 | 3300025913 | Ga0207695_10040940 | Ga0207695_100409403 | 222 |
| 559 | 3300025914 | Ga0207671_10027417 | Ga0207671_100274173 | 222 |
| 560 | 3300025914 | Ga0207671_10242119 | Ga0207671_102421192 | 222 |
| 561 | 3300025915 | Ga0207693_10049511 | Ga0207693_100495113 | 222 |
| 562 | 3300025915 | Ga0207693_10069429 | Ga0207693_100694293 | 222 |
| 563 | 3300025917 | Ga0207660_10000049 | Ga0207660_1000004930 | 222 |
| 564 | 3300025917 | Ga0207660_10001261 | Ga0207660_100012618 | 222 |
| 565 | 3300025917 | Ga0207660_10003546 | Ga0207660_100035463 | 222 |
| 566 | 3300025917 | Ga0207660_10039020 | Ga0207660_100390202 | 222 |
| 567 | 3300025917 | Ga0207660_10047117 | Ga0207660_100471173 | 222 |
| 568 | 3300025917 | Ga0207660_10071621 | Ga0207660_100716213 | 222 |
| 569 | 3300025918 | Ga0207662_10017379 | Ga0207662_100173793 | 222 |
| 570 | 3300025919 | Ga0207657_10001024 | Ga0207657_1000102427 | 222 |
| 571 | 3300025919 | Ga0207657_10002291 | Ga0207657_100022916 | 222 |
| 572 | 3300025919 | Ga0207657_10014804 | Ga0207657_100148042 | 222 |
| 573 | 3300025919 | Ga0207657_10036194 | Ga0207657_100361945 | 222 |
| 574 | 3300025919 | Ga0207657_10139372 | Ga0207657_101393722 | 222 |
| 575 | 3300025919 | Ga0207657_10186690 | Ga0207657_101866903 | 222 |
| 576 | 3300025920 | Ga0207649_10007445 | Ga0207649_100074455 | 222 |
| 577 | 3300025920 | Ga0207649_10045907 | Ga0207649_100459071 | 222 |
| 578 | 3300025920 | Ga0207649_10062698 | Ga0207649_100626983 | 222 |
| 579 | 3300025920 | Ga0207649_10091160 | Ga0207649_100911603 | 222 |
| 580 | 3300025920 | Ga0207649_10469903 | Ga0207649_104699032 | 222 |
| 581 | 3300025921 | Ga0207652_10024932 | Ga0207652_100249323 | 222 |
| 582 | 3300025921 | Ga0207652_10208467 | Ga0207652_102084673 | 222 |
| 583 | 3300025921 | Ga0207652_10721397 | Ga0207652_107213972 | 222 |
| 584 | 3300025923 | Ga0207681_10262839 | Ga0207681_102628392 | 222 |
| 585 | 3300025923 | Ga0207681_10879605 | Ga0207681_108796051 | 222 |
| 586 | 3300025924 | Ga0207694_10142998 | Ga0207694_101429982 | 222 |
| 587 | 3300025924 | Ga0207694_10264427 | Ga0207694_102644272 | 222 |
| 588 | 3300025925 | Ga0207650_10079682 | Ga0207650_100796823 | 222 |
| 589 | 3300025925 | Ga0207650_10113401 | Ga0207650_101134012 | 222 |
| 590 | 3300025925 | Ga0207650_10452633 | Ga0207650_104526332 | 222 |
| 591 | 3300025926 | Ga0207659_10192355 | Ga0207659_101923553 | 222 |
| 592 | 3300025927 | Ga0207687_10021225 | Ga0207687_100212253 | 222 |
| 593 | 3300025928 | Ga0207700_10021189 | Ga0207700_100211894 | 222 |
| 594 | 3300025928 | Ga0207700_10304307 | Ga0207700_103043073 | 222 |
| 595 | 3300025929 | Ga0207664_10103067 | Ga0207664_101030672 | 222 |
| 596 | 3300025929 | Ga0207664_10460823 | Ga0207664_104608232 | 222 |
| 597 | 3300025929 | Ga0207664_10969368 | Ga0207664_109693681 | 222 |
| 598 | 3300025931 | Ga0207644_10003758 | Ga0207644_100037583 | 222 |
| 599 | 3300025931 | Ga0207644_10007787 | Ga0207644_100077875 | 222 |
| 600 | 3300025931 | Ga0207644_10013861 | Ga0207644_100138612 | 222 |
| 601 | 3300025931 | Ga0207644_10144097 | Ga0207644_101440973 | 222 |
| 602 | 3300025931 | Ga0207644_10318803 | Ga0207644_103188032 | 222 |
| 603 | 3300025932 | Ga0207690_10021317 | Ga0207690_100213173 | 222 |
| 604 | 3300025932 | Ga0207690_10035197 | Ga0207690_100351973 | 222 |
| 605 | 3300025932 | Ga0207690_10049447 | Ga0207690_100494473 | 222 |
| 606 | 3300025932 | Ga0207690_10062335 | Ga0207690_100623353 | 222 |
| 607 | 3300025933 | Ga0207706_10010762 | Ga0207706_100107628 | 222 |
| 608 | 3300025933 | Ga0207706_10018225 | Ga0207706_100182253 | 222 |
| 609 | 3300025933 | Ga0207706_10032000 | Ga0207706_100320003 | 222 |
| 610 | 3300025933 | Ga0207706_10035781 | Ga0207706_100357813 | 222 |
| 611 | 3300025933 | Ga0207706_10063866 | Ga0207706_100638663 | 222 |
| 612 | 3300025933 | Ga0207706_10065748 | Ga0207706_100657483 | 222 |
| 613 | 3300025933 | Ga0207706_10228140 | Ga0207706_102281403 | 222 |
| 614 | 3300025933 | Ga0207706_10238712 | Ga0207706_102387122 | 222 |
| 615 | 3300025934 | Ga0207686_10086113 | Ga0207686_100861133 | 222 |
| 616 | 3300025937 | Ga0207669_10013644 | Ga0207669_100136447 | 222 |
| 617 | 3300025937 | Ga0207669_10178272 | Ga0207669_101782723 | 222 |
| 618 | 3300025938 | Ga0207704_10060736 | Ga0207704_100607361 | 222 |
| 619 | 3300025938 | Ga0207704_10128411 | Ga0207704_101284112 | 222 |
| 620 | 3300025940 | Ga0207691_10001370 | Ga0207691_1000137022 | 222 |
| 621 | 3300025940 | Ga0207691_10093754 | Ga0207691_100937542 | 222 |
| 622 | 3300025940 | Ga0207691_10111195 | Ga0207691_101111953 | 222 |
| 623 | 3300025940 | Ga0207691_10149557 | Ga0207691_101495573 | 222 |
| 624 | 3300025940 | Ga0207691_10151505 | Ga0207691_101515053 | 222 |
| 625 | 3300025940 | Ga0207691_10205146 | Ga0207691_102051462 | 222 |
| 626 | 3300025940 | Ga0207691_10302633 | Ga0207691_103026333 | 222 |
| 627 | 3300025941 | Ga0207711_10003771 | Ga0207711_100037713 | 222 |
| 628 | 3300025941 | Ga0207711_10003910 | Ga0207711_100039103 | 222 |
| 629 | 3300025941 | Ga0207711_10011332 | Ga0207711_100113323 | 222 |
| 630 | 3300025941 | Ga0207711_10218380 | Ga0207711_102183802 | 222 |
| 631 | 3300025941 | Ga0207711_10542536 | Ga0207711_105425362 | 222 |
| 632 | 3300025942 | Ga0207689_10021845 | Ga0207689_100218452 | 222 |
| 633 | 3300025942 | Ga0207689_10383070 | Ga0207689_103830702 | 222 |
| 634 | 3300025944 | Ga0207661_10013094 | Ga0207661_100130943 | 222 |
| 635 | 3300025944 | Ga0207661_10441488 | Ga0207661_104414882 | 222 |
| 636 | 3300025945 | Ga0207679_10033691 | Ga0207679_100336913 | 222 |
| 637 | 3300025945 | Ga0207679_10137075 | Ga0207679_101370753 | 222 |
| 638 | 3300025949 | Ga0207667_10017613 | Ga0207667_100176132 | 222 |
| 639 | 3300025949 | Ga0207667_10038314 | Ga0207667_100383148 | 222 |
| 640 | 3300025949 | Ga0207667_10080420 | Ga0207667_100804203 | 222 |
| 641 | 3300025949 | Ga0207667_10247312 | Ga0207667_102473123 | 222 |
| 642 | 3300025960 | Ga0207651_10001484 | Ga0207651_100014844 | 222 |
| 643 | 3300025960 | Ga0207651_10041421 | Ga0207651_100414212 | 222 |
| 644 | 3300025960 | Ga0207651_10042885 | Ga0207651_100428853 | 222 |
| 645 | 3300025960 | Ga0207651_10051538 | Ga0207651_100515383 | 222 |
| 646 | 3300025960 | Ga0207651_10153924 | Ga0207651_101539243 | 222 |
| 647 | 3300025960 | Ga0207651_10191294 | Ga0207651_101912942 | 222 |
| 648 | 3300025960 | Ga0207651_10205174 | Ga0207651_102051743 | 222 |
| 649 | 3300025961 | Ga0207712_10043240 | Ga0207712_100432403 | 222 |
| 650 | 3300025961 | Ga0207712_10155645 | Ga0207712_101556452 | 222 |
| 651 | 3300025972 | Ga0207668_10037107 | Ga0207668_100371073 | 222 |
| 652 | 3300025981 | Ga0207640_10018699 | Ga0207640_100186992 | 222 |
| 653 | 3300025981 | Ga0207640_10023246 | Ga0207640_100232465 | 222 |
| 654 | 3300025981 | Ga0207640_10048921 | Ga0207640_100489212 | 222 |
| 655 | 3300025981 | Ga0207640_10054510 | Ga0207640_100545102 | 222 |
| 656 | 3300025986 | Ga0207658_10008045 | Ga0207658_100080452 | 222 |
| 657 | 3300025986 | Ga0207658_10042081 | Ga0207658_100420813 | 222 |
| 658 | 3300025986 | Ga0207658_10070845 | Ga0207658_100708452 | 222 |
| 659 | 3300025986 | Ga0207658_10135376 | Ga0207658_101353761 | 222 |
| 660 | 3300025986 | Ga0207658_10256317 | Ga0207658_102563172 | 222 |
| 661 | 3300025986 | Ga0207658_10427161 | Ga0207658_104271612 | 222 |
| 662 | 3300025986 | Ga0207658_10552442 | Ga0207658_105524422 | 222 |
| 663 | 3300026023 | Ga0207677_10018043 | Ga0207677_100180433 | 222 |
| 664 | 3300026023 | Ga0207677_10038156 | Ga0207677_100381562 | 222 |
| 665 | 3300026023 | Ga0207677_10126659 | Ga0207677_101266592 | 222 |
| 666 | 3300026023 | Ga0207677_10253772 | Ga0207677_102537722 | 222 |
| 667 | 3300026023 | Ga0207677_10274496 | Ga0207677_102744962 | 222 |
| 668 | 3300026035 | Ga0207703_10002473 | Ga0207703_1000247313 | 222 |
| 669 | 3300026035 | Ga0207703_10020734 | Ga0207703_100207343 | 222 |
| 670 | 3300026035 | Ga0207703_10038460 | Ga0207703_100384603 | 222 |
| 671 | 3300026041 | Ga0207639_10000798 | Ga0207639_100007982 | 222 |
| 672 | 3300026041 | Ga0207639_10234441 | Ga0207639_102344411 | 222 |
| 673 | 3300026067 | Ga0207678_10012937 | Ga0207678_100129374 | 222 |
| 674 | 3300026067 | Ga0207678_10025444 | Ga0207678_100254448 | 222 |
| 675 | 3300026067 | Ga0207678_10045966 | Ga0207678_100459663 | 222 |
| 676 | 3300026067 | Ga0207678_10099798 | Ga0207678_100997982 | 222 |
| 677 | 3300026067 | Ga0207678_10141300 | Ga0207678_101413003 | 222 |
| 678 | 3300026067 | Ga0207678_10267938 | Ga0207678_102679383 | 222 |
| 679 | 3300026078 | Ga0207702_10004418 | Ga0207702_1000441814 | 222 |
| 680 | 3300026078 | Ga0207702_10028286 | Ga0207702_100282865 | 222 |
| 681 | 3300026078 | Ga0207702_10066302 | Ga0207702_100663023 | 222 |
| 682 | 3300026078 | Ga0207702_10119857 | Ga0207702_101198572 | 222 |
| 683 | 3300026078 | Ga0207702_10605623 | Ga0207702_106056232 | 222 |
| 684 | 3300026078 | Ga0207702_10929694 | Ga0207702_109296941 | 222 |
| 685 | 3300026088 | Ga0207641_10005331 | Ga0207641_1000533112 | 222 |
| 686 | 3300026088 | Ga0207641_10014002 | Ga0207641_100140025 | 222 |
| 687 | 3300026088 | Ga0207641_10016333 | Ga0207641_100163333 | 222 |
| 688 | 3300026088 | Ga0207641_10017560 | Ga0207641_100175603 | 222 |
| 689 | 3300026089 | Ga0207648_10004524 | Ga0207648_1000452412 | 222 |
| 690 | 3300026095 | Ga0207676_10009112 | Ga0207676_100091128 | 222 |
| 691 | 3300026095 | Ga0207676_10112195 | Ga0207676_101121952 | 222 |
| 692 | 3300026095 | Ga0207676_10141914 | Ga0207676_101419142 | 222 |
| 693 | 3300026095 | Ga0207676_10249643 | Ga0207676_102496432 | 222 |
| 694 | 3300026116 | Ga0207674_10000527 | Ga0207674_1000052714 | 222 |
| 695 | 3300026116 | Ga0207674_10000580 | Ga0207674_1000058028 | 222 |
| 696 | 3300026116 | Ga0207674_10011858 | Ga0207674_100118583 | 222 |
| 697 | 3300026116 | Ga0207674_10015259 | Ga0207674_100152599 | 222 |
| 698 | 3300026118 | Ga0207675_100104253 | Ga0207675_1001042532 | 222 |
| 699 | 3300026118 | Ga0207675_100359630 | Ga0207675_1003596301 | 222 |
| 700 | 3300026121 | Ga0207683_10007206 | Ga0207683_100072062 | 222 |
| 701 | 3300026121 | Ga0207683_10016776 | Ga0207683_100167765 | 222 |
| 702 | 3300026121 | Ga0207683_10040094 | Ga0207683_100400943 | 222 |
| 703 | 3300026121 | Ga0207683_10040215 | Ga0207683_100402152 | 222 |
| 704 | 3300026121 | Ga0207683_10196562 | Ga0207683_101965622 | 222 |
| 705 | 3300026121 | Ga0207683_10213917 | Ga0207683_102139173 | 222 |
| 706 | 3300026121 | Ga0207683_10899942 | Ga0207683_108999421 | 222 |
| 707 | 3300026142 | Ga0207698_10000703 | Ga0207698_1000070318 | 222 |
| 708 | 3300026142 | Ga0207698_10002428 | Ga0207698_100024283 | 222 |
| 709 | 3300026142 | Ga0207698_10104662 | Ga0207698_101046623 | 222 |
| 710 | 3300028379 | Ga0268266_10124657 | Ga0268266_101246573 | 222 |
| 711 | 3300028379 | Ga0268266_10283725 | Ga0268266_102837253 | 222 |
| 712 | 3300028379 | Ga0268266_10562897 | Ga0268266_105628972 | 222 |
| 713 | 3300028380 | Ga0268265_10044163 | Ga0268265_100441632 | 222 |
| 714 | 3300028381 | Ga0268264_10029877 | Ga0268264_100298774 | 222 |
| 715 | 3300028381 | Ga0268264_10056900 | Ga0268264_100569002 | 222 |
| 716 | 3300028381 | Ga0268264_10063115 | Ga0268264_100631153 | 222 |
| 717 | 3300028381 | Ga0268264_10396532 | Ga0268264_103965322 | 222 |
| 718 | 3300030736 | Ga0316180_1176809 | Ga0316180_11768092 | 222 |
| 719 | 3300031548 | Ga0307408_100375539 | Ga0307408_1003755392 | 222 |
| 720 | 3300031731 | Ga0307405_10033725 | Ga0307405_100337252 | 222 |
| 721 | 3300031731 | Ga0307405_10324564 | Ga0307405_103245642 | 222 |
| 722 | 3300031852 | Ga0307410_10042547 | Ga0307410_100425472 | 222 |
| 723 | 3300031852 | Ga0307410_10225692 | Ga0307410_102256922 | 222 |
| 724 | 3300031901 | Ga0307406_10148634 | Ga0307406_101486342 | 222 |
| 725 | 3300031995 | Ga0307409_100011708 | Ga0307409_1000117082 | 222 |
| 726 | 3300031995 | Ga0307409_100705244 | Ga0307409_1007052442 | 222 |
| 727 | 3300032002 | Ga0307416_100008789 | Ga0307416_1000087893 | 222 |
| 728 | 3300032004 | Ga0307414_10137642 | Ga0307414_101376423 | 222 |
| 729 | 3300032005 | Ga0307411_10086347 | Ga0307411_100863473 | 222 |
| 730 | 3300032005 | Ga0307411_10105023 | Ga0307411_101050233 | 222 |
| 731 | 3300032005 | Ga0307411_10155346 | Ga0307411_101553461 | 222 |
| 732 | 3300032005 | Ga0307411_10385226 | Ga0307411_103852262 | 222 |
| 733 | 3300032126 | Ga0307415_100012202 | Ga0307415_1000122023 | 222 |
| 734 | 3300032126 | Ga0307415_100282974 | Ga0307415_1002829742 | 222 |
| 735 | 3300035691 | Ga0373931_0067265 | Ga0373931_0067265_706_1374 | 222 |
| 736 | 3300035692 | Ga0373935_0101081 | Ga0373935_0101081_1198_1866 | 222 |
| 737 | 3300037312 | Ga0395899_0020496 | Ga0395899_0020496_2810_3478 | 222 |
| 738 | 3300037312 | Ga0395899_0049564 | Ga0395899_0049564_1845_2513 | 222 |
| 739 | 3300037312 | Ga0395899_0054770 | Ga0395899_0054770_2009_2677 | 222 |
| 740 | 3300037312 | Ga0395899_0086819 | Ga0395899_0086819_1125_1793 | 222 |
| 741 | 3300037312 | Ga0395899_0094844 | Ga0395899_0094844_1212_1880 | 222 |
| 742 | 3300037312 | Ga0395899_0415461 | Ga0395899_0415461_30_698 | 222 |
| 743 | 3300037312 | Ga0395899_0475788 | Ga0395899_0475788_38_706 | 222 |
| 744 | 3300037418 | Ga0395900_0001820 | Ga0395900_0001820_6948_7616 | 222 |
| 745 | 3300037418 | Ga0395900_0016658 | Ga0395900_0016658_6459_7127 | 222 |
| 746 | 3300037418 | Ga0395900_0017792 | Ga0395900_0017792_6424_7092 | 222 |
| 747 | 3300037418 | Ga0395900_0018428 | Ga0395900_0018428_894_1562 | 222 |
| 748 | 3300037418 | Ga0395900_0020351 | Ga0395900_0020351_1644_2312 | 222 |
| 749 | 3300037418 | Ga0395900_0021453 | Ga0395900_0021453_1262_1930 | 222 |
| 750 | 3300037418 | Ga0395900_0031110 | Ga0395900_0031110_2324_2992 | 222 |
| 751 | 3300037418 | Ga0395900_0060055 | Ga0395900_0060055_2764_3432 | 222 |
| 752 | 3300037418 | Ga0395900_0094309 | Ga0395900_0094309_1512_2180 | 222 |
| 753 | 3300037418 | Ga0395900_0100391 | Ga0395900_0100391_1966_2634 | 222 |
| 754 | 3300037418 | Ga0395900_0100615 | Ga0395900_0100615_299_967 | 222 |
| 755 | 3300037418 | Ga0395900_0178125 | Ga0395900_0178125_147_815 | 222 |
| 756 | 3300037418 | Ga0395900_0205781 | Ga0395900_0205781_1256_1924 | 222 |
| 757 | 3300037418 | Ga0395900_0244736 | Ga0395900_0244736_425_1093 | 222 |
| 758 | 3300037418 | Ga0395900_0359188 | Ga0395900_0359188_631_1299 | 222 |
| 759 | 3300037418 | Ga0395900_0409531 | Ga0395900_0409531_232_900 | 222 |
| 760 | 3300037418 | Ga0395900_0778953 | Ga0395900_0778953_16_684 | 222 |
| 761 | 3300037466 | Ga0395898_0003799 | Ga0395898_0003799_11373_12041 | 222 |
| 762 | 3300037466 | Ga0395898_0008195 | Ga0395898_0008195_4496_5164 | 222 |
| 763 | 3300037466 | Ga0395898_0015150 | Ga0395898_0015150_5630_6298 | 222 |
| 764 | 3300037466 | Ga0395898_0086427 | Ga0395898_0086427_1094_1762 | 222 |
| 765 | 3300037466 | Ga0395898_0157155 | Ga0395898_0157155_347_1015 | 222 |
| 766 | 3300037466 | Ga0395898_0249873 | Ga0395898_0249873_838_1506 | 222 |
| 767 | 3300037466 | Ga0395898_0318162 | Ga0395898_0318162_331_999 | 222 |
| 768 | 3300037471 | Ga0395905_0002222 | Ga0395905_0002222_840_1508 | 222 |
| 769 | 3300037471 | Ga0395905_0006961 | Ga0395905_0006961_3693_4361 | 222 |
| 770 | 3300037471 | Ga0395905_0013050 | Ga0395905_0013050_6834_7502 | 222 |
| 771 | 3300037471 | Ga0395905_0024947 | Ga0395905_0024947_917_1585 | 222 |
| 772 | 3300037471 | Ga0395905_0029724 | Ga0395905_0029724_2533_3201 | 222 |
| 773 | 3300037471 | Ga0395905_0030597 | Ga0395905_0030597_1542_2210 | 222 |
| 774 | 3300037471 | Ga0395905_0031077 | Ga0395905_0031077_861_1529 | 222 |
| 775 | 3300037471 | Ga0395905_0042384 | Ga0395905_0042384_3071_3739 | 222 |
| 776 | 3300037471 | Ga0395905_0076008 | Ga0395905_0076008_355_1023 | 222 |
| 777 | 3300037471 | Ga0395905_0079252 | Ga0395905_0079252_885_1553 | 222 |
| 778 | 3300037471 | Ga0395905_0084968 | Ga0395905_0084968_545_1213 | 222 |
| 779 | 3300037471 | Ga0395905_0142162 | Ga0395905_0142162_350_1018 | 222 |
| 780 | 3300037471 | Ga0395905_0142472 | Ga0395905_0142472_647_1315 | 222 |
| 781 | 3300037471 | Ga0395905_0160258 | Ga0395905_0160258_409_1077 | 222 |
| 782 | 3300037471 | Ga0395905_0186035 | Ga0395905_0186035_1081_1749 | 222 |
| 783 | 3300037471 | Ga0395905_0204800 | Ga0395905_0204800_617_1285 | 222 |
| 784 | 3300037471 | Ga0395905_0508347 | Ga0395905_0508347_180_848 | 222 |
| 785 | 3300037471 | Ga0395905_0580452 | Ga0395905_0580452_318_986 | 222 |
| 786 | 3300037471 | Ga0395905_0590118 | Ga0395905_0590118_272_940 | 222 |
| 787 | 3300038443 | Ga0395901_0000329 | Ga0395901_0000329_49288_49956 | 222 |
| 788 | 3300038443 | Ga0395901_0022979 | Ga0395901_0022979_1046_1714 | 222 |
| 789 | 3300038443 | Ga0395901_0038552 | Ga0395901_0038552_200_868 | 222 |
| 790 | 3300038443 | Ga0395901_0039511 | Ga0395901_0039511_471_1139 | 222 |
| 791 | 3300038443 | Ga0395901_0042251 | Ga0395901_0042251_3603_4271 | 222 |
| 792 | 3300038443 | Ga0395901_0053777 | Ga0395901_0053777_558_1226 | 222 |
| 793 | 3300038443 | Ga0395901_0058872 | Ga0395901_0058872_2764_3432 | 222 |
| 794 | 3300038443 | Ga0395901_0072007 | Ga0395901_0072007_2456_3124 | 222 |
| 795 | 3300038443 | Ga0395901_0120953 | Ga0395901_0120953_1761_2429 | 222 |
| 796 | 3300038443 | Ga0395901_0136801 | Ga0395901_0136801_1737_2405 | 222 |
| 797 | 3300038443 | Ga0395901_0180313 | Ga0395901_0180313_371_1039 | 222 |
| 798 | 3300038443 | Ga0395901_0255376 | Ga0395901_0255376_617_1285 | 222 |
| 799 | 3300038443 | Ga0395901_0282993 | Ga0395901_0282993_102_770 | 222 |
| 800 | 3300038443 | Ga0395901_0362357 | Ga0395901_0362357_699_1367 | 222 |
| 801 | 3300038443 | Ga0395901_0548787 | Ga0395901_0548787_391_1059 | 222 |
| 802 | 3300038443 | Ga0395901_0577847 | Ga0395901_0577847_210_878 | 222 |
| 803 | 3300038443 | Ga0395901_0679498 | Ga0395901_0679498_337_1005 | 222 |
| 804 | 3300038443 | Ga0395901_0703211 | Ga0395901_0703211_50_718 | 222 |
| 805 | 3300039437 | Ga0436365_0693987 | Ga0436365_0693987_65_733 | 222 |
| 806 | 3300039450 | Ga0436363_0985832 | Ga0436363_0985832_42_710 | 222 |
| 807 | 3300042118 | Ga0450914_000439 | Ga0450914_000439_1113_1781 | 222 |
| 808 | 3300042127 | Ga0450890_004047 | Ga0450890_004047_1006_1674 | 222 |
| 809 | 3300042138 | Ga0450903_020219 | Ga0450903_020219_42_710 | 222 |
| 810 | 3300042144 | Ga0450889_000044 | Ga0450889_000044_8487_9155 | 222 |
| 811 | 3300042439 | Ga0439464_0002797 | Ga0439464_0002797_1881_2549 | 222 |
| 812 | 3300044656 | Ga0466969_0003047 | Ga0466969_0003047_7414_8082 | 222 |
| 813 | 3300044656 | Ga0466969_0040687 | Ga0466969_0040687_467_1135 | 222 |
| 814 | 3300044658 | Ga0466972_0024711 | Ga0466972_0024711_451_1119 | 222 |
| 815 | 3300044658 | Ga0466972_0071209 | Ga0466972_0071209_910_1578 | 222 |
| 816 | 3300044683 | Ga0466965_0161878 | Ga0466965_0161878_252_920 | 222 |
| 817 | 3300044683 | Ga0466965_0216184 | Ga0466965_0216184_171_839 | 222 |
| 818 | 3300044684 | Ga0466966_0007715 | Ga0466966_0007715_5455_6123 | 222 |
| 819 | 3300044684 | Ga0466966_0044030 | Ga0466966_0044030_1389_2057 | 222 |
| 820 | 3300044684 | Ga0466966_0255387 | Ga0466966_0255387_378_1046 | 222 |
| 821 | 3300044693 | Ga0466961_0007983 | Ga0466961_0007983_712_1380 | 222 |
| 822 | 3300044693 | Ga0466961_0063839 | Ga0466961_0063839_67_735 | 222 |
| 823 | 3300044693 | Ga0466961_0076150 | Ga0466961_0076150_1014_1682 | 222 |
| 824 | 3300044694 | Ga0466963_0004259 | Ga0466963_0004259_4673_5341 | 222 |
| 825 | 3300044694 | Ga0466963_0019600 | Ga0466963_0019600_301_969 | 222 |
| 826 | 3300044694 | Ga0466963_0023316 | Ga0466963_0023316_2184_2852 | 222 |
| 827 | 3300044694 | Ga0466963_0132080 | Ga0466963_0132080_698_1366 | 222 |
| 828 | 3300044706 | Ga0466964_0007184 | Ga0466964_0007184_3430_4098 | 222 |
| 829 | 3300044706 | Ga0466964_0150964 | Ga0466964_0150964_204_872 | 222 |
| 830 | 3300044719 | Ga0466971_0004107 | Ga0466971_0004107_438_1106 | 222 |
| 831 | 3300044719 | Ga0466971_0019803 | Ga0466971_0019803_109_777 | 222 |
| 832 | 3300044719 | Ga0466971_0024097 | Ga0466971_0024097_129_797 | 222 |
| 833 | 3300044719 | Ga0466971_0072633 | Ga0466971_0072633_598_1266 | 222 |
| 834 | 3300044735 | Ga0466968_0076791 | Ga0466968_0076791_172_840 | 222 |
| 835 | 3300044765 | Ga0466970_0020907 | Ga0466970_0020907_673_1341 | 222 |
| 836 | 3300044765 | Ga0466970_0021787 | Ga0466970_0021787_974_1642 | 222 |
| 837 | 3300044765 | Ga0466970_0136491 | Ga0466970_0136491_669_1337 | 222 |
| 838 | 3300044842 | Ga0466957_0000953 | Ga0466957_0000953_15_683 | 222 |
| 839 | 3300044842 | Ga0466957_0007678 | Ga0466957_0007678_2134_2802 | 222 |
| 840 | 3300044842 | Ga0466957_0007713 | Ga0466957_0007713_2412_3080 | 222 |
| 841 | 3300044842 | Ga0466957_0183451 | Ga0466957_0183451_416_1084 | 222 |
| 842 | 3300044842 | Ga0466957_0224685 | Ga0466957_0224685_378_1046 | 222 |
| 843 | 3300044842 | Ga0466957_0725802 | Ga0466957_0725802_20_688 | 222 |
| 844 | 3300045049 | Ga0466959_0012236 | Ga0466959_0012236_1765_2433 | 222 |
| 845 | 3300045049 | Ga0466959_0036055 | Ga0466959_0036055_882_1550 | 222 |
| 846 | 3300045049 | Ga0466959_0607179 | Ga0466959_0607179_21_689 | 222 |
| 847 | 3300045836 | Ga0466958_0000295 | Ga0466958_0000295_9495_10163 | 222 |
| 848 | 3300045836 | Ga0466958_0014596 | Ga0466958_0014596_438_1106 | 222 |
| 849 | 3300045836 | Ga0466958_0074564 | Ga0466958_0074564_1217_1885 | 222 |
| 850 | 3300045836 | Ga0466958_0122981 | Ga0466958_0122981_496_1164 | 222 |
| 851 | 3300045976 | Ga0466967_0022991 | Ga0466967_0022991_1763_2431 | 222 |
| 852 | 3300045976 | Ga0466967_0447165 | Ga0466967_0447165_56_724 | 222 |
| 853 | 3300045976 | Ga0466967_0626680 | Ga0466967_0626680_229_897 | 222 |
| 854 | 3300046460 | Ga0495638_0001274 | Ga0495638_0001274_21252_21920 | 222 |
| 855 | 3300046506 | Ga0495583_0139937 | Ga0495583_0139937_82_750 | 222 |
| 856 | 3300046513 | Ga0495616_0046374 | Ga0495616_0046374_992_1660 | 222 |
| 857 | 3300046525 | Ga0495663_0002538 | Ga0495663_0002538_1420_2088 | 222 |
| 858 | 3300046525 | Ga0495663_0188753 | Ga0495663_0188753_12_680 | 222 |
| 859 | 3300046537 | Ga0495598_0000845 | Ga0495598_0000845_3893_4561 | 222 |
| 860 | 3300046539 | Ga0495621_0001328 | Ga0495621_0001328_2718_3386 | 222 |
| 861 | 3300046558 | Ga0495633_0002984 | Ga0495633_0002984_9087_9755 | 222 |
| 862 | 3300046616 | Ga0495668_0006182 | Ga0495668_0006182_1398_2066 | 222 |
| 863 | 3300046616 | Ga0495668_0018230 | Ga0495668_0018230_2063_2731 | 222 |
| 864 | 3300046660 | Ga0495625_0000231 | Ga0495625_0000231_54255_54923 | 222 |
| 865 | 3300046665 | Ga0495661_0070681 | Ga0495661_0070681_379_1047 | 222 |
| 866 | 3300046684 | Ga0495669_0002257 | Ga0495669_0002257_6615_7283 | 222 |
| 867 | 3300046684 | Ga0495669_0003671 | Ga0495669_0003671_2019_2687 | 222 |
| 868 | 3300046684 | Ga0495669_0003927 | Ga0495669_0003927_2580_3248 | 222 |
| 869 | 3300046684 | Ga0495669_0004671 | Ga0495669_0004671_4064_4732 | 222 |
| 870 | 3300046684 | Ga0495669_0029506 | Ga0495669_0029506_531_1199 | 222 |
| 871 | 3300046684 | Ga0495669_0030479 | Ga0495669_0030479_227_895 | 222 |
| 872 | 3300046684 | Ga0495669_0044364 | Ga0495669_0044364_1145_1813 | 222 |
| 873 | 3300046691 | Ga0495670_0068840 | Ga0495670_0068840_195_863 | 222 |
| 874 | 3300047445 | Ga0495677_0004046 | Ga0495677_0004046_2147_2815 | 222 |
| 875 | 3300047445 | Ga0495677_0005059 | Ga0495677_0005059_1335_2003 | 222 |
| 876 | 3300047447 | Ga0495685_094551 | Ga0495685_094551_16_684 | 222 |
| 877 | 3300047472 | Ga0495686_0054742 | Ga0495686_0054742_192_860 | 222 |
| 878 | 3300048903 | Ga0496100_0000581 | Ga0496100_0000581_13306_13974 | 222 |
| 879 | 3300048903 | Ga0496100_0190503 | Ga0496100_0190503_42_710 | 222 |
| 880 | 3300048904 | Ga0496101_0001704 | Ga0496101_0001704_9116_9784 | 222 |
| 881 | 3300048904 | Ga0496101_0521870 | Ga0496101_0521870_169_837 | 222 |
| 882 | 3300048904 | Ga0496101_0774371 | Ga0496101_0774371_64_732 | 222 |
| 883 | 3300048905 | Ga0496102_0041388 | Ga0496102_0041388_1980_2648 | 222 |
| 884 | 3300048905 | Ga0496102_0266140 | Ga0496102_0266140_581_1249 | 222 |
| 885 | 3300048905 | Ga0496102_0753257 | Ga0496102_0753257_187_855 | 222 |
| 886 | 3300048905 | Ga0496102_0787460 | Ga0496102_0787460_186_854 | 222 |
| 887 | 3300048906 | Ga0496103_0032276 | Ga0496103_0032276_2123_2791 | 222 |
| 888 | 3300048906 | Ga0496103_0046272 | Ga0496103_0046272_1664_2332 | 222 |
| 889 | 3300048908 | Ga0496105_0012037 | Ga0496105_0012037_2986_3654 | 222 |
| 890 | 3300048908 | Ga0496105_0255429 | Ga0496105_0255429_148_816 | 222 |
| 891 | 3300048909 | Ga0496106_0077615 | Ga0496106_0077615_702_1370 | 222 |
| 892 | 3300048909 | Ga0496106_0203935 | Ga0496106_0203935_415_1083 | 222 |
| 893 | 3300048910 | Ga0496107_0002199 | Ga0496107_0002199_8621_9289 | 222 |
| 894 | 3300048910 | Ga0496107_0005092 | Ga0496107_0005092_6806_7474 | 222 |
| 895 | 3300048910 | Ga0496107_0132761 | Ga0496107_0132761_662_1330 | 222 |
| 896 | 3300048910 | Ga0496107_0675035 | Ga0496107_0675035_82_750 | 222 |
| 897 | 3300048911 | Ga0496108_0031895 | Ga0496108_0031895_1855_2523 | 222 |
| 898 | 3300048911 | Ga0496108_0089414 | Ga0496108_0089414_336_1004 | 222 |
| 899 | 3300048911 | Ga0496108_0214243 | Ga0496108_0214243_933_1601 | 222 |
| 900 | 3300048912 | Ga0496109_0023088 | Ga0496109_0023088_2164_2832 | 222 |
| 901 | 3300048912 | Ga0496109_0036533 | Ga0496109_0036533_3378_4046 | 222 |
| 902 | 3300048912 | Ga0496109_0419175 | Ga0496109_0419175_50_718 | 222 |
| 903 | 3300048913 | Ga0496110_0008123 | Ga0496110_0008123_3864_4532 | 222 |
| 904 | 3300048913 | Ga0496110_0202350 | Ga0496110_0202350_867_1535 | 222 |
| 905 | 3300048913 | Ga0496110_0214298 | Ga0496110_0214298_457_1125 | 222 |
| 906 | 3300048914 | Ga0496111_0002477 | Ga0496111_0002477_3411_4079 | 222 |
| 907 | 3300048914 | Ga0496111_0011633 | Ga0496111_0011633_2666_3334 | 222 |
| 908 | 3300048915 | Ga0496112_0313210 | Ga0496112_0313210_186_854 | 222 |
| 909 | 3300048915 | Ga0496112_0556830 | Ga0496112_0556830_241_909 | 222 |
| 910 | 3300048916 | Ga0496113_0001059 | Ga0496113_0001059_3472_4140 | 222 |
| 911 | 3300048916 | Ga0496113_0012777 | Ga0496113_0012777_2564_3232 | 222 |
| 912 | 3300048917 | Ga0496114_0000131 | Ga0496114_0000131_32610_33278 | 222 |
| 913 | 3300048917 | Ga0496114_0113894 | Ga0496114_0113894_1183_1851 | 222 |
| 914 | 3300050507 | nmdc:mga05p37_762090_c1 | nmdc:mga05p37_762090_c1_182_850 | 222 |
| 915 | 3300050511 | nmdc:mga08y16_210415_c1 | nmdc:mga08y16_210415_c1_342_1010 | 222 |
| 916 | 3300053134 | Ga0500658_0000073 | Ga0500658_0000073_42635_43303 | 222 |
| 917 | 3300053134 | Ga0500658_0001099 | Ga0500658_0001099_738_1406 | 222 |
| 918 | 3300053730 | Ga0500645_001583 | Ga0500645_001583_1137_1805 | 222 |
| 919 | 3300061719 | Ga0466962_0012879 | Ga0466962_0012879_500_1168 | 222 |
| 920 | 3300061719 | Ga0466962_0016754 | Ga0466962_0016754_2206_2874 | 222 |
| 921 | 3300061719 | Ga0466962_0229622 | Ga0466962_0229622_122_790 | 222 |
| 922 | 3300061719 | Ga0466962_0284212 | Ga0466962_0284212_56_724 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mp4-assembly1.cif.gz_B | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8949 | 2 | 208 |
| 4mp4-assembly2.cif.gz_C-2 | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8698 | 2 | 206 |
| 3bby-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution | 0.859 | 2 | 206 |
| 4isd-assembly2.cif.gz_C | crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione | 0.8531 | 2 | 209 |
| 4mp4-assembly1.cif.gz_B | crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure | 0.8518 | 2 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bbyA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.89 | 2 | 81 | 3.40.30.10 |
| 4mp4C02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.8443 | 87 | 195 | 1.20.1050.10 |
| 4mp4A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8357 | 2 | 81 | 3.40.30.10 |
| af_P77544_4_214_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8319 | 2 | 208 | 3.40.50.720 |
| 3bbyA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8268 | 2 | 81 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2L7A1-F1-model_v4 | Glutathione S-transferase | 0.9667 | 64 | 210 |
GO:0016740
|
| AF-G6FUG4-F1-model_v4 | Glutathione S-transferase domain-containing protein | 0.961 | 117 | 216 |
GO:0016740
|
| AF-A0A529ZU36-F1-model_v4 | deleted | 0.9607 | 59 | 213 |
|
| AF-A0A436C5A2-F1-model_v4 | Glutathione S-transferase | 0.9568 | 75 | 213 |
GO:0016740
|
| AF-A0A090N6Z3-F1-model_v4 | Glutathione S-transferase | 0.9565 | 105 | 218 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar