F485649

General Info

Members Datasets Scaffolds Average Seq Length
917 337 1834 146

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0161658|Ga0495669_0161658_18_527
Length 169
Sequence VSGFSRTVIDKRPVIRTVEGSSMATFERHVDVDWQGSVMEGKGEMKAGTGAFSLPVTFPSRVGESGGKTSPEELMAAAHAACFAMALNGTIGRTEGVSVDRTVVRATITADKGEAGIKIQSSKLEVTAYGLKGADAAKFTEIAKLAEGRCPVSNAYRGTMQISVEAKVA

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
231 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
234 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
235 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
236 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
237 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
240 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
241 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
283 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
284 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
312 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
313 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
318 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 2.73
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 18.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0161658 3300046684 Bacteria 1063
2 Ga0065712_10080688 3300005290 Bacteria 3078
3 Ga0065712_10390511 3300005290 Bacteria 724
4 Ga0065715_10343969 3300005293 Unclassified 962
5 Ga0065715_10433142 3300005293 Bacteria 836
6 Ga0065707_10484059 3300005295 Unclassified 771
7 Ga0065707_10668308 3300005295 Bacteria 654
8 Ga0070676_10385717 3300005328 Bacteria 971
9 Ga0070676_11100544 3300005328 Unclassified 600
10 Ga0070683_100994745 3300005329 Bacteria 805
11 Ga0070690_100057181 3300005330 Bacteria 2503
12 Ga0070690_100176833 3300005330 Bacteria 1473
13 Ga0070690_100947796 3300005330 Bacteria 676
14 Ga0070670_100016649 3300005331 Bacteria 6310
15 Ga0070670_100194562 3300005331 Bacteria 1761
16 Ga0070670_100682458 3300005331 Bacteria 923
17 Ga0068869_100120487 3300005334 Bacteria 2006
18 Ga0068869_101306493 3300005334 Unclassified 640
19 Ga0070666_10006154 3300005335 Bacteria 7378
20 Ga0070666_10169179 3300005335 Unclassified 1530
21 Ga0070680_100036932 3300005336 Bacteria 3947
22 Ga0070682_100920353 3300005337 Bacteria 720
23 Ga0068868_100294086 3300005338 Bacteria 1378
24 Ga0068868_100373406 3300005338 Bacteria 1226
25 Ga0068868_100489855 3300005338 Bacteria 1075
26 Ga0068868_102110978 3300005338 Unclassified 536
27 Ga0070660_100020483 3300005339 Bacteria 4861
28 Ga0070660_100653073 3300005339 Bacteria 881
29 Ga0070689_100268391 3300005340 Bacteria 1412
30 Ga0070689_101127955 3300005340 Unclassified 702
31 Ga0070691_10069805 3300005341 Bacteria 1704
32 Ga0070687_100106033 3300005343 Bacteria 1582
33 Ga0070687_100239949 3300005343 Bacteria 1120
34 Ga0070687_100291792 3300005343 Unclassified 1031
35 Ga0070661_100780735 3300005344 Bacteria 783
36 Ga0070661_100881836 3300005344 Unclassified 738
37 Ga0070692_11287988 3300005345 Unclassified 524
38 Ga0070668_100121665 3300005347 Bacteria 2087
39 Ga0070668_100199830 3300005347 Bacteria 1641
40 Ga0070668_101918509 3300005347 Unclassified 546
41 Ga0070669_100161278 3300005353 Bacteria 1742
42 Ga0070669_100251455 3300005353 Bacteria 1407
43 Ga0070669_100316193 3300005353 Bacteria 1260
44 Ga0070669_101413726 3300005353 Unclassified 604
45 Ga0070675_100196015 3300005354 Bacteria 1752
46 Ga0070675_100425315 3300005354 Unclassified 1188
47 Ga0070675_100466649 3300005354 Bacteria 1134
48 Ga0070675_100990173 3300005354 Bacteria 772
49 Ga0070671_100124867 3300005355 Bacteria 2166
50 Ga0070671_100305290 3300005355 Bacteria 1355
51 Ga0070671_100985605 3300005355 Unclassified 738
52 Ga0070674_100296362 3300005356 Bacteria 1288
53 Ga0070674_101401304 3300005356 Unclassified 626
54 Ga0070674_102187615 3300005356 Bacteria 505
55 Ga0070673_100060277 3300005364 Bacteria 3006
56 Ga0070673_100221840 3300005364 Bacteria 1636
57 Ga0070673_100594632 3300005364 Bacteria 1009
58 Ga0070688_100057613 3300005365 Bacteria 2443
59 Ga0070688_100112049 3300005365 Bacteria 1816
60 Ga0070688_100189223 3300005365 Bacteria 1433
61 Ga0070688_100201418 3300005365 Archaea 1393
62 Ga0070659_100274326 3300005366 Bacteria 1402
63 Ga0070659_100420160 3300005366 Bacteria 1131
64 Ga0070667_100044788 3300005367 Bacteria 3717
65 Ga0070703_10113755 3300005406 Bacteria 972
66 Ga0070709_10030288 3300005434 Bacteria 3246
67 Ga0070709_10618138 3300005434 Bacteria 836
68 Ga0070709_11120277 3300005434 Unclassified 630
69 Ga0070714_101713372 3300005435 Unclassified 614
70 Ga0070713_102221729 3300005436 Unclassified 531
71 Ga0070701_10634733 3300005438 Bacteria 711
72 Ga0070711_101699652 3300005439 Unclassified 553
73 Ga0070705_100490917 3300005440 Bacteria 930
74 Ga0070705_101513316 3300005440 Bacteria 562
75 Ga0070700_100084253 3300005441 Bacteria 2060
76 Ga0070700_100153113 3300005441 Bacteria 1579
77 Ga0070694_100006907 3300005444 Bacteria 6898
78 Ga0070694_100027093 3300005444 Bacteria 3720
79 Ga0070694_100055531 3300005444 Bacteria 2686
80 Ga0070694_100076897 3300005444 Bacteria 2312
81 Ga0070694_100295277 3300005444 Bacteria 1240
82 Ga0070694_101150038 3300005444 Bacteria 649
83 Ga0070694_101409982 3300005444 Bacteria 588
84 Ga0070708_100024164 3300005445 Bacteria 5177
85 Ga0070708_100275681 3300005445 Bacteria 1582
86 Ga0070708_101348297 3300005445 Bacteria 666
87 Ga0070708_101610760 3300005445 Unclassified 604
88 Ga0070663_101729392 3300005455 Bacteria 560
89 Ga0070678_100299378 3300005456 Bacteria 1366
90 Ga0070678_100542180 3300005456 Bacteria 1032
91 Ga0070662_100054625 3300005457 Bacteria 2895
92 Ga0070662_101421062 3300005457 Unclassified 598
93 Ga0070681_10104291 3300005458 Bacteria 2778
94 Ga0070681_11017450 3300005458 Bacteria 749
95 Ga0070681_11199606 3300005458 Bacteria 681
96 Ga0070681_11676954 3300005458 Bacteria 562
97 Ga0068867_100022772 3300005459 Bacteria 4482
98 Ga0068867_100263016 3300005459 Bacteria 1407
99 Ga0068867_100388858 3300005459 Bacteria 1173
100 Ga0070706_100903305 3300005467 Bacteria 816
101 Ga0070706_101858340 3300005467 Bacteria 547
102 Ga0070707_100145499 3300005468 Bacteria 2307
103 Ga0070707_100148533 3300005468 Bacteria 2282
104 Ga0070707_100150031 3300005468 Bacteria 2270
105 Ga0070707_100161802 3300005468 Unclassified 2181
106 Ga0070707_100170834 3300005468 Unclassified 2119
107 Ga0070707_100469095 3300005468 Bacteria 1220
108 Ga0070698_100100821 3300005471 Bacteria 2860
109 Ga0070698_100128212 3300005471 Bacteria 2494
110 Ga0070698_100329084 3300005471 Bacteria 1459
111 Ga0070698_101045886 3300005471 Unclassified 764
112 Ga0070698_101059530 3300005471 Bacteria 759
113 Ga0070699_100023260 3300005518 Bacteria 5337
114 Ga0070699_101556152 3300005518 Bacteria 606
115 Ga0070679_100039009 3300005530 Unclassified 4722
116 Ga0070679_100251202 3300005530 Bacteria 1725
117 Ga0070684_100975912 3300005535 Unclassified 795
118 Ga0070697_100000287 3300005536 Bacteria 40901
119 Ga0070697_100014842 3300005536 Bacteria 6113
120 Ga0070697_100049495 3300005536 Bacteria 3411
121 Ga0070697_100396455 3300005536 Bacteria 1197
122 Ga0070697_101072292 3300005536 Bacteria 717
123 Ga0070697_101327513 3300005536 Unclassified 642
124 Ga0070672_100039415 3300005543 Bacteria 3619
125 Ga0070672_100113147 3300005543 Bacteria 2215
126 Ga0070672_101864169 3300005543 Bacteria 541
127 Ga0070686_100019422 3300005544 Bacteria 4004
128 Ga0070686_100108334 3300005544 Bacteria 1888
129 Ga0070686_100233464 3300005544 Bacteria 1335
130 Ga0070686_101368639 3300005544 Bacteria 593
131 Ga0070695_100342842 3300005545 Bacteria 1117
132 Ga0070695_100351902 3300005545 Bacteria 1104
133 Ga0070695_101564136 3300005545 Bacteria 550
134 Ga0070696_100033440 3300005546 Bacteria 3533
135 Ga0070696_101698076 3300005546 Bacteria 544
136 Ga0070693_100737649 3300005547 Bacteria 725
137 Ga0070665_100005812 3300005548 Bacteria 12653
138 Ga0070665_100033864 3300005548 Bacteria 5139
139 Ga0070665_100126214 3300005548 Bacteria 2561
140 Ga0070665_100850968 3300005548 Bacteria 925
141 Ga0070704_100027089 3300005549 Bacteria 3796
142 Ga0070704_100031294 3300005549 Bacteria 3577
143 Ga0070704_100056214 3300005549 Bacteria 2794
144 Ga0070704_100113976 3300005549 Bacteria 2062
145 Ga0070704_101892713 3300005549 Bacteria 553
146 Ga0068855_100068396 3300005563 Bacteria 4135
147 Ga0068855_100343705 3300005563 Unclassified 1645
148 Ga0068855_100509671 3300005563 Bacteria 1306
149 Ga0070664_100299963 3300005564 Bacteria 1452
150 Ga0070664_100341781 3300005564 Bacteria 1360
151 Ga0070664_101441837 3300005564 Bacteria 651
152 Ga0068854_100015949 3300005578 Bacteria 4995
153 Ga0068854_100076283 3300005578 Bacteria 2463
154 Ga0068854_100537894 3300005578 Unclassified 989
155 Ga0068854_100611319 3300005578 Bacteria 932
156 Ga0068854_100769400 3300005578 Unclassified 837
157 Ga0070702_100049940 3300005615 Bacteria 2387
158 Ga0070702_100716946 3300005615 Unclassified 764
159 Ga0070702_100822674 3300005615 Bacteria 720
160 Ga0070702_101414581 3300005615 Bacteria 569
161 Ga0068852_100392312 3300005616 Unclassified 1364
162 Ga0068852_100550580 3300005616 Bacteria 1154
163 Ga0068859_100102035 3300005617 Bacteria 2926
164 Ga0068859_100162042 3300005617 Bacteria 2316
165 Ga0068859_100418190 3300005617 Unclassified 1437
166 Ga0068864_100058932 3300005618 Bacteria 3320
167 Ga0068864_100095441 3300005618 Bacteria 2630
168 Ga0068864_100321565 3300005618 Unclassified 1453
169 Ga0068864_101450038 3300005618 Unclassified 689
170 Ga0068866_10303757 3300005718 Unclassified 998
171 Ga0068866_10388305 3300005718 Unclassified 897
172 Ga0068861_100014767 3300005719 Bacteria 5487
173 Ga0068861_100037222 3300005719 Bacteria 3617
174 Ga0068861_100135965 3300005719 Unclassified 2000
175 Ga0068861_100236741 3300005719 Bacteria 1551
176 Ga0068861_100324607 3300005719 Bacteria 1342
177 Ga0068851_10201425 3300005834 Bacteria 1111
178 Ga0068863_100045648 3300005841 Bacteria 4158
179 Ga0068863_100222386 3300005841 Bacteria 1819
180 Ga0068863_100448164 3300005841 Unclassified 1267
181 Ga0068863_101073520 3300005841 Unclassified 809
182 Ga0068858_100014560 3300005842 Bacteria 7411
183 Ga0068858_100203000 3300005842 Bacteria 1875
184 Ga0068858_100433799 3300005842 Bacteria 1265
185 Ga0068858_100681720 3300005842 Bacteria 999
186 Ga0068858_100861955 3300005842 Unclassified 885
187 Ga0068860_100030451 3300005843 Bacteria 5191
188 Ga0068860_100162630 3300005843 Bacteria 2153
189 Ga0068860_100431523 3300005843 Bacteria 1308
190 Ga0068860_100459364 3300005843 Unclassified 1267
191 Ga0068860_100716834 3300005843 Unclassified 1011
192 Ga0068860_100737431 3300005843 Bacteria 996
193 Ga0068860_101194682 3300005843 Unclassified 781
194 Ga0068860_101254422 3300005843 Unclassified 762
195 Ga0068860_101714412 3300005843 Unclassified 650
196 Ga0068862_100016477 3300005844 Bacteria 6151
197 Ga0068862_100098393 3300005844 Bacteria 2555
198 Ga0068862_100126103 3300005844 Bacteria 2260
199 Ga0068862_100642337 3300005844 Unclassified 1023
200 Ga0068862_100792207 3300005844 Bacteria 925
201 Ga0068862_100843455 3300005844 Bacteria 898
202 Ga0081455_10320273 3300005937 Unclassified 1105
203 Ga0081539_10353069 3300005985 Unclassified 618
204 Ga0075365_10385297 3300006038 Bacteria 989
205 Ga0075364_10267693 3300006051 Bacteria 1162
206 Ga0075432_10105288 3300006058 Bacteria 1046
207 Ga0070716_101098916 3300006173 Bacteria 634
208 Ga0097621_100065500 3300006237 Bacteria 2990
209 Ga0068871_100074640 3300006358 Unclassified 2798
210 Ga0068871_100142650 3300006358 Bacteria 2038
211 Ga0068871_100872846 3300006358 Bacteria 833
212 Ga0068871_101024048 3300006358 Bacteria 770
213 Ga0075428_100020634 3300006844 Bacteria 7296
214 Ga0075428_100208036 3300006844 Bacteria 2115
215 Ga0075428_100344296 3300006844 Unclassified 1600
216 Ga0075430_100037749 3300006846 Bacteria 4094
217 Ga0075430_100056915 3300006846 Bacteria 3288
218 Ga0075430_100090887 3300006846 Unclassified 2553
219 Ga0075431_100031010 3300006847 Bacteria 5506
220 Ga0075431_100055777 3300006847 Bacteria 4076
221 Ga0075431_100078042 3300006847 Bacteria 3418
222 Ga0075431_100129554 3300006847 Bacteria 2603
223 Ga0075431_101719463 3300006847 Bacteria 584
224 Ga0075433_10083124 3300006852 Bacteria 2825
225 Ga0075433_10351015 3300006852 Bacteria 1304
226 Ga0075433_10885801 3300006852 Bacteria 779
227 Ga0075433_11154991 3300006852 Bacteria 673
228 Ga0075433_11380062 3300006852 Bacteria 610
229 Ga0075433_11859160 3300006852 Unclassified 517
230 Ga0075434_100004883 3300006871 Bacteria 12148
231 Ga0075434_100041061 3300006871 Bacteria 4582
232 Ga0075434_100052908 3300006871 Bacteria 4035
233 Ga0075434_100133301 3300006871 Bacteria 2504
234 Ga0075434_100199855 3300006871 Bacteria 2019
235 Ga0075434_100386825 3300006871 Unclassified 1420
236 Ga0075434_100493577 3300006871 Bacteria 1245
237 Ga0075434_101177411 3300006871 Unclassified 779
238 Ga0075429_100022744 3300006880 Bacteria 5435
239 Ga0075429_100629303 3300006880 Bacteria 940
240 Ga0075429_101719649 3300006880 Unclassified 545
241 Ga0068865_100989635 3300006881 Bacteria 736
242 Ga0075436_100005353 3300006914 Bacteria 8832
243 Ga0075436_100015139 3300006914 Bacteria 5286
244 Ga0075436_100031878 3300006914 Bacteria 3631
245 Ga0075436_100097631 3300006914 Bacteria 2044
246 Ga0075436_100104236 3300006914 Bacteria 1977
247 Ga0075436_100138067 3300006914 Bacteria 1712
248 Ga0097620_100102036 3300006931 Bacteria 2926
249 Ga0097620_100162037 3300006931 Bacteria 2316
250 Ga0097620_100418191 3300006931 Unclassified 1437
251 Ga0075435_100002536 3300007076 Bacteria 12156
252 Ga0075435_100013141 3300007076 Bacteria 6150
253 Ga0075435_100026465 3300007076 Bacteria 4526
254 Ga0075435_100104211 3300007076 Bacteria 2353
255 Ga0075435_100106701 3300007076 Bacteria 2326
256 Ga0075435_100291338 3300007076 Bacteria 1395
257 Ga0075435_100434598 3300007076 Bacteria 1131
258 Ga0075435_100515180 3300007076 Bacteria 1035
259 Ga0075435_100642789 3300007076 Bacteria 921
260 Ga0099794_10074863 3300007265 Bacteria 1663
261 Ga0099795_10327605 3300007788 Unclassified 680
262 Ga0105251_10317427 3300009011 Bacteria 708
263 Ga0105240_10138519 3300009093 Bacteria 2912
264 Ga0105240_10394191 3300009093 Unclassified 1561
265 Ga0105240_10628974 3300009093 Unclassified 1179
266 Ga0105240_11264593 3300009093 Bacteria 779
267 Ga0105240_11305828 3300009093 Unclassified 765
268 Ga0111539_10021902 3300009094 Bacteria 7856
269 Ga0111539_10079589 3300009094 Unclassified 3855
270 Ga0111539_10129233 3300009094 Unclassified 2958
271 Ga0111539_10183174 3300009094 Bacteria 2446
272 Ga0111539_10217213 3300009094 Bacteria 2227
273 Ga0111539_10267857 3300009094 Bacteria 1989
274 Ga0111539_10346964 3300009094 Bacteria 1728
275 Ga0111539_10384234 3300009094 Unclassified 1635
276 Ga0105245_10113275 3300009098 Bacteria 2525
277 Ga0105245_10687364 3300009098 Bacteria 1056
278 Ga0105245_11851525 3300009098 Bacteria 656
279 Ga0105247_10064393 3300009101 Bacteria 2277
280 Ga0105247_10623130 3300009101 Bacteria 803
281 Ga0105247_11209354 3300009101 Bacteria 602
282 Ga0114129_10004437 3300009147 Bacteria 19799
283 Ga0114129_10004847 3300009147 Bacteria 18997
284 Ga0114129_10010525 3300009147 Bacteria 13192
285 Ga0114129_10037891 3300009147 Bacteria 6803
286 Ga0114129_10041262 3300009147 Bacteria 6503
287 Ga0114129_10041707 3300009147 Bacteria 6464
288 Ga0114129_10065086 3300009147 Bacteria 5088
289 Ga0114129_10095713 3300009147 Bacteria 4112
290 Ga0114129_10135656 3300009147 Bacteria 3377
291 Ga0114129_10145460 3300009147 Bacteria 3247
292 Ga0114129_10200781 3300009147 Bacteria 2701
293 Ga0114129_10231287 3300009147 Unclassified 2490
294 Ga0114129_10370916 3300009147 Bacteria 1892
295 Ga0114129_10525271 3300009147 Bacteria 1543
296 Ga0114129_10599102 3300009147 Bacteria 1428
297 Ga0114129_10768553 3300009147 Bacteria 1232
298 Ga0114129_11150799 3300009147 Bacteria 969
299 Ga0114129_13385713 3300009147 Unclassified 513
300 Ga0105243_10060076 3300009148 Bacteria 3036
301 Ga0105243_10555956 3300009148 Unclassified 1097
302 Ga0105243_12166600 3300009148 Bacteria 592
303 Ga0105243_12251007 3300009148 Unclassified 582
304 Ga0105241_10125955 3300009174 Bacteria 2068
305 Ga0105242_10027112 3300009176 Bacteria 4546
306 Ga0105242_10321797 3300009176 Bacteria 1419
307 Ga0105242_10587736 3300009176 Bacteria 1073
308 Ga0105248_10023438 3300009177 Bacteria 6857
309 Ga0105248_10141138 3300009177 Bacteria 2717
310 Ga0105248_10164341 3300009177 Bacteria 2503
311 Ga0105248_10191555 3300009177 Bacteria 2304
312 Ga0105248_10584101 3300009177 Unclassified 1260
313 Ga0105248_10790418 3300009177 Bacteria 1071
314 Ga0105248_10931569 3300009177 Bacteria 981
315 Ga0105248_10964065 3300009177 Bacteria 963
316 Ga0105248_11343632 3300009177 Bacteria 808
317 Ga0105237_12777002 3300009545 Bacteria 501
318 Ga0105238_10127333 3300009551 Bacteria 2525
319 Ga0105238_10855818 3300009551 Bacteria 926
320 Ga0105238_11191531 3300009551 Bacteria 786
321 Ga0105249_10093169 3300009553 Bacteria 2821
322 Ga0105249_10266111 3300009553 Bacteria 1706
323 Ga0105249_10534881 3300009553 Bacteria 1221
324 Ga0105249_10994671 3300009553 Bacteria 907
325 Ga0105249_11500336 3300009553 Bacteria 746
326 Ga0105249_11612462 3300009553 Bacteria 721
327 Ga0105239_11139192 3300010375 Bacteria 898
328 Ga0105246_10349537 3300011119 Bacteria 1211
329 Ga0157315_1031929 3300012508 Unclassified 623
330 Ga0157374_10098541 3300013296 Unclassified 2799
331 Ga0157374_10934958 3300013296 Bacteria 885
332 Ga0157374_11284156 3300013296 Bacteria 754
333 Ga0163162_10108751 3300013306 Bacteria 2869
334 Ga0163162_10446068 3300013306 Bacteria 1426
335 Ga0163162_11241189 3300013306 Bacteria 846
336 Ga0163162_11410541 3300013306 Bacteria 792
337 Ga0163162_12270568 3300013306 Unclassified 623
338 Ga0157372_11777784 3300013307 Bacteria 709
339 Ga0157375_10078151 3300013308 Bacteria 3341
340 Ga0157375_10141069 3300013308 Bacteria 2537
341 Ga0157375_10934317 3300013308 Bacteria 1010
342 Ga0157375_11621921 3300013308 Bacteria 765
343 Ga0163163_10000663 3300014325 Bacteria 29504
344 Ga0163163_10169006 3300014325 Unclassified 2233
345 Ga0163163_12476043 3300014325 Bacteria 577
346 Ga0157380_10129531 3300014326 Unclassified 2150
347 Ga0157380_10222388 3300014326 Bacteria 1690
348 Ga0157380_10384505 3300014326 Unclassified 1326
349 Ga0157380_10699769 3300014326 Bacteria 1018
350 Ga0157380_10722105 3300014326 Bacteria 1004
351 Ga0157380_12214425 3300014326 Bacteria 614
352 Ga0157377_10151823 3300014745 Unclassified 1433
353 Ga0157377_11089909 3300014745 Unclassified 611
354 Ga0157377_11099212 3300014745 Bacteria 609
355 Ga0157379_10018789 3300014968 Bacteria 6095
356 Ga0157379_10051345 3300014968 Bacteria 3683
357 Ga0157379_10477832 3300014968 Bacteria 1153
358 Ga0157379_11092815 3300014968 Unclassified 763
359 Ga0157379_11250470 3300014968 Unclassified 715
360 Ga0157379_11876865 3300014968 Bacteria 590
361 Ga0157379_12314570 3300014968 Bacteria 535
362 Ga0157376_10088262 3300014969 Unclassified 2678
363 Ga0157376_10102217 3300014969 Bacteria 2507
364 Ga0157376_10159846 3300014969 Bacteria 2041
365 Ga0157376_11071355 3300014969 Unclassified 831
366 Ga0163161_10906207 3300017792 Bacteria 747
367 Ga0207713_1261664 3300025735 Unclassified 506
368 Ga0207682_10171683 3300025893 Bacteria 987
369 Ga0207642_10015468 3300025899 Bacteria 2844
370 Ga0207642_10641363 3300025899 Unclassified 665
371 Ga0207642_10748969 3300025899 Bacteria 618
372 Ga0207710_10165306 3300025900 Unclassified 1080
373 Ga0207710_10731865 3300025900 Bacteria 519
374 Ga0207688_10378266 3300025901 Bacteria 876
375 Ga0207680_10155852 3300025903 Unclassified 1527
376 Ga0207680_10601286 3300025903 Bacteria 787
377 Ga0207699_10060562 3300025906 Bacteria 2274
378 Ga0207645_10037150 3300025907 Bacteria 3127
379 Ga0207645_10151125 3300025907 Bacteria 1516
380 Ga0207645_10245287 3300025907 Bacteria 1184
381 Ga0207645_10422405 3300025907 Unclassified 898
382 Ga0207645_10443553 3300025907 Bacteria 876
383 Ga0207684_10491220 3300025910 Bacteria 1053
384 Ga0207684_10851209 3300025910 Bacteria 769
385 Ga0207684_11018616 3300025910 Bacteria 692
386 Ga0207654_10044000 3300025911 Bacteria 2533
387 Ga0207707_10081324 3300025912 Bacteria 2828
388 Ga0207707_10219012 3300025912 Bacteria 1657
389 Ga0207707_11240097 3300025912 Bacteria 602
390 Ga0207695_11173073 3300025913 Unclassified 648
391 Ga0207693_10679459 3300025915 Bacteria 799
392 Ga0207660_10897599 3300025917 Bacteria 723
393 Ga0207662_10008810 3300025918 Bacteria 5536
394 Ga0207662_10264783 3300025918 Bacteria 1133
395 Ga0207662_10654889 3300025918 Bacteria 734
396 Ga0207657_10021131 3300025919 Bacteria 6133
397 Ga0207657_10741055 3300025919 Bacteria 762
398 Ga0207649_10262291 3300025920 Bacteria 1249
399 Ga0207649_10926906 3300025920 Bacteria 684
400 Ga0207652_10233657 3300025921 Bacteria 1657
401 Ga0207652_10383600 3300025921 Bacteria 1268
402 Ga0207652_11017612 3300025921 Bacteria 728
403 Ga0207646_10056722 3300025922 Bacteria 3500
404 Ga0207646_10137876 3300025922 Bacteria 2197
405 Ga0207646_10157754 3300025922 Bacteria 2047
406 Ga0207646_10197050 3300025922 Unclassified 1819
407 Ga0207646_10278287 3300025922 Bacteria 1512
408 Ga0207646_10511141 3300025922 Unclassified 1082
409 Ga0207681_10007101 3300025923 Bacteria 6867
410 Ga0207681_10144827 3300025923 Bacteria 1774
411 Ga0207681_10401161 3300025923 Unclassified 1108
412 Ga0207681_11236059 3300025923 Bacteria 627
413 Ga0207694_10329592 3300025924 Unclassified 1261
414 Ga0207650_10123928 3300025925 Bacteria 2015
415 Ga0207650_10299691 3300025925 Bacteria 1312
416 Ga0207650_10303436 3300025925 Bacteria 1304
417 Ga0207659_10479177 3300025926 Bacteria 1051
418 Ga0207687_10201151 3300025927 Bacteria 1557
419 Ga0207687_10454110 3300025927 Bacteria 1063
420 Ga0207644_10041596 3300025931 Bacteria 3252
421 Ga0207644_10059963 3300025931 Bacteria 2753
422 Ga0207690_11340359 3300025932 Bacteria 598
423 Ga0207706_10082624 3300025933 Bacteria 2824
424 Ga0207706_10272567 3300025933 Bacteria 1477
425 Ga0207706_10289855 3300025933 Bacteria 1427
426 Ga0207706_11122095 3300025933 Bacteria 656
427 Ga0207686_10095684 3300025934 Unclassified 1971
428 Ga0207686_10334106 3300025934 Bacteria 1136
429 Ga0207709_10083631 3300025935 Bacteria 2064
430 Ga0207670_10070752 3300025936 Bacteria 2411
431 Ga0207670_10255284 3300025936 Unclassified 1357
432 Ga0207670_10533663 3300025936 Bacteria 957
433 Ga0207670_11188204 3300025936 Bacteria 645
434 Ga0207669_10880177 3300025937 Bacteria 747
435 Ga0207669_11734937 3300025937 Bacteria 533
436 Ga0207704_10512437 3300025938 Unclassified 969
437 Ga0207704_11075681 3300025938 Bacteria 683
438 Ga0207665_10528509 3300025939 Bacteria 914
439 Ga0207691_10039547 3300025940 Bacteria 4363
440 Ga0207691_10095469 3300025940 Bacteria 2659
441 Ga0207691_10429760 3300025940 Bacteria 1125
442 Ga0207691_10531157 3300025940 Bacteria 998
443 Ga0207691_10582852 3300025940 Bacteria 947
444 Ga0207711_10263820 3300025941 Bacteria 1584
445 Ga0207711_10522146 3300025941 Bacteria 1107
446 Ga0207711_10872351 3300025941 Bacteria 837
447 Ga0207711_10941906 3300025941 Bacteria 802
448 Ga0207711_11001821 3300025941 Bacteria 775
449 Ga0207711_11286843 3300025941 Bacteria 673
450 Ga0207711_11462651 3300025941 Bacteria 626
451 Ga0207711_11768538 3300025941 Unclassified 561
452 Ga0207689_10074042 3300025942 Bacteria 2798
453 Ga0207689_10087620 3300025942 Bacteria 2557
454 Ga0207689_10360223 3300025942 Bacteria 1209
455 Ga0207689_11162604 3300025942 Unclassified 650
456 Ga0207661_10304359 3300025944 Unclassified 1430
457 Ga0207679_10951445 3300025945 Unclassified 787
458 Ga0207667_10976910 3300025949 Bacteria 835
459 Ga0207651_10016889 3300025960 Bacteria 4293
460 Ga0207651_10071319 3300025960 Bacteria 2462
461 Ga0207651_10297465 3300025960 Bacteria 1341
462 Ga0207651_10324067 3300025960 Bacteria 1289
463 Ga0207651_10424315 3300025960 Bacteria 1136
464 Ga0207651_11025642 3300025960 Bacteria 738
465 Ga0207668_10492455 3300025972 Unclassified 1053
466 Ga0207668_10747420 3300025972 Bacteria 863
467 Ga0207640_10044246 3300025981 Bacteria 2851
468 Ga0207640_10454299 3300025981 Bacteria 1056
469 Ga0207658_10340858 3300025986 Bacteria 1303
470 Ga0207677_10070634 3300026023 Bacteria 2462
471 Ga0207677_11422477 3300026023 Bacteria 639
472 Ga0207703_10039094 3300026035 Bacteria 3790
473 Ga0207703_10107517 3300026035 Bacteria 2374
474 Ga0207703_10119069 3300026035 Bacteria 2264
475 Ga0207703_10142345 3300026035 Bacteria 2083
476 Ga0207703_10277340 3300026035 Unclassified 1521
477 Ga0207703_10783321 3300026035 Unclassified 910
478 Ga0207703_11608998 3300026035 Bacteria 625
479 Ga0207708_10018869 3300026075 Bacteria 5194
480 Ga0207708_10082808 3300026075 Bacteria 2467
481 Ga0207708_10367040 3300026075 Bacteria 1184
482 Ga0207708_10954945 3300026075 Unclassified 744
483 Ga0207708_11244354 3300026075 Unclassified 651
484 Ga0207708_11375557 3300026075 Bacteria 619
485 Ga0207641_10000431 3300026088 Bacteria 48383
486 Ga0207641_10201145 3300026088 Bacteria 1837
487 Ga0207641_10450155 3300026088 Unclassified 1244
488 Ga0207648_10043260 3300026089 Bacteria 3954
489 Ga0207648_10100246 3300026089 Bacteria 2537
490 Ga0207676_10022200 3300026095 Bacteria 4666
491 Ga0207676_10535681 3300026095 Viruses 1117
492 Ga0207676_10665738 3300026095 Bacteria 1006
493 Ga0207676_11898432 3300026095 Bacteria 594
494 Ga0207674_10521180 3300026116 Unclassified 1148
495 Ga0207674_11470672 3300026116 Bacteria 650
496 Ga0207675_100026246 3300026118 Bacteria 5423
497 Ga0207675_100037661 3300026118 Bacteria 4512
498 Ga0207675_100109441 3300026118 Bacteria 2607
499 Ga0207675_100115450 3300026118 Bacteria 2537
500 Ga0207675_100184447 3300026118 Bacteria 1999
501 Ga0207675_100315472 3300026118 Bacteria 1525
502 Ga0207683_10211428 3300026121 Bacteria 1766
503 Ga0207683_10222823 3300026121 Bacteria 1718
504 Ga0207683_11527115 3300026121 Unclassified 617
505 Ga0207698_10296474 3300026142 Bacteria 1503
506 Ga0207698_10476764 3300026142 Bacteria 1210
507 Ga0207698_11943344 3300026142 Bacteria 603
508 Ga0207428_10006669 3300027907 Bacteria 10602
509 Ga0207428_10046768 3300027907 Unclassified 3478
510 Ga0207428_10053521 3300027907 Unclassified 3218
511 Ga0207428_10172414 3300027907 Bacteria 1638
512 Ga0207428_10193579 3300027907 Unclassified 1532
513 Ga0207428_10274758 3300027907 Unclassified 1252
514 Ga0268266_10027732 3300028379 Bacteria 4815
515 Ga0268266_10228278 3300028379 Bacteria 1714
516 Ga0268265_10182162 3300028380 Bacteria 1806
517 Ga0268265_11863491 3300028380 Bacteria 608
518 Ga0268264_10130727 3300028381 Bacteria 2225
519 Ga0268264_10208354 3300028381 Bacteria 1793
520 Ga0268264_10357685 3300028381 Bacteria 1392
521 Ga0268264_10476959 3300028381 Bacteria 1213
522 Ga0268264_10794985 3300028381 Bacteria 945
523 Ga0268264_11238967 3300028381 Unclassified 756
524 Ga0268264_11245988 3300028381 Unclassified 754
525 Ga0268264_11387462 3300028381 Unclassified 713
526 Ga0265316_10640197 3300031344 Bacteria 752
527 Ga0307513_10286160 3300031456 Bacteria 1423
528 Ga0307408_100005415 3300031548 Bacteria 8543
529 Ga0307408_100006703 3300031548 Bacteria 7639
530 Ga0307408_100023003 3300031548 Bacteria 4241
531 Ga0307408_100609781 3300031548 Unclassified 971
532 Ga0307408_101063457 3300031548 Unclassified 749
533 Ga0307408_101215187 3300031548 Bacteria 704
534 Ga0307408_101530590 3300031548 Bacteria 632
535 Ga0265314_10032573 3300031711 Bacteria 3833
536 Ga0307516_10044102 3300031730 Bacteria 4415
537 Ga0307405_10002286 3300031731 Bacteria 8394
538 Ga0307405_10011491 3300031731 Bacteria 4645
539 Ga0307405_10203012 3300031731 Bacteria 1441
540 Ga0307405_10320742 3300031731 Bacteria 1183
541 Ga0307405_11125674 3300031731 Unclassified 676
542 Ga0307413_10015804 3300031824 Bacteria 3878
543 Ga0307413_10670535 3300031824 Bacteria 858
544 Ga0307413_10775848 3300031824 Bacteria 803
545 Ga0307410_10006216 3300031852 Bacteria 6422
546 Ga0307410_10008403 3300031852 Bacteria 5722
547 Ga0307410_10056525 3300031852 Bacteria 2669
548 Ga0307410_11027613 3300031852 Bacteria 712
549 Ga0307406_10021415 3300031901 Bacteria 3823
550 Ga0307407_10003405 3300031903 Bacteria 6513
551 Ga0307407_10010229 3300031903 Bacteria 4414
552 Ga0307407_10015376 3300031903 Bacteria 3782
553 Ga0307407_10970353 3300031903 Bacteria 655
554 Ga0307412_10007357 3300031911 Bacteria 6244
555 Ga0307412_10057324 3300031911 Bacteria 2600
556 Ga0307412_10129524 3300031911 Bacteria 1830
557 Ga0307409_100016311 3300031995 Bacteria 4910
558 Ga0307409_100022483 3300031995 Bacteria 4349
559 Ga0307409_100096731 3300031995 Unclassified 2437
560 Ga0307409_100669412 3300031995 Bacteria 1034
561 Ga0307409_100803229 3300031995 Bacteria 948
562 Ga0307409_100917202 3300031995 Unclassified 890
563 Ga0307409_101192536 3300031995 Bacteria 784
564 Ga0307409_101527837 3300031995 Unclassified 695
565 Ga0307416_100013573 3300032002 Bacteria 5544
566 Ga0307416_100033478 3300032002 Bacteria 3896
567 Ga0307416_100047212 3300032002 Bacteria 3406
568 Ga0307416_100155177 3300032002 Bacteria 2106
569 Ga0307416_100157092 3300032002 Bacteria 2096
570 Ga0307416_100310907 3300032002 Bacteria 1572
571 Ga0307416_100539554 3300032002 Bacteria 1238
572 Ga0307416_101062825 3300032002 Bacteria 913
573 Ga0307416_102681265 3300032002 Bacteria 595
574 Ga0307416_103383085 3300032002 Unclassified 534
575 Ga0307414_10002467 3300032004 Bacteria 9696
576 Ga0307414_10075807 3300032004 Bacteria 2442
577 Ga0307414_10547621 3300032004 Bacteria 1031
578 Ga0307414_10810503 3300032004 Bacteria 854
579 Ga0307411_10026143 3300032005 Bacteria 3510
580 Ga0307411_10027197 3300032005 Bacteria 3456
581 Ga0307411_10068283 3300032005 Bacteria 2395
582 Ga0307411_10123735 3300032005 Bacteria 1876
583 Ga0307415_100028592 3300032126 Bacteria 3549
584 Ga0307415_100098521 3300032126 Bacteria 2137
585 Ga0307415_100128456 3300032126 Unclassified 1914
586 Ga0307415_100132205 3300032126 Bacteria 1891
587 Ga0307415_101528662 3300032126 Bacteria 639
588 Ga0373930_0004299 3300034816 Unclassified 2309
589 Ga0373948_0154321 3300034817 Unclassified 575
590 Ga0373950_0001278 3300034818 Bacteria 3255
591 Ga0373950_0163326 3300034818 Unclassified 516
592 Ga0373958_0001085 3300034819 Unclassified 3581
593 Ga0373959_0001126 3300034820 Bacteria 4331
594 Ga0373938_0001071 3300034957 Bacteria 4406
595 Ga0373928_0019640 3300035084 Unclassified 1411
596 Ga0373929_0002543 3300035085 Bacteria 3352
597 Ga0373934_0044110 3300035086 Bacteria 1762
598 Ga0373940_0000884 3300035088 Bacteria 5040
599 Ga0373940_0380525 3300035088 Unclassified 500
600 Ga0373944_0296857 3300035089 Bacteria 606
601 Ga0373949_0000773 3300035090 Bacteria 10301
602 Ga0373951_0003932 3300035091 Bacteria 3570
603 Ga0373952_0017925 3300035092 Unclassified 1459
604 Ga0373923_0235173 3300035111 Bacteria 855
605 Ga0373923_0340506 3300035111 Bacteria 715
606 Ga0373932_0002493 3300035112 Bacteria 4628
607 Ga0373939_0000278 3300035114 Bacteria 13575
608 Ga0373939_0135961 3300035114 Unclassified 882
609 Ga0373941_0001587 3300035115 Bacteria 4833
610 Ga0373941_0094428 3300035115 Bacteria 1031
611 Ga0373953_0015618 3300035117 Bacteria 2756
612 Ga0373953_0389933 3300035117 Unclassified 612
613 Ga0373954_0028468 3300035118 Bacteria 2569
614 Ga0373956_0058302 3300035119 Bacteria 1745
615 Ga0373957_0008096 3300035120 Bacteria 3393
616 Ga0373960_0008281 3300035121 Bacteria 2488
617 Ga0373943_0029958 3300035170 Bacteria 2574
618 Ga0373955_0012170 3300035172 Bacteria 4129
619 Ga0373942_0001929 3300035207 Bacteria 5196
620 Ga0373942_0247254 3300035207 Unclassified 605
621 Ga0373961_0005151 3300035241 Bacteria 3144
622 Ga0373962_0002088 3300035242 Bacteria 4770
623 Ga0373931_0002373 3300035691 Bacteria 8330
624 Ga0373931_0433490 3300035691 Bacteria 838
625 Ga0373935_0308091 3300035692 Bacteria 1121
626 Ga0373935_1369123 3300035692 Unclassified 529
627 Ga0373933_0003937 3300035724 Bacteria 8198
628 Ga0373933_0095202 3300035724 Bacteria 1842
629 Ga0373947_0703449 3300035725 Unclassified 689
630 Ga0373937_0002473 3300036401 Bacteria 15364
631 Ga0373937_0026192 3300036401 Bacteria 5269
632 Ga0395900_0974279 3300037418 Bacteria 769
633 Ga0395898_1709784 3300037466 Bacteria 552
634 Ga0439453_0003888 3300041408 Bacteria 2186
635 Ga0451802_0460898 3300041460 Bacteria 1013
636 Ga0439433_0156601 3300041999 Bacteria 588
637 Ga0439441_030869 3300042001 Bacteria 1038
638 Ga0439442_018750 3300042002 Bacteria 1431
639 Ga0439445_0023184 3300042004 Unclassified 1570
640 Ga0439448_0214667 3300042005 Bacteria 676
641 Ga0439449_0214609 3300042007 Unclassified 721
642 Ga0439457_108920 3300042014 Bacteria 649
643 Ga0439462_0009957 3300042015 Bacteria 2406
644 Ga0450917_031056 3300042120 Bacteria 511
645 Ga0450896_083896 3300042133 Unclassified 538
646 Ga0439446_0060699 3300042156 Bacteria 1142
647 Ga0439435_0004616 3300042436 Bacteria 2981
648 Ga0439435_0007930 3300042436 Bacteria 2451
649 Ga0439444_0118344 3300042437 Bacteria 616
650 Ga0439464_0003239 3300042439 Bacteria 4096
651 Ga0439460_0187256 3300042461 Bacteria 701
652 Ga0451577_0006008 3300042876 Bacteria 12224
653 Ga0451577_1019614 3300042876 Bacteria 743
654 Ga0453683_0904183 3300044673 Unclassified 584
655 Ga0466963_0033446 3300044694 Bacteria 3338
656 Ga0466957_1087912 3300044842 Unclassified 576
657 Ga0451576_0023050 3300045051 Bacteria 6747
658 Ga0451576_0069259 3300045051 Bacteria 3671
659 Ga0451576_0531913 3300045051 Bacteria 1235
660 Ga0451576_0746837 3300045051 Bacteria 1028
661 Ga0451576_0943353 3300045051 Unclassified 905
662 Ga0495629_0239266 3300046459 Bacteria 1250
663 Ga0495651_0167947 3300046462 Bacteria 1565
664 Ga0495580_0420680 3300046472 Bacteria 899
665 Ga0495582_0572419 3300046473 Unclassified 653
666 Ga0495639_0685530 3300046475 Bacteria 529
667 Ga0495662_0346216 3300046476 Unclassified 731
668 Ga0495664_0164091 3300046477 Bacteria 1348
669 Ga0495608_0718179 3300046511 Unclassified 594
670 Ga0495644_0309513 3300046523 Unclassified 619
671 Ga0495663_0141499 3300046525 Bacteria 817
672 Ga0495587_0291051 3300046536 Bacteria 914
673 Ga0495645_0023915 3300046543 Bacteria 4429
674 Ga0495645_0068053 3300046543 Bacteria 2571
675 Ga0495635_0852181 3300046663 Bacteria 585
676 Ga0495659_0150321 3300046664 Unclassified 935
677 Ga0495659_0270484 3300046664 Bacteria 712
678 Ga0495647_0029994 3300046681 Bacteria 2015
679 Ga0495647_0049941 3300046681 Bacteria 1622
680 Ga0495658_0244340 3300046683 Bacteria 1128
681 Ga0495658_0697070 3300046683 Bacteria 650
682 Ga0495658_0850393 3300046683 Bacteria 584
683 Ga0495669_0229425 3300046684 Bacteria 891
684 Ga0495613_0194794 3300046689 Bacteria 1431
685 Ga0495613_0850268 3300046689 Unclassified 593
686 Ga0495649_0658252 3300046694 Bacteria 515
687 Ga0495600_0074263 3300046809 Bacteria 2220
688 Ga0495674_1223676 3300047319 Bacteria 566
689 Ga0495680_0452609 3300047322 Bacteria 878
690 Ga0495680_0727555 3300047322 Bacteria 653
691 Ga0495680_0831521 3300047322 Bacteria 601
692 Ga0495684_0119626 3300047471 Bacteria 1985
693 Ga0496102_0085164 3300048905 Bacteria 2918
694 Ga0496102_1434328 3300048905 Unclassified 609
695 Ga0496104_0436873 3300048907 Bacteria 1221
696 Ga0496104_0683109 3300048907 Bacteria 935
697 Ga0496104_0689521 3300048907 Bacteria 929
698 Ga0496104_0725602 3300048907 Bacteria 901
699 Ga0496105_0361501 3300048908 Unclassified 1158
700 Ga0496105_0827977 3300048908 Unclassified 702
701 Ga0496106_0381952 3300048909 Bacteria 1132
702 Ga0496106_0588927 3300048909 Unclassified 891
703 Ga0496108_0208682 3300048911 Bacteria 1695
704 Ga0496109_1195752 3300048912 Bacteria 697
705 Ga0496110_0282324 3300048913 Bacteria 1512
706 Ga0496110_1313440 3300048913 Bacteria 633
707 Ga0496111_1201956 3300048914 Unclassified 537
708 Ga0496112_0005771 3300048915 Bacteria 10767
709 Ga0496112_0198786 3300048915 Bacteria 1965
710 Ga0496112_0226392 3300048915 Unclassified 1825
711 Ga0496112_0930916 3300048915 Bacteria 790
712 Ga0496113_0034682 3300048916 Bacteria 3684
713 Ga0496114_0086978 3300048917 Bacteria 2649
714 Ga0496114_0635507 3300048917 Bacteria 940
715 Ga0496114_0668123 3300048917 Unclassified 913
716 Ga0496115_0165313 3300048918 Unclassified 1830
717 Ga0501291_002252 3300049514 Bacteria 2299
718 Ga0501291_021479 3300049514 Bacteria 1030
719 Ga0501295_044435 3300049518 Bacteria 933
720 Ga0501299_003204 3300049522 Bacteria 2349
721 Ga0501031_0833355 3300049568 Bacteria 591
722 Ga0501032_0092028 3300049569 Bacteria 2012
723 Ga0501033_0032253 3300049570 Bacteria 3934
724 Ga0501033_0178137 3300049570 Unclassified 1525
725 Ga0501033_0907837 3300049570 Bacteria 592
726 Ga0501034_0021350 3300049571 Bacteria 6601
727 Ga0501034_0524142 3300049571 Bacteria 1096
728 Ga0501036_0013771 3300049572 Bacteria 6727
729 Ga0501036_0040647 3300049572 Bacteria 3933
730 Ga0501036_0128021 3300049572 Bacteria 2144
731 Ga0501036_0179068 3300049572 Bacteria 1785
732 Ga0501037_0035700 3300049573 Bacteria 3664
733 Ga0501038_0050051 3300049574 Unclassified 3611
734 Ga0501038_0053481 3300049574 Bacteria 3476
735 Ga0501038_0261480 3300049574 Bacteria 1368
736 Ga0501039_0233725 3300049575 Bacteria 1445
737 Ga0501040_0129935 3300049576 Bacteria 1771
738 Ga0501040_0209337 3300049576 Unclassified 1386
739 Ga0501040_0470318 3300049576 Bacteria 905
740 Ga0501040_1098656 3300049576 Bacteria 577
741 Ga0501041_0056679 3300049577 Bacteria 2395
742 Ga0501041_0065455 3300049577 Bacteria 2227
743 Ga0501041_0306149 3300049577 Bacteria 1001
744 Ga0501041_0485853 3300049577 Bacteria 785
745 Ga0501041_1092070 3300049577 Unclassified 514
746 Ga0501042_0170161 3300049578 Bacteria 1572
747 Ga0501042_0677837 3300049578 Bacteria 749
748 Ga0501043_0621303 3300049579 Bacteria 796
749 Ga0501046_0008884 3300049580 Bacteria 8725
750 Ga0501046_0334038 3300049580 Bacteria 1102
751 Ga0501046_0355952 3300049580 Bacteria 1062
752 Ga0501046_0885568 3300049580 Bacteria 623
753 Ga0501046_0888775 3300049580 Bacteria 622
754 Ga0501046_1162131 3300049580 Bacteria 531
755 Ga0501047_0021937 3300049581 Bacteria 6132
756 Ga0501047_0459007 3300049581 Bacteria 1103
757 Ga0501048_0228173 3300049582 Bacteria 1321
758 Ga0501048_1247463 3300049582 Bacteria 534
759 Ga0501067_0081852 3300049583 Bacteria 1790
760 Ga0501067_0184313 3300049583 Bacteria 1162
761 Ga0501067_0303220 3300049583 Bacteria 889
762 Ga0501067_0607159 3300049583 Bacteria 614
763 Ga0501068_0729984 3300049584 Bacteria 648
764 Ga0501069_0010055 3300049585 Bacteria 5002
765 Ga0501069_0197095 3300049585 Bacteria 1166
766 Ga0501069_0321684 3300049585 Unclassified 909
767 Ga0501069_0791574 3300049585 Unclassified 574
768 Ga0501070_0035806 3300049586 Bacteria 4145
769 Ga0501070_0127532 3300049586 Bacteria 2102
770 Ga0501071_0006987 3300049587 Bacteria 7371
771 Ga0501071_0019441 3300049587 Bacteria 4713
772 Ga0501071_0081007 3300049587 Bacteria 2375
773 Ga0501071_0167890 3300049587 Bacteria 1642
774 Ga0501071_0172525 3300049587 Bacteria 1619
775 Ga0501071_0197664 3300049587 Bacteria 1510
776 Ga0501071_0414939 3300049587 Bacteria 1029
777 Ga0501071_1218048 3300049587 Unclassified 582
778 Ga0501072_0010778 3300049588 Bacteria 6967
779 Ga0501072_0030383 3300049588 Bacteria 4225
780 Ga0501072_0184581 3300049588 Bacteria 1664
781 Ga0501072_0263669 3300049588 Bacteria 1371
782 Ga0501072_0387823 3300049588 Bacteria 1108
783 Ga0501072_0857826 3300049588 Bacteria 710
784 Ga0501072_1187203 3300049588 Unclassified 593
785 Ga0501072_1272720 3300049588 Unclassified 570
786 Ga0501073_0397643 3300049589 Bacteria 952
787 Ga0501073_0851391 3300049589 Bacteria 628
788 Ga0501074_0065860 3300049590 Bacteria 2607
789 Ga0501074_0234976 3300049590 Bacteria 1304
790 Ga0501074_0269431 3300049590 Bacteria 1210
791 Ga0501074_0697551 3300049590 Bacteria 716
792 Ga0501075_0096154 3300049591 Bacteria 2248
793 Ga0501075_0158546 3300049591 Bacteria 1726
794 Ga0501075_0171367 3300049591 Unclassified 1656
795 Ga0501075_0337173 3300049591 Bacteria 1149
796 Ga0501075_0475909 3300049591 Bacteria 953
797 Ga0501076_0020912 3300049592 Bacteria 5012
798 Ga0501076_0038728 3300049592 Bacteria 3743
799 Ga0501076_0806715 3300049592 Bacteria 774
800 Ga0501077_0283637 3300049593 Unclassified 1054
801 Ga0501208_018162 3300049655 Bacteria 1117
802 Ga0501243_143796 3300049675 Bacteria 505
803 Ga0501225_0099636 3300049705 Bacteria 848
804 Ga0501079_0057317 3300049741 Bacteria 3006
805 Ga0501079_0111075 3300049741 Bacteria 2130
806 Ga0501079_0249654 3300049741 Bacteria 1387
807 Ga0501079_0523448 3300049741 Bacteria 932
808 Ga0501079_0667864 3300049741 Bacteria 818
809 Ga0501079_0744591 3300049741 Bacteria 771
810 Ga0501080_0023057 3300049742 Bacteria 5772
811 Ga0501080_0236843 3300049742 Unclassified 1667
812 Ga0501080_0240032 3300049742 Bacteria 1654
813 Ga0501080_0307484 3300049742 Unclassified 1437
814 Ga0501080_0475317 3300049742 Bacteria 1118
815 Ga0501081_0054150 3300049743 Bacteria 2772
816 Ga0501081_0095665 3300049743 Bacteria 2094
817 Ga0501081_0142446 3300049743 Bacteria 1718
818 Ga0501081_0237066 3300049743 Bacteria 1330
819 Ga0501081_0580178 3300049743 Bacteria 839
820 Ga0501279_047722 3300049775 Bacteria 672
821 Ga0501283_021834 3300049779 Bacteria 1029
822 Ga0501283_041396 3300049779 Bacteria 798
823 Ga0501035_0024777 3300049822 Bacteria 5500
824 Ga0501035_0450322 3300049822 Bacteria 1065
825 Ga0501044_0033845 3300049823 Bacteria 5365
826 Ga0501045_0045363 3300049824 Bacteria 3200
827 Ga0501045_0152449 3300049824 Bacteria 1719
828 Ga0501045_0207440 3300049824 Bacteria 1460
829 nmdc:mga0yw44_363210_c1 3300050492 Bacteria 976
830 nmdc:mga05p37_114827_c1 3300050507 Bacteria 3310
831 nmdc:mga05p37_12052_c1 3300050507 Bacteria 10319
832 nmdc:mga05p37_12825_c1 3300050507 Bacteria 10020
833 nmdc:mga05p37_129840_c1 3300050507 Bacteria 3092
834 nmdc:mga05p37_164318_c1 3300050507 Bacteria 2710
835 nmdc:mga05p37_1798_c1 3300050507 Bacteria 25039
836 nmdc:mga05p37_192788_c1 3300050507 Bacteria 2473
837 nmdc:mga05p37_2049296_c1 3300050507 Unclassified 539
838 nmdc:mga05p37_213638_c1 3300050507 Bacteria 2331
839 nmdc:mga05p37_250579_c1 3300050507 Bacteria 2124
840 nmdc:mga05p37_281227_c1 3300050507 Bacteria 1984
841 nmdc:mga05p37_283453_c1 3300050507 Bacteria 1975
842 nmdc:mga05p37_557928_c1 3300050507 Bacteria 1302
843 nmdc:mga05p37_7393_c1 3300050507 Bacteria 12957
844 nmdc:mga09592_11361_c1 3300050508 Bacteria 7241
845 nmdc:mga09592_46293_c1 3300050508 Bacteria 3665
846 nmdc:mga09592_785134_c1 3300050508 Bacteria 806
847 nmdc:mga0qj67_17204_c1 3300050509 Bacteria 5494
848 nmdc:mga0qj67_33120_c1 3300050509 Bacteria 4031
849 nmdc:mga06r32_118372_c1 3300050510 Bacteria 2611
850 nmdc:mga06r32_1388_c1 3300050510 Bacteria 21877
851 nmdc:mga06r32_65039_c1 3300050510 Bacteria 3517
852 nmdc:mga06r32_7406_c1 3300050510 Bacteria 9871
853 nmdc:mga08y16_12953_c1 3300050511 Bacteria 8774
854 nmdc:mga08y16_154548_c1 3300050511 Bacteria 2384
855 nmdc:mga08y16_211018_c1 3300050511 Unclassified 2011
856 nmdc:mga08y16_226093_c1 3300050511 Bacteria 1936
857 nmdc:mga08y16_306295_c1 3300050511 Bacteria 1637
858 nmdc:mga08y16_342065_c1 3300050511 Unclassified 1538
859 nmdc:mga08y16_38128_c1 3300050511 Bacteria 5047
860 nmdc:mga08y16_90746_c1 3300050511 Bacteria 3185
861 nmdc:mga0n895_110399_c1 3300050512 Bacteria 2766
862 nmdc:mga0n895_1146959_c1 3300050512 Bacteria 753
863 nmdc:mga0n895_1565665_c1 3300050512 Bacteria 624
864 nmdc:mga0n895_262058_c1 3300050512 Unclassified 1754
865 nmdc:mga0n895_2680_c1 3300050512 Bacteria 14053
866 nmdc:mga0n895_286838_c1 3300050512 Bacteria 1669
867 nmdc:mga0n895_35375_c1 3300050512 Bacteria 4815
868 nmdc:mga0n895_667156_c1 3300050512 Bacteria 1037
869 nmdc:mga0n895_856232_c1 3300050512 Unclassified 897
870 nmdc:mga0rr50_10974_c1 3300050513 Bacteria 5778
871 nmdc:mga0rr50_113514_c1 3300050513 Bacteria 2147
872 nmdc:mga0rr50_148409_c1 3300050513 Bacteria 1892
873 nmdc:mga0rr50_181103_c1 3300050513 Bacteria 1722
874 nmdc:mga0rr50_195585_c1 3300050513 Bacteria 1659
875 nmdc:mga0rr50_210403_c1 3300050513 Bacteria 1602
876 nmdc:mga0rr50_38578_c1 3300050513 Bacteria 3459
877 nmdc:mga0rr50_413979_c1 3300050513 Bacteria 1140
878 nmdc:mga0rr50_500_c1 3300050513 Bacteria 20905
879 nmdc:mga0rr50_68770_c1 3300050513 Bacteria 2694
880 nmdc:mga0rr50_867994_c1 3300050513 Bacteria 769
881 nmdc:mga0rr50_87137_c1 3300050513 Bacteria 2423
882 nmdc:mga08x19_121217_c1 3300050514 Bacteria 1753
883 nmdc:mga08x19_1442_c1 3300050514 Bacteria 14702
884 nmdc:mga08x19_177015_c1 3300050514 Bacteria 1455
885 nmdc:mga08x19_184705_c1 3300050514 Bacteria 1425
886 nmdc:mga08x19_68995_c1 3300050514 Bacteria 2302
887 nmdc:mga08x19_739_c1 3300050514 Bacteria 20880
888 nmdc:mga0a205_1145802_c1 3300050515 Bacteria 625
889 nmdc:mga0a205_1155381_c1 3300050515 Bacteria 622
890 nmdc:mga0a205_204797_c1 3300050515 Bacteria 1862
891 nmdc:mga0a205_34471_c1 3300050515 Bacteria 4855
892 nmdc:mga0a205_485070_c1 3300050515 Bacteria 1094
893 nmdc:mga0a205_555883_c1 3300050515 Bacteria 1003
894 nmdc:mga0a205_562841_c1 3300050515 Bacteria 995
895 nmdc:mga0a205_58385_c1 3300050515 Bacteria 3727
896 Ga0495601_0176096 3300053077 Bacteria 1398
897 Ga0495601_0196318 3300053077 Bacteria 1319
898 Ga0495601_0238366 3300053077 Bacteria 1188
899 Ga0495595_0057007 3300053084 Bacteria 1822
900 Ga0495595_0115100 3300053084 Bacteria 1307
901 Ga0495595_0297822 3300053084 Bacteria 811
902 Ga0495619_0021584 3300053085 Bacteria 4112
903 Ga0495619_0301510 3300053085 Bacteria 1110
904 Ga0495619_0379095 3300053085 Unclassified 977
905 Ga0495619_0737177 3300053085 Bacteria 669
906 Ga0501084_0013187 3300054114 Bacteria 6838
907 Ga0501084_0041596 3300054114 Bacteria 3845
908 Ga0501084_0501781 3300054114 Bacteria 1025
909 Ga0501084_1403239 3300054114 Bacteria 585
910 Ga0501082_0038373 3300060353 Bacteria 4132
911 Ga0501082_0051097 3300060353 Bacteria 3563
912 Ga0501082_0169853 3300060353 Bacteria 1896
913 Ga0501082_0281817 3300060353 Unclassified 1447
914 Ga0501082_0314351 3300060353 Bacteria 1364
915 Ga0501082_1280145 3300060353 Bacteria 641
916 Ga0501082_1604358 3300060353 Bacteria 568
917 Ga0530510_1048910 3300061734 Bacteria 624
918 Ga0495669_0161658
919 Ga0065712_10080688
920 Ga0065712_10390511
921 Ga0065715_10343969
922 Ga0065715_10433142
923 Ga0065707_10484059
924 Ga0065707_10668308
925 Ga0070676_10385717
926 Ga0070676_11100544
927 Ga0070683_100994745
928 Ga0070690_100057181
929 Ga0070690_100176833
930 Ga0070690_100947796
931 Ga0070670_100016649
932 Ga0070670_100194562
933 Ga0070670_100682458
934 Ga0068869_100120487
935 Ga0068869_101306493
936 Ga0070666_10006154
937 Ga0070666_10169179
938 Ga0070680_100036932
939 Ga0070682_100920353
940 Ga0068868_100294086
941 Ga0068868_100373406
942 Ga0068868_100489855
943 Ga0068868_102110978
944 Ga0070660_100020483
945 Ga0070660_100653073
946 Ga0070689_100268391
947 Ga0070689_101127955
948 Ga0070691_10069805
949 Ga0070687_100106033
950 Ga0070687_100239949
951 Ga0070687_100291792
952 Ga0070661_100780735
953 Ga0070661_100881836
954 Ga0070692_11287988
955 Ga0070668_100121665
956 Ga0070668_100199830
957 Ga0070668_101918509
958 Ga0070669_100161278
959 Ga0070669_100251455
960 Ga0070669_100316193
961 Ga0070669_101413726
962 Ga0070675_100196015
963 Ga0070675_100425315
964 Ga0070675_100466649
965 Ga0070675_100990173
966 Ga0070671_100124867
967 Ga0070671_100305290
968 Ga0070671_100985605
969 Ga0070674_100296362
970 Ga0070674_101401304
971 Ga0070674_102187615
972 Ga0070673_100060277
973 Ga0070673_100221840
974 Ga0070673_100594632
975 Ga0070688_100057613
976 Ga0070688_100112049
977 Ga0070688_100189223
978 Ga0070688_100201418
979 Ga0070659_100274326
980 Ga0070659_100420160
981 Ga0070667_100044788
982 Ga0070703_10113755
983 Ga0070709_10030288
984 Ga0070709_10618138
985 Ga0070709_11120277
986 Ga0070714_101713372
987 Ga0070713_102221729
988 Ga0070701_10634733
989 Ga0070711_101699652
990 Ga0070705_100490917
991 Ga0070705_101513316
992 Ga0070700_100084253
993 Ga0070700_100153113
994 Ga0070694_100006907
995 Ga0070694_100027093
996 Ga0070694_100055531
997 Ga0070694_100076897
998 Ga0070694_100295277
999 Ga0070694_101150038
1000 Ga0070694_101409982
1001 Ga0070708_100024164
1002 Ga0070708_100275681
1003 Ga0070708_101348297
1004 Ga0070708_101610760
1005 Ga0070663_101729392
1006 Ga0070678_100299378
1007 Ga0070678_100542180
1008 Ga0070662_100054625
1009 Ga0070662_101421062
1010 Ga0070681_10104291
1011 Ga0070681_11017450
1012 Ga0070681_11199606
1013 Ga0070681_11676954
1014 Ga0068867_100022772
1015 Ga0068867_100263016
1016 Ga0068867_100388858
1017 Ga0070706_100903305
1018 Ga0070706_101858340
1019 Ga0070707_100145499
1020 Ga0070707_100148533
1021 Ga0070707_100150031
1022 Ga0070707_100161802
1023 Ga0070707_100170834
1024 Ga0070707_100469095
1025 Ga0070698_100100821
1026 Ga0070698_100128212
1027 Ga0070698_100329084
1028 Ga0070698_101045886
1029 Ga0070698_101059530
1030 Ga0070699_100023260
1031 Ga0070699_101556152
1032 Ga0070679_100039009
1033 Ga0070679_100251202
1034 Ga0070684_100975912
1035 Ga0070697_100000287
1036 Ga0070697_100014842
1037 Ga0070697_100049495
1038 Ga0070697_100396455
1039 Ga0070697_101072292
1040 Ga0070697_101327513
1041 Ga0070672_100039415
1042 Ga0070672_100113147
1043 Ga0070672_101864169
1044 Ga0070686_100019422
1045 Ga0070686_100108334
1046 Ga0070686_100233464
1047 Ga0070686_101368639
1048 Ga0070695_100342842
1049 Ga0070695_100351902
1050 Ga0070695_101564136
1051 Ga0070696_100033440
1052 Ga0070696_101698076
1053 Ga0070693_100737649
1054 Ga0070665_100005812
1055 Ga0070665_100033864
1056 Ga0070665_100126214
1057 Ga0070665_100850968
1058 Ga0070704_100027089
1059 Ga0070704_100031294
1060 Ga0070704_100056214
1061 Ga0070704_100113976
1062 Ga0070704_101892713
1063 Ga0068855_100068396
1064 Ga0068855_100343705
1065 Ga0068855_100509671
1066 Ga0070664_100299963
1067 Ga0070664_100341781
1068 Ga0070664_101441837
1069 Ga0068854_100015949
1070 Ga0068854_100076283
1071 Ga0068854_100537894
1072 Ga0068854_100611319
1073 Ga0068854_100769400
1074 Ga0070702_100049940
1075 Ga0070702_100716946
1076 Ga0070702_100822674
1077 Ga0070702_101414581
1078 Ga0068852_100392312
1079 Ga0068852_100550580
1080 Ga0068859_100102035
1081 Ga0068859_100162042
1082 Ga0068859_100418190
1083 Ga0068864_100058932
1084 Ga0068864_100095441
1085 Ga0068864_100321565
1086 Ga0068864_101450038
1087 Ga0068866_10303757
1088 Ga0068866_10388305
1089 Ga0068861_100014767
1090 Ga0068861_100037222
1091 Ga0068861_100135965
1092 Ga0068861_100236741
1093 Ga0068861_100324607
1094 Ga0068851_10201425
1095 Ga0068863_100045648
1096 Ga0068863_100222386
1097 Ga0068863_100448164
1098 Ga0068863_101073520
1099 Ga0068858_100014560
1100 Ga0068858_100203000
1101 Ga0068858_100433799
1102 Ga0068858_100681720
1103 Ga0068858_100861955
1104 Ga0068860_100030451
1105 Ga0068860_100162630
1106 Ga0068860_100431523
1107 Ga0068860_100459364
1108 Ga0068860_100716834
1109 Ga0068860_100737431
1110 Ga0068860_101194682
1111 Ga0068860_101254422
1112 Ga0068860_101714412
1113 Ga0068862_100016477
1114 Ga0068862_100098393
1115 Ga0068862_100126103
1116 Ga0068862_100642337
1117 Ga0068862_100792207
1118 Ga0068862_100843455
1119 Ga0081455_10320273
1120 Ga0081539_10353069
1121 Ga0075365_10385297
1122 Ga0075364_10267693
1123 Ga0075432_10105288
1124 Ga0070716_101098916
1125 Ga0097621_100065500
1126 Ga0068871_100074640
1127 Ga0068871_100142650
1128 Ga0068871_100872846
1129 Ga0068871_101024048
1130 Ga0075428_100020634
1131 Ga0075428_100208036
1132 Ga0075428_100344296
1133 Ga0075430_100037749
1134 Ga0075430_100056915
1135 Ga0075430_100090887
1136 Ga0075431_100031010
1137 Ga0075431_100055777
1138 Ga0075431_100078042
1139 Ga0075431_100129554
1140 Ga0075431_101719463
1141 Ga0075433_10083124
1142 Ga0075433_10351015
1143 Ga0075433_10885801
1144 Ga0075433_11154991
1145 Ga0075433_11380062
1146 Ga0075433_11859160
1147 Ga0075434_100004883
1148 Ga0075434_100041061
1149 Ga0075434_100052908
1150 Ga0075434_100133301
1151 Ga0075434_100199855
1152 Ga0075434_100386825
1153 Ga0075434_100493577
1154 Ga0075434_101177411
1155 Ga0075429_100022744
1156 Ga0075429_100629303
1157 Ga0075429_101719649
1158 Ga0068865_100989635
1159 Ga0075436_100005353
1160 Ga0075436_100015139
1161 Ga0075436_100031878
1162 Ga0075436_100097631
1163 Ga0075436_100104236
1164 Ga0075436_100138067
1165 Ga0097620_100102036
1166 Ga0097620_100162037
1167 Ga0097620_100418191
1168 Ga0075435_100002536
1169 Ga0075435_100013141
1170 Ga0075435_100026465
1171 Ga0075435_100104211
1172 Ga0075435_100106701
1173 Ga0075435_100291338
1174 Ga0075435_100434598
1175 Ga0075435_100515180
1176 Ga0075435_100642789
1177 Ga0099794_10074863
1178 Ga0099795_10327605
1179 Ga0105251_10317427
1180 Ga0105240_10138519
1181 Ga0105240_10394191
1182 Ga0105240_10628974
1183 Ga0105240_11264593
1184 Ga0105240_11305828
1185 Ga0111539_10021902
1186 Ga0111539_10079589
1187 Ga0111539_10129233
1188 Ga0111539_10183174
1189 Ga0111539_10217213
1190 Ga0111539_10267857
1191 Ga0111539_10346964
1192 Ga0111539_10384234
1193 Ga0105245_10113275
1194 Ga0105245_10687364
1195 Ga0105245_11851525
1196 Ga0105247_10064393
1197 Ga0105247_10623130
1198 Ga0105247_11209354
1199 Ga0114129_10004437
1200 Ga0114129_10004847
1201 Ga0114129_10010525
1202 Ga0114129_10037891
1203 Ga0114129_10041262
1204 Ga0114129_10041707
1205 Ga0114129_10065086
1206 Ga0114129_10095713
1207 Ga0114129_10135656
1208 Ga0114129_10145460
1209 Ga0114129_10200781
1210 Ga0114129_10231287
1211 Ga0114129_10370916
1212 Ga0114129_10525271
1213 Ga0114129_10599102
1214 Ga0114129_10768553
1215 Ga0114129_11150799
1216 Ga0114129_13385713
1217 Ga0105243_10060076
1218 Ga0105243_10555956
1219 Ga0105243_12166600
1220 Ga0105243_12251007
1221 Ga0105241_10125955
1222 Ga0105242_10027112
1223 Ga0105242_10321797
1224 Ga0105242_10587736
1225 Ga0105248_10023438
1226 Ga0105248_10141138
1227 Ga0105248_10164341
1228 Ga0105248_10191555
1229 Ga0105248_10584101
1230 Ga0105248_10790418
1231 Ga0105248_10931569
1232 Ga0105248_10964065
1233 Ga0105248_11343632
1234 Ga0105237_12777002
1235 Ga0105238_10127333
1236 Ga0105238_10855818
1237 Ga0105238_11191531
1238 Ga0105249_10093169
1239 Ga0105249_10266111
1240 Ga0105249_10534881
1241 Ga0105249_10994671
1242 Ga0105249_11500336
1243 Ga0105249_11612462
1244 Ga0105239_11139192
1245 Ga0105246_10349537
1246 Ga0157315_1031929
1247 Ga0157374_10098541
1248 Ga0157374_10934958
1249 Ga0157374_11284156
1250 Ga0163162_10108751
1251 Ga0163162_10446068
1252 Ga0163162_11241189
1253 Ga0163162_11410541
1254 Ga0163162_12270568
1255 Ga0157372_11777784
1256 Ga0157375_10078151
1257 Ga0157375_10141069
1258 Ga0157375_10934317
1259 Ga0157375_11621921
1260 Ga0163163_10000663
1261 Ga0163163_10169006
1262 Ga0163163_12476043
1263 Ga0157380_10129531
1264 Ga0157380_10222388
1265 Ga0157380_10384505
1266 Ga0157380_10699769
1267 Ga0157380_10722105
1268 Ga0157380_12214425
1269 Ga0157377_10151823
1270 Ga0157377_11089909
1271 Ga0157377_11099212
1272 Ga0157379_10018789
1273 Ga0157379_10051345
1274 Ga0157379_10477832
1275 Ga0157379_11092815
1276 Ga0157379_11250470
1277 Ga0157379_11876865
1278 Ga0157379_12314570
1279 Ga0157376_10088262
1280 Ga0157376_10102217
1281 Ga0157376_10159846
1282 Ga0157376_11071355
1283 Ga0163161_10906207
1284 Ga0207713_1261664
1285 Ga0207682_10171683
1286 Ga0207642_10015468
1287 Ga0207642_10641363
1288 Ga0207642_10748969
1289 Ga0207710_10165306
1290 Ga0207710_10731865
1291 Ga0207688_10378266
1292 Ga0207680_10155852
1293 Ga0207680_10601286
1294 Ga0207699_10060562
1295 Ga0207645_10037150
1296 Ga0207645_10151125
1297 Ga0207645_10245287
1298 Ga0207645_10422405
1299 Ga0207645_10443553
1300 Ga0207684_10491220
1301 Ga0207684_10851209
1302 Ga0207684_11018616
1303 Ga0207654_10044000
1304 Ga0207707_10081324
1305 Ga0207707_10219012
1306 Ga0207707_11240097
1307 Ga0207695_11173073
1308 Ga0207693_10679459
1309 Ga0207660_10897599
1310 Ga0207662_10008810
1311 Ga0207662_10264783
1312 Ga0207662_10654889
1313 Ga0207657_10021131
1314 Ga0207657_10741055
1315 Ga0207649_10262291
1316 Ga0207649_10926906
1317 Ga0207652_10233657
1318 Ga0207652_10383600
1319 Ga0207652_11017612
1320 Ga0207646_10056722
1321 Ga0207646_10137876
1322 Ga0207646_10157754
1323 Ga0207646_10197050
1324 Ga0207646_10278287
1325 Ga0207646_10511141
1326 Ga0207681_10007101
1327 Ga0207681_10144827
1328 Ga0207681_10401161
1329 Ga0207681_11236059
1330 Ga0207694_10329592
1331 Ga0207650_10123928
1332 Ga0207650_10299691
1333 Ga0207650_10303436
1334 Ga0207659_10479177
1335 Ga0207687_10201151
1336 Ga0207687_10454110
1337 Ga0207644_10041596
1338 Ga0207644_10059963
1339 Ga0207690_11340359
1340 Ga0207706_10082624
1341 Ga0207706_10272567
1342 Ga0207706_10289855
1343 Ga0207706_11122095
1344 Ga0207686_10095684
1345 Ga0207686_10334106
1346 Ga0207709_10083631
1347 Ga0207670_10070752
1348 Ga0207670_10255284
1349 Ga0207670_10533663
1350 Ga0207670_11188204
1351 Ga0207669_10880177
1352 Ga0207669_11734937
1353 Ga0207704_10512437
1354 Ga0207704_11075681
1355 Ga0207665_10528509
1356 Ga0207691_10039547
1357 Ga0207691_10095469
1358 Ga0207691_10429760
1359 Ga0207691_10531157
1360 Ga0207691_10582852
1361 Ga0207711_10263820
1362 Ga0207711_10522146
1363 Ga0207711_10872351
1364 Ga0207711_10941906
1365 Ga0207711_11001821
1366 Ga0207711_11286843
1367 Ga0207711_11462651
1368 Ga0207711_11768538
1369 Ga0207689_10074042
1370 Ga0207689_10087620
1371 Ga0207689_10360223
1372 Ga0207689_11162604
1373 Ga0207661_10304359
1374 Ga0207679_10951445
1375 Ga0207667_10976910
1376 Ga0207651_10016889
1377 Ga0207651_10071319
1378 Ga0207651_10297465
1379 Ga0207651_10324067
1380 Ga0207651_10424315
1381 Ga0207651_11025642
1382 Ga0207668_10492455
1383 Ga0207668_10747420
1384 Ga0207640_10044246
1385 Ga0207640_10454299
1386 Ga0207658_10340858
1387 Ga0207677_10070634
1388 Ga0207677_11422477
1389 Ga0207703_10039094
1390 Ga0207703_10107517
1391 Ga0207703_10119069
1392 Ga0207703_10142345
1393 Ga0207703_10277340
1394 Ga0207703_10783321
1395 Ga0207703_11608998
1396 Ga0207708_10018869
1397 Ga0207708_10082808
1398 Ga0207708_10367040
1399 Ga0207708_10954945
1400 Ga0207708_11244354
1401 Ga0207708_11375557
1402 Ga0207641_10000431
1403 Ga0207641_10201145
1404 Ga0207641_10450155
1405 Ga0207648_10043260
1406 Ga0207648_10100246
1407 Ga0207676_10022200
1408 Ga0207676_10535681
1409 Ga0207676_10665738
1410 Ga0207676_11898432
1411 Ga0207674_10521180
1412 Ga0207674_11470672
1413 Ga0207675_100026246
1414 Ga0207675_100037661
1415 Ga0207675_100109441
1416 Ga0207675_100115450
1417 Ga0207675_100184447
1418 Ga0207675_100315472
1419 Ga0207683_10211428
1420 Ga0207683_10222823
1421 Ga0207683_11527115
1422 Ga0207698_10296474
1423 Ga0207698_10476764
1424 Ga0207698_11943344
1425 Ga0207428_10006669
1426 Ga0207428_10046768
1427 Ga0207428_10053521
1428 Ga0207428_10172414
1429 Ga0207428_10193579
1430 Ga0207428_10274758
1431 Ga0268266_10027732
1432 Ga0268266_10228278
1433 Ga0268265_10182162
1434 Ga0268265_11863491
1435 Ga0268264_10130727
1436 Ga0268264_10208354
1437 Ga0268264_10357685
1438 Ga0268264_10476959
1439 Ga0268264_10794985
1440 Ga0268264_11238967
1441 Ga0268264_11245988
1442 Ga0268264_11387462
1443 Ga0265316_10640197
1444 Ga0307513_10286160
1445 Ga0307408_100005415
1446 Ga0307408_100006703
1447 Ga0307408_100023003
1448 Ga0307408_100609781
1449 Ga0307408_101063457
1450 Ga0307408_101215187
1451 Ga0307408_101530590
1452 Ga0265314_10032573
1453 Ga0307516_10044102
1454 Ga0307405_10002286
1455 Ga0307405_10011491
1456 Ga0307405_10203012
1457 Ga0307405_10320742
1458 Ga0307405_11125674
1459 Ga0307413_10015804
1460 Ga0307413_10670535
1461 Ga0307413_10775848
1462 Ga0307410_10006216
1463 Ga0307410_10008403
1464 Ga0307410_10056525
1465 Ga0307410_11027613
1466 Ga0307406_10021415
1467 Ga0307407_10003405
1468 Ga0307407_10010229
1469 Ga0307407_10015376
1470 Ga0307407_10970353
1471 Ga0307412_10007357
1472 Ga0307412_10057324
1473 Ga0307412_10129524
1474 Ga0307409_100016311
1475 Ga0307409_100022483
1476 Ga0307409_100096731
1477 Ga0307409_100669412
1478 Ga0307409_100803229
1479 Ga0307409_100917202
1480 Ga0307409_101192536
1481 Ga0307409_101527837
1482 Ga0307416_100013573
1483 Ga0307416_100033478
1484 Ga0307416_100047212
1485 Ga0307416_100155177
1486 Ga0307416_100157092
1487 Ga0307416_100310907
1488 Ga0307416_100539554
1489 Ga0307416_101062825
1490 Ga0307416_102681265
1491 Ga0307416_103383085
1492 Ga0307414_10002467
1493 Ga0307414_10075807
1494 Ga0307414_10547621
1495 Ga0307414_10810503
1496 Ga0307411_10026143
1497 Ga0307411_10027197
1498 Ga0307411_10068283
1499 Ga0307411_10123735
1500 Ga0307415_100028592
1501 Ga0307415_100098521
1502 Ga0307415_100128456
1503 Ga0307415_100132205
1504 Ga0307415_101528662
1505 Ga0373930_0004299
1506 Ga0373948_0154321
1507 Ga0373950_0001278
1508 Ga0373950_0163326
1509 Ga0373958_0001085
1510 Ga0373959_0001126
1511 Ga0373938_0001071
1512 Ga0373928_0019640
1513 Ga0373929_0002543
1514 Ga0373934_0044110
1515 Ga0373940_0000884
1516 Ga0373940_0380525
1517 Ga0373944_0296857
1518 Ga0373949_0000773
1519 Ga0373951_0003932
1520 Ga0373952_0017925
1521 Ga0373923_0235173
1522 Ga0373923_0340506
1523 Ga0373932_0002493
1524 Ga0373939_0000278
1525 Ga0373939_0135961
1526 Ga0373941_0001587
1527 Ga0373941_0094428
1528 Ga0373953_0015618
1529 Ga0373953_0389933
1530 Ga0373954_0028468
1531 Ga0373956_0058302
1532 Ga0373957_0008096
1533 Ga0373960_0008281
1534 Ga0373943_0029958
1535 Ga0373955_0012170
1536 Ga0373942_0001929
1537 Ga0373942_0247254
1538 Ga0373961_0005151
1539 Ga0373962_0002088
1540 Ga0373931_0002373
1541 Ga0373931_0433490
1542 Ga0373935_0308091
1543 Ga0373935_1369123
1544 Ga0373933_0003937
1545 Ga0373933_0095202
1546 Ga0373947_0703449
1547 Ga0373937_0002473
1548 Ga0373937_0026192
1549 Ga0395900_0974279
1550 Ga0395898_1709784
1551 Ga0439453_0003888
1552 Ga0451802_0460898
1553 Ga0439433_0156601
1554 Ga0439441_030869
1555 Ga0439442_018750
1556 Ga0439445_0023184
1557 Ga0439448_0214667
1558 Ga0439449_0214609
1559 Ga0439457_108920
1560 Ga0439462_0009957
1561 Ga0450917_031056
1562 Ga0450896_083896
1563 Ga0439446_0060699
1564 Ga0439435_0004616
1565 Ga0439435_0007930
1566 Ga0439444_0118344
1567 Ga0439464_0003239
1568 Ga0439460_0187256
1569 Ga0451577_0006008
1570 Ga0451577_1019614
1571 Ga0453683_0904183
1572 Ga0466963_0033446
1573 Ga0466957_1087912
1574 Ga0451576_0023050
1575 Ga0451576_0069259
1576 Ga0451576_0531913
1577 Ga0451576_0746837
1578 Ga0451576_0943353
1579 Ga0495629_0239266
1580 Ga0495651_0167947
1581 Ga0495580_0420680
1582 Ga0495582_0572419
1583 Ga0495639_0685530
1584 Ga0495662_0346216
1585 Ga0495664_0164091
1586 Ga0495608_0718179
1587 Ga0495644_0309513
1588 Ga0495663_0141499
1589 Ga0495587_0291051
1590 Ga0495645_0023915
1591 Ga0495645_0068053
1592 Ga0495635_0852181
1593 Ga0495659_0150321
1594 Ga0495659_0270484
1595 Ga0495647_0029994
1596 Ga0495647_0049941
1597 Ga0495658_0244340
1598 Ga0495658_0697070
1599 Ga0495658_0850393
1600 Ga0495669_0229425
1601 Ga0495613_0194794
1602 Ga0495613_0850268
1603 Ga0495649_0658252
1604 Ga0495600_0074263
1605 Ga0495674_1223676
1606 Ga0495680_0452609
1607 Ga0495680_0727555
1608 Ga0495680_0831521
1609 Ga0495684_0119626
1610 Ga0496102_0085164
1611 Ga0496102_1434328
1612 Ga0496104_0436873
1613 Ga0496104_0683109
1614 Ga0496104_0689521
1615 Ga0496104_0725602
1616 Ga0496105_0361501
1617 Ga0496105_0827977
1618 Ga0496106_0381952
1619 Ga0496106_0588927
1620 Ga0496108_0208682
1621 Ga0496109_1195752
1622 Ga0496110_0282324
1623 Ga0496110_1313440
1624 Ga0496111_1201956
1625 Ga0496112_0005771
1626 Ga0496112_0198786
1627 Ga0496112_0226392
1628 Ga0496112_0930916
1629 Ga0496113_0034682
1630 Ga0496114_0086978
1631 Ga0496114_0635507
1632 Ga0496114_0668123
1633 Ga0496115_0165313
1634 Ga0501291_002252
1635 Ga0501291_021479
1636 Ga0501295_044435
1637 Ga0501299_003204
1638 Ga0501031_0833355
1639 Ga0501032_0092028
1640 Ga0501033_0032253
1641 Ga0501033_0178137
1642 Ga0501033_0907837
1643 Ga0501034_0021350
1644 Ga0501034_0524142
1645 Ga0501036_0013771
1646 Ga0501036_0040647
1647 Ga0501036_0128021
1648 Ga0501036_0179068
1649 Ga0501037_0035700
1650 Ga0501038_0050051
1651 Ga0501038_0053481
1652 Ga0501038_0261480
1653 Ga0501039_0233725
1654 Ga0501040_0129935
1655 Ga0501040_0209337
1656 Ga0501040_0470318
1657 Ga0501040_1098656
1658 Ga0501041_0056679
1659 Ga0501041_0065455
1660 Ga0501041_0306149
1661 Ga0501041_0485853
1662 Ga0501041_1092070
1663 Ga0501042_0170161
1664 Ga0501042_0677837
1665 Ga0501043_0621303
1666 Ga0501046_0008884
1667 Ga0501046_0334038
1668 Ga0501046_0355952
1669 Ga0501046_0885568
1670 Ga0501046_0888775
1671 Ga0501046_1162131
1672 Ga0501047_0021937
1673 Ga0501047_0459007
1674 Ga0501048_0228173
1675 Ga0501048_1247463
1676 Ga0501067_0081852
1677 Ga0501067_0184313
1678 Ga0501067_0303220
1679 Ga0501067_0607159
1680 Ga0501068_0729984
1681 Ga0501069_0010055
1682 Ga0501069_0197095
1683 Ga0501069_0321684
1684 Ga0501069_0791574
1685 Ga0501070_0035806
1686 Ga0501070_0127532
1687 Ga0501071_0006987
1688 Ga0501071_0019441
1689 Ga0501071_0081007
1690 Ga0501071_0167890
1691 Ga0501071_0172525
1692 Ga0501071_0197664
1693 Ga0501071_0414939
1694 Ga0501071_1218048
1695 Ga0501072_0010778
1696 Ga0501072_0030383
1697 Ga0501072_0184581
1698 Ga0501072_0263669
1699 Ga0501072_0387823
1700 Ga0501072_0857826
1701 Ga0501072_1187203
1702 Ga0501072_1272720
1703 Ga0501073_0397643
1704 Ga0501073_0851391
1705 Ga0501074_0065860
1706 Ga0501074_0234976
1707 Ga0501074_0269431
1708 Ga0501074_0697551
1709 Ga0501075_0096154
1710 Ga0501075_0158546
1711 Ga0501075_0171367
1712 Ga0501075_0337173
1713 Ga0501075_0475909
1714 Ga0501076_0020912
1715 Ga0501076_0038728
1716 Ga0501076_0806715
1717 Ga0501077_0283637
1718 Ga0501208_018162
1719 Ga0501243_143796
1720 Ga0501225_0099636
1721 Ga0501079_0057317
1722 Ga0501079_0111075
1723 Ga0501079_0249654
1724 Ga0501079_0523448
1725 Ga0501079_0667864
1726 Ga0501079_0744591
1727 Ga0501080_0023057
1728 Ga0501080_0236843
1729 Ga0501080_0240032
1730 Ga0501080_0307484
1731 Ga0501080_0475317
1732 Ga0501081_0054150
1733 Ga0501081_0095665
1734 Ga0501081_0142446
1735 Ga0501081_0237066
1736 Ga0501081_0580178
1737 Ga0501279_047722
1738 Ga0501283_021834
1739 Ga0501283_041396
1740 Ga0501035_0024777
1741 Ga0501035_0450322
1742 Ga0501044_0033845
1743 Ga0501045_0045363
1744 Ga0501045_0152449
1745 Ga0501045_0207440
1746 nmdc:mga0yw44_363210_c1
1747 nmdc:mga05p37_114827_c1
1748 nmdc:mga05p37_12052_c1
1749 nmdc:mga05p37_12825_c1
1750 nmdc:mga05p37_129840_c1
1751 nmdc:mga05p37_164318_c1
1752 nmdc:mga05p37_1798_c1
1753 nmdc:mga05p37_192788_c1
1754 nmdc:mga05p37_2049296_c1
1755 nmdc:mga05p37_213638_c1
1756 nmdc:mga05p37_250579_c1
1757 nmdc:mga05p37_281227_c1
1758 nmdc:mga05p37_283453_c1
1759 nmdc:mga05p37_557928_c1
1760 nmdc:mga05p37_7393_c1
1761 nmdc:mga09592_11361_c1
1762 nmdc:mga09592_46293_c1
1763 nmdc:mga09592_785134_c1
1764 nmdc:mga0qj67_17204_c1
1765 nmdc:mga0qj67_33120_c1
1766 nmdc:mga06r32_118372_c1
1767 nmdc:mga06r32_1388_c1
1768 nmdc:mga06r32_65039_c1
1769 nmdc:mga06r32_7406_c1
1770 nmdc:mga08y16_12953_c1
1771 nmdc:mga08y16_154548_c1
1772 nmdc:mga08y16_211018_c1
1773 nmdc:mga08y16_226093_c1
1774 nmdc:mga08y16_306295_c1
1775 nmdc:mga08y16_342065_c1
1776 nmdc:mga08y16_38128_c1
1777 nmdc:mga08y16_90746_c1
1778 nmdc:mga0n895_110399_c1
1779 nmdc:mga0n895_1146959_c1
1780 nmdc:mga0n895_1565665_c1
1781 nmdc:mga0n895_262058_c1
1782 nmdc:mga0n895_2680_c1
1783 nmdc:mga0n895_286838_c1
1784 nmdc:mga0n895_35375_c1
1785 nmdc:mga0n895_667156_c1
1786 nmdc:mga0n895_856232_c1
1787 nmdc:mga0rr50_10974_c1
1788 nmdc:mga0rr50_113514_c1
1789 nmdc:mga0rr50_148409_c1
1790 nmdc:mga0rr50_181103_c1
1791 nmdc:mga0rr50_195585_c1
1792 nmdc:mga0rr50_210403_c1
1793 nmdc:mga0rr50_38578_c1
1794 nmdc:mga0rr50_413979_c1
1795 nmdc:mga0rr50_500_c1
1796 nmdc:mga0rr50_68770_c1
1797 nmdc:mga0rr50_867994_c1
1798 nmdc:mga0rr50_87137_c1
1799 nmdc:mga08x19_121217_c1
1800 nmdc:mga08x19_1442_c1
1801 nmdc:mga08x19_177015_c1
1802 nmdc:mga08x19_184705_c1
1803 nmdc:mga08x19_68995_c1
1804 nmdc:mga08x19_739_c1
1805 nmdc:mga0a205_1145802_c1
1806 nmdc:mga0a205_1155381_c1
1807 nmdc:mga0a205_204797_c1
1808 nmdc:mga0a205_34471_c1
1809 nmdc:mga0a205_485070_c1
1810 nmdc:mga0a205_555883_c1
1811 nmdc:mga0a205_562841_c1
1812 nmdc:mga0a205_58385_c1
1813 Ga0495601_0176096
1814 Ga0495601_0196318
1815 Ga0495601_0238366
1816 Ga0495595_0057007
1817 Ga0495595_0115100
1818 Ga0495595_0297822
1819 Ga0495619_0021584
1820 Ga0495619_0301510
1821 Ga0495619_0379095
1822 Ga0495619_0737177
1823 Ga0501084_0013187
1824 Ga0501084_0041596
1825 Ga0501084_0501781
1826 Ga0501084_1403239
1827 Ga0501082_0038373
1828 Ga0501082_0051097
1829 Ga0501082_0169853
1830 Ga0501082_0281817
1831 Ga0501082_0314351
1832 Ga0501082_1280145
1833 Ga0501082_1604358
1834 Ga0530510_1048910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

63

165

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9392 5 146
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9266 5 146
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9218 2 145
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.9164 2 145
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.8861 2 145
ID Description Score Start End Superfamily
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9315 5 146 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9198 2 145 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9187 5 146 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9171 7 146 3.30.300.20
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.894 5 144 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V8CJ94-F1-model_v4 OsmC family peroxiredoxin 0.995 1 146 GO:0004601
GO:0006979
AF-A0A2V8C3J3-F1-model_v4 Osmotically inducible protein OsmC 0.9935 1 129 GO:0004601
GO:0006979
AF-A0A2V8ES66-F1-model_v4 Osmotically inducible protein OsmC 0.9925 1 146 GO:0004601
GO:0006979
AF-A0A2V8CJ94-F1-model_v4 OsmC family peroxiredoxin 0.9882 1 146 GO:0004601
GO:0006979
AF-A0A2V8ES66-F1-model_v4 Osmotically inducible protein OsmC 0.9858 1 146 GO:0004601
GO:0006979

Map